1FKRA

Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of FKBP, a rotamase enzyme and receptor for FK506 and rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
molecule keywords FK506 AND RAPAMYCIN-BINDING PROTEIN
total genus 13
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkrA00
3KZ7A 2D9FA 3O5GA 4TW7A 1J4HA 4JFIA 1BKFA 4J4NA 3H9RB 1TCOC 3O5JA 3KAIA 1FKFA 3NI6A 4TYOA 1P5QA 3KAFA 1F40A 2IF4A 1NMWA 1FKTA 4G50A 4W9OA 5HUAA 2RUQA 2FAPA 2UZ5A 4LAWA 3UQIA 4DRJA 4DH0A 4IQ2A 4ODKA 4W9QA 5HW6A 4QIBA 2MPHA 3CGMA 3O5LA 3PRDA 2PV3A 1QZ2A 2Y78A 1F8AB 2ZQSA 4GGQA 1Q1CA 1A7XA 1Q6UA 2M1IA 2RQSA 5D75A 1FKIA 3UQBA 2XPAA 3TC5A 3O5DA 5BXJA 4ODNA 3WH0A 1YATA 4DRPA 1FKDA 3KCEA 4DROA 3O5EA 1FKJA 4TW8A 3KAHA 4DZ2A 1PINA 3FAPA 3PA7A 1FKRA 4U84A 1C9HA 5DIUA 4ODMA 5HW8A 3O5QA 4LAVA 2XPBA 4ITZA 3VAWA 2RURA 4ODQA 2ZR5A 2K8IA 2Q5AA 4DZ3A 5HTGA 2DG3A 2XP3A 3JYMA 4DIPA 1FKKA 2F4EA 2PBCA 2VCDA 2LKNA 3OOBA 2MLXA 4JYSA 2PPPA 1W26A 3MDYB 1FKHA 2L2SA 2OFNA 2XP4A 1J4IA 3O5PA 5I98A 1D6OA 1ZK6A 2PPNA 1NMVA 3NRKA 1YW5A 3CGNA 3IK8A 3KAGA 5HT1A 3KACA 2XP7A 1FKBA 1Q6HA 1NSGA 2ZQVA 4BF8A 5DITA 4TW6A 3PRBA 3RGCA 4DRIA 4DRMA 1KT0A 5GPGA 1EYMA 3JXVA 2DG9A 5HW7A 2MLYA 2PPOA 4FN2A 3KABA 4DRQA 1EQ3A 2M08A 4R0XA 2MF9A 1PBKA 2F2DA 3I6CA 3TDBA 1FKGA 1JNSA 3IKGA 2XP5A 5DIVA 4LAXA 5HWCA 3UF8A 3O5IA 5B8IC 2RSEA 2LJ4A 4MGVA 2KGJA 4TNSA 4U86A 4JFMA 4QT2A 1FD9A 3UI6A 4ODLA 5J6EA 2VN1A 4JFLA 1FKSA 4MSPA 4DRHA 4IQCA 4FAPA 4JFKA 2JZVA 2N87A 1FJDA 1HXVA 2PV2A 2LPVA 3IKDA 1M5YA 3KADA 4LAYA 1L1PA 1D7JA 4J4OA 2XP8A 2AWGA 1J6YA 1ROUA 5HKGA 1KT1A 4NNRA 2M2AA 1N1AA 3ODKA 2RUDA 5HWBA 4DT4A 3O5OA 1BL4A 4ODRA 4GIVA 2RUCA 1D7IA 2ZQTA 1T11A 2KFWA 4U85A 3O5KA 2KI3A 1B6CA 4O2TA 1QPLA 4W9PA 2KE0A 1JNTA 4ODOA 3EY6A 2MNTA 3LUOA 3TCZA 1ZCNA 2MLZA 1D7HA 3JYJA 2XP6A 4DRKA 1Q6IA 3O5MA 1JVWA 1QPFA 1R9HA 1Y0OA 3UI5A 2FKEA 4DRNA 1FAPA 3GPKA 4C02B 2KO7A 2LGOA 1FKLA 1J4RA 2ZR6A 3IHZA 3O5FA 1U79A 4ODPA 3B7XA 1ROTA 2DG4A 3O5RA 2ZQUA 2ITKA 4N19A 3UI4A 4JFJA 4QT3A 3NTPA 2ZR4A 4TX0A 2KR7A 3RFWA 4G2PA 4IPXA 2XP9A 2F21A 2PV1A 3UQAA
chains in the Genus database with same CATH superfamily
1W1TA 4TW7A 1BKFA 3H9RB 2DSZA 3KAFA 4IT4A 3UQIA 4DH0A 4IQ2A 5JH8A 2IUZA 3CGMA 3O5LA 4Q22A 2PV3A 2Y78A 1F8AB 3O5DA 3WH0A 3KCEA 4DROA 1HJWA 3AS0A 1C9HA 3ARUA 3VAWA 2ZR5A 2Q5AA 2XP3A 1IX5A 2F4EA 5DEZA 2PBCA 4JYSA 3CHFA 3BXWA 3MDYB 1E15A 1E6ZA 1XHGA 1J4IA 2PPNA 3NRKA 1SYTA 2OLHA 2O92A 3KAGA 5HT1A 1LG1A 1FKBA 1E6RA 5DITA 1E9LA 3PRBA 3AROA 2YBTA 1NH6A 3RM9A 1KT0A 3BMBA 1SR0A 4DRQA 1JNSA 1KFWA 3WKZA 4LAXA 3G6LA 1LL7A 1GUVA 3QOKA 4U86A 4ZPWR 4JFLA 4DRHA 4IQCA 1LJYA 3RMEA 3CH9A 4JFKA 2JZVA 2FDMA 1D7JA 1NWSA 4J4OA 1J6YA 3ARQA 5HKGA 4WKFA 1W9VA 2B31A 4GIVA 1UR9A 2KFWA 2PI6A 4O2TA 3EY6A 2MNTA 3ARZA 1ZCNA 4WKHA 3GTYX 1QPFA 1R9HA 1Y0OA 2O9OA 4C02B 2DT3A 2WM0A 2ZQUA 4N19A 4NSBA 3NTPA 4DRJA 2XP9A 2G8ZA 2ETNA 3UQAA 1HKIA 3KZ7A 3O5GA 1ITXA 4JFIA 1TCOC 3KAIA 1FKFA 1P5QA 1F40A 1RD6A 3ALGA 1FKTA 1W1YA 2UZ5A 2P4VA 1WAWA 5HW6A 4W9QA 4Z2GA 1GRJA 4QIBA 3PRDA 1QZ2A 4WKAA 4WJXA 1Q1CA 1Q6UA 2M1IA 1FKIA 2DT1A 4KQZA 3ALFA 5BXJA 1VF8A 4ODNA 3O5EA 4TW8A 2DSWA 3FAPA 5DIUA 4Q7NA 3FY1A 4HBEA 2RURA 2K8IA 4DZ3A 3AQUA 1GPFA 2DG3A 2DSVA 4DIPA 3WD2A 3AS1A 2MLXA 4MTVA 5I98A 1D6OA 2XP7A 3CZ8A 4ZS6A 1EYMA 1EDQA 5HW7A 1EQ3A 4R0XA 3I6CA 3TDBA 2B5UB 4WK9A 5HWCA 1GOIA 2RSEA 2KGJA 4TNSA 4JFMA 1ZU8A 4QT2A 3UI6A 3ARRA 2VN1A 2G41A 1UR8A 1ZBVA 1HKKA 3WD3A 1HJXA 1FJDA 2N87A 3IKDA 1HKMA 2AWGA 3PR9A 1KT1A 4NNRA 1N1AA 4URIA 3ODKA 5HWBA 1W9UA 4DT4A 1BL4A 1JNDA 1D7IA 4U85A 3O5KA 3AS2A 1B6CA 4ZPVR 4W9PA 1JNTA 1E6NA 4DWSA 4P8UA 3ARVA 1FAPA 2A3AA 3ARPA 1H0IA 2ITKA 4QZVB 4P8XA 4QT3A 2ZR4A 4MNLA 4L72B 2PV1A 3ARWA 4MPKA 1J4HA 3OA5A 3NI6A 5HUAA 4LAWA 4ZPTR 1H0GA 1LL6A 1LL4A 2MPHA 4GGQA 2ZQSA 4IT6A 3CHEA 3W4RA 3UQBA 2XPAA 5HBFA 3TC5A 4DWSD 1W1PA 4DRPA 1PINA 1D2KA 1WNOA 4ML4A 3WQVA 3ARTA 1X6NA 3O5QA 5HW8A 2ESCA 4ODQA 5HTGA 3JYMA 3OOBA 1W26A 2XP4A 3O5PA 3WL0A 1NMVA 3CGNA 2AOSA 4R5EA 3RM4A 3G6MA 4UDMA 2DPEA 2WLYA 1NSGA 2ZQVA 3B9EA 3B9DA 3RGCA 3B9AA 1NWUA 4DRMA 2EULA 1E44A 3EIPA 1ZB5A 4S3KA 3RM8A 4FN2A 2M08A 2F2DA 3WIJA 3WQWA 4Z2IA 5DIVA 4PTMA 3UF8A 1NWRA 3O5IA 3CHDA 5GPRA 4W5UA 1JCHB 1CTNA 1XRVA 4HARA 4ODLA 4LGXA 5J6EA 2PN0A 1ZBWA 1WB0A 4FAPA 1HXVA 2PV2A 5DO2A 2LPVA 3KADA 1M5YA 1L1PA 2DT2A 2XP8A 2YBUA 2M2AA 4MAVA 4XAKA 2RUDA 1LG2A 3O5OA 2RUCA 4MNMA 1X6LA 3ARSA 4MNJA 2KI3A 3TCZA 4Z2KA 1D7HA 1ZBKA 4DRKA 5GQBA 1JVWA 4P8VA 3UI5A 2FKEA 4DRNA 1FKLA 1J4RA 2ZR6A 3IHZA 3O5FA 4ODPA 1EIBA 4MNKA 3AS3A 4TX0A 2A3CA 2KR7A 4G2PA 4IPXA 2F21A 2D9FA 3CHCA 4J4NA 4TYOA 3O5JA 1W9PA 2IF4A 1NMWA 4G50A 4W9OA 2RUQA 2FAPA 1EHNA 4ODKA 1ZBCA 2A3BA 4DWSC 1A7XA 1JNEA 4Z2JA 2RQSA 5D75A 1OWQA 1W1VA 4NZCA 4HBOA 1YATA 1FKDA 1FKJA 3KAHA 4DZ2A 1FKRA 2A3EA 3PA7A 4U84A 5DF0A 4ODMA 1HJVA 4LAVA 2XPBA 4ITZA 1LQ0A 1FKKA 2DSUA 1K9TA 2VCDA 3WD4A 2LKNA 1OGGA 2PPPA 4AY1A 1FKHA 2L2SA 2OFNA 1NWTA 1ZK6A 1YW5A 3IK8A 4Z2LA 4L3NA 3KACA 4Z2HA 2WK2A 1Q6HA 4BF8A 4DRIA 3B8SA 5GPGA 3JXVA 2DG9A 3GU0A 2MLYA 2PPOA 3KABA 2MF9A 1PBKA 1ZL1A 1FKGA 2QF8A 2XP5A 3IKGA 3ARXA 5B8IC 4P8WA 4MGVA 2LJ4A 4DWSB 1FD9A 3PRAA 1FKSA 4MSPA 1FFQA 3FXYA 1TFVA 1O6IA 3ARYA 4LAYA 2F23A 2DT0A 1ROUA 4S3JA 4ODRA 2ZQTA 1T11A 3WD0A 1QPLA 2KE0A 4ODOA 3LUOA 2MLZA 3JYJA 2XP6A 1Q6IA 3O5MA 4KR0B 1FFRA 3WD1A 3GPKA 2KO7A 2LGOA 1U79A 3B7XA 2WLZA 1ROTA 2DG4A 1HKJA 3O5RA 3UI4A 3WL1A 1OGBA 1E6PA 4JFJA 4WIWA 3RFWA 4TW6A
chains in the Genus database with same CATH topology
1W1TA 4TW7A 1BKFA 3H9RB 2DSZA 3KAFA 4IT4A 3UQIA 4DH0A 4IQ2A 5JH8A 2IUZA 3CGMA 3O5LA 4Q22A 2PV3A 2Y78A 1F8AB 3O5DA 3WH0A 3KCEA 4DROA 1HJWA 3AS0A 1C9HA 3ARUA 3VAWA 2ZR5A 2Q5AA 2XP3A 1IX5A 2F4EA 5DEZA 4JYSA 2PBCA 3CHFA 3BXWA 3MDYB 1E15A 1E6ZA 1XHGA 1J4IA 2PPNA 3NRKA 1SYTA 2OLHA 2O92A 3KAGA 5HT1A 1LG1A 1FKBA 1E6RA 5DITA 1E9LA 3PRBA 3AROA 2YBTA 1NH6A 3RM9A 1KT0A 1SR0A 4DRQA 1JNSA 1KFWA 3WKZA 4LAXA 3G6LA 1LL7A 1GUVA 3QOKA 4U86A 4ZPWR 4JFLA 4DRHA 4IQCA 1LJYA 3RMEA 3CH9A 4JFKA 2JZVA 2FDMA 1D7JA 1NWSA 4J4OA 1J6YA 3ARQA 5HKGA 4WKFA 1W9VA 2B31A 4GIVA 1UR9A 2KFWA 2PI6A 4O2TA 3EY6A 2MNTA 3ARZA 1ZCNA 4WKHA 1QPFA 1R9HA 1Y0OA 2O9OA 4C02B 2DT3A 2WM0A 2ZQUA 4N19A 4NSBA 3NTPA 4DRJA 2XP9A 2G8ZA 3UQAA 1HKIA 3KZ7A 3O5GA 1ITXA 4JFIA 1TCOC 3KAIA 1FKFA 1P5QA 1F40A 1RD6A 3ALGA 1FKTA 1W1YA 2UZ5A 1WAWA 5HW6A 4W9QA 4Z2GA 4QIBA 3PRDA 1QZ2A 4WKAA 4WJXA 1Q1CA 1Q6UA 2M1IA 1FKIA 2DT1A 4KQZA 3ALFA 5BXJA 1VF8A 4ODNA 3O5EA 4TW8A 2DSWA 3FAPA 5DIUA 4Q7NA 3FY1A 4HBEA 2RURA 2K8IA 4DZ3A 3AQUA 1GPFA 2DG3A 2DSVA 4DIPA 3WD2A 3AS1A 2MLXA 4MTVA 5I98A 1D6OA 2XP7A 3CZ8A 4ZS6A 1EYMA 1EDQA 5HW7A 1EQ3A 4R0XA 3I6CA 3TDBA 4WK9A 5HWCA 1GOIA 2RSEA 2KGJA 4TNSA 4JFMA 1ZU8A 4QT2A 3UI6A 3ARRA 2VN1A 2G41A 1UR8A 1ZBVA 1HKKA 3WD3A 1HJXA 1FJDA 2N87A 3IKDA 1HKMA 2AWGA 3PR9A 1KT1A 4NNRA 1N1AA 4URIA 3ODKA 5HWBA 1W9UA 4DT4A 1BL4A 1JNDA 1D7IA 4U85A 3O5KA 3AS2A 1B6CA 4ZPVR 4W9PA 1JNTA 1E6NA 4DWSA 4P8UA 3ARVA 1FAPA 2A3AA 3ARPA 1H0IA 2ITKA 4QZVB 4P8XA 4QT3A 2ZR4A 4MNLA 4L72B 2PV1A 3ARWA 4MPKA 1J4HA 3OA5A 3NI6A 5HUAA 4LAWA 4ZPTR 1H0GA 1LL6A 1LL4A 2MPHA 4GGQA 2ZQSA 4IT6A 3CHEA 3W4RA 3UQBA 2XPAA 5HBFA 3TC5A 4DWSD 1W1PA 4DRPA 1PINA 1D2KA 1WNOA 4ML4A 3WQVA 3ARTA 1X6NA 3O5QA 5HW8A 2ESCA 4ODQA 5HTGA 3JYMA 3OOBA 1W26A 2XP4A 3O5PA 3WL0A 1NMVA 3CGNA 2AOSA 4R5EA 3RM4A 3G6MA 2DPEA 2WLYA 1NSGA 2ZQVA 3B9EA 3B9DA 3RGCA 3B9AA 1NWUA 4DRMA 1ZB5A 4S3KA 3RM8A 4FN2A 2M08A 2F2DA 3WIJA 3WQWA 4Z2IA 5DIVA 4PTMA 3UF8A 1NWRA 3O5IA 3CHDA 5GPRA 4W5UA 1CTNA 1XRVA 4HARA 4ODLA 4LGXA 5J6EA 1ZBWA 1WB0A 4FAPA 1HXVA 2PV2A 5DO2A 2LPVA 3KADA 1M5YA 1L1PA 2DT2A 2XP8A 2YBUA 2M2AA 4MAVA 4XAKA 2RUDA 1LG2A 3O5OA 2RUCA 4MNMA 1X6LA 3ARSA 4MNJA 2KI3A 3TCZA 4Z2KA 1D7HA 1ZBKA 4DRKA 5GQBA 1JVWA 4P8VA 3UI5A 2FKEA 4DRNA 1FKLA 1J4RA 2ZR6A 3IHZA 3O5FA 4ODPA 1EIBA 4MNKA 3AS3A 4TX0A 2A3CA 2KR7A 4G2PA 4IPXA 2F21A 2D9FA 3CHCA 4J4NA 4TYOA 3O5JA 1W9PA 2IF4A 1NMWA 4G50A 4W9OA 2RUQA 2FAPA 1EHNA 4ODKA 1ZBCA 2A3BA 4DWSC 1A7XA 1JNEA 4Z2JA 2RQSA 5D75A 1OWQA 1W1VA 4NZCA 4HBOA 1YATA 1FKDA 1FKJA 3KAHA 4DZ2A 1FKRA 2A3EA 3PA7A 4U84A 5DF0A 4ODMA 1HJVA 4LAVA 2XPBA 4ITZA 1LQ0A 1FKKA 2DSUA 1K9TA 2VCDA 3WD4A 2LKNA 1OGGA 2PPPA 4AY1A 1FKHA 2L2SA 2OFNA 1NWTA 1ZK6A 1YW5A 3IK8A 4Z2LA 4L3NA 3KACA 4Z2HA 2WK2A 1Q6HA 4BF8A 4DRIA 3B8SA 5GPGA 3JXVA 2DG9A 2MLYA 2PPOA 3KABA 2MF9A 1PBKA 1ZL1A 1FKGA 2QF8A 2XP5A 3IKGA 3ARXA 5B8IC 4P8WA 4MGVA 2LJ4A 4DWSB 1FD9A 3PRAA 1FKSA 4MSPA 1FFQA 3FXYA 1TFVA 1O6IA 3ARYA 4LAYA 2DT0A 1ROUA 4S3JA 4ODRA 2ZQTA 1T11A 3WD0A 1QPLA 2KE0A 4ODOA 3LUOA 2MLZA 3JYJA 2XP6A 1Q6IA 3O5MA 4KR0B 1FFRA 3WD1A 3GPKA 2KO7A 2LGOA 1U79A 3B7XA 2WLZA 1ROTA 2DG4A 1HKJA 3O5RA 3UI4A 3WL1A 1OGBA 1E6PA 4JFJA 4WIWA 3RFWA 4TW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZ7 A;  2D9F A;  3O5G A;  4TW7 A;  1J4H A;  4JFI A;  1BKF A;  4J4N A;  3H9R B;  1TCO C;  3O5J A;  3KAI A;  1FKF A;  3NI6 A;  4TYO A;  1P5Q A;  3KAF A;  1F40 A;  2IF4 A;  1NMW A;  1FKT A;  4G50 A;  4W9O A;  5HUA A;  2RUQ A;  2FAP A;  2UZ5 A;  4LAW A;  3UQI A;  4DRJ A;  4DH0 A;  4IQ2 A;  4ODK A;  4W9Q A;  5HW6 A;  4QIB A;  2MPH A;  3CGM A;  3O5L A;  3PRD A;  2PV3 A;  1QZ2 A;  2Y78 A;  1F8A B;  2ZQS A;  4GGQ A;  1Q1C A;  1A7X A;  1Q6U A;  2M1I A;  2RQS A;  5D75 A;  1FKI A;  3UQB A;  2XPA A;  3TC5 A;  3O5D A;  5BXJ A;  4ODN A;  3WH0 A;  1YAT A;  4DRP A;  1FKD A;  3KCE A;  4DRO A;  3O5E A;  1FKJ A;  4TW8 A;  3KAH A;  4DZ2 A;  1PIN A;  3FAP A;  3PA7 A;  1FKR A;  4U84 A;  1C9H A;  5DIU A;  4ODM A;  5HW8 A;  3O5Q A;  4LAV A;  2XPB A;  4ITZ A;  3VAW A;  2RUR A;  4ODQ A;  2ZR5 A;  2K8I A;  2Q5A A;  4DZ3 A;  5HTG A;  2DG3 A;  2XP3 A;  3JYM A;  4DIP A;  1FKK A;  2F4E A;  2PBC A;  2VCD A;  2LKN A;  3OOB A;  2MLX A;  4JYS A;  2PPP A;  1W26 A;  3MDY B;  1FKH A;  2L2S A;  2OFN A;  2XP4 A;  1J4I A;  3O5P A;  5I98 A;  1D6O A;  1ZK6 A;  2PPN A;  1NMV A;  3NRK A;  1YW5 A;  3CGN A;  3IK8 A;  3KAG A;  5HT1 A;  3KAC A;  2XP7 A;  1FKB A;  1Q6H A;  1NSG A;  2ZQV A;  4BF8 A;  5DIT A;  4TW6 A;  3PRB A;  3RGC A;  4DRI A;  4DRM A;  1KT0 A;  5GPG A;  1EYM A;  3JXV A;  2DG9 A;  5HW7 A;  2MLY A;  2PPO A;  4FN2 A;  3KAB A;  4DRQ A;  1EQ3 A;  2M08 A;  4R0X A;  2MF9 A;  1PBK A;  2F2D A;  3I6C A;  3TDB A;  1FKG A;  1JNS A;  3IKG A;  2XP5 A;  5DIV A;  4LAX A;  5HWC A;  3UF8 A;  3O5I A;  5B8I C;  2RSE A;  2LJ4 A;  4MGV A;  2KGJ A;  4TNS A;  4U86 A;  4JFM A;  4QT2 A;  1FD9 A;  3UI6 A;  4ODL A;  5J6E A;  2VN1 A;  4JFL A;  1FKS A;  4MSP A;  4DRH A;  4IQC A;  4FAP A;  4JFK A;  2JZV A;  2N87 A;  1FJD A;  1HXV A;  2PV2 A;  2LPV A;  3IKD A;  1M5Y A;  3KAD A;  4LAY A;  1L1P A;  1D7J A;  4J4O A;  2XP8 A;  2AWG A;  1J6Y A;  1ROU A;  5HKG A;  1KT1 A;  4NNR A;  2M2A A;  1N1A A;  3ODK A;  2RUD A;  5HWB A;  4DT4 A;  3O5O A;  1BL4 A;  4ODR A;  4GIV A;  2RUC A;  1D7I A;  2ZQT A;  1T11 A;  2KFW A;  4U85 A;  3O5K A;  2KI3 A;  1B6C A;  4O2T A;  1QPL A;  4W9P A;  2KE0 A;  1JNT A;  4ODO A;  3EY6 A;  2MNT A;  3LUO A;  3TCZ A;  1ZCN A;  2MLZ A;  1D7H A;  3JYJ A;  2XP6 A;  4DRK A;  1Q6I A;  3O5M A;  1JVW A;  1QPF A;  1R9H A;  1Y0O A;  3UI5 A;  2FKE A;  4DRN A;  1FAP A;  3GPK A;  4C02 B;  2KO7 A;  2LGO A;  1FKL A;  1J4R A;  2ZR6 A;  3IHZ A;  3O5F A;  1U79 A;  4ODP A;  3B7X A;  1ROT A;  2DG4 A;  3O5R A;  2ZQU A;  2ITK A;  4N19 A;  3UI4 A;  4JFJ A;  4QT3 A;  3NTP A;  2ZR4 A;  4TX0 A;  2KR7 A;  3RFW A;  4G2P A;  4IPX A;  2XP9 A;  2F21 A;  2PV1 A;  3UQA A; 
#chains in the Genus database with same CATH topology
 1W1T A;  4TW7 A;  1BKF A;  3H9R B;  2DSZ A;  3KAF A;  4IT4 A;  3UQI A;  4DH0 A;  4IQ2 A;  5JH8 A;  2IUZ A;  3CGM A;  3O5L A;  4Q22 A;  2PV3 A;  2Y78 A;  1F8A B;  3O5D A;  3WH0 A;  3KCE A;  4DRO A;  1HJW A;  3AS0 A;  1C9H A;  3ARU A;  3VAW A;  2ZR5 A;  2Q5A A;  2XP3 A;  1IX5 A;  2F4E A;  5DEZ A;  2PBC A;  4JYS A;  3CHF A;  3BXW A;  3MDY B;  1E15 A;  1E6Z A;  1XHG A;  1J4I A;  2PPN A;  3NRK A;  1SYT A;  2OLH A;  2O92 A;  3KAG A;  5HT1 A;  1LG1 A;  1FKB A;  1E6R A;  5DIT A;  1E9L A;  3PRB A;  3ARO A;  2YBT A;  1NH6 A;  3RM9 A;  1KT0 A;  3BMB A;  1SR0 A;  4DRQ A;  1JNS A;  1KFW A;  3WKZ A;  4LAX A;  3G6L A;  1LL7 A;  1GUV A;  3QOK A;  4U86 A;  4ZPW R;  4JFL A;  4DRH A;  4IQC A;  1LJY A;  3RME A;  3CH9 A;  4JFK A;  2JZV A;  2FDM A;  1D7J A;  1NWS A;  4J4O A;  1J6Y A;  3ARQ A;  5HKG A;  4WKF A;  1W9V A;  2B31 A;  4GIV A;  1UR9 A;  2KFW A;  2PI6 A;  4O2T A;  3EY6 A;  2MNT A;  3ARZ A;  1ZCN A;  4WKH A;  3GTY X;  1QPF A;  1R9H A;  1Y0O A;  2O9O A;  4C02 B;  2DT3 A;  2WM0 A;  2ZQU A;  4N19 A;  4NSB A;  3NTP A;  4DRJ A;  2XP9 A;  2G8Z A;  2ETN A;  3UQA A;  1HKI A;  3KZ7 A;  3O5G A;  1ITX A;  4JFI A;  1TCO C;  3KAI A;  1FKF A;  1P5Q A;  1F40 A;  1RD6 A;  3ALG A;  1FKT A;  1W1Y A;  2UZ5 A;  2P4V A;  1WAW A;  5HW6 A;  4W9Q A;  4Z2G A;  1GRJ A;  4QIB A;  3PRD A;  1QZ2 A;  4WKA A;  4WJX A;  1Q1C A;  1Q6U A;  2M1I A;  1FKI A;  2DT1 A;  4KQZ A;  3ALF A;  5BXJ A;  1VF8 A;  4ODN A;  3O5E A;  4TW8 A;  2DSW A;  3FAP A;  5DIU A;  4Q7N A;  3FY1 A;  4HBE A;  2RUR A;  2K8I A;  4DZ3 A;  3AQU A;  1GPF A;  2DG3 A;  2DSV A;  4DIP A;  3WD2 A;  3AS1 A;  2MLX A;  4MTV A;  5I98 A;  1D6O A;  2XP7 A;  3CZ8 A;  4ZS6 A;  1EYM A;  1EDQ A;  5HW7 A;  1EQ3 A;  4R0X A;  3I6C A;  3TDB A;  2B5U B;  4WK9 A;  5HWC A;  1GOI A;  2RSE A;  2KGJ A;  4TNS A;  4JFM A;  1ZU8 A;  4QT2 A;  3UI6 A;  3ARR A;  2VN1 A;  2G41 A;  1UR8 A;  1ZBV A;  1HKK A;  3WD3 A;  1HJX A;  1FJD A;  2N87 A;  3IKD A;  1HKM A;  2AWG A;  3PR9 A;  1KT1 A;  4NNR A;  1N1A A;  4URI A;  3ODK A;  5HWB A;  1W9U A;  4DT4 A;  1BL4 A;  1JND A;  1D7I A;  4U85 A;  3O5K A;  3AS2 A;  1B6C A;  4ZPV R;  4W9P A;  1JNT A;  1E6N A;  4DWS A;  4P8U A;  3ARV A;  1FAP A;  2A3A A;  3ARP A;  1H0I A;  2ITK A;  4QZV B;  4P8X A;  4QT3 A;  2ZR4 A;  4MNL A;  4L72 B;  2PV1 A;  3ARW A;  4MPK A;  1J4H A;  3OA5 A;  3NI6 A;  5HUA A;  4LAW A;  4ZPT R;  1H0G A;  1LL6 A;  1LL4 A;  2MPH A;  4GGQ A;  2ZQS A;  4IT6 A;  3CHE A;  3W4R A;  3UQB A;  2XPA A;  5HBF A;  3TC5 A;  4DWS D;  1W1P A;  4DRP A;  1PIN A;  1D2K A;  1WNO A;  4ML4 A;  3WQV A;  3ART A;  1X6N A;  3O5Q A;  5HW8 A;  2ESC A;  4ODQ A;  5HTG A;  3JYM A;  3OOB A;  1W26 A;  2XP4 A;  3O5P A;  3WL0 A;  1NMV A;  3CGN A;  2AOS A;  4R5E A;  3RM4 A;  3G6M A;  4UDM A;  2DPE A;  2WLY A;  1NSG A;  2ZQV A;  3B9E A;  3B9D A;  3RGC A;  3B9A A;  1NWU A;  4DRM A;  2EUL A;  1E44 A;  3EIP A;  1ZB5 A;  4S3K A;  3RM8 A;  4FN2 A;  2M08 A;  2F2D A;  3WIJ A;  3WQW A;  4Z2I A;  5DIV A;  4PTM A;  3UF8 A;  1NWR A;  3O5I A;  3CHD A;  5GPR A;  4W5U A;  1JCH B;  1CTN A;  1XRV A;  4HAR A;  4ODL A;  4LGX A;  5J6E A;  2PN0 A;  1ZBW A;  1WB0 A;  4FAP A;  1HXV A;  2PV2 A;  5DO2 A;  2LPV A;  3KAD A;  1M5Y A;  1L1P A;  2DT2 A;  2XP8 A;  2YBU A;  2M2A A;  4MAV A;  4XAK A;  2RUD A;  1LG2 A;  3O5O A;  2RUC A;  4MNM A;  1X6L A;  3ARS A;  4MNJ A;  2KI3 A;  3TCZ A;  4Z2K A;  1D7H A;  1ZBK A;  4DRK A;  5GQB A;  1JVW A;  4P8V A;  3UI5 A;  2FKE A;  4DRN A;  1FKL A;  1J4R A;  2ZR6 A;  3IHZ A;  3O5F A;  4ODP A;  1EIB A;  4MNK A;  3AS3 A;  4TX0 A;  2A3C A;  2KR7 A;  4G2P A;  4IPX A;  2F21 A;  2D9F A;  3CHC A;  4J4N A;  4TYO A;  3O5J A;  1W9P A;  2IF4 A;  1NMW A;  4G50 A;  4W9O A;  2RUQ A;  2FAP A;  1EHN A;  4ODK A;  1ZBC A;  2A3B A;  4DWS C;  1A7X A;  1JNE A;  4Z2J A;  2RQS A;  5D75 A;  1OWQ A;  1W1V A;  4NZC A;  4HBO A;  1YAT A;  1FKD A;  1FKJ A;  3KAH A;  4DZ2 A;  1FKR A;  2A3E A;  3PA7 A;  4U84 A;  5DF0 A;  4ODM A;  1HJV A;  4LAV A;  2XPB A;  4ITZ A;  1LQ0 A;  1FKK A;  2DSU A;  1K9T A;  2VCD A;  3WD4 A;  2LKN A;  1OGG A;  2PPP A;  4AY1 A;  1FKH A;  2L2S A;  2OFN A;  1NWT A;  1ZK6 A;  1YW5 A;  3IK8 A;  4Z2L A;  4L3N A;  3KAC A;  4Z2H A;  2WK2 A;  1Q6H A;  4BF8 A;  4DRI A;  3B8S A;  5GPG A;  3JXV A;  2DG9 A;  3GU0 A;  2MLY A;  2PPO A;  3KAB A;  2MF9 A;  1PBK A;  1ZL1 A;  1FKG A;  2QF8 A;  2XP5 A;  3IKG A;  3ARX A;  5B8I C;  4P8W A;  4MGV A;  2LJ4 A;  4DWS B;  1FD9 A;  3PRA A;  1FKS A;  4MSP A;  1FFQ A;  3FXY A;  1TFV A;  1O6I A;  3ARY A;  4LAY A;  2F23 A;  2DT0 A;  1ROU A;  4S3J A;  4ODR A;  2ZQT A;  1T11 A;  3WD0 A;  1QPL A;  2KE0 A;  4ODO A;  3LUO A;  2MLZ A;  3JYJ A;  2XP6 A;  1Q6I A;  3O5M A;  4KR0 B;  1FFR A;  3WD1 A;  3GPK A;  2KO7 A;  2LGO A;  1U79 A;  3B7X A;  2WLZ A;  1ROT A;  2DG4 A;  1HKJ A;  3O5R A;  3UI4 A;  3WL1 A;  1OGB A;  1E6P A;  4JFJ A;  4WIW A;  3RFW A;  4TW6 A; 
#chains in the Genus database with same CATH homology
 1W1T A;  4TW7 A;  1BKF A;  3H9R B;  2DSZ A;  3KAF A;  4IT4 A;  3UQI A;  4DH0 A;  4IQ2 A;  5JH8 A;  2IUZ A;  3CGM A;  3O5L A;  4Q22 A;  2PV3 A;  2Y78 A;  1F8A B;  3O5D A;  3WH0 A;  3KCE A;  4DRO A;  1HJW A;  3AS0 A;  1C9H A;  3ARU A;  3VAW A;  2ZR5 A;  2Q5A A;  2XP3 A;  1IX5 A;  2F4E A;  5DEZ A;  4JYS A;  2PBC A;  3CHF A;  3BXW A;  3MDY B;  1E15 A;  1E6Z A;  1XHG A;  1J4I A;  2PPN A;  3NRK A;  1SYT A;  2OLH A;  2O92 A;  3KAG A;  5HT1 A;  1LG1 A;  1FKB A;  1E6R A;  5DIT A;  1E9L A;  3PRB A;  3ARO A;  2YBT A;  1NH6 A;  3RM9 A;  1KT0 A;  1SR0 A;  4DRQ A;  1JNS A;  1KFW A;  3WKZ A;  4LAX A;  3G6L A;  1LL7 A;  1GUV A;  3QOK A;  4U86 A;  4ZPW R;  4JFL A;  4DRH A;  4IQC A;  1LJY A;  3RME A;  3CH9 A;  4JFK A;  2JZV A;  2FDM A;  1D7J A;  1NWS A;  4J4O A;  1J6Y A;  3ARQ A;  5HKG A;  4WKF A;  1W9V A;  2B31 A;  4GIV A;  1UR9 A;  2KFW A;  2PI6 A;  4O2T A;  3EY6 A;  2MNT A;  3ARZ A;  1ZCN A;  4WKH A;  1QPF A;  1R9H A;  1Y0O A;  2O9O A;  4C02 B;  2DT3 A;  2WM0 A;  2ZQU A;  4N19 A;  4NSB A;  3NTP A;  4DRJ A;  2XP9 A;  2G8Z A;  3UQA A;  1HKI A;  3KZ7 A;  3O5G A;  1ITX A;  4JFI A;  1TCO C;  3KAI A;  1FKF A;  1P5Q A;  1F40 A;  1RD6 A;  3ALG A;  1FKT A;  1W1Y A;  2UZ5 A;  1WAW A;  5HW6 A;  4W9Q A;  4Z2G A;  4QIB A;  3PRD A;  1QZ2 A;  4WKA A;  4WJX A;  1Q1C A;  1Q6U A;  2M1I A;  1FKI A;  2DT1 A;  4KQZ A;  3ALF A;  5BXJ A;  1VF8 A;  4ODN A;  3O5E A;  4TW8 A;  2DSW A;  3FAP A;  5DIU A;  4Q7N A;  3FY1 A;  4HBE A;  2RUR A;  2K8I A;  4DZ3 A;  3AQU A;  1GPF A;  2DG3 A;  2DSV A;  4DIP A;  3WD2 A;  3AS1 A;  2MLX A;  4MTV A;  5I98 A;  1D6O A;  2XP7 A;  3CZ8 A;  4ZS6 A;  1EYM A;  1EDQ A;  5HW7 A;  1EQ3 A;  4R0X A;  3I6C A;  3TDB A;  4WK9 A;  5HWC A;  1GOI A;  2RSE A;  2KGJ A;  4TNS A;  4JFM A;  1ZU8 A;  4QT2 A;  3UI6 A;  3ARR A;  2VN1 A;  2G41 A;  1UR8 A;  1ZBV A;  1HKK A;  3WD3 A;  1HJX A;  1FJD A;  2N87 A;  3IKD A;  1HKM A;  2AWG A;  3PR9 A;  1KT1 A;  4NNR A;  1N1A A;  4URI A;  3ODK A;  5HWB A;  1W9U A;  4DT4 A;  1BL4 A;  1JND A;  1D7I A;  4U85 A;  3O5K A;  3AS2 A;  1B6C A;  4ZPV R;  4W9P A;  1JNT A;  1E6N A;  4DWS A;  4P8U A;  3ARV A;  1FAP A;  2A3A A;  3ARP A;  1H0I A;  2ITK A;  4QZV B;  4P8X A;  4QT3 A;  2ZR4 A;  4MNL A;  4L72 B;  2PV1 A;  3ARW A;  4MPK A;  1J4H A;  3OA5 A;  3NI6 A;  5HUA A;  4LAW A;  4ZPT R;  1H0G A;  1LL6 A;  1LL4 A;  2MPH A;  4GGQ A;  2ZQS A;  4IT6 A;  3CHE A;  3W4R A;  3UQB A;  2XPA A;  5HBF A;  3TC5 A;  4DWS D;  1W1P A;  4DRP A;  1PIN A;  1D2K A;  1WNO A;  4ML4 A;  3WQV A;  3ART A;  1X6N A;  3O5Q A;  5HW8 A;  2ESC A;  4ODQ A;  5HTG A;  3JYM A;  3OOB A;  1W26 A;  2XP4 A;  3O5P A;  3WL0 A;  1NMV A;  3CGN A;  2AOS A;  4R5E A;  3RM4 A;  3G6M A;  2DPE A;  2WLY A;  1NSG A;  2ZQV A;  3B9E A;  3B9D A;  3RGC A;  3B9A A;  1NWU A;  4DRM A;  1ZB5 A;  4S3K A;  3RM8 A;  4FN2 A;  2M08 A;  2F2D A;  3WIJ A;  3WQW A;  4Z2I A;  5DIV A;  4PTM A;  3UF8 A;  1NWR A;  3O5I A;  3CHD A;  5GPR A;  4W5U A;  1CTN A;  1XRV A;  4HAR A;  4ODL A;  4LGX A;  5J6E A;  1ZBW A;  1WB0 A;  4FAP A;  1HXV A;  2PV2 A;  5DO2 A;  2LPV A;  3KAD A;  1M5Y A;  1L1P A;  2DT2 A;  2XP8 A;  2YBU A;  2M2A A;  4MAV A;  4XAK A;  2RUD A;  1LG2 A;  3O5O A;  2RUC A;  4MNM A;  1X6L A;  3ARS A;  4MNJ A;  2KI3 A;  3TCZ A;  4Z2K A;  1D7H A;  1ZBK A;  4DRK A;  5GQB A;  1JVW A;  4P8V A;  3UI5 A;  2FKE A;  4DRN A;  1FKL A;  1J4R A;  2ZR6 A;  3IHZ A;  3O5F A;  4ODP A;  1EIB A;  4MNK A;  3AS3 A;  4TX0 A;  2A3C A;  2KR7 A;  4G2P A;  4IPX A;  2F21 A;  2D9F A;  3CHC A;  4J4N A;  4TYO A;  3O5J A;  1W9P A;  2IF4 A;  1NMW A;  4G50 A;  4W9O A;  2RUQ A;  2FAP A;  1EHN A;  4ODK A;  1ZBC A;  2A3B A;  4DWS C;  1A7X A;  1JNE A;  4Z2J A;  2RQS A;  5D75 A;  1OWQ A;  1W1V A;  4NZC A;  4HBO A;  1YAT A;  1FKD A;  1FKJ A;  3KAH A;  4DZ2 A;  1FKR A;  2A3E A;  3PA7 A;  4U84 A;  5DF0 A;  4ODM A;  1HJV A;  4LAV A;  2XPB A;  4ITZ A;  1LQ0 A;  1FKK A;  2DSU A;  1K9T A;  2VCD A;  3WD4 A;  2LKN A;  1OGG A;  2PPP A;  4AY1 A;  1FKH A;  2L2S A;  2OFN A;  1NWT A;  1ZK6 A;  1YW5 A;  3IK8 A;  4Z2L A;  4L3N A;  3KAC A;  4Z2H A;  2WK2 A;  1Q6H A;  4BF8 A;  4DRI A;  3B8S A;  5GPG A;  3JXV A;  2DG9 A;  2MLY A;  2PPO A;  3KAB A;  2MF9 A;  1PBK A;  1ZL1 A;  1FKG A;  2QF8 A;  2XP5 A;  3IKG A;  3ARX A;  5B8I C;  4P8W A;  4MGV A;  2LJ4 A;  4DWS B;  1FD9 A;  3PRA A;  1FKS A;  4MSP A;  1FFQ A;  3FXY A;  1TFV A;  1O6I A;  3ARY A;  4LAY A;  2DT0 A;  1ROU A;  4S3J A;  4ODR A;  2ZQT A;  1T11 A;  3WD0 A;  1QPL A;  2KE0 A;  4ODO A;  3LUO A;  2MLZ A;  3JYJ A;  2XP6 A;  1Q6I A;  3O5M A;  4KR0 B;  1FFR A;  3WD1 A;  3GPK A;  2KO7 A;  2LGO A;  1U79 A;  3B7X A;  2WLZ A;  1ROT A;  2DG4 A;  1HKJ A;  3O5R A;  3UI4 A;  3WL1 A;  1OGB A;  1E6P A;  4JFJ A;  4WIW A;  3RFW A;  4TW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...