1F40A

Solution structure of fkbp12 complexed with gpi-1046, a neurotrophic ligand
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a neurotrophic ligand bound to FKBP12 and its effects on protein dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506 BINDING PROTEIN (FKBP12)
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1f40A00
4IQCA 3KAFA 2PPPA 4TYOA 5BXJA 3KABA 1ROTA 4DRKA 2XP7A 2Y78A 3IKDA 4DZ2A 2RUDA 1M5YA 1FKGA 1Q6UA 2DG3A 4JFJA 4N19A 4ODQA 3WH0A 3NTPA 2KFWA 4GIVA 2VN1A 2LJ4A 4DIPA 3JYMA 2Q5AA 4U86A 3OOBA 1FJDA 5HW8A 3CGMA 3O5QA 4LAYA 4JYSA 2AWGA 4G50A 4DROA 1FD9A 1ZCNA 3H9RB 2XP3A 1Q6HA 2MPHA 2XPAA 3O5GA 3JXVA 2MLYA 2JZVA 2KR7A 4DRJA 1FKBA 1L1PA 2MF9A 2ZQUA 2F4EA 4W9PA 1D7HA 1FKFA 4IQ2A 2M2AA 3GPKA 1D6OA 3KACA 4ITZA 4ODNA 4W9OA 2D9FA 4DH0A 3KCEA 2PPOA 4IPXA 1JVWA 5B8IC 2KI3A 2MLXA 2K8IA 3O5OA 4C02B 2DG9A 2PBCA 3RGCA 1EYMA 2MLZA 2ZR4A 2ZQSA 1FKTA 1NSGA 3I6CA 4ODMA 1QPFA 5HKGA 1FKSA 1JNTA 1KT1A 1ROUA 1J4RA 1FKRA 1BL4A 5GPGA 1PINA 3MDYB 3O5JA 3UI6A 2FKEA 1YW5A 4JFLA 1Q1CA 4TW8A 1EQ3A 2PV3A 3NI6A 1D7JA 1FKIA 1KT0A 2MNTA 1YATA 2F21A 3JYJA 3O5RA 3O5FA 1FKDA 2OFNA 4J4NA 3O5LA 4DRNA 1HXVA 2DG4A 2XP6A 1F40A 1FKLA 2RUQA 3O5PA 1T11A 1NMWA 1D7IA 3IHZA 2M08A 1BKFA 3FAPA 4QT2A 2RUCA 2XP8A 2N87A 4QIBA 3LUOA 4TW6A 4DRHA 2M1IA 4DRMA 2F2DA 1J6YA 1Y0OA 4ODRA 1P5QA 2ZQVA 2ITKA 4ODLA 4TX0A 1FAPA 2PV2A 1QPLA 5HUAA 2LGOA 5HTGA 4JFMA 4U84A 3ODKA 1QZ2A 5I98A 3NRKA 2LKNA 2IF4A 5DIUA 1FKJA 1FKKA 1PBKA 4QT3A 1J4HA 4DRPA 5HWBA 3IK8A 4DRIA 3RFWA 1FKHA 1ZK6A 1R9HA 3KADA 3O5IA 4MGVA 5DITA 4LAXA 3TDBA 3VAWA 3CGNA 3UF8A 4W9QA 3TCZA 3O5EA 3PRDA 1N1AA 2LPVA 1JNSA 3O5KA 3B7XA 3KZ7A 3UI4A 4FN2A 4O2TA 1W26A 4JFKA 1TCOC 1B6CA 5DIVA 5HT1A 2L2SA 3KAHA 3PRBA 1J4IA 2FAPA 2RQSA 4MSPA 4ODKA 4TNSA 5HW7A 2KO7A 2XP9A 4NNRA 4U85A 2KE0A 3IKGA 3UQBA 4GGQA 2UZ5A 5J6EA 3O5MA 3KAGA 4JFIA 3PA7A 4J4OA 2ZQTA 5D75A 2VCDA 2XP5A 1U79A 4ODPA 3UQIA 1C9HA 2PV1A 1Q6IA 4LAVA 5HW6A 1F8AB 3EY6A 3UQAA 2ZR5A 4DRQA 4FAPA 2RSEA 2XP4A 3O5DA 3KAIA 5HWCA 4R0XA 2PPNA 4TW7A 4LAWA 2XPBA 4ODOA 2KGJA 3UI5A 4DZ3A 1A7XA 4G2PA 4BF8A 4DT4A 2RURA 3TC5A 2ZR6A 1NMVA
chains in the Genus database with same CATH superfamily
1H0GA 4MNKA 4TYOA 3G6LA 5BXJA 2XP7A 2RUDA 2DG3A 4ODQA 3WH0A 3NTPA 2KFWA 4GIVA 2VN1A 2LJ4A 3JYMA 2Q5AA 3ARWA 2A3EA 3OOBA 1SR0A 4DROA 4LAYA 4S3KA 1ZCNA 2YBTA 2XPAA 3O5GA 3JXVA 4Z2KA 5JH8A 2B5UB 2MF9A 1L1PA 4ZPWR 1EDQA 2ZQUA 2F4EA 4W9PA 1D7HA 3GPKA 3BMBA 3AQUA 4ODNA 4W9OA 1GPFA 2PPOA 2WM0A 5B8IC 2ZR4A 1FKTA 1LJYA 1KT1A 1ROUA 1FKRA 3CHFA 1BL4A 2YBUA 2PV3A 2MNTA 1KT0A 3ARUA 1YATA 1ZBKA 1FKDA 1HXVA 3O5LA 4DRNA 1FKLA 2RUQA 3O5PA 3AS3A 2M08A 1IX5A 2XP8A 4PTMA 4DRHA 4DRMA 4P8VA 1W1VA 4P8UA 1P5QA 1X6LA 2ZQVA 4ODLA 1W9VA 5HTGA 4MTVA 4U84A 5DIUA 1FKJA 1FKKA 3WL1A 1J4HA 3IK8A 4DRIA 2WK2A 3ARSA 1ZU8A 4Z2JA 1ZK6A 4LAXA 1SYTA 3CGNA 3UF8A 1ZBWA 2DT2A 2FDMA 4MNLA 5HT1A 4U85A 4GGQA 4MNJA 1NH6A 4JFIA 1HKKA 2ETNA 2XP5A 1E6ZA 4WKHA 4ODPA 3UQIA 5DEZA 2O92A 1UR8A 1FFRA 4XAKA 3EY6A 1E6PA 4KQZA 2XPBA 3B8SA 4BF8A 3TC5A 1W1TA 4JYSA 4IQCA 3AS1A 3ARQA 3KAFA 3KABA 1ROTA 1OGGA 3EIPA 2EULA 4ZPVR 4JFJA 1Q6UA 1JNDA 4N19A 1UR9A 4DIPA 5DO2A 1FJDA 2O9OA 3O5QA 1GUVA 4Z2LA 1GRJA 2MPHA 2KR7A 3OA5A 1NWRA 4ITZA 2QF8A 5GPRA 2D9FA 4DH0A 1WNOA 3KCEA 3ALFA 4DWSD 2WLZA 3O5OA 3RGCA 1O6IA 2ZQSA 5HKGA 4ML4A 1FKSA 1W9UA 1PINA 3MDYB 2A3AA 1NWSA 3NI6A 1D7JA 2DSUA 4NZCA 3IHZA 3FAPA 1EIBA 4L72B 4Z2GA 1W1YA 4ZS6A 4Z2IA 1J6YA 4ODRA 4P8XA 2ITKA 1E44A 2PV2A 1QPLA 1ZL1A 3NRKA 5HWBA 3RFWA 1FKHA 2DSZA 1ITXA 1R9HA 3AS0A 3RMEA 4W9QA 3O5EA 2IUZA 3FY1A 1JNSA 2A3BA 3UI4A 4HARA 1W26A 2G41A 1GOIA 3KAHA 1LL4A 3RM8A 3ARVA 4TNSA 2RQSA 4NNRA 1E6NA 3UQBA 1K9TA 3KAGA 1W1PA 4J4OA 2ZQTA 5D75A 3WQVA 1U79A 1ZBCA 3B9DA 2DPEA 3B9AA 4DRQA 5HWCA 3KAIA 3W4RA 4LAWA 3WD0A 4DZ3A 4G2PA 2RURA 4Z2HA 2Y78A 3ARTA 2G8ZA 2DT0A 1NWUA 1JNEA 4U86A 3ARXA 3CGMA 1FD9A 3H9RB 2XP3A 1Q6HA 3G6MA 2JZVA 4ZPTR 4DRJA 1FKBA 2OLHA 1FKFA 2M2AA 1D6OA 3KACA 1XHGA 2AOSA 2KI3A 1HJVA 2K8IA 4C02B 2DG9A 2PBCA 1ZB5A 1EYMA 2MLZA 3PR9A 1JNTA 3CH9A 3UI6A 1YW5A 4JFLA 4TW8A 1EQ3A 3ALGA 2F21A 3O5FA 4KR0B 2DG4A 2XP6A 1KFWA 1D7IA 1VF8A 4P8WA 2RUCA 4HBEA 1FFQA 2N87A 2PI6A 4QIBA 4TW6A 4WK9A 2F2DA 3WD3A 1Y0OA 1WAWA 4WKAA 4TX0A 1W9PA 5HUAA 5I98A 2LGOA 4LGXA 3ODKA 3CZ8A 2LKNA 3WQWA 1PBKA 2DSVA 4QT3A 4L3NA 3WL0A 3KADA 3O5IA 4MGVA 3VAWA 3AROA 3QOKA 1ZBVA 5GQBA 1HKJA 3ARRA 1N1AA 2LPVA 3O5KA 4NSBA 4FN2A 4O2TA 3ARPA 1TCOC 1B6CA 3PRAA 2KO7A 2XP9A 3FXYA 2KE0A 3IKGA 4WKFA 2UZ5A 3WD2A 3O5MA 2WLYA 3WIJA 4S3JA 1OGBA 1LQ0A 1E9LA 1C9HA 2PV1A 4LAVA 5HW6A 1F8AB 2ZR5A 2RSEA 4Q22A 4R0XA 3RM4A 4WIWA 4ODOA 2F23A 1HKIA 2ZR6A 4IT6A 4UDMA 2PPPA 4DRKA 3WKZA 3IKDA 4DZ2A 1M5YA 1FKGA 4MAVA 4R5EA 1EHNA 3CHDA 4AY1A 2DT1A 5HW8A 2AWGA 4G50A 1LL7A 1XRVA 1HKMA 2MLYA 2DSWA 3WD4A 3CHEA 4IQ2A 3WD1A 4W5UA 5DF0A 4IPXA 1JVWA 2MLXA 1WB0A 3ARZA 3I6CA 2DT3A 1NSGA 4MNMA 4ODMA 1QPFA 3GTYX 1J4RA 5GPGA 3O5JA 2FKEA 2ESCA 2PN0A 1Q1CA 4DWSC 3BXWA 1FKIA 3JYJA 3O5RA 4HBOA 1E15A 2OFNA 4J4NA 1E6RA 4QZVB 1F40A 1H0IA 1T11A 1NMWA 1BKFA 4QT2A 3LUOA 2M1IA 4DWSB 1FAPA 1LG2A 4JFMA 1QZ2A 2P4VA 2IF4A 4IT4A 4DRPA 1X6NA 3GU0A 4URIA 1OWQA 4MPKA 5DITA 1HJWA 1TFVA 3TDBA 3TCZA 5HBFA 3PRDA 1RD6A 3CHCA 3B7XA 3KZ7A 4JFKA 1CTNA 3ARYA 2A3CA 5DIVA 2L2SA 1D2KA 3PRBA 1J4IA 2FAPA 3AS2A 4MSPA 4ODKA 5HW7A 1HJXA 4WJXA 5J6EA 3PA7A 2B31A 2VCDA 3B9EA 3RM9A 1Q6IA 3UQAA 4FAPA 2XP4A 1LG1A 3O5DA 2PPNA 1LL6A 4TW7A 4DWSA 1NWTA 2KGJA 3UI5A 1A7XA 1JCHB 4Q7NA 4DT4A 1NMVA
chains in the Genus database with same CATH topology
1H0GA 4MNKA 4TYOA 3G6LA 5BXJA 2XP7A 2RUDA 2DG3A 4ODQA 3WH0A 3NTPA 2KFWA 4GIVA 2VN1A 2LJ4A 3JYMA 2Q5AA 3ARWA 2A3EA 3OOBA 1SR0A 4DROA 4LAYA 4S3KA 1ZCNA 2YBTA 2XPAA 3O5GA 3JXVA 4Z2KA 5JH8A 1L1PA 2MF9A 4ZPWR 1EDQA 2ZQUA 2F4EA 4W9PA 1D7HA 3GPKA 3AQUA 4ODNA 4W9OA 1GPFA 2PPOA 2WM0A 5B8IC 2ZR4A 1FKTA 1LJYA 1KT1A 1ROUA 1FKRA 3CHFA 1BL4A 2YBUA 2PV3A 2MNTA 1KT0A 3ARUA 1YATA 1ZBKA 1FKDA 1HXVA 3O5LA 4DRNA 1FKLA 2RUQA 3O5PA 3AS3A 2M08A 1IX5A 2XP8A 4PTMA 4DRHA 4DRMA 4P8VA 1W1VA 4P8UA 1P5QA 1X6LA 2ZQVA 4ODLA 1W9VA 5HTGA 4MTVA 4U84A 5DIUA 1FKJA 1FKKA 3WL1A 1J4HA 3IK8A 4DRIA 2WK2A 3ARSA 1ZU8A 4Z2JA 1ZK6A 4LAXA 1SYTA 3CGNA 3UF8A 1ZBWA 2DT2A 2FDMA 4MNLA 5HT1A 4U85A 4GGQA 4MNJA 1NH6A 4JFIA 1HKKA 2XP5A 1E6ZA 4WKHA 4ODPA 3UQIA 5DEZA 2O92A 1UR8A 1FFRA 4XAKA 3EY6A 1E6PA 4KQZA 2XPBA 3B8SA 4BF8A 3TC5A 1W1TA 4JYSA 4IQCA 3AS1A 3ARQA 3KAFA 3KABA 1ROTA 1OGGA 4ZPVR 4JFJA 1Q6UA 1JNDA 4N19A 1UR9A 4DIPA 5DO2A 1FJDA 2O9OA 3O5QA 1GUVA 4Z2LA 2MPHA 2KR7A 3OA5A 1NWRA 4ITZA 2QF8A 5GPRA 2D9FA 4DH0A 1WNOA 3KCEA 3ALFA 4DWSD 2WLZA 3O5OA 3RGCA 1O6IA 2ZQSA 5HKGA 4ML4A 1FKSA 1W9UA 1PINA 3MDYB 2A3AA 1NWSA 3NI6A 1D7JA 2DSUA 4NZCA 3IHZA 3FAPA 1EIBA 4L72B 4Z2GA 1W1YA 4ZS6A 4Z2IA 1J6YA 4ODRA 4P8XA 2ITKA 2PV2A 1QPLA 1ZL1A 3NRKA 5HWBA 3RFWA 1FKHA 2DSZA 1ITXA 1R9HA 3AS0A 3RMEA 4W9QA 3O5EA 2IUZA 3FY1A 1JNSA 2A3BA 3UI4A 4HARA 1W26A 2G41A 1GOIA 3KAHA 1LL4A 3RM8A 3ARVA 4TNSA 2RQSA 4NNRA 1E6NA 3UQBA 1K9TA 3KAGA 1W1PA 4J4OA 2ZQTA 5D75A 3WQVA 1U79A 1ZBCA 3B9DA 2DPEA 3B9AA 4DRQA 5HWCA 3KAIA 3W4RA 4LAWA 3WD0A 4DZ3A 4G2PA 2RURA 4Z2HA 2Y78A 3ARTA 2G8ZA 2DT0A 1NWUA 1JNEA 4U86A 3ARXA 3CGMA 1FD9A 3H9RB 2XP3A 1Q6HA 3G6MA 2JZVA 4ZPTR 4DRJA 1FKBA 2OLHA 1FKFA 2M2AA 1D6OA 3KACA 1XHGA 2AOSA 2KI3A 1HJVA 2K8IA 4C02B 2DG9A 2PBCA 1ZB5A 1EYMA 2MLZA 3PR9A 1JNTA 3CH9A 3UI6A 1YW5A 4JFLA 4TW8A 1EQ3A 3ALGA 2F21A 3O5FA 4KR0B 2DG4A 2XP6A 1KFWA 1D7IA 1VF8A 4P8WA 2RUCA 4HBEA 1FFQA 2N87A 2PI6A 4QIBA 4TW6A 4WK9A 2F2DA 3WD3A 1Y0OA 1WAWA 4WKAA 4TX0A 1W9PA 5HUAA 5I98A 2LGOA 4LGXA 3ODKA 3CZ8A 2LKNA 3WQWA 1PBKA 2DSVA 4QT3A 4L3NA 3WL0A 3KADA 3O5IA 4MGVA 3VAWA 3AROA 3QOKA 1ZBVA 5GQBA 1HKJA 3ARRA 1N1AA 2LPVA 3O5KA 4NSBA 4FN2A 4O2TA 3ARPA 1TCOC 1B6CA 3PRAA 2KO7A 2XP9A 3FXYA 2KE0A 3IKGA 4WKFA 2UZ5A 3WD2A 3O5MA 2WLYA 3WIJA 4S3JA 1OGBA 1LQ0A 1E9LA 1C9HA 2PV1A 4LAVA 5HW6A 1F8AB 2ZR5A 2RSEA 4Q22A 4R0XA 3RM4A 4WIWA 4ODOA 1HKIA 2ZR6A 4IT6A 2PPPA 4DRKA 3WKZA 3IKDA 4DZ2A 1M5YA 1FKGA 4MAVA 4R5EA 1EHNA 3CHDA 4AY1A 2DT1A 5HW8A 2AWGA 4G50A 1LL7A 1XRVA 1HKMA 2MLYA 2DSWA 3WD4A 3CHEA 4IQ2A 3WD1A 4W5UA 5DF0A 4IPXA 1JVWA 2MLXA 1WB0A 3ARZA 3I6CA 2DT3A 1NSGA 4MNMA 4ODMA 1QPFA 1J4RA 5GPGA 3O5JA 2FKEA 2ESCA 1Q1CA 4DWSC 3BXWA 1FKIA 3JYJA 3O5RA 4HBOA 1E15A 2OFNA 4J4NA 1E6RA 4QZVB 1F40A 1H0IA 1T11A 1NMWA 1BKFA 4QT2A 3LUOA 2M1IA 4DWSB 1FAPA 1LG2A 4JFMA 1QZ2A 2IF4A 4IT4A 4DRPA 1X6NA 4URIA 1OWQA 4MPKA 5DITA 1HJWA 1TFVA 3TDBA 3TCZA 5HBFA 3PRDA 1RD6A 3CHCA 3B7XA 3KZ7A 4JFKA 1CTNA 3ARYA 2A3CA 5DIVA 2L2SA 1D2KA 3PRBA 1J4IA 2FAPA 3AS2A 4MSPA 4ODKA 5HW7A 1HJXA 4WJXA 5J6EA 3PA7A 2B31A 2VCDA 3B9EA 3RM9A 1Q6IA 3UQAA 4FAPA 2XP4A 1LG1A 3O5DA 2PPNA 1LL6A 4TW7A 4DWSA 1NWTA 2KGJA 3UI5A 1A7XA 4Q7NA 4DT4A 1NMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQC A;  3KAF A;  2PPP A;  4TYO A;  5BXJ A;  3KAB A;  1ROT A;  4DRK A;  2XP7 A;  2Y78 A;  3IKD A;  4DZ2 A;  2RUD A;  1M5Y A;  1FKG A;  1Q6U A;  2DG3 A;  4JFJ A;  4N19 A;  4ODQ A;  3WH0 A;  3NTP A;  2KFW A;  4GIV A;  2VN1 A;  2LJ4 A;  4DIP A;  3JYM A;  2Q5A A;  4U86 A;  3OOB A;  1FJD A;  5HW8 A;  3CGM A;  3O5Q A;  4LAY A;  4JYS A;  2AWG A;  4G50 A;  4DRO A;  1FD9 A;  1ZCN A;  3H9R B;  2XP3 A;  1Q6H A;  2MPH A;  2XPA A;  3O5G A;  3JXV A;  2MLY A;  2JZV A;  2KR7 A;  4DRJ A;  1FKB A;  1L1P A;  2MF9 A;  2ZQU A;  2F4E A;  4W9P A;  1D7H A;  1FKF A;  4IQ2 A;  2M2A A;  3GPK A;  1D6O A;  3KAC A;  4ITZ A;  4ODN A;  4W9O A;  2D9F A;  4DH0 A;  3KCE A;  2PPO A;  4IPX A;  1JVW A;  5B8I C;  2KI3 A;  2MLX A;  2K8I A;  3O5O A;  4C02 B;  2DG9 A;  2PBC A;  3RGC A;  1EYM A;  2MLZ A;  2ZR4 A;  2ZQS A;  1FKT A;  1NSG A;  3I6C A;  4ODM A;  1QPF A;  5HKG A;  1FKS A;  1JNT A;  1KT1 A;  1ROU A;  1J4R A;  1FKR A;  1BL4 A;  5GPG A;  1PIN A;  3MDY B;  3O5J A;  3UI6 A;  2FKE A;  1YW5 A;  4JFL A;  1Q1C A;  4TW8 A;  1EQ3 A;  2PV3 A;  3NI6 A;  1D7J A;  1FKI A;  1KT0 A;  2MNT A;  1YAT A;  2F21 A;  3JYJ A;  3O5R A;  3O5F A;  1FKD A;  2OFN A;  4J4N A;  3O5L A;  4DRN A;  1HXV A;  2DG4 A;  2XP6 A;  1F40 A;  1FKL A;  2RUQ A;  3O5P A;  1T11 A;  1NMW A;  1D7I A;  3IHZ A;  2M08 A;  1BKF A;  3FAP A;  4QT2 A;  2RUC A;  2XP8 A;  2N87 A;  4QIB A;  3LUO A;  4TW6 A;  4DRH A;  2M1I A;  4DRM A;  2F2D A;  1J6Y A;  1Y0O A;  4ODR A;  1P5Q A;  2ZQV A;  2ITK A;  4ODL A;  4TX0 A;  1FAP A;  2PV2 A;  1QPL A;  5HUA A;  2LGO A;  5HTG A;  4JFM A;  4U84 A;  3ODK A;  1QZ2 A;  5I98 A;  3NRK A;  2LKN A;  2IF4 A;  5DIU A;  1FKJ A;  1FKK A;  1PBK A;  4QT3 A;  1J4H A;  4DRP A;  5HWB A;  3IK8 A;  4DRI A;  3RFW A;  1FKH A;  1ZK6 A;  1R9H A;  3KAD A;  3O5I A;  4MGV A;  5DIT A;  4LAX A;  3TDB A;  3VAW A;  3CGN A;  3UF8 A;  4W9Q A;  3TCZ A;  3O5E A;  3PRD A;  1N1A A;  2LPV A;  1JNS A;  3O5K A;  3B7X A;  3KZ7 A;  3UI4 A;  4FN2 A;  4O2T A;  1W26 A;  4JFK A;  1TCO C;  1B6C A;  5DIV A;  5HT1 A;  2L2S A;  3KAH A;  3PRB A;  1J4I A;  2FAP A;  2RQS A;  4MSP A;  4ODK A;  4TNS A;  5HW7 A;  2KO7 A;  2XP9 A;  4NNR A;  4U85 A;  2KE0 A;  3IKG A;  3UQB A;  4GGQ A;  2UZ5 A;  5J6E A;  3O5M A;  3KAG A;  4JFI A;  3PA7 A;  4J4O A;  2ZQT A;  5D75 A;  2VCD A;  2XP5 A;  1U79 A;  4ODP A;  3UQI A;  1C9H A;  2PV1 A;  1Q6I A;  4LAV A;  5HW6 A;  1F8A B;  3EY6 A;  3UQA A;  2ZR5 A;  4DRQ A;  4FAP A;  2RSE A;  2XP4 A;  3O5D A;  3KAI A;  5HWC A;  4R0X A;  2PPN A;  4TW7 A;  4LAW A;  2XPB A;  4ODO A;  2KGJ A;  3UI5 A;  4DZ3 A;  1A7X A;  4G2P A;  4BF8 A;  4DT4 A;  2RUR A;  3TC5 A;  2ZR6 A;  1NMV A; 
#chains in the Genus database with same CATH topology
 1H0G A;  4MNK A;  4TYO A;  3G6L A;  5BXJ A;  2XP7 A;  2RUD A;  2DG3 A;  4ODQ A;  3WH0 A;  3NTP A;  2KFW A;  4GIV A;  2VN1 A;  2LJ4 A;  3JYM A;  2Q5A A;  3ARW A;  2A3E A;  3OOB A;  1SR0 A;  4DRO A;  4LAY A;  4S3K A;  1ZCN A;  2YBT A;  2XPA A;  3O5G A;  3JXV A;  4Z2K A;  5JH8 A;  2B5U B;  2MF9 A;  1L1P A;  4ZPW R;  1EDQ A;  2ZQU A;  2F4E A;  4W9P A;  1D7H A;  3GPK A;  3BMB A;  3AQU A;  4ODN A;  4W9O A;  1GPF A;  2PPO A;  2WM0 A;  5B8I C;  2ZR4 A;  1FKT A;  1LJY A;  1KT1 A;  1ROU A;  1FKR A;  3CHF A;  1BL4 A;  2YBU A;  2PV3 A;  2MNT A;  1KT0 A;  3ARU A;  1YAT A;  1ZBK A;  1FKD A;  1HXV A;  3O5L A;  4DRN A;  1FKL A;  2RUQ A;  3O5P A;  3AS3 A;  2M08 A;  1IX5 A;  2XP8 A;  4PTM A;  4DRH A;  4DRM A;  4P8V A;  1W1V A;  4P8U A;  1P5Q A;  1X6L A;  2ZQV A;  4ODL A;  1W9V A;  5HTG A;  4MTV A;  4U84 A;  5DIU A;  1FKJ A;  1FKK A;  3WL1 A;  1J4H A;  3IK8 A;  4DRI A;  2WK2 A;  3ARS A;  1ZU8 A;  4Z2J A;  1ZK6 A;  4LAX A;  1SYT A;  3CGN A;  3UF8 A;  1ZBW A;  2DT2 A;  2FDM A;  4MNL A;  5HT1 A;  4U85 A;  4GGQ A;  4MNJ A;  1NH6 A;  4JFI A;  1HKK A;  2ETN A;  2XP5 A;  1E6Z A;  4WKH A;  4ODP A;  3UQI A;  5DEZ A;  2O92 A;  1UR8 A;  1FFR A;  4XAK A;  3EY6 A;  1E6P A;  4KQZ A;  2XPB A;  3B8S A;  4BF8 A;  3TC5 A;  1W1T A;  4JYS A;  4IQC A;  3AS1 A;  3ARQ A;  3KAF A;  3KAB A;  1ROT A;  1OGG A;  3EIP A;  2EUL A;  4ZPV R;  4JFJ A;  1Q6U A;  1JND A;  4N19 A;  1UR9 A;  4DIP A;  5DO2 A;  1FJD A;  2O9O A;  3O5Q A;  1GUV A;  4Z2L A;  1GRJ A;  2MPH A;  2KR7 A;  3OA5 A;  1NWR A;  4ITZ A;  2QF8 A;  5GPR A;  2D9F A;  4DH0 A;  1WNO A;  3KCE A;  3ALF A;  4DWS D;  2WLZ A;  3O5O A;  3RGC A;  1O6I A;  2ZQS A;  5HKG A;  4ML4 A;  1FKS A;  1W9U A;  1PIN A;  3MDY B;  2A3A A;  1NWS A;  3NI6 A;  1D7J A;  2DSU A;  4NZC A;  3IHZ A;  3FAP A;  1EIB A;  4L72 B;  4Z2G A;  1W1Y A;  4ZS6 A;  4Z2I A;  1J6Y A;  4ODR A;  4P8X A;  2ITK A;  1E44 A;  2PV2 A;  1QPL A;  1ZL1 A;  3NRK A;  5HWB A;  3RFW A;  1FKH A;  2DSZ A;  1ITX A;  1R9H A;  3AS0 A;  3RME A;  4W9Q A;  3O5E A;  2IUZ A;  3FY1 A;  1JNS A;  2A3B A;  3UI4 A;  4HAR A;  1W26 A;  2G41 A;  1GOI A;  3KAH A;  1LL4 A;  3RM8 A;  3ARV A;  4TNS A;  2RQS A;  4NNR A;  1E6N A;  3UQB A;  1K9T A;  3KAG A;  1W1P A;  4J4O A;  2ZQT A;  5D75 A;  3WQV A;  1U79 A;  1ZBC A;  3B9D A;  2DPE A;  3B9A A;  4DRQ A;  5HWC A;  3KAI A;  3W4R A;  4LAW A;  3WD0 A;  4DZ3 A;  4G2P A;  2RUR A;  4Z2H A;  2Y78 A;  3ART A;  2G8Z A;  2DT0 A;  1NWU A;  1JNE A;  4U86 A;  3ARX A;  3CGM A;  1FD9 A;  3H9R B;  2XP3 A;  1Q6H A;  3G6M A;  2JZV A;  4ZPT R;  4DRJ A;  1FKB A;  2OLH A;  1FKF A;  2M2A A;  1D6O A;  3KAC A;  1XHG A;  2AOS A;  2KI3 A;  1HJV A;  2K8I A;  4C02 B;  2DG9 A;  2PBC A;  1ZB5 A;  1EYM A;  2MLZ A;  3PR9 A;  1JNT A;  3CH9 A;  3UI6 A;  1YW5 A;  4JFL A;  4TW8 A;  1EQ3 A;  3ALG A;  2F21 A;  3O5F A;  4KR0 B;  2DG4 A;  2XP6 A;  1KFW A;  1D7I A;  1VF8 A;  4P8W A;  2RUC A;  4HBE A;  1FFQ A;  2N87 A;  2PI6 A;  4QIB A;  4TW6 A;  4WK9 A;  2F2D A;  3WD3 A;  1Y0O A;  1WAW A;  4WKA A;  4TX0 A;  1W9P A;  5HUA A;  5I98 A;  2LGO A;  4LGX A;  3ODK A;  3CZ8 A;  2LKN A;  3WQW A;  1PBK A;  2DSV A;  4QT3 A;  4L3N A;  3WL0 A;  3KAD A;  3O5I A;  4MGV A;  3VAW A;  3ARO A;  3QOK A;  1ZBV A;  5GQB A;  1HKJ A;  3ARR A;  1N1A A;  2LPV A;  3O5K A;  4NSB A;  4FN2 A;  4O2T A;  3ARP A;  1TCO C;  1B6C A;  3PRA A;  2KO7 A;  2XP9 A;  3FXY A;  2KE0 A;  3IKG A;  4WKF A;  2UZ5 A;  3WD2 A;  3O5M A;  2WLY A;  3WIJ A;  4S3J A;  1OGB A;  1LQ0 A;  1E9L A;  1C9H A;  2PV1 A;  4LAV A;  5HW6 A;  1F8A B;  2ZR5 A;  2RSE A;  4Q22 A;  4R0X A;  3RM4 A;  4WIW A;  4ODO A;  2F23 A;  1HKI A;  2ZR6 A;  4IT6 A;  4UDM A;  2PPP A;  4DRK A;  3WKZ A;  3IKD A;  4DZ2 A;  1M5Y A;  1FKG A;  4MAV A;  4R5E A;  1EHN A;  3CHD A;  4AY1 A;  2DT1 A;  5HW8 A;  2AWG A;  4G50 A;  1LL7 A;  1XRV A;  1HKM A;  2MLY A;  2DSW A;  3WD4 A;  3CHE A;  4IQ2 A;  3WD1 A;  4W5U A;  5DF0 A;  4IPX A;  1JVW A;  2MLX A;  1WB0 A;  3ARZ A;  3I6C A;  2DT3 A;  1NSG A;  4MNM A;  4ODM A;  1QPF A;  3GTY X;  1J4R A;  5GPG A;  3O5J A;  2FKE A;  2ESC A;  2PN0 A;  1Q1C A;  4DWS C;  3BXW A;  1FKI A;  3JYJ A;  3O5R A;  4HBO A;  1E15 A;  2OFN A;  4J4N A;  1E6R A;  4QZV B;  1F40 A;  1H0I A;  1T11 A;  1NMW A;  1BKF A;  4QT2 A;  3LUO A;  2M1I A;  4DWS B;  1FAP A;  1LG2 A;  4JFM A;  1QZ2 A;  2P4V A;  2IF4 A;  4IT4 A;  4DRP A;  1X6N A;  3GU0 A;  4URI A;  1OWQ A;  4MPK A;  5DIT A;  1HJW A;  1TFV A;  3TDB A;  3TCZ A;  5HBF A;  3PRD A;  1RD6 A;  3CHC A;  3B7X A;  3KZ7 A;  4JFK A;  1CTN A;  3ARY A;  2A3C A;  5DIV A;  2L2S A;  1D2K A;  3PRB A;  1J4I A;  2FAP A;  3AS2 A;  4MSP A;  4ODK A;  5HW7 A;  1HJX A;  4WJX A;  5J6E A;  3PA7 A;  2B31 A;  2VCD A;  3B9E A;  3RM9 A;  1Q6I A;  3UQA A;  4FAP A;  2XP4 A;  1LG1 A;  3O5D A;  2PPN A;  1LL6 A;  4TW7 A;  4DWS A;  1NWT A;  2KGJ A;  3UI5 A;  1A7X A;  1JCH B;  4Q7N A;  4DT4 A;  1NMV A; 
#chains in the Genus database with same CATH homology
 1H0G A;  4MNK A;  4TYO A;  3G6L A;  5BXJ A;  2XP7 A;  2RUD A;  2DG3 A;  4ODQ A;  3WH0 A;  3NTP A;  2KFW A;  4GIV A;  2VN1 A;  2LJ4 A;  3JYM A;  2Q5A A;  3ARW A;  2A3E A;  3OOB A;  1SR0 A;  4DRO A;  4LAY A;  4S3K A;  1ZCN A;  2YBT A;  2XPA A;  3O5G A;  3JXV A;  4Z2K A;  5JH8 A;  1L1P A;  2MF9 A;  4ZPW R;  1EDQ A;  2ZQU A;  2F4E A;  4W9P A;  1D7H A;  3GPK A;  3AQU A;  4ODN A;  4W9O A;  1GPF A;  2PPO A;  2WM0 A;  5B8I C;  2ZR4 A;  1FKT A;  1LJY A;  1KT1 A;  1ROU A;  1FKR A;  3CHF A;  1BL4 A;  2YBU A;  2PV3 A;  2MNT A;  1KT0 A;  3ARU A;  1YAT A;  1ZBK A;  1FKD A;  1HXV A;  3O5L A;  4DRN A;  1FKL A;  2RUQ A;  3O5P A;  3AS3 A;  2M08 A;  1IX5 A;  2XP8 A;  4PTM A;  4DRH A;  4DRM A;  4P8V A;  1W1V A;  4P8U A;  1P5Q A;  1X6L A;  2ZQV A;  4ODL A;  1W9V A;  5HTG A;  4MTV A;  4U84 A;  5DIU A;  1FKJ A;  1FKK A;  3WL1 A;  1J4H A;  3IK8 A;  4DRI A;  2WK2 A;  3ARS A;  1ZU8 A;  4Z2J A;  1ZK6 A;  4LAX A;  1SYT A;  3CGN A;  3UF8 A;  1ZBW A;  2DT2 A;  2FDM A;  4MNL A;  5HT1 A;  4U85 A;  4GGQ A;  4MNJ A;  1NH6 A;  4JFI A;  1HKK A;  2XP5 A;  1E6Z A;  4WKH A;  4ODP A;  3UQI A;  5DEZ A;  2O92 A;  1UR8 A;  1FFR A;  4XAK A;  3EY6 A;  1E6P A;  4KQZ A;  2XPB A;  3B8S A;  4BF8 A;  3TC5 A;  1W1T A;  4JYS A;  4IQC A;  3AS1 A;  3ARQ A;  3KAF A;  3KAB A;  1ROT A;  1OGG A;  4ZPV R;  4JFJ A;  1Q6U A;  1JND A;  4N19 A;  1UR9 A;  4DIP A;  5DO2 A;  1FJD A;  2O9O A;  3O5Q A;  1GUV A;  4Z2L A;  2MPH A;  2KR7 A;  3OA5 A;  1NWR A;  4ITZ A;  2QF8 A;  5GPR A;  2D9F A;  4DH0 A;  1WNO A;  3KCE A;  3ALF A;  4DWS D;  2WLZ A;  3O5O A;  3RGC A;  1O6I A;  2ZQS A;  5HKG A;  4ML4 A;  1FKS A;  1W9U A;  1PIN A;  3MDY B;  2A3A A;  1NWS A;  3NI6 A;  1D7J A;  2DSU A;  4NZC A;  3IHZ A;  3FAP A;  1EIB A;  4L72 B;  4Z2G A;  1W1Y A;  4ZS6 A;  4Z2I A;  1J6Y A;  4ODR A;  4P8X A;  2ITK A;  2PV2 A;  1QPL A;  1ZL1 A;  3NRK A;  5HWB A;  3RFW A;  1FKH A;  2DSZ A;  1ITX A;  1R9H A;  3AS0 A;  3RME A;  4W9Q A;  3O5E A;  2IUZ A;  3FY1 A;  1JNS A;  2A3B A;  3UI4 A;  4HAR A;  1W26 A;  2G41 A;  1GOI A;  3KAH A;  1LL4 A;  3RM8 A;  3ARV A;  4TNS A;  2RQS A;  4NNR A;  1E6N A;  3UQB A;  1K9T A;  3KAG A;  1W1P A;  4J4O A;  2ZQT A;  5D75 A;  3WQV A;  1U79 A;  1ZBC A;  3B9D A;  2DPE A;  3B9A A;  4DRQ A;  5HWC A;  3KAI A;  3W4R A;  4LAW A;  3WD0 A;  4DZ3 A;  4G2P A;  2RUR A;  4Z2H A;  2Y78 A;  3ART A;  2G8Z A;  2DT0 A;  1NWU A;  1JNE A;  4U86 A;  3ARX A;  3CGM A;  1FD9 A;  3H9R B;  2XP3 A;  1Q6H A;  3G6M A;  2JZV A;  4ZPT R;  4DRJ A;  1FKB A;  2OLH A;  1FKF A;  2M2A A;  1D6O A;  3KAC A;  1XHG A;  2AOS A;  2KI3 A;  1HJV A;  2K8I A;  4C02 B;  2DG9 A;  2PBC A;  1ZB5 A;  1EYM A;  2MLZ A;  3PR9 A;  1JNT A;  3CH9 A;  3UI6 A;  1YW5 A;  4JFL A;  4TW8 A;  1EQ3 A;  3ALG A;  2F21 A;  3O5F A;  4KR0 B;  2DG4 A;  2XP6 A;  1KFW A;  1D7I A;  1VF8 A;  4P8W A;  2RUC A;  4HBE A;  1FFQ A;  2N87 A;  2PI6 A;  4QIB A;  4TW6 A;  4WK9 A;  2F2D A;  3WD3 A;  1Y0O A;  1WAW A;  4WKA A;  4TX0 A;  1W9P A;  5HUA A;  5I98 A;  2LGO A;  4LGX A;  3ODK A;  3CZ8 A;  2LKN A;  3WQW A;  1PBK A;  2DSV A;  4QT3 A;  4L3N A;  3WL0 A;  3KAD A;  3O5I A;  4MGV A;  3VAW A;  3ARO A;  3QOK A;  1ZBV A;  5GQB A;  1HKJ A;  3ARR A;  1N1A A;  2LPV A;  3O5K A;  4NSB A;  4FN2 A;  4O2T A;  3ARP A;  1TCO C;  1B6C A;  3PRA A;  2KO7 A;  2XP9 A;  3FXY A;  2KE0 A;  3IKG A;  4WKF A;  2UZ5 A;  3WD2 A;  3O5M A;  2WLY A;  3WIJ A;  4S3J A;  1OGB A;  1LQ0 A;  1E9L A;  1C9H A;  2PV1 A;  4LAV A;  5HW6 A;  1F8A B;  2ZR5 A;  2RSE A;  4Q22 A;  4R0X A;  3RM4 A;  4WIW A;  4ODO A;  1HKI A;  2ZR6 A;  4IT6 A;  2PPP A;  4DRK A;  3WKZ A;  3IKD A;  4DZ2 A;  1M5Y A;  1FKG A;  4MAV A;  4R5E A;  1EHN A;  3CHD A;  4AY1 A;  2DT1 A;  5HW8 A;  2AWG A;  4G50 A;  1LL7 A;  1XRV A;  1HKM A;  2MLY A;  2DSW A;  3WD4 A;  3CHE A;  4IQ2 A;  3WD1 A;  4W5U A;  5DF0 A;  4IPX A;  1JVW A;  2MLX A;  1WB0 A;  3ARZ A;  3I6C A;  2DT3 A;  1NSG A;  4MNM A;  4ODM A;  1QPF A;  1J4R A;  5GPG A;  3O5J A;  2FKE A;  2ESC A;  1Q1C A;  4DWS C;  3BXW A;  1FKI A;  3JYJ A;  3O5R A;  4HBO A;  1E15 A;  2OFN A;  4J4N A;  1E6R A;  4QZV B;  1F40 A;  1H0I A;  1T11 A;  1NMW A;  1BKF A;  4QT2 A;  3LUO A;  2M1I A;  4DWS B;  1FAP A;  1LG2 A;  4JFM A;  1QZ2 A;  2IF4 A;  4IT4 A;  4DRP A;  1X6N A;  4URI A;  1OWQ A;  4MPK A;  5DIT A;  1HJW A;  1TFV A;  3TDB A;  3TCZ A;  5HBF A;  3PRD A;  1RD6 A;  3CHC A;  3B7X A;  3KZ7 A;  4JFK A;  1CTN A;  3ARY A;  2A3C A;  5DIV A;  2L2S A;  1D2K A;  3PRB A;  1J4I A;  2FAP A;  3AS2 A;  4MSP A;  4ODK A;  5HW7 A;  1HJX A;  4WJX A;  5J6E A;  3PA7 A;  2B31 A;  2VCD A;  3B9E A;  3RM9 A;  1Q6I A;  3UQA A;  4FAP A;  2XP4 A;  1LG1 A;  3O5D A;  2PPN A;  1LL6 A;  4TW7 A;  4DWS A;  1NWT A;  2KGJ A;  3UI5 A;  1A7X A;  4Q7N A;  4DT4 A;  1NMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...