1F40A

Solution structure of fkbp12 complexed with gpi-1046, a neurotrophic ligand
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506 BINDING PROTEIN (FKBP12)
publication title Solution structure of a neurotrophic ligand bound to FKBP12 and its effects on protein dynamics.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1f40A00
4LAYA 4IPXA 1FKFA 2ZR4A 3OOBA 2Q5AA 4W9QA 3UI6A 1D7JA 1KT0A 4GGQA 4MGVA 1T11A 1FD9A 4QT2A 3GPKA 3O5FA 3UQBA 1FKLA 2MPHA 3O5EA 2RUQA 4JFIA 3PA7A 3KAHA 1EYMA 2XP3A 5DIUA 1NMVA 4DRIA 2N87A 5HWCA 5DITA 3CGNA 3O5QA 4U86A 3KAGA 2M08A 4MSPA 4TW8A 4ODRA 3UQIA 2XP4A 4G2PA 1FJDA 2Y78A 3H9RB 3NRKA 3O5OA 2MLXA 1D7IA 1Y0OA 4FAPA 1FKHA 1EQ3A 2ZQVA 3KAIA 1P5QA 5HUAA 1PINA 1YW5A 1J4IA 4DZ2A 5GPGA 2F21A 4JYSA 3RFWA 4QT3A 3TCZA 3UI4A 2RURA 2LKNA 3TDBA 1BKFA 4GIVA 1FKSA 3O5IA 2KR7A 2FAPA 3O5JA 3NI6A 3UF8A 1J4HA 4ODKA 2XP6A 1FKRA 3KAFA 1FKTA 4ODOA 1M5YA 2MNTA 2M2AA 2ZR6A 2PV3A 5I98A 2LJ4A 1Q1CA 5HTGA 2KI3A 3IKDA 1FKJA 4DRKA 3IK8A 3EY6A 2K8IA 2RUCA 1N1AA 1BL4A 1Q6HA 1FAPA 4ITZA 4U84A 1TCOC 1FKIA 4N19A 3KADA 2MLYA 2PBCA 3KACA 3PRBA 4R0XA 4LAXA 2RQSA 1ZCNA 3O5KA 4U85A 4DRNA 4C02B 2KFWA 3O5DA 4DH0A 1F8AB 2DG9A 2PPPA 3UQAA 4DROA 2L2SA 4QIBA 5J6EA 3O5RA 3WH0A 4TW6A 4DZ3A 3KABA 3B7XA 3KCEA 2RUDA 1FKGA 4DRHA 2MF9A 4JFKA 2KO7A 2VCDA 1D7HA 3I6CA 1JNTA 1NSGA 1U79A 2UZ5A 3IKGA 4TYOA 3O5PA 2JZVA 1NMWA 2DG3A 2OFNA 1QPFA 2LPVA 4DRQA 2D9FA 4JFJA 1J6YA 2ZQSA 1HXVA 4DRMA 1ZK6A 3O5MA 1JNSA 4FN2A 2XPAA 2PPOA 3PRDA 4BF8A 2PV2A 4DRPA 2DG4A 2RSEA 2FKEA 4W9OA 3JYJA 4IQCA 5HWBA 1Q6IA 2XP8A 4NNRA 1R9HA 2ZR5A 3MDYB 4O2TA 4DT4A 2LGOA 1F40A 1L1PA 2ITKA 1A7XA 3CGMA 4DIPA 4TW7A 2KGJA 2XPBA 3IHZA 1JVWA 2MLZA 5HW8A 1J4RA 2F2DA 2XP9A 5D75A 3O5LA 1C9HA 4G50A 5HT1A 3RGCA 1Q6UA 5HKGA 1FKBA 2ZQUA 5DIVA 2M1IA 2IF4A 2VN1A 2ZQTA 1W26A 3JYMA 3NTPA 4J4NA 4LAWA 1QPLA 5B8IC 3UI5A 3TC5A 1D6OA 1ROTA 2PPNA 2XP5A 3LUOA 1PBKA 4ODQA 1YATA 4ODPA 3VAWA 4TNSA 4ODLA 2XP7A 2PV1A 2KE0A 1FKDA 1FKKA 1KT1A 4ODNA 4ODMA 4DRJA 3JXVA 4JFMA 3O5GA 3KZ7A 4TX0A 4W9PA 5BXJA 3FAPA 2AWGA 1B6CA 4IQ2A 4JFLA 5HW7A 4LAVA 3ODKA 4J4OA 2F4EA 5HW6A 1QZ2A 1ROUA
chains in the Genus database with same CATH superfamily
2ZR4A 3OOBA 3UI6A 2Q5AA 4MGVA 4L3NA 4QT2A 1NWTA 1FKLA 2XP3A 1LG2A 5HWCA 3CGNA 2WK2A 4MSPA 5GQBA 3O5OA 4XAKA 4FAPA 3EIPA 1EQ3A 2ZQVA 1PINA 4JYSA 2IUZA 3TCZA 2RURA 2A3BA 2LKNA 3TDBA 3O5JA 4WK9A 3RM9A 1HJXA 1UR9A 2M2AA 1Q1CA 4DRKA 2K8IA 1FAPA 4ITZA 1JNEA 3AS2A 4P8UA 3KADA 4R0XA 3PRAA 2RQSA 2KFWA 3ARVA 3O5DA 1F8AB 2PPPA 2ESCA 4QIBA 3O5RA 3WH0A 5JH8A 3KABA 2MF9A 3IKGA 1NSGA 4P8VA 1NMWA 1O6IA 1QPFA 1RD6A 2LPVA 2D9FA 3WQVA 2XPAA 4W9OA 3JYJA 2DSVA 1XRVA 4DT4A 4NNRA 2ZR5A 3WD0A 1LQ0A 4HBOA 2XPBA 3IHZA 1JVWA 2MLZA 4ZPWR 1J4RA 2F2DA 1OGGA 4G50A 1FKBA 3AQUA 2ZQUA 2M1IA 1E9LA 1QPLA 2WLYA 3TC5A 3B9DA 1YATA 4ODPA 2O9OA 2PV1A 1FKKA 2B5UB 4DRJA 3O5GA 5GPRA 2AWGA 4LAVA 3AS1A 1ITXA 3ARTA 4W9QA 4DWSD 1T11A 4WKAA 5DF0A 1WAWA 3FXYA 1NMVA 4WKFA 1E15A 2N87A 1FFQA 1LL6A 3O5QA 3KAGA 5HBFA 2F23A 1FJDA 4G2PA 4Z2JA 3CHEA 2Y78A 4KR0B 4UDMA 2MLXA 1Y0OA 4IT4A 3ARWA 5HUAA 2F21A 4AY1A 4MPKA 3UI4A 1UR8A 3AS0A 1FKSA 2FAPA 3NI6A 2XP6A 1W1PA 3KAFA 1FKTA 2G8ZA 1HJWA 1EIBA 1E44A 1HKMA 2ZR6A 3IKDA 2KI3A 1XHGA 1FKJA 2DT3A 3CHFA 3RM4A 1N1AA 1LL7A 4U84A 2A3CA 1FKIA 4N19A 2PBCA 3OA5A 4LAXA 4U85A 4DH0A 3BMBA 1W1VA 3GTYX 2QF8A 3KCEA 3ARSA 4TYOA 1D7HA 1H0GA 1JNTA 1U79A 4WKHA 1WB0A 2JZVA 2DG3A 2OFNA 4ZPTR 4JFJA 4MNLA 3FY1A 2ZQSA 3O5MA 1ZB5A 3PRDA 2PV2A 2DG4A 2P4VA 4IQCA 1Q6IA 1W9VA 1R9HA 1HKKA 2OLHA 4O2TA 2LGOA 1A7XA 4DIPA 1NWUA 3WD3A 1X6NA 1Q6UA 1E6ZA 2WLZA 4J4NA 4R5EA 3JYMA 3CHCA 2O92A 4DWSC 1W1YA 2PPNA 3QOKA 4WIWA 1TFVA 1ZBVA 1FKDA 1KT1A 1WNOA 1ZBWA 3FAPA 4JFLA 4IQ2A 2B31A 3RMEA 2YBTA 1CTNA 4MNMA 2G41A 2PI6A 3GU0A 5HW6A 3ARUA 1ROUA 1NWSA 2DT2A 1D7JA 4GGQA 1FD9A 3O5FA 2A3EA 1HJVA 1GUVA 2MPHA 3O5EA 2RUQA 1OGBA 2EULA 3KAHA 1EYMA 3PA7A 5DIUA 4DRIA 5DITA 4ZS6A 3B9AA 4U86A 3UQIA 4TW8A 4ODRA 3W4RA 3AROA 1ZBCA 1FFRA 3H9RB 1FKHA 1P5QA 1YW5A 4HBEA 5GPGA 1EHNA 4QT3A 1BKFA 2KR7A 3UF8A 4NZCA 1J4HA 2FDMA 4ODKA 4MAVA 4ODOA 1M5YA 4Z2LA 2ETNA 5I98A 2DT0A 2LJ4A 2PN0A 5HTGA 3ARYA 3IK8A 3EY6A 2AOSA 3G6MA 1BL4A 1Q6HA 1TCOC 4MTVA 3ALFA 2A3AA 4P8XA 3KACA 4Z2KA 1ZBKA 3AS3A 3PRBA 3O5KA 1ZCNA 4DRNA 4Q7NA 3ARRA 3UQAA 3B8SA 3ARPA 2L2SA 4DZ3A 3B7XA 5DO2A 2RUDA 1NH6A 4JFKA 2KO7A 2VCDA 1JNDA 1OWQA 4DRQA 3B9EA 4Z2IA 1HXVA 4FN2A 2PPOA 4BF8A 3WL0A 1E6NA 1EDQA 5HWBA 2XP8A 3MDYB 4L72B 1LG1A 1L1PA 2ITKA 3CGMA 2YBUA 4NSBA 4URIA 3ARXA 4MNKA 3O5LA 1C9HA 4PTMA 5HT1A 5HKGA 2IF4A 3BXWA 2ZQTA 1W26A 1GPFA 5B8IC 3UI5A 3PR9A 3ARZA 3LUOA 2XP5A 4P8WA 1PBKA 3WL1A 3VAWA 4TNSA 4KQZA 4ODLA 2XP7A 2KE0A 4ODMA 4WJXA 3ALGA 3JXVA 4W5UA 5BXJA 3KZ7A 4TX0A 4W9PA 1IX5A 3ODKA 4J4OA 1W1TA 2DSZA 2F4EA 1HKIA 4IPXA 4LAYA 1FKFA 3CZ8A 3RM8A 1E6PA 1KT0A 3GPKA 1JCHB 3UQBA 1H0IA 4JFIA 1W9PA 2M08A 3ARQA 2XP4A 4LGXA 3CHDA 3NRKA 4Q22A 1D7IA 1W9UA 3KAIA 1SYTA 4Z2GA 3WD2A 1J4IA 1ZL1A 4ZPVR 3WIJA 4DZ2A 2WM0A 3RFWA 3WQWA 4S3JA 5DEZA 4GIVA 3O5IA 1K9TA 4DWSB 1FKRA 1SR0A 2MNTA 2PV3A 3WD1A 4ML4A 2RUCA 1LJYA 4DWSA 4IT6A 4MNJA 3G6LA 4S3KA 2MLYA 1D2KA 4C02B 2DG9A 4DROA 5J6EA 1HKJA 4TW6A 1FKGA 3CH9A 4DRHA 2DSWA 1GRJA 3I6CA 3WKZA 1LL4A 2UZ5A 3O5PA 1J6YA 4DRMA 1ZK6A 1X6LA 1JNSA 1E6RA 4DRPA 2RSEA 2FKEA 4HARA 1F40A 1GOIA 2DPEA 4TW7A 2KGJA 1VF8A 5HW8A 2XP9A 2DT1A 5D75A 3RGCA 4QZVB 5DIVA 2VN1A 4LAWA 4Z2HA 2DSUA 1D6OA 1ROTA 4ODQA 4ODNA 4JFMA 1NWRA 3WD4A 1KFWA 5HW7A 1B6CA 1ZU8A 1QZ2A 3NTPA
chains in the Genus database with same CATH topology
2ZR4A 3OOBA 3UI6A 2Q5AA 4MGVA 4L3NA 4QT2A 1NWTA 1FKLA 2XP3A 1LG2A 5HWCA 3CGNA 2WK2A 4MSPA 5GQBA 3O5OA 4XAKA 4FAPA 1EQ3A 2ZQVA 1PINA 4JYSA 2IUZA 3TCZA 2RURA 2A3BA 2LKNA 3TDBA 3O5JA 4WK9A 3RM9A 1HJXA 1UR9A 2M2AA 1Q1CA 4DRKA 2K8IA 1FAPA 4ITZA 1JNEA 3AS2A 4P8UA 3KADA 4R0XA 3PRAA 2RQSA 2KFWA 3ARVA 3O5DA 1F8AB 2PPPA 2ESCA 4QIBA 3O5RA 3WH0A 5JH8A 3KABA 2MF9A 3IKGA 1NSGA 4P8VA 1NMWA 1O6IA 1QPFA 1RD6A 2LPVA 2D9FA 3WQVA 2XPAA 4W9OA 3JYJA 2DSVA 1XRVA 4DT4A 4NNRA 2ZR5A 3WD0A 1LQ0A 4HBOA 2XPBA 3IHZA 1JVWA 2MLZA 4ZPWR 1J4RA 2F2DA 1OGGA 4G50A 1FKBA 3AQUA 2ZQUA 2M1IA 1E9LA 1QPLA 2WLYA 3TC5A 3B9DA 1YATA 4ODPA 2O9OA 2PV1A 1FKKA 4DRJA 3O5GA 5GPRA 2AWGA 4LAVA 3AS1A 1ITXA 3ARTA 4W9QA 4DWSD 1T11A 4WKAA 5DF0A 1WAWA 3FXYA 1NMVA 4WKFA 1E15A 2N87A 1FFQA 1LL6A 3O5QA 3KAGA 5HBFA 1FJDA 4G2PA 4Z2JA 3CHEA 2Y78A 4KR0B 2MLXA 1Y0OA 4IT4A 3ARWA 5HUAA 2F21A 4AY1A 4MPKA 3UI4A 1UR8A 3AS0A 1FKSA 2FAPA 3NI6A 2XP6A 1W1PA 3KAFA 1FKTA 2G8ZA 1HJWA 1EIBA 1HKMA 2ZR6A 3IKDA 2KI3A 1XHGA 1FKJA 2DT3A 3CHFA 3RM4A 1N1AA 1LL7A 4U84A 2A3CA 1FKIA 4N19A 2PBCA 3OA5A 4LAXA 4U85A 4DH0A 1W1VA 2QF8A 3KCEA 3ARSA 4TYOA 1D7HA 1H0GA 1JNTA 1U79A 4WKHA 1WB0A 2JZVA 2DG3A 2OFNA 4ZPTR 4JFJA 4MNLA 3FY1A 2ZQSA 3O5MA 1ZB5A 3PRDA 2PV2A 2DG4A 4IQCA 1Q6IA 1W9VA 1R9HA 1HKKA 2OLHA 4O2TA 2LGOA 1A7XA 4DIPA 1NWUA 3WD3A 1X6NA 1Q6UA 1E6ZA 2WLZA 4J4NA 4R5EA 3JYMA 3CHCA 2O92A 4DWSC 1W1YA 2PPNA 3QOKA 4WIWA 1TFVA 1ZBVA 1FKDA 1KT1A 1WNOA 1ZBWA 3FAPA 4JFLA 4IQ2A 2B31A 3RMEA 2YBTA 1CTNA 4MNMA 2G41A 2PI6A 5HW6A 3ARUA 1ROUA 1NWSA 2DT2A 1D7JA 4GGQA 1FD9A 3O5FA 2A3EA 1HJVA 1GUVA 2MPHA 3O5EA 2RUQA 1OGBA 3PA7A 3KAHA 1EYMA 5DIUA 4DRIA 5DITA 4ZS6A 3B9AA 4U86A 3UQIA 4TW8A 4ODRA 3W4RA 3AROA 1ZBCA 1FFRA 3H9RB 1FKHA 1P5QA 1YW5A 4HBEA 5GPGA 1EHNA 4QT3A 1BKFA 2KR7A 3UF8A 4NZCA 1J4HA 2FDMA 4ODKA 4MAVA 4ODOA 1M5YA 4Z2LA 5I98A 2DT0A 2LJ4A 5HTGA 3ARYA 3IK8A 3EY6A 2AOSA 3G6MA 1BL4A 1Q6HA 1TCOC 4MTVA 3ALFA 2A3AA 4P8XA 3KACA 4Z2KA 1ZBKA 3AS3A 3PRBA 3O5KA 1ZCNA 4DRNA 4Q7NA 3ARRA 3UQAA 3B8SA 3ARPA 2L2SA 4DZ3A 3B7XA 5DO2A 2RUDA 1NH6A 4JFKA 2KO7A 2VCDA 1JNDA 1OWQA 4DRQA 3B9EA 4Z2IA 1HXVA 4FN2A 2PPOA 4BF8A 3WL0A 1E6NA 1EDQA 5HWBA 2XP8A 3MDYB 4L72B 1LG1A 1L1PA 2ITKA 3CGMA 2YBUA 4NSBA 4URIA 3ARXA 4MNKA 3O5LA 1C9HA 4PTMA 5HT1A 5HKGA 2IF4A 3BXWA 2ZQTA 1W26A 1GPFA 5B8IC 3UI5A 3PR9A 3ARZA 3LUOA 2XP5A 4P8WA 1PBKA 3WL1A 3VAWA 4TNSA 4KQZA 4ODLA 2XP7A 2KE0A 4ODMA 4WJXA 3ALGA 3JXVA 4W5UA 5BXJA 3KZ7A 4TX0A 4W9PA 1IX5A 3ODKA 4J4OA 1W1TA 2DSZA 2F4EA 1HKIA 4IPXA 4LAYA 1FKFA 3CZ8A 3RM8A 1E6PA 1KT0A 3GPKA 3UQBA 1H0IA 4JFIA 1W9PA 2M08A 3ARQA 2XP4A 4LGXA 3CHDA 3NRKA 4Q22A 1D7IA 1W9UA 3KAIA 1SYTA 4Z2GA 3WD2A 1J4IA 1ZL1A 4ZPVR 3WIJA 4DZ2A 2WM0A 3RFWA 3WQWA 4S3JA 5DEZA 4GIVA 3O5IA 1K9TA 4DWSB 1FKRA 1SR0A 2MNTA 2PV3A 3WD1A 4ML4A 2RUCA 1LJYA 4DWSA 4IT6A 4MNJA 3G6LA 4S3KA 2MLYA 1D2KA 4C02B 2DG9A 4DROA 5J6EA 1HKJA 4TW6A 1FKGA 3CH9A 4DRHA 2DSWA 3WKZA 3I6CA 1LL4A 2UZ5A 3O5PA 1J6YA 4DRMA 1ZK6A 1X6LA 1JNSA 1E6RA 4DRPA 2RSEA 2FKEA 4HARA 1F40A 1GOIA 2DPEA 4TW7A 2KGJA 1VF8A 5HW8A 2XP9A 2DT1A 5D75A 3RGCA 4QZVB 5DIVA 2VN1A 4LAWA 4Z2HA 2DSUA 1D6OA 1ROTA 4ODQA 4ODNA 4JFMA 1NWRA 3WD4A 1KFWA 5HW7A 1B6CA 1ZU8A 1QZ2A 3NTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAY A;  4IPX A;  1FKF A;  2ZR4 A;  3OOB A;  2Q5A A;  4W9Q A;  3UI6 A;  1D7J A;  1KT0 A;  4GGQ A;  4MGV A;  1T11 A;  1FD9 A;  4QT2 A;  3GPK A;  3O5F A;  3UQB A;  1FKL A;  2MPH A;  3O5E A;  2RUQ A;  4JFI A;  3PA7 A;  3KAH A;  1EYM A;  2XP3 A;  5DIU A;  1NMV A;  4DRI A;  2N87 A;  5HWC A;  5DIT A;  3CGN A;  3O5Q A;  4U86 A;  3KAG A;  2M08 A;  4MSP A;  4TW8 A;  4ODR A;  3UQI A;  2XP4 A;  4G2P A;  1FJD A;  2Y78 A;  3H9R B;  3NRK A;  3O5O A;  2MLX A;  1D7I A;  1Y0O A;  4FAP A;  1FKH A;  1EQ3 A;  2ZQV A;  3KAI A;  1P5Q A;  5HUA A;  1PIN A;  1YW5 A;  1J4I A;  4DZ2 A;  5GPG A;  2F21 A;  4JYS A;  3RFW A;  4QT3 A;  3TCZ A;  3UI4 A;  2RUR A;  2LKN A;  3TDB A;  1BKF A;  4GIV A;  1FKS A;  3O5I A;  2KR7 A;  2FAP A;  3O5J A;  3NI6 A;  3UF8 A;  1J4H A;  4ODK A;  2XP6 A;  1FKR A;  3KAF A;  1FKT A;  4ODO A;  1M5Y A;  2MNT A;  2M2A A;  2ZR6 A;  2PV3 A;  5I98 A;  2LJ4 A;  1Q1C A;  5HTG A;  2KI3 A;  3IKD A;  1FKJ A;  4DRK A;  3IK8 A;  3EY6 A;  2K8I A;  2RUC A;  1N1A A;  1BL4 A;  1Q6H A;  1FAP A;  4ITZ A;  4U84 A;  1TCO C;  1FKI A;  4N19 A;  3KAD A;  2MLY A;  2PBC A;  3KAC A;  3PRB A;  4R0X A;  4LAX A;  2RQS A;  1ZCN A;  3O5K A;  4U85 A;  4DRN A;  4C02 B;  2KFW A;  3O5D A;  4DH0 A;  1F8A B;  2DG9 A;  2PPP A;  3UQA A;  4DRO A;  2L2S A;  4QIB A;  5J6E A;  3O5R A;  3WH0 A;  4TW6 A;  4DZ3 A;  3KAB A;  3B7X A;  3KCE A;  2RUD A;  1FKG A;  4DRH A;  2MF9 A;  4JFK A;  2KO7 A;  2VCD A;  1D7H A;  3I6C A;  1JNT A;  1NSG A;  1U79 A;  2UZ5 A;  3IKG A;  4TYO A;  3O5P A;  2JZV A;  1NMW A;  2DG3 A;  2OFN A;  1QPF A;  2LPV A;  4DRQ A;  2D9F A;  4JFJ A;  1J6Y A;  2ZQS A;  1HXV A;  4DRM A;  1ZK6 A;  3O5M A;  1JNS A;  4FN2 A;  2XPA A;  2PPO A;  3PRD A;  4BF8 A;  2PV2 A;  4DRP A;  2DG4 A;  2RSE A;  2FKE A;  4W9O A;  3JYJ A;  4IQC A;  5HWB A;  1Q6I A;  2XP8 A;  4NNR A;  1R9H A;  2ZR5 A;  3MDY B;  4O2T A;  4DT4 A;  2LGO A;  1F40 A;  1L1P A;  2ITK A;  1A7X A;  3CGM A;  4DIP A;  4TW7 A;  2KGJ A;  2XPB A;  3IHZ A;  1JVW A;  2MLZ A;  5HW8 A;  1J4R A;  2F2D A;  2XP9 A;  5D75 A;  3O5L A;  1C9H A;  4G50 A;  5HT1 A;  3RGC A;  1Q6U A;  5HKG A;  1FKB A;  2ZQU A;  5DIV A;  2M1I A;  2IF4 A;  2VN1 A;  2ZQT A;  1W26 A;  3JYM A;  3NTP A;  4J4N A;  4LAW A;  1QPL A;  5B8I C;  3UI5 A;  3TC5 A;  1D6O A;  1ROT A;  2PPN A;  2XP5 A;  3LUO A;  1PBK A;  4ODQ A;  1YAT A;  4ODP A;  3VAW A;  4TNS A;  4ODL A;  2XP7 A;  2PV1 A;  2KE0 A;  1FKD A;  1FKK A;  1KT1 A;  4ODN A;  4ODM A;  4DRJ A;  3JXV A;  4JFM A;  3O5G A;  3KZ7 A;  4TX0 A;  4W9P A;  5BXJ A;  3FAP A;  2AWG A;  1B6C A;  4IQ2 A;  4JFL A;  5HW7 A;  4LAV A;  3ODK A;  4J4O A;  2F4E A;  5HW6 A;  1QZ2 A;  1ROU A; 
#chains in the Genus database with same CATH topology
 2ZR4 A;  3OOB A;  3UI6 A;  2Q5A A;  4MGV A;  4L3N A;  4QT2 A;  1NWT A;  1FKL A;  2XP3 A;  1LG2 A;  5HWC A;  3CGN A;  2WK2 A;  4MSP A;  5GQB A;  3O5O A;  4XAK A;  4FAP A;  3EIP A;  1EQ3 A;  2ZQV A;  1PIN A;  4JYS A;  2IUZ A;  3TCZ A;  2RUR A;  2A3B A;  2LKN A;  3TDB A;  3O5J A;  4WK9 A;  3RM9 A;  1HJX A;  1UR9 A;  2M2A A;  1Q1C A;  4DRK A;  2K8I A;  1FAP A;  4ITZ A;  1JNE A;  3AS2 A;  4P8U A;  3KAD A;  4R0X A;  3PRA A;  2RQS A;  2KFW A;  3ARV A;  3O5D A;  1F8A B;  2PPP A;  2ESC A;  4QIB A;  3O5R A;  3WH0 A;  5JH8 A;  3KAB A;  2MF9 A;  3IKG A;  1NSG A;  4P8V A;  1NMW A;  1O6I A;  1QPF A;  1RD6 A;  2LPV A;  2D9F A;  3WQV A;  2XPA A;  4W9O A;  3JYJ A;  2DSV A;  1XRV A;  4DT4 A;  4NNR A;  2ZR5 A;  3WD0 A;  1LQ0 A;  4HBO A;  2XPB A;  3IHZ A;  1JVW A;  2MLZ A;  4ZPW R;  1J4R A;  2F2D A;  1OGG A;  4G50 A;  1FKB A;  3AQU A;  2ZQU A;  2M1I A;  1E9L A;  1QPL A;  2WLY A;  3TC5 A;  3B9D A;  1YAT A;  4ODP A;  2O9O A;  2PV1 A;  1FKK A;  2B5U B;  4DRJ A;  3O5G A;  5GPR A;  2AWG A;  4LAV A;  3AS1 A;  1ITX A;  3ART A;  4W9Q A;  4DWS D;  1T11 A;  4WKA A;  5DF0 A;  1WAW A;  3FXY A;  1NMV A;  4WKF A;  1E15 A;  2N87 A;  1FFQ A;  1LL6 A;  3O5Q A;  3KAG A;  5HBF A;  2F23 A;  1FJD A;  4G2P A;  4Z2J A;  3CHE A;  2Y78 A;  4KR0 B;  4UDM A;  2MLX A;  1Y0O A;  4IT4 A;  3ARW A;  5HUA A;  2F21 A;  4AY1 A;  4MPK A;  3UI4 A;  1UR8 A;  3AS0 A;  1FKS A;  2FAP A;  3NI6 A;  2XP6 A;  1W1P A;  3KAF A;  1FKT A;  2G8Z A;  1HJW A;  1EIB A;  1E44 A;  1HKM A;  2ZR6 A;  3IKD A;  2KI3 A;  1XHG A;  1FKJ A;  2DT3 A;  3CHF A;  3RM4 A;  1N1A A;  1LL7 A;  4U84 A;  2A3C A;  1FKI A;  4N19 A;  2PBC A;  3OA5 A;  4LAX A;  4U85 A;  4DH0 A;  3BMB A;  1W1V A;  3GTY X;  2QF8 A;  3KCE A;  3ARS A;  4TYO A;  1D7H A;  1H0G A;  1JNT A;  1U79 A;  4WKH A;  1WB0 A;  2JZV A;  2DG3 A;  2OFN A;  4ZPT R;  4JFJ A;  4MNL A;  3FY1 A;  2ZQS A;  3O5M A;  1ZB5 A;  3PRD A;  2PV2 A;  2DG4 A;  2P4V A;  4IQC A;  1Q6I A;  1W9V A;  1R9H A;  1HKK A;  2OLH A;  4O2T A;  2LGO A;  1A7X A;  4DIP A;  1NWU A;  3WD3 A;  1X6N A;  1Q6U A;  1E6Z A;  2WLZ A;  4J4N A;  4R5E A;  3JYM A;  3CHC A;  2O92 A;  4DWS C;  1W1Y A;  2PPN A;  3QOK A;  4WIW A;  1TFV A;  1ZBV A;  1FKD A;  1KT1 A;  1WNO A;  1ZBW A;  3FAP A;  4JFL A;  4IQ2 A;  2B31 A;  3RME A;  2YBT A;  1CTN A;  4MNM A;  2G41 A;  2PI6 A;  3GU0 A;  5HW6 A;  3ARU A;  1ROU A;  1NWS A;  2DT2 A;  1D7J A;  4GGQ A;  1FD9 A;  3O5F A;  2A3E A;  1HJV A;  1GUV A;  2MPH A;  3O5E A;  2RUQ A;  1OGB A;  2EUL A;  3KAH A;  1EYM A;  3PA7 A;  5DIU A;  4DRI A;  5DIT A;  4ZS6 A;  3B9A A;  4U86 A;  3UQI A;  4TW8 A;  4ODR A;  3W4R A;  3ARO A;  1ZBC A;  1FFR A;  3H9R B;  1FKH A;  1P5Q A;  1YW5 A;  4HBE A;  5GPG A;  1EHN A;  4QT3 A;  1BKF A;  2KR7 A;  3UF8 A;  4NZC A;  1J4H A;  2FDM A;  4ODK A;  4MAV A;  4ODO A;  1M5Y A;  4Z2L A;  2ETN A;  5I98 A;  2DT0 A;  2LJ4 A;  2PN0 A;  5HTG A;  3ARY A;  3IK8 A;  3EY6 A;  2AOS A;  3G6M A;  1BL4 A;  1Q6H A;  1TCO C;  4MTV A;  3ALF A;  2A3A A;  4P8X A;  3KAC A;  4Z2K A;  1ZBK A;  3AS3 A;  3PRB A;  3O5K A;  1ZCN A;  4DRN A;  4Q7N A;  3ARR A;  3UQA A;  3B8S A;  3ARP A;  2L2S A;  4DZ3 A;  3B7X A;  5DO2 A;  2RUD A;  1NH6 A;  4JFK A;  2KO7 A;  2VCD A;  1JND A;  1OWQ A;  4DRQ A;  3B9E A;  4Z2I A;  1HXV A;  4FN2 A;  2PPO A;  4BF8 A;  3WL0 A;  1E6N A;  1EDQ A;  5HWB A;  2XP8 A;  3MDY B;  4L72 B;  1LG1 A;  1L1P A;  2ITK A;  3CGM A;  2YBU A;  4NSB A;  4URI A;  3ARX A;  4MNK A;  3O5L A;  1C9H A;  4PTM A;  5HT1 A;  5HKG A;  2IF4 A;  3BXW A;  2ZQT A;  1W26 A;  1GPF A;  5B8I C;  3UI5 A;  3PR9 A;  3ARZ A;  3LUO A;  2XP5 A;  4P8W A;  1PBK A;  3WL1 A;  3VAW A;  4TNS A;  4KQZ A;  4ODL A;  2XP7 A;  2KE0 A;  4ODM A;  4WJX A;  3ALG A;  3JXV A;  4W5U A;  5BXJ A;  3KZ7 A;  4TX0 A;  4W9P A;  1IX5 A;  3ODK A;  4J4O A;  1W1T A;  2DSZ A;  2F4E A;  1HKI A;  4IPX A;  4LAY A;  1FKF A;  3CZ8 A;  3RM8 A;  1E6P A;  1KT0 A;  3GPK A;  1JCH B;  3UQB A;  1H0I A;  4JFI A;  1W9P A;  2M08 A;  3ARQ A;  2XP4 A;  4LGX A;  3CHD A;  3NRK A;  4Q22 A;  1D7I A;  1W9U A;  3KAI A;  1SYT A;  4Z2G A;  3WD2 A;  1J4I A;  1ZL1 A;  4ZPV R;  3WIJ A;  4DZ2 A;  2WM0 A;  3RFW A;  3WQW A;  4S3J A;  5DEZ A;  4GIV A;  3O5I A;  1K9T A;  4DWS B;  1FKR A;  1SR0 A;  2MNT A;  2PV3 A;  3WD1 A;  4ML4 A;  2RUC A;  1LJY A;  4DWS A;  4IT6 A;  4MNJ A;  3G6L A;  4S3K A;  2MLY A;  1D2K A;  4C02 B;  2DG9 A;  4DRO A;  5J6E A;  1HKJ A;  4TW6 A;  1FKG A;  3CH9 A;  4DRH A;  2DSW A;  1GRJ A;  3I6C A;  3WKZ A;  1LL4 A;  2UZ5 A;  3O5P A;  1J6Y A;  4DRM A;  1ZK6 A;  1X6L A;  1JNS A;  1E6R A;  4DRP A;  2RSE A;  2FKE A;  4HAR A;  1F40 A;  1GOI A;  2DPE A;  4TW7 A;  2KGJ A;  1VF8 A;  5HW8 A;  2XP9 A;  2DT1 A;  5D75 A;  3RGC A;  4QZV B;  5DIV A;  2VN1 A;  4LAW A;  4Z2H A;  2DSU A;  1D6O A;  1ROT A;  4ODQ A;  4ODN A;  4JFM A;  1NWR A;  3WD4 A;  1KFW A;  5HW7 A;  1B6C A;  1ZU8 A;  1QZ2 A;  3NTP A; 
#chains in the Genus database with same CATH homology
 2ZR4 A;  3OOB A;  3UI6 A;  2Q5A A;  4MGV A;  4L3N A;  4QT2 A;  1NWT A;  1FKL A;  2XP3 A;  1LG2 A;  5HWC A;  3CGN A;  2WK2 A;  4MSP A;  5GQB A;  3O5O A;  4XAK A;  4FAP A;  1EQ3 A;  2ZQV A;  1PIN A;  4JYS A;  2IUZ A;  3TCZ A;  2RUR A;  2A3B A;  2LKN A;  3TDB A;  3O5J A;  4WK9 A;  3RM9 A;  1HJX A;  1UR9 A;  2M2A A;  1Q1C A;  4DRK A;  2K8I A;  1FAP A;  4ITZ A;  1JNE A;  3AS2 A;  4P8U A;  3KAD A;  4R0X A;  3PRA A;  2RQS A;  2KFW A;  3ARV A;  3O5D A;  1F8A B;  2PPP A;  2ESC A;  4QIB A;  3O5R A;  3WH0 A;  5JH8 A;  3KAB A;  2MF9 A;  3IKG A;  1NSG A;  4P8V A;  1NMW A;  1O6I A;  1QPF A;  1RD6 A;  2LPV A;  2D9F A;  3WQV A;  2XPA A;  4W9O A;  3JYJ A;  2DSV A;  1XRV A;  4DT4 A;  4NNR A;  2ZR5 A;  3WD0 A;  1LQ0 A;  4HBO A;  2XPB A;  3IHZ A;  1JVW A;  2MLZ A;  4ZPW R;  1J4R A;  2F2D A;  1OGG A;  4G50 A;  1FKB A;  3AQU A;  2ZQU A;  2M1I A;  1E9L A;  1QPL A;  2WLY A;  3TC5 A;  3B9D A;  1YAT A;  4ODP A;  2O9O A;  2PV1 A;  1FKK A;  4DRJ A;  3O5G A;  5GPR A;  2AWG A;  4LAV A;  3AS1 A;  1ITX A;  3ART A;  4W9Q A;  4DWS D;  1T11 A;  4WKA A;  5DF0 A;  1WAW A;  3FXY A;  1NMV A;  4WKF A;  1E15 A;  2N87 A;  1FFQ A;  1LL6 A;  3O5Q A;  3KAG A;  5HBF A;  1FJD A;  4G2P A;  4Z2J A;  3CHE A;  2Y78 A;  4KR0 B;  2MLX A;  1Y0O A;  4IT4 A;  3ARW A;  5HUA A;  2F21 A;  4AY1 A;  4MPK A;  3UI4 A;  1UR8 A;  3AS0 A;  1FKS A;  2FAP A;  3NI6 A;  2XP6 A;  1W1P A;  3KAF A;  1FKT A;  2G8Z A;  1HJW A;  1EIB A;  1HKM A;  2ZR6 A;  3IKD A;  2KI3 A;  1XHG A;  1FKJ A;  2DT3 A;  3CHF A;  3RM4 A;  1N1A A;  1LL7 A;  4U84 A;  2A3C A;  1FKI A;  4N19 A;  2PBC A;  3OA5 A;  4LAX A;  4U85 A;  4DH0 A;  1W1V A;  2QF8 A;  3KCE A;  3ARS A;  4TYO A;  1D7H A;  1H0G A;  1JNT A;  1U79 A;  4WKH A;  1WB0 A;  2JZV A;  2DG3 A;  2OFN A;  4ZPT R;  4JFJ A;  4MNL A;  3FY1 A;  2ZQS A;  3O5M A;  1ZB5 A;  3PRD A;  2PV2 A;  2DG4 A;  4IQC A;  1Q6I A;  1W9V A;  1R9H A;  1HKK A;  2OLH A;  4O2T A;  2LGO A;  1A7X A;  4DIP A;  1NWU A;  3WD3 A;  1X6N A;  1Q6U A;  1E6Z A;  2WLZ A;  4J4N A;  4R5E A;  3JYM A;  3CHC A;  2O92 A;  4DWS C;  1W1Y A;  2PPN A;  3QOK A;  4WIW A;  1TFV A;  1ZBV A;  1FKD A;  1KT1 A;  1WNO A;  1ZBW A;  3FAP A;  4JFL A;  4IQ2 A;  2B31 A;  3RME A;  2YBT A;  1CTN A;  4MNM A;  2G41 A;  2PI6 A;  5HW6 A;  3ARU A;  1ROU A;  1NWS A;  2DT2 A;  1D7J A;  4GGQ A;  1FD9 A;  3O5F A;  2A3E A;  1HJV A;  1GUV A;  2MPH A;  3O5E A;  2RUQ A;  1OGB A;  3PA7 A;  3KAH A;  1EYM A;  5DIU A;  4DRI A;  5DIT A;  4ZS6 A;  3B9A A;  4U86 A;  3UQI A;  4TW8 A;  4ODR A;  3W4R A;  3ARO A;  1ZBC A;  1FFR A;  3H9R B;  1FKH A;  1P5Q A;  1YW5 A;  4HBE A;  5GPG A;  1EHN A;  4QT3 A;  1BKF A;  2KR7 A;  3UF8 A;  4NZC A;  1J4H A;  2FDM A;  4ODK A;  4MAV A;  4ODO A;  1M5Y A;  4Z2L A;  5I98 A;  2DT0 A;  2LJ4 A;  5HTG A;  3ARY A;  3IK8 A;  3EY6 A;  2AOS A;  3G6M A;  1BL4 A;  1Q6H A;  1TCO C;  4MTV A;  3ALF A;  2A3A A;  4P8X A;  3KAC A;  4Z2K A;  1ZBK A;  3AS3 A;  3PRB A;  3O5K A;  1ZCN A;  4DRN A;  4Q7N A;  3ARR A;  3UQA A;  3B8S A;  3ARP A;  2L2S A;  4DZ3 A;  3B7X A;  5DO2 A;  2RUD A;  1NH6 A;  4JFK A;  2KO7 A;  2VCD A;  1JND A;  1OWQ A;  4DRQ A;  3B9E A;  4Z2I A;  1HXV A;  4FN2 A;  2PPO A;  4BF8 A;  3WL0 A;  1E6N A;  1EDQ A;  5HWB A;  2XP8 A;  3MDY B;  4L72 B;  1LG1 A;  1L1P A;  2ITK A;  3CGM A;  2YBU A;  4NSB A;  4URI A;  3ARX A;  4MNK A;  3O5L A;  1C9H A;  4PTM A;  5HT1 A;  5HKG A;  2IF4 A;  3BXW A;  2ZQT A;  1W26 A;  1GPF A;  5B8I C;  3UI5 A;  3PR9 A;  3ARZ A;  3LUO A;  2XP5 A;  4P8W A;  1PBK A;  3WL1 A;  3VAW A;  4TNS A;  4KQZ A;  4ODL A;  2XP7 A;  2KE0 A;  4ODM A;  4WJX A;  3ALG A;  3JXV A;  4W5U A;  5BXJ A;  3KZ7 A;  4TX0 A;  4W9P A;  1IX5 A;  3ODK A;  4J4O A;  1W1T A;  2DSZ A;  2F4E A;  1HKI A;  4IPX A;  4LAY A;  1FKF A;  3CZ8 A;  3RM8 A;  1E6P A;  1KT0 A;  3GPK A;  3UQB A;  1H0I A;  4JFI A;  1W9P A;  2M08 A;  3ARQ A;  2XP4 A;  4LGX A;  3CHD A;  3NRK A;  4Q22 A;  1D7I A;  1W9U A;  3KAI A;  1SYT A;  4Z2G A;  3WD2 A;  1J4I A;  1ZL1 A;  4ZPV R;  3WIJ A;  4DZ2 A;  2WM0 A;  3RFW A;  3WQW A;  4S3J A;  5DEZ A;  4GIV A;  3O5I A;  1K9T A;  4DWS B;  1FKR A;  1SR0 A;  2MNT A;  2PV3 A;  3WD1 A;  4ML4 A;  2RUC A;  1LJY A;  4DWS A;  4IT6 A;  4MNJ A;  3G6L A;  4S3K A;  2MLY A;  1D2K A;  4C02 B;  2DG9 A;  4DRO A;  5J6E A;  1HKJ A;  4TW6 A;  1FKG A;  3CH9 A;  4DRH A;  2DSW A;  3WKZ A;  3I6C A;  1LL4 A;  2UZ5 A;  3O5P A;  1J6Y A;  4DRM A;  1ZK6 A;  1X6L A;  1JNS A;  1E6R A;  4DRP A;  2RSE A;  2FKE A;  4HAR A;  1F40 A;  1GOI A;  2DPE A;  4TW7 A;  2KGJ A;  1VF8 A;  5HW8 A;  2XP9 A;  2DT1 A;  5D75 A;  3RGC A;  4QZV B;  5DIV A;  2VN1 A;  4LAW A;  4Z2H A;  2DSU A;  1D6O A;  1ROT A;  4ODQ A;  4ODN A;  4JFM A;  1NWR A;  3WD4 A;  1KFW A;  5HW7 A;  1B6C A;  1ZU8 A;  1QZ2 A;  3NTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...