1FJDA

Human parvulin-like peptidyl prolyl cis/trans isomerase, hpar14
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
104
structure length
104
Chain Sequence
GSGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PEPTIDYL PROLYL CIS/TRANS ISOMERASE (PPIASE)
publication title Solution structure of the human parvulin-like peptidyl prolyl cis/trans isomerase, hPar14.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 104
sequence length 104
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fjdA00
3NRKA 2N87A 3O5IA 1Q6HA 2KFWA 2Q5AA 3TCZA 1FKRA 2RURA 4W9OA 1F40A 4GIVA 4JFIA 4DRKA 2ZR5A 5DITA 4TX0A 2XPBA 3PRDA 1FKFA 4FAPA 2XPAA 2XP6A 1FD9A 1YATA 2PPNA 1BL4A 4GGQA 2LKNA 2M2AA 1N1AA 1Q6UA 4U84A 3UQIA 3LUOA 4NNRA 2AWGA 1C9HA 1QPFA 3O5PA 2F21A 3MDYB 5HWCA 1NMWA 1R9HA 1J4RA 1FKSA 2D9FA 4IQ2A 1ROTA 3O5DA 4TYOA 3UQBA 2LPVA 4TW8A 4DH0A 1J4IA 2F2DA 2ZQVA 3CGMA 5BXJA 4W9PA 3PRBA 4LAXA 1BKFA 2ITKA 1PBKA 4JYSA 2XP9A 3O5GA 4ODQA 1ZCNA 4ODLA 2KE0A 2XP4A 4DRIA 4BF8A 4U86A 2L2SA 3JYJA 5J6EA 1P5QA 3NTPA 1FKGA 3IKGA 5DIVA 1FKTA 3EY6A 1D7HA 4JFLA 4DRNA 1D7JA 4DRPA 4ODRA 1FKHA 4LAYA 5HT1A 3FAPA 1T11A 1KT0A 2MLZA 2K8IA 4IQCA 4JFKA 1TCOC 2OFNA 3WH0A 4O2TA 1QPLA 1HXVA 3KAHA 4DROA 2PV2A 2LJ4A 3VAWA 4DT4A 2MPHA 2MLXA 1M5YA 3KADA 5GPGA 2PV3A 2RSEA 3O5MA 1FKJA 1JVWA 4LAVA 2XP8A 2ZR6A 3KABA 1EQ3A 4DZ2A 2FKEA 3IHZA 4J4NA 3UQAA 5B8IC 3RGCA 5HTGA 4ODMA 2VCDA 2ZQUA 3JYMA 1PINA 2PV1A 4MGVA 1EYMA 4ODOA 2KO7A 3CGNA 2VN1A 2PPPA 2ZQTA 4ODNA 2XP5A 2JZVA 3RFWA 5HUAA 1F8AB 3TDBA 4DIPA 3UI5A 2RUCA 2F4EA 1FKLA 1Q1CA 3PA7A 3I6CA 4G2PA 3O5JA 2RUQA 2M1IA 1FKKA 1QZ2A 4DZ3A 1W26A 2RQSA 2ZQSA 4QIBA 4QT2A 1J6YA 5HW6A 4N19A 4C02B 2XP3A 3O5EA 5HW8A 3KACA 2MNTA 3KAGA 3KZ7A 2MLYA 2UZ5A 3JXVA 3NI6A 3O5LA 1NSGA 2LGOA 4ODKA 2XP7A 3H9RB 3UF8A 3O5KA 4R0XA 4TW6A 2KR7A 1J4HA 2PBCA 4G50A 1A7XA 2Y78A 4U85A 4LAWA 1KT1A 2M08A 4ODPA 3TC5A 4MSPA 5DIUA 1FKDA 1Y0OA 4ITZA 5HKGA 4J4OA 4DRMA 4DRQA 1L1PA 4QT3A 1YW5A 4JFJA 4JFMA 1JNTA 1NMVA 2KI3A 3UI4A 5D75A 4TNSA 5HW7A 5HWBA 3IK8A 1Q6IA 1ZK6A 2DG3A 3B7XA 3KAIA 1JNSA 1B6CA 1FKIA 3OOBA 1ROUA 4W9QA 3KCEA 3O5RA 2KGJA 3ODKA 2DG4A 1FJDA 4DRHA 3O5FA 3UI6A 1U79A 3O5QA 5I98A 1D7IA 1FAPA 2RUDA 1D6OA 3GPKA 3KAFA 4FN2A 2IF4A 3O5OA 1FKBA 2FAPA 2PPOA 4TW7A 4DRJA 2DG9A 3IKDA 2MF9A 2ZR4A 4IPXA
chains in the Genus database with same CATH superfamily
3NRKA 3GTYX 2N87A 3RM4A 1HKMA 2RURA 1E15A 4TX0A 3RM9A 3PRDA 1FKFA 2DT3A 4PTMA 3ARPA 4WKAA 4GGQA 2LKNA 2M2AA 3UQIA 3WD2A 3LUOA 2OLHA 3B8SA 5HWCA 4S3JA 1ROTA 1KFWA 4TW8A 3FXYA 2YBUA 2ITKA 1LG2A 2O9OA 4DRIA 3CHCA 1EDQA 2L2SA 1LL6A 2ETNA 1ITXA 5J6EA 3NTPA 5HW7A 1D7JA 3CHDA 4ODRA 5HT1A 4IQCA 3WH0A 4W5UA 2OFNA 1QPLA 4DWSD 5DEZA 3VAWA 3B9DA 4DT4A 1HJWA 1SR0A 2PV3A 3ARVA 2XP8A 1GPFA 3UQAA 3IHZA 5JH8A 3B9AA 3GU0A 3JYMA 2PV1A 1VF8A 3QOKA 4ODNA 4XAKA 2JZVA 5HUAA 1F8AB 1FFQA 2RUCA 1EIBA 4NSBA 1FKKA 1O6IA 1QZ2A 1W26A 4QT2A 1J6YA 4C02B 4ITZA 3KZ7A 2MLYA 3PR9A 3WQVA 3H9RB 2F23A 2G8ZA 4U85A 4LAWA 1KT1A 2M08A 4MSPA 3AROA 4ZPVR 3WD1A 1TFVA 4DRMA 1OGGA 4JFJA 5D75A 5HWBA 2DG3A 3B7XA 1JNSA 3OOBA 3KCEA 3ODKA 1FJDA 4DRHA 3UI6A 3B9EA 5I98A 2RUDA 2O92A 3KAFA 3WQWA 4FN2A 4AY1A 2DT2A 2DPEA 1SYTA 3PRBA 1NWUA 3CZ8A 3TCZA 3AQUA 1K9TA 1GRJA 4GIVA 1E6RA 1GUVA 4FAPA 1NWSA 3ARYA 1W9PA 2PPNA 4U84A 3O5PA 1QPFA 2DSWA 2F21A 2WM0A 3ARSA 4IQ2A 1FKSA 2YBTA 2LPVA 2ZQVA 3CGMA 2DSVA 3ARQA 4IT6A 4ODQA 3BMBA 2KE0A 2XP4A 4U86A 3ARWA 1FKGA 3IKGA 3ALGA 2DT0A 3AS0A 1HJXA 1D2KA 2MLZA 4O2TA 4DROA 4Z2IA 2LJ4A 3ARZA 1W1PA 2MPHA 1NWTA 3KADA 1ZBCA 3ARUA 1EQ3A 1FKJA 4Z2JA 4LAVA 2ZR6A 4J4NA 4WKHA 5HTGA 2QF8A 4ODMA 2ZQUA 1PINA 4MGVA 3WD4A 3CGNA 1ZBVA 4Q7NA 3WKZA 4MPKA 3RFWA 3TDBA 3UI5A 3WL1A 1ZBKA 2WLYA 1FKLA 1Q1CA 3O5JA 4MNJA 4HBEA 4QIBA 4LGXA 1XRVA 4MNMA 2XP3A 3O5EA 4IT4A 3O5LA 2MNTA 2UZ5A 1NSGA 4TW6A 1J4HA 4G50A 2Y78A 3G6LA 4NZCA 4DRQA 4QT3A 4P8XA 2WLZA 1NMVA 4L3NA 3KAIA 4ZS6A 1ROUA 2KGJA 3O5FA 1U79A 4WJXA 1FAPA 3GPKA 4HARA 1E6ZA 3OA5A 2IF4A 3O5OA 1FKBA 2PPOA 4DRJA 1JCHB 2MF9A 2DSUA 4IPXA 3WL0A 1IX5A 4MAVA 4W9OA 4JFIA 3G6MA 4DRKA 2XPBA 2A3EA 2DSZA 2AWGA 1C9HA 3AS1A 3MDYB 4WKFA 1HKJA 1NMWA 1R9HA 1WNOA 4S3KA 2ESCA 2D9FA 2G41A 4DH0A 1J4IA 4Q22A 1HKKA 1BKFA 1W1VA 1PBKA 2XP9A 3O5GA 2IUZA 1FFRA 1P5QA 3WD3A 5DIVA 1FKTA 4JFLA 4DRNA 4DRPA 1FKHA 3ARTA 3FAPA 1T11A 1KT0A 2K8IA 4JFKA 1TCOC 1NH6A 3PRAA 1W1YA 1HXVA 3KAHA 1E9LA 1X6LA 4HBOA 2MLXA 3O5MA 3KABA 2VCDA 4P8UA 2P4VA 4ODOA 3FY1A 2ZQTA 2XP5A 2F4EA 3PA7A 3I6CA 1WB0A 3CH9A 4G2PA 2M1IA 4L72B 4DWSA 2ZQSA 4N19A 5HW8A 4DWSB 3KAGA 3JXVA 4Z2GA 3NI6A 2B31A 2LGOA 4ODKA 2XP7A 3O5KA 4R0XA 2PBCA 1A7XA 3RMEA 1HJVA 3ALFA 4ODPA 3ARXA 1FKDA 2EULA 5HKGA 4J4OA 1JNEA 1L1PA 3BXWA 2AOSA 2B5UB 3WD0A 4TNSA 5DO2A 3IK8A 1Q6IA 1B6CA 1FKIA 4ZPWR 3O5RA 2DG4A 3O5QA 4P8WA 1W1TA 3WIJA 1ZB5A 1UR9A 1ZL1A 4UDMA 4Z2KA 2DG9A 3IKDA 2ZR4A 3O5IA 1FKRA 1Q6HA 2KFWA 2Q5AA 1F40A 1JNDA 1W9UA 1E6NA 2ZR5A 5DITA 3AS3A 1CTNA 1E6PA 1HKIA 2XPAA 2XP6A 1FD9A 1YATA 1BL4A 2A3CA 4URIA 1N1AA 1OWQA 1Q6UA 4NNRA 4R5EA 1W9VA 1J4RA 3O5DA 4TYOA 3UQBA 2DT1A 2F2DA 4MTVA 5BXJA 4W9PA 4LAXA 1LQ0A 4P8VA 4JYSA 3CHFA 1ZCNA 4ODLA 4BF8A 3JYJA 3EY6A 1D7HA 2WK2A 4LAYA 3AS2A 4KR0B 2PV2A 1H0GA 4MNKA 1EHNA 4MNLA 1M5YA 5GPGA 1X6NA 2RSEA 1ZU8A 1JVWA 1OGBA 2PI6A 4ML4A 4DZ2A 2FKEA 5B8IC 3RGCA 2PN0A 2A3BA 4KQZA 1EYMA 4Z2LA 1LL7A 2KO7A 4WIWA 2VN1A 2PPPA 2A3AA 3CHEA 4DIPA 1GOIA 5GQBA 1ZBWA 2RUQA 4DZ3A 2RQSA 1RD6A 5HW6A 3ARRA 3KACA 1UR8A 3UF8A 4WK9A 3W4RA 2KR7A 1WAWA 2FDMA 3TC5A 5DIUA 1Y0OA 4ZPTR 5HBFA 3EIPA 1LG1A 4QZVB 1YW5A 4DWSC 4JFMA 1JNTA 2KI3A 3UI4A 1ZK6A 4W9QA 3RM8A 1H0IA 1XHGA 4Z2HA 5DF0A 1D7IA 1LL4A 1D6OA 1E44A 1LJYA 2FAPA 4TW7A 1NWRA 5GPRA
chains in the Genus database with same CATH topology
3NRKA 2N87A 3RM4A 1HKMA 2RURA 1E15A 4TX0A 3RM9A 3PRDA 1FKFA 2DT3A 4PTMA 3ARPA 4WKAA 4GGQA 2LKNA 2M2AA 3UQIA 3WD2A 3LUOA 2OLHA 3B8SA 5HWCA 4S3JA 1ROTA 1KFWA 4TW8A 3FXYA 2YBUA 2ITKA 1LG2A 2O9OA 4DRIA 3CHCA 1EDQA 2L2SA 1LL6A 1ITXA 5J6EA 3NTPA 5HW7A 1D7JA 3CHDA 4ODRA 5HT1A 4IQCA 3WH0A 4W5UA 2OFNA 1QPLA 4DWSD 5DEZA 3VAWA 3B9DA 4DT4A 1HJWA 1SR0A 2PV3A 3ARVA 2XP8A 1GPFA 3UQAA 3IHZA 5JH8A 3B9AA 3JYMA 2PV1A 1VF8A 3QOKA 4ODNA 4XAKA 2JZVA 5HUAA 1F8AB 1FFQA 2RUCA 1EIBA 4NSBA 1FKKA 1O6IA 1QZ2A 1W26A 4QT2A 1J6YA 4C02B 4ITZA 3KZ7A 2MLYA 3PR9A 3WQVA 3H9RB 2G8ZA 4U85A 4LAWA 1KT1A 2M08A 4MSPA 3AROA 4ZPVR 3WD1A 1TFVA 4DRMA 1OGGA 4JFJA 5D75A 5HWBA 2DG3A 3B7XA 1JNSA 3OOBA 3KCEA 3ODKA 1FJDA 4DRHA 3UI6A 3B9EA 5I98A 2RUDA 2O92A 3KAFA 3WQWA 4FN2A 4AY1A 2DT2A 2DPEA 1SYTA 3PRBA 1NWUA 3CZ8A 3TCZA 3AQUA 1K9TA 4GIVA 1E6RA 1GUVA 4FAPA 1NWSA 3ARYA 1W9PA 2PPNA 4U84A 3O5PA 1QPFA 2DSWA 2F21A 2WM0A 3ARSA 4IQ2A 1FKSA 2YBTA 2LPVA 2ZQVA 3CGMA 2DSVA 3ARQA 4IT6A 4ODQA 2KE0A 2XP4A 4U86A 3ARWA 1FKGA 3IKGA 3ALGA 2DT0A 3AS0A 1HJXA 1D2KA 2MLZA 4O2TA 4DROA 4Z2IA 2LJ4A 3ARZA 1W1PA 2MPHA 1NWTA 3KADA 1ZBCA 3ARUA 1EQ3A 1FKJA 4Z2JA 4LAVA 2ZR6A 4J4NA 4WKHA 5HTGA 2QF8A 4ODMA 2ZQUA 1PINA 4MGVA 3WD4A 3CGNA 1ZBVA 4Q7NA 3WKZA 4MPKA 3RFWA 3TDBA 3UI5A 3WL1A 1ZBKA 2WLYA 1FKLA 1Q1CA 3O5JA 4MNJA 4HBEA 4QIBA 4LGXA 1XRVA 4MNMA 2XP3A 3O5EA 4IT4A 3O5LA 2MNTA 2UZ5A 1NSGA 4TW6A 1J4HA 4G50A 2Y78A 3G6LA 4NZCA 4DRQA 4QT3A 4P8XA 2WLZA 1NMVA 4L3NA 3KAIA 4ZS6A 1ROUA 2KGJA 3O5FA 1U79A 4WJXA 1FAPA 3GPKA 4HARA 1E6ZA 3OA5A 2IF4A 3O5OA 1FKBA 2PPOA 4DRJA 2MF9A 2DSUA 4IPXA 3WL0A 1IX5A 4MAVA 4W9OA 4JFIA 3G6MA 4DRKA 2XPBA 2A3EA 2DSZA 2AWGA 1C9HA 3AS1A 3MDYB 4WKFA 1HKJA 1NMWA 1R9HA 1WNOA 4S3KA 2ESCA 2D9FA 2G41A 4DH0A 1J4IA 4Q22A 1HKKA 1BKFA 1W1VA 1PBKA 2XP9A 3O5GA 2IUZA 1FFRA 1P5QA 3WD3A 5DIVA 1FKTA 4JFLA 4DRNA 4DRPA 1FKHA 3ARTA 3FAPA 1T11A 1KT0A 2K8IA 4JFKA 1TCOC 1NH6A 3PRAA 1W1YA 1HXVA 3KAHA 1E9LA 1X6LA 4HBOA 2MLXA 3O5MA 3KABA 2VCDA 4P8UA 4ODOA 3FY1A 2ZQTA 2XP5A 2F4EA 3PA7A 3I6CA 1WB0A 3CH9A 4G2PA 2M1IA 4L72B 4DWSA 2ZQSA 4N19A 5HW8A 4DWSB 3KAGA 3JXVA 4Z2GA 3NI6A 2B31A 2LGOA 4ODKA 2XP7A 3O5KA 4R0XA 2PBCA 1A7XA 3RMEA 1HJVA 3ALFA 4ODPA 3ARXA 1FKDA 5HKGA 4J4OA 1JNEA 1L1PA 3BXWA 2AOSA 3WD0A 4TNSA 5DO2A 3IK8A 1Q6IA 1B6CA 1FKIA 4ZPWR 3O5RA 2DG4A 3O5QA 4P8WA 1W1TA 3WIJA 1ZB5A 1UR9A 1ZL1A 4Z2KA 2DG9A 3IKDA 2ZR4A 3O5IA 1FKRA 1Q6HA 2KFWA 2Q5AA 1F40A 1JNDA 1W9UA 1E6NA 2ZR5A 5DITA 3AS3A 1CTNA 1E6PA 1HKIA 2XPAA 2XP6A 1FD9A 1YATA 1BL4A 2A3CA 4URIA 1N1AA 1OWQA 1Q6UA 4NNRA 4R5EA 1W9VA 1J4RA 3O5DA 4TYOA 3UQBA 2DT1A 2F2DA 4MTVA 5BXJA 4W9PA 4LAXA 1LQ0A 4P8VA 4JYSA 3CHFA 1ZCNA 4ODLA 4BF8A 3JYJA 3EY6A 1D7HA 2WK2A 4LAYA 3AS2A 4KR0B 2PV2A 1H0GA 4MNKA 1EHNA 4MNLA 1M5YA 5GPGA 1X6NA 2RSEA 1ZU8A 1JVWA 1OGBA 2PI6A 4ML4A 4DZ2A 2FKEA 5B8IC 3RGCA 2A3BA 4KQZA 1EYMA 4Z2LA 1LL7A 2KO7A 4WIWA 2VN1A 2PPPA 2A3AA 3CHEA 4DIPA 1GOIA 5GQBA 1ZBWA 2RUQA 4DZ3A 2RQSA 1RD6A 5HW6A 3ARRA 3KACA 1UR8A 3UF8A 4WK9A 3W4RA 2KR7A 1WAWA 2FDMA 3TC5A 5DIUA 1Y0OA 4ZPTR 5HBFA 1LG1A 4QZVB 1YW5A 4DWSC 4JFMA 1JNTA 2KI3A 3UI4A 1ZK6A 4W9QA 3RM8A 1H0IA 1XHGA 4Z2HA 5DF0A 1D7IA 1LL4A 1D6OA 1LJYA 2FAPA 4TW7A 1NWRA 5GPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRK A;  2N87 A;  3O5I A;  1Q6H A;  2KFW A;  2Q5A A;  3TCZ A;  1FKR A;  2RUR A;  4W9O A;  1F40 A;  4GIV A;  4JFI A;  4DRK A;  2ZR5 A;  5DIT A;  4TX0 A;  2XPB A;  3PRD A;  1FKF A;  4FAP A;  2XPA A;  2XP6 A;  1FD9 A;  1YAT A;  2PPN A;  1BL4 A;  4GGQ A;  2LKN A;  2M2A A;  1N1A A;  1Q6U A;  4U84 A;  3UQI A;  3LUO A;  4NNR A;  2AWG A;  1C9H A;  1QPF A;  3O5P A;  2F21 A;  3MDY B;  5HWC A;  1NMW A;  1R9H A;  1J4R A;  1FKS A;  2D9F A;  4IQ2 A;  1ROT A;  3O5D A;  4TYO A;  3UQB A;  2LPV A;  4TW8 A;  4DH0 A;  1J4I A;  2F2D A;  2ZQV A;  3CGM A;  5BXJ A;  4W9P A;  3PRB A;  4LAX A;  1BKF A;  2ITK A;  1PBK A;  4JYS A;  2XP9 A;  3O5G A;  4ODQ A;  1ZCN A;  4ODL A;  2KE0 A;  2XP4 A;  4DRI A;  4BF8 A;  4U86 A;  2L2S A;  3JYJ A;  5J6E A;  1P5Q A;  3NTP A;  1FKG A;  3IKG A;  5DIV A;  1FKT A;  3EY6 A;  1D7H A;  4JFL A;  4DRN A;  1D7J A;  4DRP A;  4ODR A;  1FKH A;  4LAY A;  5HT1 A;  3FAP A;  1T11 A;  1KT0 A;  2MLZ A;  2K8I A;  4IQC A;  4JFK A;  1TCO C;  2OFN A;  3WH0 A;  4O2T A;  1QPL A;  1HXV A;  3KAH A;  4DRO A;  2PV2 A;  2LJ4 A;  3VAW A;  4DT4 A;  2MPH A;  2MLX A;  1M5Y A;  3KAD A;  5GPG A;  2PV3 A;  2RSE A;  3O5M A;  1FKJ A;  1JVW A;  4LAV A;  2XP8 A;  2ZR6 A;  3KAB A;  1EQ3 A;  4DZ2 A;  2FKE A;  3IHZ A;  4J4N A;  3UQA A;  5B8I C;  3RGC A;  5HTG A;  4ODM A;  2VCD A;  2ZQU A;  3JYM A;  1PIN A;  2PV1 A;  4MGV A;  1EYM A;  4ODO A;  2KO7 A;  3CGN A;  2VN1 A;  2PPP A;  2ZQT A;  4ODN A;  2XP5 A;  2JZV A;  3RFW A;  5HUA A;  1F8A B;  3TDB A;  4DIP A;  3UI5 A;  2RUC A;  2F4E A;  1FKL A;  1Q1C A;  3PA7 A;  3I6C A;  4G2P A;  3O5J A;  2RUQ A;  2M1I A;  1FKK A;  1QZ2 A;  4DZ3 A;  1W26 A;  2RQS A;  2ZQS A;  4QIB A;  4QT2 A;  1J6Y A;  5HW6 A;  4N19 A;  4C02 B;  2XP3 A;  3O5E A;  5HW8 A;  3KAC A;  2MNT A;  3KAG A;  3KZ7 A;  2MLY A;  2UZ5 A;  3JXV A;  3NI6 A;  3O5L A;  1NSG A;  2LGO A;  4ODK A;  2XP7 A;  3H9R B;  3UF8 A;  3O5K A;  4R0X A;  4TW6 A;  2KR7 A;  1J4H A;  2PBC A;  4G50 A;  1A7X A;  2Y78 A;  4U85 A;  4LAW A;  1KT1 A;  2M08 A;  4ODP A;  3TC5 A;  4MSP A;  5DIU A;  1FKD A;  1Y0O A;  4ITZ A;  5HKG A;  4J4O A;  4DRM A;  4DRQ A;  1L1P A;  4QT3 A;  1YW5 A;  4JFJ A;  4JFM A;  1JNT A;  1NMV A;  2KI3 A;  3UI4 A;  5D75 A;  4TNS A;  5HW7 A;  5HWB A;  3IK8 A;  1Q6I A;  1ZK6 A;  2DG3 A;  3B7X A;  3KAI A;  1JNS A;  1B6C A;  1FKI A;  3OOB A;  1ROU A;  4W9Q A;  3KCE A;  3O5R A;  2KGJ A;  3ODK A;  2DG4 A;  1FJD A;  4DRH A;  3O5F A;  3UI6 A;  1U79 A;  3O5Q A;  5I98 A;  1D7I A;  1FAP A;  2RUD A;  1D6O A;  3GPK A;  3KAF A;  4FN2 A;  2IF4 A;  3O5O A;  1FKB A;  2FAP A;  2PPO A;  4TW7 A;  4DRJ A;  2DG9 A;  3IKD A;  2MF9 A;  2ZR4 A;  4IPX A; 
#chains in the Genus database with same CATH topology
 3NRK A;  3GTY X;  2N87 A;  3RM4 A;  1HKM A;  2RUR A;  1E15 A;  4TX0 A;  3RM9 A;  3PRD A;  1FKF A;  2DT3 A;  4PTM A;  3ARP A;  4WKA A;  4GGQ A;  2LKN A;  2M2A A;  3UQI A;  3WD2 A;  3LUO A;  2OLH A;  3B8S A;  5HWC A;  4S3J A;  1ROT A;  1KFW A;  4TW8 A;  3FXY A;  2YBU A;  2ITK A;  1LG2 A;  2O9O A;  4DRI A;  3CHC A;  1EDQ A;  2L2S A;  1LL6 A;  2ETN A;  1ITX A;  5J6E A;  3NTP A;  5HW7 A;  1D7J A;  3CHD A;  4ODR A;  5HT1 A;  4IQC A;  3WH0 A;  4W5U A;  2OFN A;  1QPL A;  4DWS D;  5DEZ A;  3VAW A;  3B9D A;  4DT4 A;  1HJW A;  1SR0 A;  2PV3 A;  3ARV A;  2XP8 A;  1GPF A;  3UQA A;  3IHZ A;  5JH8 A;  3B9A A;  3GU0 A;  3JYM A;  2PV1 A;  1VF8 A;  3QOK A;  4ODN A;  4XAK A;  2JZV A;  5HUA A;  1F8A B;  1FFQ A;  2RUC A;  1EIB A;  4NSB A;  1FKK A;  1O6I A;  1QZ2 A;  1W26 A;  4QT2 A;  1J6Y A;  4C02 B;  4ITZ A;  3KZ7 A;  2MLY A;  3PR9 A;  3WQV A;  3H9R B;  2F23 A;  2G8Z A;  4U85 A;  4LAW A;  1KT1 A;  2M08 A;  4MSP A;  3ARO A;  4ZPV R;  3WD1 A;  1TFV A;  4DRM A;  1OGG A;  4JFJ A;  5D75 A;  5HWB A;  2DG3 A;  3B7X A;  1JNS A;  3OOB A;  3KCE A;  3ODK A;  1FJD A;  4DRH A;  3UI6 A;  3B9E A;  5I98 A;  2RUD A;  2O92 A;  3KAF A;  3WQW A;  4FN2 A;  4AY1 A;  2DT2 A;  2DPE A;  1SYT A;  3PRB A;  1NWU A;  3CZ8 A;  3TCZ A;  3AQU A;  1K9T A;  1GRJ A;  4GIV A;  1E6R A;  1GUV A;  4FAP A;  1NWS A;  3ARY A;  1W9P A;  2PPN A;  4U84 A;  3O5P A;  1QPF A;  2DSW A;  2F21 A;  2WM0 A;  3ARS A;  4IQ2 A;  1FKS A;  2YBT A;  2LPV A;  2ZQV A;  3CGM A;  2DSV A;  3ARQ A;  4IT6 A;  4ODQ A;  3BMB A;  2KE0 A;  2XP4 A;  4U86 A;  3ARW A;  1FKG A;  3IKG A;  3ALG A;  2DT0 A;  3AS0 A;  1HJX A;  1D2K A;  2MLZ A;  4O2T A;  4DRO A;  4Z2I A;  2LJ4 A;  3ARZ A;  1W1P A;  2MPH A;  1NWT A;  3KAD A;  1ZBC A;  3ARU A;  1EQ3 A;  1FKJ A;  4Z2J A;  4LAV A;  2ZR6 A;  4J4N A;  4WKH A;  5HTG A;  2QF8 A;  4ODM A;  2ZQU A;  1PIN A;  4MGV A;  3WD4 A;  3CGN A;  1ZBV A;  4Q7N A;  3WKZ A;  4MPK A;  3RFW A;  3TDB A;  3UI5 A;  3WL1 A;  1ZBK A;  2WLY A;  1FKL A;  1Q1C A;  3O5J A;  4MNJ A;  4HBE A;  4QIB A;  4LGX A;  1XRV A;  4MNM A;  2XP3 A;  3O5E A;  4IT4 A;  3O5L A;  2MNT A;  2UZ5 A;  1NSG A;  4TW6 A;  1J4H A;  4G50 A;  2Y78 A;  3G6L A;  4NZC A;  4DRQ A;  4QT3 A;  4P8X A;  2WLZ A;  1NMV A;  4L3N A;  3KAI A;  4ZS6 A;  1ROU A;  2KGJ A;  3O5F A;  1U79 A;  4WJX A;  1FAP A;  3GPK A;  4HAR A;  1E6Z A;  3OA5 A;  2IF4 A;  3O5O A;  1FKB A;  2PPO A;  4DRJ A;  1JCH B;  2MF9 A;  2DSU A;  4IPX A;  3WL0 A;  1IX5 A;  4MAV A;  4W9O A;  4JFI A;  3G6M A;  4DRK A;  2XPB A;  2A3E A;  2DSZ A;  2AWG A;  1C9H A;  3AS1 A;  3MDY B;  4WKF A;  1HKJ A;  1NMW A;  1R9H A;  1WNO A;  4S3K A;  2ESC A;  2D9F A;  2G41 A;  4DH0 A;  1J4I A;  4Q22 A;  1HKK A;  1BKF A;  1W1V A;  1PBK A;  2XP9 A;  3O5G A;  2IUZ A;  1FFR A;  1P5Q A;  3WD3 A;  5DIV A;  1FKT A;  4JFL A;  4DRN A;  4DRP A;  1FKH A;  3ART A;  3FAP A;  1T11 A;  1KT0 A;  2K8I A;  4JFK A;  1TCO C;  1NH6 A;  3PRA A;  1W1Y A;  1HXV A;  3KAH A;  1E9L A;  1X6L A;  4HBO A;  2MLX A;  3O5M A;  3KAB A;  2VCD A;  4P8U A;  2P4V A;  4ODO A;  3FY1 A;  2ZQT A;  2XP5 A;  2F4E A;  3PA7 A;  3I6C A;  1WB0 A;  3CH9 A;  4G2P A;  2M1I A;  4L72 B;  4DWS A;  2ZQS A;  4N19 A;  5HW8 A;  4DWS B;  3KAG A;  3JXV A;  4Z2G A;  3NI6 A;  2B31 A;  2LGO A;  4ODK A;  2XP7 A;  3O5K A;  4R0X A;  2PBC A;  1A7X A;  3RME A;  1HJV A;  3ALF A;  4ODP A;  3ARX A;  1FKD A;  2EUL A;  5HKG A;  4J4O A;  1JNE A;  1L1P A;  3BXW A;  2AOS A;  2B5U B;  3WD0 A;  4TNS A;  5DO2 A;  3IK8 A;  1Q6I A;  1B6C A;  1FKI A;  4ZPW R;  3O5R A;  2DG4 A;  3O5Q A;  4P8W A;  1W1T A;  3WIJ A;  1ZB5 A;  1UR9 A;  1ZL1 A;  4UDM A;  4Z2K A;  2DG9 A;  3IKD A;  2ZR4 A;  3O5I A;  1FKR A;  1Q6H A;  2KFW A;  2Q5A A;  1F40 A;  1JND A;  1W9U A;  1E6N A;  2ZR5 A;  5DIT A;  3AS3 A;  1CTN A;  1E6P A;  1HKI A;  2XPA A;  2XP6 A;  1FD9 A;  1YAT A;  1BL4 A;  2A3C A;  4URI A;  1N1A A;  1OWQ A;  1Q6U A;  4NNR A;  4R5E A;  1W9V A;  1J4R A;  3O5D A;  4TYO A;  3UQB A;  2DT1 A;  2F2D A;  4MTV A;  5BXJ A;  4W9P A;  4LAX A;  1LQ0 A;  4P8V A;  4JYS A;  3CHF A;  1ZCN A;  4ODL A;  4BF8 A;  3JYJ A;  3EY6 A;  1D7H A;  2WK2 A;  4LAY A;  3AS2 A;  4KR0 B;  2PV2 A;  1H0G A;  4MNK A;  1EHN A;  4MNL A;  1M5Y A;  5GPG A;  1X6N A;  2RSE A;  1ZU8 A;  1JVW A;  1OGB A;  2PI6 A;  4ML4 A;  4DZ2 A;  2FKE A;  5B8I C;  3RGC A;  2PN0 A;  2A3B A;  4KQZ A;  1EYM A;  4Z2L A;  1LL7 A;  2KO7 A;  4WIW A;  2VN1 A;  2PPP A;  2A3A A;  3CHE A;  4DIP A;  1GOI A;  5GQB A;  1ZBW A;  2RUQ A;  4DZ3 A;  2RQS A;  1RD6 A;  5HW6 A;  3ARR A;  3KAC A;  1UR8 A;  3UF8 A;  4WK9 A;  3W4R A;  2KR7 A;  1WAW A;  2FDM A;  3TC5 A;  5DIU A;  1Y0O A;  4ZPT R;  5HBF A;  3EIP A;  1LG1 A;  4QZV B;  1YW5 A;  4DWS C;  4JFM A;  1JNT A;  2KI3 A;  3UI4 A;  1ZK6 A;  4W9Q A;  3RM8 A;  1H0I A;  1XHG A;  4Z2H A;  5DF0 A;  1D7I A;  1LL4 A;  1D6O A;  1E44 A;  1LJY A;  2FAP A;  4TW7 A;  1NWR A;  5GPR A; 
#chains in the Genus database with same CATH homology
 3NRK A;  2N87 A;  3RM4 A;  1HKM A;  2RUR A;  1E15 A;  4TX0 A;  3RM9 A;  3PRD A;  1FKF A;  2DT3 A;  4PTM A;  3ARP A;  4WKA A;  4GGQ A;  2LKN A;  2M2A A;  3UQI A;  3WD2 A;  3LUO A;  2OLH A;  3B8S A;  5HWC A;  4S3J A;  1ROT A;  1KFW A;  4TW8 A;  3FXY A;  2YBU A;  2ITK A;  1LG2 A;  2O9O A;  4DRI A;  3CHC A;  1EDQ A;  2L2S A;  1LL6 A;  1ITX A;  5J6E A;  3NTP A;  5HW7 A;  1D7J A;  3CHD A;  4ODR A;  5HT1 A;  4IQC A;  3WH0 A;  4W5U A;  2OFN A;  1QPL A;  4DWS D;  5DEZ A;  3VAW A;  3B9D A;  4DT4 A;  1HJW A;  1SR0 A;  2PV3 A;  3ARV A;  2XP8 A;  1GPF A;  3UQA A;  3IHZ A;  5JH8 A;  3B9A A;  3JYM A;  2PV1 A;  1VF8 A;  3QOK A;  4ODN A;  4XAK A;  2JZV A;  5HUA A;  1F8A B;  1FFQ A;  2RUC A;  1EIB A;  4NSB A;  1FKK A;  1O6I A;  1QZ2 A;  1W26 A;  4QT2 A;  1J6Y A;  4C02 B;  4ITZ A;  3KZ7 A;  2MLY A;  3PR9 A;  3WQV A;  3H9R B;  2G8Z A;  4U85 A;  4LAW A;  1KT1 A;  2M08 A;  4MSP A;  3ARO A;  4ZPV R;  3WD1 A;  1TFV A;  4DRM A;  1OGG A;  4JFJ A;  5D75 A;  5HWB A;  2DG3 A;  3B7X A;  1JNS A;  3OOB A;  3KCE A;  3ODK A;  1FJD A;  4DRH A;  3UI6 A;  3B9E A;  5I98 A;  2RUD A;  2O92 A;  3KAF A;  3WQW A;  4FN2 A;  4AY1 A;  2DT2 A;  2DPE A;  1SYT A;  3PRB A;  1NWU A;  3CZ8 A;  3TCZ A;  3AQU A;  1K9T A;  4GIV A;  1E6R A;  1GUV A;  4FAP A;  1NWS A;  3ARY A;  1W9P A;  2PPN A;  4U84 A;  3O5P A;  1QPF A;  2DSW A;  2F21 A;  2WM0 A;  3ARS A;  4IQ2 A;  1FKS A;  2YBT A;  2LPV A;  2ZQV A;  3CGM A;  2DSV A;  3ARQ A;  4IT6 A;  4ODQ A;  2KE0 A;  2XP4 A;  4U86 A;  3ARW A;  1FKG A;  3IKG A;  3ALG A;  2DT0 A;  3AS0 A;  1HJX A;  1D2K A;  2MLZ A;  4O2T A;  4DRO A;  4Z2I A;  2LJ4 A;  3ARZ A;  1W1P A;  2MPH A;  1NWT A;  3KAD A;  1ZBC A;  3ARU A;  1EQ3 A;  1FKJ A;  4Z2J A;  4LAV A;  2ZR6 A;  4J4N A;  4WKH A;  5HTG A;  2QF8 A;  4ODM A;  2ZQU A;  1PIN A;  4MGV A;  3WD4 A;  3CGN A;  1ZBV A;  4Q7N A;  3WKZ A;  4MPK A;  3RFW A;  3TDB A;  3UI5 A;  3WL1 A;  1ZBK A;  2WLY A;  1FKL A;  1Q1C A;  3O5J A;  4MNJ A;  4HBE A;  4QIB A;  4LGX A;  1XRV A;  4MNM A;  2XP3 A;  3O5E A;  4IT4 A;  3O5L A;  2MNT A;  2UZ5 A;  1NSG A;  4TW6 A;  1J4H A;  4G50 A;  2Y78 A;  3G6L A;  4NZC A;  4DRQ A;  4QT3 A;  4P8X A;  2WLZ A;  1NMV A;  4L3N A;  3KAI A;  4ZS6 A;  1ROU A;  2KGJ A;  3O5F A;  1U79 A;  4WJX A;  1FAP A;  3GPK A;  4HAR A;  1E6Z A;  3OA5 A;  2IF4 A;  3O5O A;  1FKB A;  2PPO A;  4DRJ A;  2MF9 A;  2DSU A;  4IPX A;  3WL0 A;  1IX5 A;  4MAV A;  4W9O A;  4JFI A;  3G6M A;  4DRK A;  2XPB A;  2A3E A;  2DSZ A;  2AWG A;  1C9H A;  3AS1 A;  3MDY B;  4WKF A;  1HKJ A;  1NMW A;  1R9H A;  1WNO A;  4S3K A;  2ESC A;  2D9F A;  2G41 A;  4DH0 A;  1J4I A;  4Q22 A;  1HKK A;  1BKF A;  1W1V A;  1PBK A;  2XP9 A;  3O5G A;  2IUZ A;  1FFR A;  1P5Q A;  3WD3 A;  5DIV A;  1FKT A;  4JFL A;  4DRN A;  4DRP A;  1FKH A;  3ART A;  3FAP A;  1T11 A;  1KT0 A;  2K8I A;  4JFK A;  1TCO C;  1NH6 A;  3PRA A;  1W1Y A;  1HXV A;  3KAH A;  1E9L A;  1X6L A;  4HBO A;  2MLX A;  3O5M A;  3KAB A;  2VCD A;  4P8U A;  4ODO A;  3FY1 A;  2ZQT A;  2XP5 A;  2F4E A;  3PA7 A;  3I6C A;  1WB0 A;  3CH9 A;  4G2P A;  2M1I A;  4L72 B;  4DWS A;  2ZQS A;  4N19 A;  5HW8 A;  4DWS B;  3KAG A;  3JXV A;  4Z2G A;  3NI6 A;  2B31 A;  2LGO A;  4ODK A;  2XP7 A;  3O5K A;  4R0X A;  2PBC A;  1A7X A;  3RME A;  1HJV A;  3ALF A;  4ODP A;  3ARX A;  1FKD A;  5HKG A;  4J4O A;  1JNE A;  1L1P A;  3BXW A;  2AOS A;  3WD0 A;  4TNS A;  5DO2 A;  3IK8 A;  1Q6I A;  1B6C A;  1FKI A;  4ZPW R;  3O5R A;  2DG4 A;  3O5Q A;  4P8W A;  1W1T A;  3WIJ A;  1ZB5 A;  1UR9 A;  1ZL1 A;  4Z2K A;  2DG9 A;  3IKD A;  2ZR4 A;  3O5I A;  1FKR A;  1Q6H A;  2KFW A;  2Q5A A;  1F40 A;  1JND A;  1W9U A;  1E6N A;  2ZR5 A;  5DIT A;  3AS3 A;  1CTN A;  1E6P A;  1HKI A;  2XPA A;  2XP6 A;  1FD9 A;  1YAT A;  1BL4 A;  2A3C A;  4URI A;  1N1A A;  1OWQ A;  1Q6U A;  4NNR A;  4R5E A;  1W9V A;  1J4R A;  3O5D A;  4TYO A;  3UQB A;  2DT1 A;  2F2D A;  4MTV A;  5BXJ A;  4W9P A;  4LAX A;  1LQ0 A;  4P8V A;  4JYS A;  3CHF A;  1ZCN A;  4ODL A;  4BF8 A;  3JYJ A;  3EY6 A;  1D7H A;  2WK2 A;  4LAY A;  3AS2 A;  4KR0 B;  2PV2 A;  1H0G A;  4MNK A;  1EHN A;  4MNL A;  1M5Y A;  5GPG A;  1X6N A;  2RSE A;  1ZU8 A;  1JVW A;  1OGB A;  2PI6 A;  4ML4 A;  4DZ2 A;  2FKE A;  5B8I C;  3RGC A;  2A3B A;  4KQZ A;  1EYM A;  4Z2L A;  1LL7 A;  2KO7 A;  4WIW A;  2VN1 A;  2PPP A;  2A3A A;  3CHE A;  4DIP A;  1GOI A;  5GQB A;  1ZBW A;  2RUQ A;  4DZ3 A;  2RQS A;  1RD6 A;  5HW6 A;  3ARR A;  3KAC A;  1UR8 A;  3UF8 A;  4WK9 A;  3W4R A;  2KR7 A;  1WAW A;  2FDM A;  3TC5 A;  5DIU A;  1Y0O A;  4ZPT R;  5HBF A;  1LG1 A;  4QZV B;  1YW5 A;  4DWS C;  4JFM A;  1JNT A;  2KI3 A;  3UI4 A;  1ZK6 A;  4W9Q A;  3RM8 A;  1H0I A;  1XHG A;  4Z2H A;  5DF0 A;  1D7I A;  1LL4 A;  1D6O A;  1LJY A;  2FAP A;  4TW7 A;  1NWR A;  5GPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...