1FJDA

Human parvulin-like peptidyl prolyl cis/trans isomerase, hpar14
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
104
structure length
104
Chain Sequence
GSGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the human parvulin-like peptidyl prolyl cis/trans isomerase, hPar14.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL PROLYL CIS/TRANS ISOMERASE (PPIASE)
total genus 12
structure length 104
sequence length 104
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fjdA00
5DITA 2RUCA 2XPBA 3PRDA 2RQSA 5DIUA 4TW6A 2MLYA 4G50A 3RFWA 3UI4A 4DRMA 4TNSA 2UZ5A 1P5QA 3O5KA 5D75A 2RURA 1JNTA 5BXJA 5HW7A 1FAPA 3KCEA 3IKDA 3O5RA 4JFMA 2KO7A 3RGCA 1A7XA 5GPGA 5B8IC 5I98A 3TDBA 1FKSA 5HTGA 1FKBA 4JFJA 2M08A 4ODMA 1R9HA 2ZQVA 4IQ2A 1KT0A 1ROTA 5HKGA 1Q6HA 4LAXA 1B6CA 3O5GA 3O5EA 2FAPA 2MNTA 4ODRA 1L1PA 4N19A 1FKTA 2MLXA 3KACA 2RUDA 2XP8A 3JXVA 3JYMA 2ZQUA 4QT3A 2RUQA 2XP6A 1C9HA 3KAGA 4ODPA 2F4EA 3UF8A 5HWBA 1TCOC 2D9FA 4FN2A 4DRHA 1FKRA 1NMVA 2Q5AA 3CGMA 4W9OA 3KABA 4GGQA 4LAWA 3I6CA 4W9QA 4J4NA 5HT1A 4DRKA 2XP9A 4ODNA 1QZ2A 2RSEA 2DG3A 2L2SA 5J6EA 3UQBA 4DRNA 1F8AB 2PPPA 2VN1A 3EY6A 3IHZA 3NRKA 4MSPA 4U86A 1EQ3A 4O2TA 2PV2A 3B7XA 2F21A 4JFLA 3O5JA 3TC5A 4ODKA 4JFIA 2LPVA 4TW7A 1FKFA 2LJ4A 4NNRA 1J4IA 4FAPA 3OOBA 2MLZA 1Q6UA 1NMWA 3O5QA 2FKEA 4DIPA 1BL4A 2ZR5A 5HW8A 1ROUA 1ZCNA 1FKGA 2ZQTA 1ZK6A 2XP4A 3KAFA 4DRJA 1J6YA 1NSGA 2PV1A 3PA7A 1Y0OA 2KGJA 2PV3A 1FKHA 2ZQSA 3WH0A 3GPKA 2PPNA 4MGVA 2ZR4A 3KAIA 4TYOA 1W26A 2F2DA 1PINA 3PRBA 3MDYB 4G2PA 1HXVA 3IKGA 3NTPA 1Q1CA 3O5PA 2XP7A 3O5FA 1J4RA 4DROA 1FJDA 2OFNA 3O5LA 2M1IA 2K8IA 2XPAA 3KADA 4ODLA 1BKFA 1D7IA 2KE0A 2VCDA 4DRPA 5HWCA 1JVWA 1PBKA 2KFWA 1FKDA 1F40A 2IF4A 2XP5A 4DRIA 4J4OA 4C02B 4DH0A 3O5IA 2PPOA 1FKIA 1U79A 3ODKA 2ZR6A 1QPFA 1YATA 2PBCA 4JFKA 4LAYA 3UQIA 5HUAA 4R0XA 2XP3A 4JYSA 2DG9A 3JYJA 1FKLA 2KR7A 1KT1A 2ITKA 1T11A 3CGNA 5HW6A 1M5YA 2DG4A 4QIBA 3TCZA 1D7HA 1QPLA 3KZ7A 1JNSA 1D7JA 1FD9A 1D6OA 1N1AA 4U85A 3O5DA 4W9PA 2MF9A 2LKNA 4TW8A 2Y78A 2JZVA 3FAPA 1FKKA 3KAHA 4LAVA 5DIVA 4QT2A 4DZ2A 3UI5A 2N87A 4U84A 2LGOA 1EYMA 2MPHA 4GIVA 4ITZA 4ODQA 4ODOA 2KI3A 1YW5A 2M2AA 3IK8A 1Q6IA 3UQAA 4DZ3A 3O5MA 3LUOA 3O5OA 3H9RB 4BF8A 4TX0A 2AWGA 1FKJA 4IQCA 3VAWA 3NI6A 1J4HA 3UI6A 4DRQA 4IPXA 4DT4A
chains in the Genus database with same CATH superfamily
1OGGA 2AOSA 3CHCA 5D75A 2DPEA 3WD2A 1RD6A 1A7XA 5GPGA 1CTNA 1Q6HA 1B6CA 3O5GA 5HBFA 2F23A 2MNTA 4ODRA 1L1PA 4N19A 3KACA 2XP8A 1TFVA 3ARVA 4KR0B 3KAGA 4ODPA 2F4EA 1TCOC 1HJXA 2D9FA 4DRHA 4LAWA 4W9QA 3CH9A 3WQWA 2XP9A 5GPRA 4Z2IA 2RSEA 1F8AB 3IHZA 3NRKA 4U86A 4UDMA 2PV2A 3B7XA 2F21A 3O5JA 1O6IA 1NH6A 2LJ4A 1IX5A 3OOBA 1Q6UA 1NMWA 2FKEA 5GQBA 2B31A 2ZQTA 1ZCNA 1FKGA 1ZBCA 1HJVA 3KAFA 1NSGA 2OLHA 4L3NA 1FKHA 2ZQSA 3GPKA 3WD4A 4MGVA 3KAIA 3MDYB 3O5FA 1E6NA 2M1IA 3KADA 4L72B 3WQVA 4DRPA 1JVWA 2KFWA 3BMBA 2IF4A 2XP5A 3GU0A 1LG1A 1ZB5A 1GUVA 4KQZA 3BXWA 1QPFA 2PBCA 4LAYA 3UQIA 3ARTA 4NSBA 3ALGA 1D7JA 1D6OA 1W9PA 4U85A 4W9PA 3WKZA 2MF9A 1FKKA 3PR9A 4P8XA 3AS3A 3B9DA 3WIJA 1OGBA 4ITZA 4ODOA 4P8WA 3UQAA 4WIWA 1E6ZA 4BF8A 2AWGA 1J4HA 1EHNA 5DITA 2RUCA 4AY1A 3GTYX 2MLYA 3RFWA 2UZ5A 2DT1A 4Z2HA 4Q22A 3O5RA 3RGCA 4IQ2A 3B9AA 1ROTA 1EDQA 5HKGA 4ZS6A 5DEZA 4LAXA 4WKFA 4Q7NA 3CHEA 1FKTA 2MLXA 3JXVA 2RUDA 4IT6A 2XP6A 1C9HA 4LGXA 1E44A 1HJWA 4QZVB 4FN2A 1NWTA 2Q5AA 3OA5A 1NWRA 4W9OA 1E9LA 1W9UA 3WL1A 1EQ3A 4MTVA 3EY6A 4O2TA 3TC5A 4JFLA 3FY1A 2LPVA 3G6LA 1FKFA 1J4IA 4Z2KA 2EULA 4FAPA 2MLZA 3O5QA 4ZPWR 2ZR5A 4XAKA 5HW8A 1ZK6A 4WK9A 4HBEA 4WKHA 4TYOA 2F2DA 3ARZA 4MAVA 3NTPA 3RMEA 2XP7A 3WD3A 1H0GA 1D7IA 5HWCA 2KE0A 1HKJA 4MNMA 1FKDA 4DRIA 4J4OA 4C02B 3B8SA 4S3KA 1U79A 4JFKA 2DG9A 3JYJA 4W5UA 2KR7A 3CGNA 1M5YA 1D7HA 3ARUA 1JNSA 1FD9A 1N1AA 3CHFA 1ZBVA 1D2KA 4ML4A 4WKAA 2N87A 1EIBA 4ODQA 3RM8A 3ARRA 3IK8A 3O5MA 4Z2GA 4WJXA 3H9RB 2DT3A 4TX0A 4P8UA 1ITXA 4IQCA 2ETNA 1W1VA 3NI6A 4DRQA 4IPXA 3PRDA 2RQSA 2P4VA 4TW6A 5DF0A 4G50A 3ARYA 3UI4A 4TNSA 1P5QA 3O5KA 5HW7A 1JNTA 5BXJA 1FAPA 3EIPA 1HKMA 1UR8A 3IKDA 2KO7A 1SR0A 5B8IC 3TDBA 5HTGA 1FKBA 1R9HA 5JH8A 2ZQVA 2YBUA 2WLYA 1W1PA 3JYMA 2ZQUA 2RUQA 4HARA 3UF8A 1XRVA 5HWBA 1W9VA 3CGMA 4MNKA 5HT1A 1QZ2A 2DG3A 3W4RA 1X6LA 2YBTA 3UQBA 2VN1A 4MSPA 1ZBWA 2A3BA 3WL0A 1NWSA 4NNRA 4DWSC 1LL7A 3AQUA 1GOIA 4DRJA 2DT2A 2PV1A 1J6YA 3PA7A 1Y0OA 2KGJA 4ZPTR 1LL6A 2PPNA 2ZR4A 1WAWA 2WLZA 1JCHB 1PINA 2ESCA 4G2PA 4NZCA 1HXVA 3IKGA 2PN0A 1OWQA 3O5PA 4DROA 2OFNA 3O5LA 1FFQA 3B9EA 2K8IA 2XPAA 3AROA 4ODLA 1LG2A 4MPKA 2DSZA 4DH0A 3O5IA 2PPOA 3ODKA 1YATA 2XP3A 4JYSA 2WK2A 1T11A 4DWSB 2DG4A 1KFWA 1QPLA 2O92A 3KZ7A 1W1TA 2LKNA 4TW8A 2Y78A 2JZVA 3FAPA 3KAHA 4DZ2A 3ARXA 1E6PA 1K9TA 1EYMA 4GIVA 2KI3A 3AS1A 3O5OA 3ARWA 4Z2JA 2DT0A 1GPFA 3UI6A 3ARSA 4MNJA 4MNLA 2XPBA 5DIUA 1JNDA 1E6RA 4IT4A 2B5UB 2G8ZA 4DRMA 2RURA 3KCEA 4JFMA 3FXYA 3RM9A 5I98A 1FKSA 4JFJA 2M08A 4ODMA 1KT0A 1NWUA 3AS2A 3O5EA 1H0IA 2FAPA 4DWSD 3WD0A 1E15A 3ARQA 4S3JA 1WNOA 4QT3A 2IUZA 4PTMA 3PRAA 1FKRA 1NMVA 3G6MA 3KABA 4GGQA 3I6CA 2DSWA 4J4NA 4DRKA 4ODNA 3RM4A 2DSUA 2L2SA 4DRNA 2PPPA 4ZPVR 1ZBKA 3ARPA 5DO2A 3AS0A 4ODKA 4JFIA 4TW7A 2A3CA 1HKIA 1LQ0A 4DWSA 4DIPA 1BL4A 1ROUA 2A3AA 2A3EA 2O9OA 2XP4A 4Z2LA 1ZU8A 1FFRA 2PV3A 3WH0A 1W1YA 1W26A 3PRBA 2QF8A 1Q1CA 1FJDA 1J4RA 1VF8A 1WB0A 1ZL1A 1LL4A 1BKFA 2VCDA 2FDMA 2DSVA 3CHDA 1PBKA 1F40A 3ALFA 1FKIA 2WM0A 1LJYA 2ZR6A 5HUAA 4R0XA 1SYTA 1FKLA 4P8VA 1KT1A 2ITKA 5HW6A 4QIBA 3TCZA 1XHGA 3O5DA 1UR9A 4LAVA 5DIVA 4QT2A 2G41A 1JNEA 3UI5A 4R5EA 4HBOA 3WD1A 1HKKA 4U84A 2LGOA 2MPHA 3QOKA 2PI6A 1YW5A 1GRJA 2M2AA 4URIA 1Q6IA 4DZ3A 3LUOA 1FKJA 3VAWA 3CZ8A 5J6EA 1X6NA 4DT4A
chains in the Genus database with same CATH topology
1OGGA 2AOSA 3CHCA 5D75A 2DPEA 3WD2A 1RD6A 1A7XA 5GPGA 1CTNA 1Q6HA 1B6CA 3O5GA 5HBFA 2MNTA 4ODRA 1L1PA 4N19A 3KACA 2XP8A 1TFVA 3ARVA 4KR0B 3KAGA 4ODPA 2F4EA 1TCOC 1HJXA 2D9FA 4DRHA 4LAWA 4W9QA 3CH9A 3WQWA 2XP9A 5GPRA 4Z2IA 2RSEA 1F8AB 3IHZA 3NRKA 4U86A 2PV2A 3B7XA 2F21A 3O5JA 1O6IA 1NH6A 2LJ4A 1IX5A 3OOBA 1Q6UA 1NMWA 2FKEA 5GQBA 2B31A 2ZQTA 1ZCNA 1FKGA 1ZBCA 1HJVA 3KAFA 1NSGA 2OLHA 4L3NA 1FKHA 2ZQSA 3GPKA 3WD4A 4MGVA 3KAIA 3MDYB 3O5FA 1E6NA 2M1IA 3KADA 4L72B 3WQVA 4DRPA 1JVWA 2KFWA 2IF4A 2XP5A 4KQZA 1LG1A 1ZB5A 1GUVA 3BXWA 1QPFA 2PBCA 4LAYA 3UQIA 3ARTA 4NSBA 3ALGA 1D7JA 1D6OA 1W9PA 4U85A 4W9PA 3WKZA 2MF9A 1FKKA 3PR9A 4P8XA 3AS3A 3B9DA 3WIJA 1OGBA 4ITZA 4ODOA 4P8WA 3UQAA 4WIWA 1E6ZA 4BF8A 2AWGA 1J4HA 1EHNA 5DITA 2RUCA 4AY1A 2MLYA 3RFWA 2UZ5A 2DT1A 4Z2HA 4Q22A 3O5RA 3RGCA 4IQ2A 3B9AA 1ROTA 1EDQA 5HKGA 4ZS6A 5DEZA 4LAXA 4WKFA 4Q7NA 3CHEA 1FKTA 2MLXA 3JXVA 2RUDA 4IT6A 2XP6A 1C9HA 4LGXA 1HJWA 4QZVB 4FN2A 1NWTA 2Q5AA 3OA5A 1NWRA 4W9OA 1E9LA 1W9UA 3WL1A 1EQ3A 4MTVA 3EY6A 4O2TA 3TC5A 4JFLA 3FY1A 2LPVA 3G6LA 1FKFA 1J4IA 4Z2KA 4FAPA 2MLZA 3O5QA 4ZPWR 2ZR5A 4XAKA 5HW8A 1ZK6A 4WK9A 4HBEA 4WKHA 4TYOA 2F2DA 3ARZA 4MAVA 3NTPA 3RMEA 2XP7A 3WD3A 1H0GA 1D7IA 5HWCA 2KE0A 1HKJA 4MNMA 1FKDA 4DRIA 4J4OA 4C02B 3B8SA 4S3KA 1U79A 4JFKA 2DG9A 3JYJA 4W5UA 2KR7A 3CGNA 1M5YA 1D7HA 3ARUA 1JNSA 1FD9A 1N1AA 3CHFA 1ZBVA 1D2KA 4ML4A 4WKAA 2N87A 1EIBA 4ODQA 3RM8A 3ARRA 3IK8A 3O5MA 4Z2GA 4WJXA 3H9RB 2DT3A 4TX0A 4P8UA 1ITXA 4IQCA 1W1VA 3NI6A 4DRQA 4IPXA 3PRDA 2RQSA 4TW6A 5DF0A 4G50A 3ARYA 3UI4A 4TNSA 1P5QA 3O5KA 5HW7A 1JNTA 5BXJA 1FAPA 1HKMA 1UR8A 3IKDA 2KO7A 1SR0A 5B8IC 3TDBA 5HTGA 1FKBA 1R9HA 5JH8A 2ZQVA 2YBUA 2WLYA 1W1PA 3JYMA 2ZQUA 2RUQA 4HARA 3UF8A 1XRVA 5HWBA 1W9VA 3CGMA 4MNKA 5HT1A 1QZ2A 2DG3A 3W4RA 1X6LA 2YBTA 3UQBA 2VN1A 4MSPA 1ZBWA 2A3BA 3WL0A 1NWSA 4NNRA 4DWSC 1LL7A 3AQUA 1GOIA 4DRJA 2DT2A 2PV1A 1J6YA 3PA7A 1Y0OA 2KGJA 4ZPTR 1LL6A 2PPNA 2ZR4A 1WAWA 2WLZA 1PINA 2ESCA 4G2PA 4NZCA 1HXVA 3IKGA 1OWQA 3O5PA 4DROA 2OFNA 3O5LA 1FFQA 3B9EA 2K8IA 2XPAA 3AROA 4ODLA 1LG2A 4MPKA 2DSZA 4DH0A 3O5IA 2PPOA 3ODKA 1YATA 2XP3A 4JYSA 2WK2A 1T11A 4DWSB 2DG4A 1KFWA 1QPLA 2O92A 3KZ7A 1W1TA 2LKNA 4TW8A 2Y78A 2JZVA 3FAPA 3KAHA 4DZ2A 3ARXA 1E6PA 1K9TA 1EYMA 4GIVA 2KI3A 3AS1A 3O5OA 3ARWA 4Z2JA 2DT0A 1GPFA 3UI6A 3ARSA 4MNJA 4MNLA 2XPBA 5DIUA 1JNDA 1E6RA 4IT4A 2G8ZA 4DRMA 2RURA 3KCEA 4JFMA 3FXYA 3RM9A 5I98A 1FKSA 4JFJA 2M08A 4ODMA 1KT0A 1NWUA 3AS2A 3O5EA 1H0IA 2FAPA 4DWSD 3WD0A 1E15A 3ARQA 4S3JA 1WNOA 4QT3A 2IUZA 4PTMA 3PRAA 1FKRA 1NMVA 3G6MA 3KABA 4GGQA 3I6CA 2DSWA 4J4NA 4DRKA 4ODNA 3RM4A 2DSUA 2L2SA 4DRNA 2PPPA 4ZPVR 1ZBKA 3ARPA 5DO2A 3AS0A 4ODKA 4JFIA 4TW7A 2A3CA 1HKIA 1LQ0A 4DWSA 4DIPA 1BL4A 1ROUA 2A3AA 2A3EA 2O9OA 2XP4A 4Z2LA 1ZU8A 1FFRA 2PV3A 3WH0A 1W1YA 1W26A 3PRBA 2QF8A 1Q1CA 1FJDA 1J4RA 1VF8A 1WB0A 1ZL1A 1LL4A 1BKFA 2VCDA 2FDMA 2DSVA 3CHDA 1PBKA 1F40A 3ALFA 1FKIA 2WM0A 1LJYA 2ZR6A 5HUAA 4R0XA 1SYTA 1FKLA 4P8VA 1KT1A 2ITKA 5HW6A 4QIBA 3TCZA 1XHGA 3O5DA 1UR9A 4LAVA 5DIVA 4QT2A 2G41A 1JNEA 3UI5A 4R5EA 4HBOA 3WD1A 1HKKA 4U84A 2LGOA 2MPHA 3QOKA 2PI6A 1YW5A 2M2AA 4URIA 1Q6IA 4DZ3A 3LUOA 1FKJA 3VAWA 3CZ8A 5J6EA 1X6NA 4DT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIT A;  2RUC A;  2XPB A;  3PRD A;  2RQS A;  5DIU A;  4TW6 A;  2MLY A;  4G50 A;  3RFW A;  3UI4 A;  4DRM A;  4TNS A;  2UZ5 A;  1P5Q A;  3O5K A;  5D75 A;  2RUR A;  1JNT A;  5BXJ A;  5HW7 A;  1FAP A;  3KCE A;  3IKD A;  3O5R A;  4JFM A;  2KO7 A;  3RGC A;  1A7X A;  5GPG A;  5B8I C;  5I98 A;  3TDB A;  1FKS A;  5HTG A;  1FKB A;  4JFJ A;  2M08 A;  4ODM A;  1R9H A;  2ZQV A;  4IQ2 A;  1KT0 A;  1ROT A;  5HKG A;  1Q6H A;  4LAX A;  1B6C A;  3O5G A;  3O5E A;  2FAP A;  2MNT A;  4ODR A;  1L1P A;  4N19 A;  1FKT A;  2MLX A;  3KAC A;  2RUD A;  2XP8 A;  3JXV A;  3JYM A;  2ZQU A;  4QT3 A;  2RUQ A;  2XP6 A;  1C9H A;  3KAG A;  4ODP A;  2F4E A;  3UF8 A;  5HWB A;  1TCO C;  2D9F A;  4FN2 A;  4DRH A;  1FKR A;  1NMV A;  2Q5A A;  3CGM A;  4W9O A;  3KAB A;  4GGQ A;  4LAW A;  3I6C A;  4W9Q A;  4J4N A;  5HT1 A;  4DRK A;  2XP9 A;  4ODN A;  1QZ2 A;  2RSE A;  2DG3 A;  2L2S A;  5J6E A;  3UQB A;  4DRN A;  1F8A B;  2PPP A;  2VN1 A;  3EY6 A;  3IHZ A;  3NRK A;  4MSP A;  4U86 A;  1EQ3 A;  4O2T A;  2PV2 A;  3B7X A;  2F21 A;  4JFL A;  3O5J A;  3TC5 A;  4ODK A;  4JFI A;  2LPV A;  4TW7 A;  1FKF A;  2LJ4 A;  4NNR A;  1J4I A;  4FAP A;  3OOB A;  2MLZ A;  1Q6U A;  1NMW A;  3O5Q A;  2FKE A;  4DIP A;  1BL4 A;  2ZR5 A;  5HW8 A;  1ROU A;  1ZCN A;  1FKG A;  2ZQT A;  1ZK6 A;  2XP4 A;  3KAF A;  4DRJ A;  1J6Y A;  1NSG A;  2PV1 A;  3PA7 A;  1Y0O A;  2KGJ A;  2PV3 A;  1FKH A;  2ZQS A;  3WH0 A;  3GPK A;  2PPN A;  4MGV A;  2ZR4 A;  3KAI A;  4TYO A;  1W26 A;  2F2D A;  1PIN A;  3PRB A;  3MDY B;  4G2P A;  1HXV A;  3IKG A;  3NTP A;  1Q1C A;  3O5P A;  2XP7 A;  3O5F A;  1J4R A;  4DRO A;  1FJD A;  2OFN A;  3O5L A;  2M1I A;  2K8I A;  2XPA A;  3KAD A;  4ODL A;  1BKF A;  1D7I A;  2KE0 A;  2VCD A;  4DRP A;  5HWC A;  1JVW A;  1PBK A;  2KFW A;  1FKD A;  1F40 A;  2IF4 A;  2XP5 A;  4DRI A;  4J4O A;  4C02 B;  4DH0 A;  3O5I A;  2PPO A;  1FKI A;  1U79 A;  3ODK A;  2ZR6 A;  1QPF A;  1YAT A;  2PBC A;  4JFK A;  4LAY A;  3UQI A;  5HUA A;  4R0X A;  2XP3 A;  4JYS A;  2DG9 A;  3JYJ A;  1FKL A;  2KR7 A;  1KT1 A;  2ITK A;  1T11 A;  3CGN A;  5HW6 A;  1M5Y A;  2DG4 A;  4QIB A;  3TCZ A;  1D7H A;  1QPL A;  3KZ7 A;  1JNS A;  1D7J A;  1FD9 A;  1D6O A;  1N1A A;  4U85 A;  3O5D A;  4W9P A;  2MF9 A;  2LKN A;  4TW8 A;  2Y78 A;  2JZV A;  3FAP A;  1FKK A;  3KAH A;  4LAV A;  5DIV A;  4QT2 A;  4DZ2 A;  3UI5 A;  2N87 A;  4U84 A;  2LGO A;  1EYM A;  2MPH A;  4GIV A;  4ITZ A;  4ODQ A;  4ODO A;  2KI3 A;  1YW5 A;  2M2A A;  3IK8 A;  1Q6I A;  3UQA A;  4DZ3 A;  3O5M A;  3LUO A;  3O5O A;  3H9R B;  4BF8 A;  4TX0 A;  2AWG A;  1FKJ A;  4IQC A;  3VAW A;  3NI6 A;  1J4H A;  3UI6 A;  4DRQ A;  4IPX A;  4DT4 A; 
#chains in the Genus database with same CATH topology
 1OGG A;  2AOS A;  3CHC A;  5D75 A;  2DPE A;  3WD2 A;  1RD6 A;  1A7X A;  5GPG A;  1CTN A;  1Q6H A;  1B6C A;  3O5G A;  5HBF A;  2F23 A;  2MNT A;  4ODR A;  1L1P A;  4N19 A;  3KAC A;  2XP8 A;  1TFV A;  3ARV A;  4KR0 B;  3KAG A;  4ODP A;  2F4E A;  1TCO C;  1HJX A;  2D9F A;  4DRH A;  4LAW A;  4W9Q A;  3CH9 A;  3WQW A;  2XP9 A;  5GPR A;  4Z2I A;  2RSE A;  1F8A B;  3IHZ A;  3NRK A;  4U86 A;  4UDM A;  2PV2 A;  3B7X A;  2F21 A;  3O5J A;  1O6I A;  1NH6 A;  2LJ4 A;  1IX5 A;  3OOB A;  1Q6U A;  1NMW A;  2FKE A;  5GQB A;  2B31 A;  2ZQT A;  1ZCN A;  1FKG A;  1ZBC A;  1HJV A;  3KAF A;  1NSG A;  2OLH A;  4L3N A;  1FKH A;  2ZQS A;  3GPK A;  3WD4 A;  4MGV A;  3KAI A;  3MDY B;  3O5F A;  1E6N A;  2M1I A;  3KAD A;  4L72 B;  3WQV A;  4DRP A;  1JVW A;  2KFW A;  3BMB A;  2IF4 A;  2XP5 A;  3GU0 A;  1LG1 A;  1ZB5 A;  1GUV A;  4KQZ A;  3BXW A;  1QPF A;  2PBC A;  4LAY A;  3UQI A;  3ART A;  4NSB A;  3ALG A;  1D7J A;  1D6O A;  1W9P A;  4U85 A;  4W9P A;  3WKZ A;  2MF9 A;  1FKK A;  3PR9 A;  4P8X A;  3AS3 A;  3B9D A;  3WIJ A;  1OGB A;  4ITZ A;  4ODO A;  4P8W A;  3UQA A;  4WIW A;  1E6Z A;  4BF8 A;  2AWG A;  1J4H A;  1EHN A;  5DIT A;  2RUC A;  4AY1 A;  3GTY X;  2MLY A;  3RFW A;  2UZ5 A;  2DT1 A;  4Z2H A;  4Q22 A;  3O5R A;  3RGC A;  4IQ2 A;  3B9A A;  1ROT A;  1EDQ A;  5HKG A;  4ZS6 A;  5DEZ A;  4LAX A;  4WKF A;  4Q7N A;  3CHE A;  1FKT A;  2MLX A;  3JXV A;  2RUD A;  4IT6 A;  2XP6 A;  1C9H A;  4LGX A;  1E44 A;  1HJW A;  4QZV B;  4FN2 A;  1NWT A;  2Q5A A;  3OA5 A;  1NWR A;  4W9O A;  1E9L A;  1W9U A;  3WL1 A;  1EQ3 A;  4MTV A;  3EY6 A;  4O2T A;  3TC5 A;  4JFL A;  3FY1 A;  2LPV A;  3G6L A;  1FKF A;  1J4I A;  4Z2K A;  2EUL A;  4FAP A;  2MLZ A;  3O5Q A;  4ZPW R;  2ZR5 A;  4XAK A;  5HW8 A;  1ZK6 A;  4WK9 A;  4HBE A;  4WKH A;  4TYO A;  2F2D A;  3ARZ A;  4MAV A;  3NTP A;  3RME A;  2XP7 A;  3WD3 A;  1H0G A;  1D7I A;  5HWC A;  2KE0 A;  1HKJ A;  4MNM A;  1FKD A;  4DRI A;  4J4O A;  4C02 B;  3B8S A;  4S3K A;  1U79 A;  4JFK A;  2DG9 A;  3JYJ A;  4W5U A;  2KR7 A;  3CGN A;  1M5Y A;  1D7H A;  3ARU A;  1JNS A;  1FD9 A;  1N1A A;  3CHF A;  1ZBV A;  1D2K A;  4ML4 A;  4WKA A;  2N87 A;  1EIB A;  4ODQ A;  3RM8 A;  3ARR A;  3IK8 A;  3O5M A;  4Z2G A;  4WJX A;  3H9R B;  2DT3 A;  4TX0 A;  4P8U A;  1ITX A;  4IQC A;  2ETN A;  1W1V A;  3NI6 A;  4DRQ A;  4IPX A;  3PRD A;  2RQS A;  2P4V A;  4TW6 A;  5DF0 A;  4G50 A;  3ARY A;  3UI4 A;  4TNS A;  1P5Q A;  3O5K A;  5HW7 A;  1JNT A;  5BXJ A;  1FAP A;  3EIP A;  1HKM A;  1UR8 A;  3IKD A;  2KO7 A;  1SR0 A;  5B8I C;  3TDB A;  5HTG A;  1FKB A;  1R9H A;  5JH8 A;  2ZQV A;  2YBU A;  2WLY A;  1W1P A;  3JYM A;  2ZQU A;  2RUQ A;  4HAR A;  3UF8 A;  1XRV A;  5HWB A;  1W9V A;  3CGM A;  4MNK A;  5HT1 A;  1QZ2 A;  2DG3 A;  3W4R A;  1X6L A;  2YBT A;  3UQB A;  2VN1 A;  4MSP A;  1ZBW A;  2A3B A;  3WL0 A;  1NWS A;  4NNR A;  4DWS C;  1LL7 A;  3AQU A;  1GOI A;  4DRJ A;  2DT2 A;  2PV1 A;  1J6Y A;  3PA7 A;  1Y0O A;  2KGJ A;  4ZPT R;  1LL6 A;  2PPN A;  2ZR4 A;  1WAW A;  2WLZ A;  1JCH B;  1PIN A;  2ESC A;  4G2P A;  4NZC A;  1HXV A;  3IKG A;  2PN0 A;  1OWQ A;  3O5P A;  4DRO A;  2OFN A;  3O5L A;  1FFQ A;  3B9E A;  2K8I A;  2XPA A;  3ARO A;  4ODL A;  1LG2 A;  4MPK A;  2DSZ A;  4DH0 A;  3O5I A;  2PPO A;  3ODK A;  1YAT A;  2XP3 A;  4JYS A;  2WK2 A;  1T11 A;  4DWS B;  2DG4 A;  1KFW A;  1QPL A;  2O92 A;  3KZ7 A;  1W1T A;  2LKN A;  4TW8 A;  2Y78 A;  2JZV A;  3FAP A;  3KAH A;  4DZ2 A;  3ARX A;  1E6P A;  1K9T A;  1EYM A;  4GIV A;  2KI3 A;  3AS1 A;  3O5O A;  3ARW A;  4Z2J A;  2DT0 A;  1GPF A;  3UI6 A;  3ARS A;  4MNJ A;  4MNL A;  2XPB A;  5DIU A;  1JND A;  1E6R A;  4IT4 A;  2B5U B;  2G8Z A;  4DRM A;  2RUR A;  3KCE A;  4JFM A;  3FXY A;  3RM9 A;  5I98 A;  1FKS A;  4JFJ A;  2M08 A;  4ODM A;  1KT0 A;  1NWU A;  3AS2 A;  3O5E A;  1H0I A;  2FAP A;  4DWS D;  3WD0 A;  1E15 A;  3ARQ A;  4S3J A;  1WNO A;  4QT3 A;  2IUZ A;  4PTM A;  3PRA A;  1FKR A;  1NMV A;  3G6M A;  3KAB A;  4GGQ A;  3I6C A;  2DSW A;  4J4N A;  4DRK A;  4ODN A;  3RM4 A;  2DSU A;  2L2S A;  4DRN A;  2PPP A;  4ZPV R;  1ZBK A;  3ARP A;  5DO2 A;  3AS0 A;  4ODK A;  4JFI A;  4TW7 A;  2A3C A;  1HKI A;  1LQ0 A;  4DWS A;  4DIP A;  1BL4 A;  1ROU A;  2A3A A;  2A3E A;  2O9O A;  2XP4 A;  4Z2L A;  1ZU8 A;  1FFR A;  2PV3 A;  3WH0 A;  1W1Y A;  1W26 A;  3PRB A;  2QF8 A;  1Q1C A;  1FJD A;  1J4R A;  1VF8 A;  1WB0 A;  1ZL1 A;  1LL4 A;  1BKF A;  2VCD A;  2FDM A;  2DSV A;  3CHD A;  1PBK A;  1F40 A;  3ALF A;  1FKI A;  2WM0 A;  1LJY A;  2ZR6 A;  5HUA A;  4R0X A;  1SYT A;  1FKL A;  4P8V A;  1KT1 A;  2ITK A;  5HW6 A;  4QIB A;  3TCZ A;  1XHG A;  3O5D A;  1UR9 A;  4LAV A;  5DIV A;  4QT2 A;  2G41 A;  1JNE A;  3UI5 A;  4R5E A;  4HBO A;  3WD1 A;  1HKK A;  4U84 A;  2LGO A;  2MPH A;  3QOK A;  2PI6 A;  1YW5 A;  1GRJ A;  2M2A A;  4URI A;  1Q6I A;  4DZ3 A;  3LUO A;  1FKJ A;  3VAW A;  3CZ8 A;  5J6E A;  1X6N A;  4DT4 A; 
#chains in the Genus database with same CATH homology
 1OGG A;  2AOS A;  3CHC A;  5D75 A;  2DPE A;  3WD2 A;  1RD6 A;  1A7X A;  5GPG A;  1CTN A;  1Q6H A;  1B6C A;  3O5G A;  5HBF A;  2MNT A;  4ODR A;  1L1P A;  4N19 A;  3KAC A;  2XP8 A;  1TFV A;  3ARV A;  4KR0 B;  3KAG A;  4ODP A;  2F4E A;  1TCO C;  1HJX A;  2D9F A;  4DRH A;  4LAW A;  4W9Q A;  3CH9 A;  3WQW A;  2XP9 A;  5GPR A;  4Z2I A;  2RSE A;  1F8A B;  3IHZ A;  3NRK A;  4U86 A;  2PV2 A;  3B7X A;  2F21 A;  3O5J A;  1O6I A;  1NH6 A;  2LJ4 A;  1IX5 A;  3OOB A;  1Q6U A;  1NMW A;  2FKE A;  5GQB A;  2B31 A;  2ZQT A;  1ZCN A;  1FKG A;  1ZBC A;  1HJV A;  3KAF A;  1NSG A;  2OLH A;  4L3N A;  1FKH A;  2ZQS A;  3GPK A;  3WD4 A;  4MGV A;  3KAI A;  3MDY B;  3O5F A;  1E6N A;  2M1I A;  3KAD A;  4L72 B;  3WQV A;  4DRP A;  1JVW A;  2KFW A;  2IF4 A;  2XP5 A;  4KQZ A;  1LG1 A;  1ZB5 A;  1GUV A;  3BXW A;  1QPF A;  2PBC A;  4LAY A;  3UQI A;  3ART A;  4NSB A;  3ALG A;  1D7J A;  1D6O A;  1W9P A;  4U85 A;  4W9P A;  3WKZ A;  2MF9 A;  1FKK A;  3PR9 A;  4P8X A;  3AS3 A;  3B9D A;  3WIJ A;  1OGB A;  4ITZ A;  4ODO A;  4P8W A;  3UQA A;  4WIW A;  1E6Z A;  4BF8 A;  2AWG A;  1J4H A;  1EHN A;  5DIT A;  2RUC A;  4AY1 A;  2MLY A;  3RFW A;  2UZ5 A;  2DT1 A;  4Z2H A;  4Q22 A;  3O5R A;  3RGC A;  4IQ2 A;  3B9A A;  1ROT A;  1EDQ A;  5HKG A;  4ZS6 A;  5DEZ A;  4LAX A;  4WKF A;  4Q7N A;  3CHE A;  1FKT A;  2MLX A;  3JXV A;  2RUD A;  4IT6 A;  2XP6 A;  1C9H A;  4LGX A;  1HJW A;  4QZV B;  4FN2 A;  1NWT A;  2Q5A A;  3OA5 A;  1NWR A;  4W9O A;  1E9L A;  1W9U A;  3WL1 A;  1EQ3 A;  4MTV A;  3EY6 A;  4O2T A;  3TC5 A;  4JFL A;  3FY1 A;  2LPV A;  3G6L A;  1FKF A;  1J4I A;  4Z2K A;  4FAP A;  2MLZ A;  3O5Q A;  4ZPW R;  2ZR5 A;  4XAK A;  5HW8 A;  1ZK6 A;  4WK9 A;  4HBE A;  4WKH A;  4TYO A;  2F2D A;  3ARZ A;  4MAV A;  3NTP A;  3RME A;  2XP7 A;  3WD3 A;  1H0G A;  1D7I A;  5HWC A;  2KE0 A;  1HKJ A;  4MNM A;  1FKD A;  4DRI A;  4J4O A;  4C02 B;  3B8S A;  4S3K A;  1U79 A;  4JFK A;  2DG9 A;  3JYJ A;  4W5U A;  2KR7 A;  3CGN A;  1M5Y A;  1D7H A;  3ARU A;  1JNS A;  1FD9 A;  1N1A A;  3CHF A;  1ZBV A;  1D2K A;  4ML4 A;  4WKA A;  2N87 A;  1EIB A;  4ODQ A;  3RM8 A;  3ARR A;  3IK8 A;  3O5M A;  4Z2G A;  4WJX A;  3H9R B;  2DT3 A;  4TX0 A;  4P8U A;  1ITX A;  4IQC A;  1W1V A;  3NI6 A;  4DRQ A;  4IPX A;  3PRD A;  2RQS A;  4TW6 A;  5DF0 A;  4G50 A;  3ARY A;  3UI4 A;  4TNS A;  1P5Q A;  3O5K A;  5HW7 A;  1JNT A;  5BXJ A;  1FAP A;  1HKM A;  1UR8 A;  3IKD A;  2KO7 A;  1SR0 A;  5B8I C;  3TDB A;  5HTG A;  1FKB A;  1R9H A;  5JH8 A;  2ZQV A;  2YBU A;  2WLY A;  1W1P A;  3JYM A;  2ZQU A;  2RUQ A;  4HAR A;  3UF8 A;  1XRV A;  5HWB A;  1W9V A;  3CGM A;  4MNK A;  5HT1 A;  1QZ2 A;  2DG3 A;  3W4R A;  1X6L A;  2YBT A;  3UQB A;  2VN1 A;  4MSP A;  1ZBW A;  2A3B A;  3WL0 A;  1NWS A;  4NNR A;  4DWS C;  1LL7 A;  3AQU A;  1GOI A;  4DRJ A;  2DT2 A;  2PV1 A;  1J6Y A;  3PA7 A;  1Y0O A;  2KGJ A;  4ZPT R;  1LL6 A;  2PPN A;  2ZR4 A;  1WAW A;  2WLZ A;  1PIN A;  2ESC A;  4G2P A;  4NZC A;  1HXV A;  3IKG A;  1OWQ A;  3O5P A;  4DRO A;  2OFN A;  3O5L A;  1FFQ A;  3B9E A;  2K8I A;  2XPA A;  3ARO A;  4ODL A;  1LG2 A;  4MPK A;  2DSZ A;  4DH0 A;  3O5I A;  2PPO A;  3ODK A;  1YAT A;  2XP3 A;  4JYS A;  2WK2 A;  1T11 A;  4DWS B;  2DG4 A;  1KFW A;  1QPL A;  2O92 A;  3KZ7 A;  1W1T A;  2LKN A;  4TW8 A;  2Y78 A;  2JZV A;  3FAP A;  3KAH A;  4DZ2 A;  3ARX A;  1E6P A;  1K9T A;  1EYM A;  4GIV A;  2KI3 A;  3AS1 A;  3O5O A;  3ARW A;  4Z2J A;  2DT0 A;  1GPF A;  3UI6 A;  3ARS A;  4MNJ A;  4MNL A;  2XPB A;  5DIU A;  1JND A;  1E6R A;  4IT4 A;  2G8Z A;  4DRM A;  2RUR A;  3KCE A;  4JFM A;  3FXY A;  3RM9 A;  5I98 A;  1FKS A;  4JFJ A;  2M08 A;  4ODM A;  1KT0 A;  1NWU A;  3AS2 A;  3O5E A;  1H0I A;  2FAP A;  4DWS D;  3WD0 A;  1E15 A;  3ARQ A;  4S3J A;  1WNO A;  4QT3 A;  2IUZ A;  4PTM A;  3PRA A;  1FKR A;  1NMV A;  3G6M A;  3KAB A;  4GGQ A;  3I6C A;  2DSW A;  4J4N A;  4DRK A;  4ODN A;  3RM4 A;  2DSU A;  2L2S A;  4DRN A;  2PPP A;  4ZPV R;  1ZBK A;  3ARP A;  5DO2 A;  3AS0 A;  4ODK A;  4JFI A;  4TW7 A;  2A3C A;  1HKI A;  1LQ0 A;  4DWS A;  4DIP A;  1BL4 A;  1ROU A;  2A3A A;  2A3E A;  2O9O A;  2XP4 A;  4Z2L A;  1ZU8 A;  1FFR A;  2PV3 A;  3WH0 A;  1W1Y A;  1W26 A;  3PRB A;  2QF8 A;  1Q1C A;  1FJD A;  1J4R A;  1VF8 A;  1WB0 A;  1ZL1 A;  1LL4 A;  1BKF A;  2VCD A;  2FDM A;  2DSV A;  3CHD A;  1PBK A;  1F40 A;  3ALF A;  1FKI A;  2WM0 A;  1LJY A;  2ZR6 A;  5HUA A;  4R0X A;  1SYT A;  1FKL A;  4P8V A;  1KT1 A;  2ITK A;  5HW6 A;  4QIB A;  3TCZ A;  1XHG A;  3O5D A;  1UR9 A;  4LAV A;  5DIV A;  4QT2 A;  2G41 A;  1JNE A;  3UI5 A;  4R5E A;  4HBO A;  3WD1 A;  1HKK A;  4U84 A;  2LGO A;  2MPH A;  3QOK A;  2PI6 A;  1YW5 A;  2M2A A;  4URI A;  1Q6I A;  4DZ3 A;  3LUO A;  1FKJ A;  3VAW A;  3CZ8 A;  5J6E A;  1X6N A;  4DT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...