1FKRA

Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cis-trans isomerase
molecule keywords FK506 AND RAPAMYCIN-BINDING PROTEIN
publication title Solution structure of FKBP, a rotamase enzyme and receptor for FK506 and rapamycin.
pubmed rcsb
source organism Homo sapiens
total genus 13
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkrA00
3KZ7A 4DZ3A 5J6EA 5HWBA 1FD9A 2RURA 2UZ5A 1ROTA 2Y78A 3FAPA 2XP7A 1U79A 3OOBA 4U84A 1J4HA 4ODNA 4TW7A 4W9PA 1FJDA 1N1AA 2KI3A 4DH0A 4W9QA 3NTPA 5HW8A 4FAPA 2ITKA 3UI6A 2KE0A 2MLYA 3JXVA 4DROA 3O5JA 3UF8A 5I98A 1BL4A 3MDYB 2MLXA 2RQSA 4IQ2A 4DRHA 5DIVA 1FKDA 2PPNA 4U86A 3O5QA 3O5MA 4LAXA 4DRMA 4J4OA 2LJ4A 3ODKA 4JFMA 4ODMA 1L1PA 3TDBA 3O5RA 1J4RA 1BKFA 2LKNA 2XP8A 3JYMA 1FKRA 1HXVA 2MLZA 1R9HA 1QPFA 1Q6IA 4JFKA 4DRQA 1F8AB 1NSGA 3LUOA 3UI4A 2PV2A 1FKTA 1KT0A 1KT1A 1PINA 2F4EA 2PBCA 2ZR4A 1EQ3A 2PV1A 3KAHA 3I6CA 5HT1A 4TW8A 4DZ2A 3UQAA 1FKFA 1JNTA 4G2PA 2RUDA 2LPVA 2ZQSA 3KAGA 2DG9A 2DG4A 3IKDA 1Q6UA 4U85A 1FKGA 1ZK6A 2PPOA 4J4NA 2IF4A 3TC5A 1B6CA 4IQCA 5B8IC 3KAIA 5HW6A 5HTGA 1T11A 1FKJA 1D6OA 3PA7A 3NRKA 4DRKA 5GPGA 3EY6A 2KFWA 4FN2A 2M08A 4JFLA 2KGJA 1FKLA 2ZR6A 2MF9A 2M1IA 2Q5AA 2ZR5A 1QZ2A 4DRNA 2RUQA 1FKIA 2XP5A 2F2DA 3UI5A 1FKSA 2XPAA 4ODOA 4ODQA 1TCOC 1FKBA 3O5LA 4ITZA 4QT2A 4R0XA 2RSEA 1JVWA 2KR7A 2FKEA 1D7HA 1Y0OA 1FKHA 4QT3A 4C02B 4JYSA 4DRJA 1NMWA 1PBKA 4DRIA 1FAPA 5HKGA 1FKKA 1YATA 4LAWA 1J6YA 3CGNA 4TNSA 4MGVA 3KABA 4MSPA 4NNRA 4DRPA 3TCZA 2JZVA 4ODPA 3O5EA 1YW5A 2XP9A 3PRDA 4TYOA 2DG3A 2XP3A 1D7IA 1QPLA 2XPBA 3KACA 3WH0A 4JFJA 5DITA 3O5KA 3RFWA 3IKGA 4ODKA 3O5OA 3KADA 3KCEA 1C9HA 3O5DA 4G50A 2XP6A 2ZQUA 4IPXA 1J4IA 3RGCA 5BXJA 3GPKA 5HWCA 5HUAA 4JFIA 4TX0A 3UQIA 1Q1CA 3H9RB 4ODRA 5HW7A 1ROUA 4LAVA 5D75A 3IK8A 2D9FA 2MNTA 4N19A 4DIPA 3KAFA 4GIVA 2ZQTA 2RUCA 3CGMA 3IHZA 3UQBA 2VN1A 2PV3A 4DT4A 3VAWA 2K8IA 4LAYA 2L2SA 1F40A 4GGQA 4O2TA 3O5GA 3O5IA 2OFNA 2VCDA 2XP4A 2ZQVA 3O5PA 3O5FA 4W9OA 2FAPA 2AWGA 2MPHA 4TW6A 3NI6A 1A7XA 3B7XA 1NMVA 1W26A 2N87A 1M5YA 1EYMA 4QIBA 3PRBA 5DIUA 4ODLA 2PPPA 2M2AA 1JNSA 1ZCNA 1D7JA 2LGOA 1Q6HA 2F21A 2KO7A 1P5QA 3JYJA 4BF8A
chains in the Genus database with same CATH superfamily
5J6EA 5HWBA 1ROTA 2Y78A 2XP7A 3OOBA 4U84A 2A3CA 1J4HA 1N1AA 3NTPA 3O5JA 1BL4A 3MDYB 4DRHA 3CHDA 1EIBA 2PPNA 3WD4A 4UDMA 4ODMA 3RMEA 1L1PA 3O5RA 2OLHA 1K9TA 2MLZA 1XHGA 1NSGA 3LUOA 1ZBCA 1FKTA 2F4EA 1KT1A 1W1TA 2PBCA 2PV1A 2DSUA 1HKJA 3IKDA 1ZK6A 1E44A 1JNEA 2A3BA 1T11A 1D6OA 1OGGA 4DWSB 3CZ8A 4DWSC 1EDQA 2M1IA 2Q5AA 2ZR5A 4AY1A 3GU0A 1JCHB 2F2DA 1FKSA 1LQ0A 1JVWA 2KR7A 2FKEA 1D7HA 4ML4A 2DT2A 1GUVA 4L72B 1FAPA 1YATA 2B5UB 3B8SA 2YBTA 4ZS6A 4Z2GA 4MSPA 3OA5A 1LG2A 4ODPA 1ZBWA 3O5EA 2DG3A 1HKIA 5DITA 3O5KA 3EIPA 3G6LA 3O5DA 3KCEA 3RGCA 1C9HA 5HWCA 2XP6A 2ZQUA 3AS1A 3CHEA 1X6NA 5DEZA 5D75A 3IK8A 4N19A 1X6LA 1W1PA 1NWSA 2K8IA 3ARXA 1F40A 3WD1A 3WL1A 2OFNA 3O5PA 3O5FA 1FFRA 2G8ZA 4TW6A 3NI6A 2B31A 2PI6A 1M5YA 1UR8A 3CH9A 1JNSA 1NWRA 2KO7A 4ZPTR 5DO2A 4BF8A 4DWSA 4IT4A 2RURA 1U79A 3BXWA 4TW7A 4DWSD 2KI3A 4Q22A 1TFVA 4W9QA 2YBUA 3UI6A 2KE0A 3JXVA 4DROA 3UF8A 3B9EA 1OWQA 4U86A 3WD0A 3WQWA 4J4OA 4JFMA 1J4RA 1BKFA 1GPFA 2LKNA 2XP8A 1ZL1A 1HXVA 1R9HA 1HKKA 1KT0A 5GQBA 4MTVA 4TW8A 3RM4A 1HJWA 1FKFA 5GPRA 4Z2JA 1IX5A 1Q6UA 3TC5A 1B6CA 3KAIA 3PA7A 3NRKA 2QF8A 1KFWA 4JFLA 4Z2LA 2ZR6A 1QZ2A 1E6PA 2RUQA 2XP5A 3UI5A 4ODOA 3O5LA 4R0XA 3AROA 1Y0OA 4DRJA 1PBKA 4MPKA 3WKZA 1NWUA 3RM9A 1JNDA 3WD3A 1J6YA 3GTYX 4MGVA 3KABA 2G41A 3TCZA 2A3EA 1YW5A 4P8VA 3ARVA 2XP3A 1D7IA 3B9AA 3IKGA 3WQVA 3O5OA 4G50A 5BXJA 2EULA 4MNLA 1W9PA 4TX0A 1H0GA 3H9RB 1LL7A 1RD6A 1WAWA 4GIVA 2RUCA 3RM8A 3ARSA 4R5EA 1O6IA 2VN1A 2PV3A 4Q7NA 1FFQA 3ARQA 2DSVA 3O5GA 2DPEA 4W9OA 1E6NA 2AWGA 4WK9A 1E9LA 1A7XA 3B7XA 1NMVA 1W26A 1ZU8A 4ODLA 2PPPA 4QZVB 2F21A 1P5QA 2A3AA 3JYJA 4WKHA 3KZ7A 4DZ3A 1FD9A 1LJYA 4W9PA 3AS3A 4ODNA 1FJDA 3FY1A 1HKMA 4DH0A 5HW8A 3AS2A 2MLXA 2RQSA 5DIVA 1FKDA 1CTNA 3O5MA 4LAXA 4DRMA 4NZCA 2LJ4A 3TDBA 1SYTA 1HJXA 4JFKA 4DRQA 1QPFA 1Q6IA 1F8AB 4LGXA 2ZR4A 5HT1A 3UQAA 4G2PA 1W1VA 2DG9A 4U85A 1FKGA 2PPOA 2DT1A 2IF4A 1E6RA 5HTGA 2WM0A 5HW6A 4KR0B 1FKJA 4MNJA 2M08A 2KGJA 2DT0A 4S3KA 4DRNA 2ESCA 3ALGA 4ITZA 3AQUA 2O92A 1W1YA 2WLYA 4P8UA 4QT2A 1FKHA 3BMBA 4JYSA 4C02B 1NMWA 3ARZA 4WKAA 4LAWA 3CGNA 1NWTA 2JZVA 3CHCA 3PRDA 4TYOA 1LG1A 3ARPA 2XPBA 1QPLA 3FXYA 3KACA 3RFWA 4ODKA 3KADA 4Z2IA 3GPKA 4JFIA 4PTMA 1Q1CA 4HARA 4ODRA 1WB0A 4LAVA 1LL4A 2D9FA 4DIPA 3KAFA 2WLZA 2ZQTA 4URIA 3CGMA 3G6MA 3IHZA 1SR0A 1E6ZA 4GGQA 3WIJA 3O5IA 4MNMA 2VCDA 3ALFA 5JH8A 2ZQVA 2MPHA 4WJXA 5DIUA 3PRBA 4S3JA 2M2AA 2LGOA 1WNOA 2UZ5A 3FAPA 3PRAA 5DF0A 4HBOA 3WL0A 2DSZA 3ARWA 1HJVA 4FAPA 3ARUA 2WK2A 2ITKA 2MLYA 2IUZA 5I98A 1GOIA 4KQZA 4IQ2A 1E15A 2PN0A 4MAVA 3O5QA 1VF8A 1EHNA 4Z2HA 3ODKA 4L3NA 4P8WA 4W5UA 3JYMA 2O9OA 4ZPVR 1FKRA 5HBFA 3WD2A 3UI4A 2PV2A 1PINA 1EQ3A 1NH6A 3KAHA 3I6CA 4DZ2A 2AOSA 1JNTA 2RUDA 3QOKA 2LPVA 2ZQSA 3ARYA 3KAGA 2DG4A 3ARRA 4J4NA 4IQCA 5B8IC 4P8XA 4DRKA 5GPGA 3EY6A 1D2KA 2KFWA 1UR9A 4IT6A 4FN2A 1FKLA 2MF9A 4ZPWR 1ZB5A 1FKIA 4HBEA 1ZBKA 2XPAA 4ODQA 1TCOC 4NSBA 1FKBA 1ITXA 2ETNA 2RSEA 4QT3A 3B9DA 2DSWA 1W9VA 1XRVA 4DRIA 5HKGA 2DT3A 1FKKA 1LL6A 1W9UA 3CHFA 3W4RA 4TNSA 4NNRA 4XAKA 4DRPA 3AS0A 2XP9A 4WIWA 3WH0A 4JFJA 3PR9A 4IPXA 2FDMA 4WKFA 1J4IA 1GRJA 5HUAA 3UQIA 5HW7A 1ZBVA 1ROUA 2MNTA 4Z2KA 3UQBA 4DT4A 1H0IA 3VAWA 4LAYA 2L2SA 2P4VA 4O2TA 2XP4A 4MNKA 2FAPA 1OGBA 2N87A 4QIBA 1EYMA 2F23A 1ZCNA 1D7JA 1Q6HA 3ARTA
chains in the Genus database with same CATH topology
5J6EA 5HWBA 1ROTA 2Y78A 2XP7A 3OOBA 4U84A 2A3CA 1J4HA 1N1AA 3NTPA 3O5JA 1BL4A 3MDYB 4DRHA 3CHDA 1EIBA 2PPNA 3WD4A 4ODMA 3RMEA 1L1PA 3O5RA 2OLHA 1K9TA 2MLZA 1XHGA 1NSGA 3LUOA 1ZBCA 1FKTA 2F4EA 1KT1A 1W1TA 2PBCA 2PV1A 2DSUA 1HKJA 3IKDA 1ZK6A 1JNEA 2A3BA 1T11A 1D6OA 1OGGA 4DWSB 3CZ8A 4DWSC 1EDQA 2M1IA 2Q5AA 2ZR5A 4AY1A 2F2DA 1FKSA 1LQ0A 1JVWA 2KR7A 2FKEA 1D7HA 4ML4A 2DT2A 1GUVA 4L72B 1FAPA 1YATA 3B8SA 2YBTA 4ZS6A 4Z2GA 4MSPA 3OA5A 1LG2A 4ODPA 1ZBWA 3O5EA 2DG3A 1HKIA 5DITA 3O5KA 3G6LA 3O5DA 3KCEA 3RGCA 1C9HA 5HWCA 2XP6A 2ZQUA 3AS1A 3CHEA 1X6NA 5DEZA 5D75A 3IK8A 4N19A 1X6LA 1W1PA 1NWSA 2K8IA 3ARXA 1F40A 3WD1A 3WL1A 2OFNA 3O5PA 3O5FA 1FFRA 2G8ZA 4TW6A 3NI6A 2B31A 2PI6A 1M5YA 1UR8A 3CH9A 1JNSA 1NWRA 2KO7A 4ZPTR 5DO2A 4BF8A 4DWSA 4IT4A 2RURA 1U79A 3BXWA 4TW7A 4DWSD 2KI3A 4Q22A 1TFVA 4W9QA 2YBUA 3UI6A 2KE0A 3JXVA 4DROA 3UF8A 3B9EA 1OWQA 4U86A 3WD0A 3WQWA 4J4OA 4JFMA 1J4RA 1BKFA 1GPFA 2LKNA 2XP8A 1ZL1A 1HXVA 1R9HA 1HKKA 1KT0A 5GQBA 4MTVA 4TW8A 3RM4A 1HJWA 1FKFA 5GPRA 4Z2JA 1IX5A 1Q6UA 3TC5A 1B6CA 3KAIA 3PA7A 3NRKA 2QF8A 1KFWA 4JFLA 4Z2LA 2ZR6A 1QZ2A 1E6PA 2RUQA 2XP5A 3UI5A 4ODOA 3O5LA 4R0XA 3AROA 1Y0OA 4DRJA 1PBKA 4MPKA 3WKZA 1NWUA 3RM9A 1JNDA 3WD3A 1J6YA 4MGVA 3KABA 2G41A 3TCZA 2A3EA 1YW5A 4P8VA 3ARVA 2XP3A 1D7IA 3B9AA 3IKGA 3WQVA 3O5OA 4G50A 5BXJA 4MNLA 1W9PA 4TX0A 1H0GA 3H9RB 1LL7A 1RD6A 1WAWA 4GIVA 2RUCA 3RM8A 3ARSA 4R5EA 1O6IA 2VN1A 2PV3A 4Q7NA 1FFQA 3ARQA 2DSVA 3O5GA 2DPEA 4W9OA 1E6NA 2AWGA 4WK9A 1E9LA 1A7XA 3B7XA 1NMVA 1W26A 1ZU8A 4ODLA 2PPPA 4QZVB 2F21A 1P5QA 2A3AA 3JYJA 4WKHA 3KZ7A 4DZ3A 1FD9A 1LJYA 4W9PA 3AS3A 4ODNA 1FJDA 3FY1A 1HKMA 4DH0A 5HW8A 3AS2A 2MLXA 2RQSA 5DIVA 1FKDA 1CTNA 3O5MA 4LAXA 4DRMA 4NZCA 2LJ4A 3TDBA 1SYTA 1HJXA 4JFKA 4DRQA 1QPFA 1Q6IA 1F8AB 4LGXA 2ZR4A 5HT1A 3UQAA 4G2PA 1W1VA 2DG9A 4U85A 1FKGA 2PPOA 2DT1A 2IF4A 1E6RA 5HTGA 2WM0A 5HW6A 4KR0B 1FKJA 4MNJA 2M08A 2KGJA 2DT0A 4S3KA 4DRNA 2ESCA 3ALGA 4ITZA 3AQUA 2O92A 1W1YA 2WLYA 4P8UA 4QT2A 1FKHA 4C02B 4JYSA 1NMWA 3ARZA 4WKAA 4LAWA 3CGNA 1NWTA 2JZVA 3CHCA 3PRDA 4TYOA 1LG1A 3ARPA 2XPBA 1QPLA 3FXYA 3KACA 3RFWA 4ODKA 3KADA 4Z2IA 3GPKA 4JFIA 4PTMA 1Q1CA 4HARA 4ODRA 1WB0A 4LAVA 1LL4A 2D9FA 4DIPA 3KAFA 2WLZA 2ZQTA 4URIA 3CGMA 3G6MA 3IHZA 1SR0A 1E6ZA 4GGQA 3WIJA 3O5IA 4MNMA 2VCDA 3ALFA 5JH8A 2ZQVA 2MPHA 4WJXA 5DIUA 3PRBA 4S3JA 2M2AA 2LGOA 1WNOA 2UZ5A 3FAPA 3PRAA 5DF0A 4HBOA 3WL0A 2DSZA 3ARWA 1HJVA 4FAPA 3ARUA 2WK2A 2ITKA 2MLYA 2IUZA 5I98A 1GOIA 4KQZA 4IQ2A 1E15A 4MAVA 3O5QA 1VF8A 1EHNA 4Z2HA 3ODKA 4L3NA 4P8WA 4W5UA 3JYMA 2O9OA 4ZPVR 1FKRA 5HBFA 3WD2A 3UI4A 2PV2A 1PINA 1EQ3A 1NH6A 3KAHA 3I6CA 4DZ2A 2AOSA 1JNTA 2RUDA 3QOKA 2LPVA 2ZQSA 3ARYA 3KAGA 2DG4A 3ARRA 4J4NA 4IQCA 5B8IC 4P8XA 4DRKA 5GPGA 3EY6A 1D2KA 2KFWA 1UR9A 4IT6A 4FN2A 1FKLA 2MF9A 4ZPWR 1ZB5A 1FKIA 4HBEA 1ZBKA 2XPAA 4ODQA 1TCOC 4NSBA 1FKBA 1ITXA 2RSEA 4QT3A 3B9DA 2DSWA 1W9VA 1XRVA 4DRIA 5HKGA 2DT3A 1FKKA 1LL6A 1W9UA 3CHFA 3W4RA 4TNSA 4NNRA 4XAKA 4DRPA 3AS0A 2XP9A 4WIWA 3WH0A 4JFJA 3PR9A 4IPXA 2FDMA 4WKFA 1J4IA 5HUAA 3UQIA 5HW7A 1ZBVA 1ROUA 2MNTA 4Z2KA 3UQBA 4DT4A 1H0IA 3VAWA 4LAYA 2L2SA 4O2TA 2XP4A 4MNKA 2FAPA 1OGBA 2N87A 4QIBA 1EYMA 1ZCNA 1D7JA 1Q6HA 3ARTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZ7 A;  4DZ3 A;  5J6E A;  5HWB A;  1FD9 A;  2RUR A;  2UZ5 A;  1ROT A;  2Y78 A;  3FAP A;  2XP7 A;  1U79 A;  3OOB A;  4U84 A;  1J4H A;  4ODN A;  4TW7 A;  4W9P A;  1FJD A;  1N1A A;  2KI3 A;  4DH0 A;  4W9Q A;  3NTP A;  5HW8 A;  4FAP A;  2ITK A;  3UI6 A;  2KE0 A;  2MLY A;  3JXV A;  4DRO A;  3O5J A;  3UF8 A;  5I98 A;  1BL4 A;  3MDY B;  2MLX A;  2RQS A;  4IQ2 A;  4DRH A;  5DIV A;  1FKD A;  2PPN A;  4U86 A;  3O5Q A;  3O5M A;  4LAX A;  4DRM A;  4J4O A;  2LJ4 A;  3ODK A;  4JFM A;  4ODM A;  1L1P A;  3TDB A;  3O5R A;  1J4R A;  1BKF A;  2LKN A;  2XP8 A;  3JYM A;  1FKR A;  1HXV A;  2MLZ A;  1R9H A;  1QPF A;  1Q6I A;  4JFK A;  4DRQ A;  1F8A B;  1NSG A;  3LUO A;  3UI4 A;  2PV2 A;  1FKT A;  1KT0 A;  1KT1 A;  1PIN A;  2F4E A;  2PBC A;  2ZR4 A;  1EQ3 A;  2PV1 A;  3KAH A;  3I6C A;  5HT1 A;  4TW8 A;  4DZ2 A;  3UQA A;  1FKF A;  1JNT A;  4G2P A;  2RUD A;  2LPV A;  2ZQS A;  3KAG A;  2DG9 A;  2DG4 A;  3IKD A;  1Q6U A;  4U85 A;  1FKG A;  1ZK6 A;  2PPO A;  4J4N A;  2IF4 A;  3TC5 A;  1B6C A;  4IQC A;  5B8I C;  3KAI A;  5HW6 A;  5HTG A;  1T11 A;  1FKJ A;  1D6O A;  3PA7 A;  3NRK A;  4DRK A;  5GPG A;  3EY6 A;  2KFW A;  4FN2 A;  2M08 A;  4JFL A;  2KGJ A;  1FKL A;  2ZR6 A;  2MF9 A;  2M1I A;  2Q5A A;  2ZR5 A;  1QZ2 A;  4DRN A;  2RUQ A;  1FKI A;  2XP5 A;  2F2D A;  3UI5 A;  1FKS A;  2XPA A;  4ODO A;  4ODQ A;  1TCO C;  1FKB A;  3O5L A;  4ITZ A;  4QT2 A;  4R0X A;  2RSE A;  1JVW A;  2KR7 A;  2FKE A;  1D7H A;  1Y0O A;  1FKH A;  4QT3 A;  4C02 B;  4JYS A;  4DRJ A;  1NMW A;  1PBK A;  4DRI A;  1FAP A;  5HKG A;  1FKK A;  1YAT A;  4LAW A;  1J6Y A;  3CGN A;  4TNS A;  4MGV A;  3KAB A;  4MSP A;  4NNR A;  4DRP A;  3TCZ A;  2JZV A;  4ODP A;  3O5E A;  1YW5 A;  2XP9 A;  3PRD A;  4TYO A;  2DG3 A;  2XP3 A;  1D7I A;  1QPL A;  2XPB A;  3KAC A;  3WH0 A;  4JFJ A;  5DIT A;  3O5K A;  3RFW A;  3IKG A;  4ODK A;  3O5O A;  3KAD A;  3KCE A;  1C9H A;  3O5D A;  4G50 A;  2XP6 A;  2ZQU A;  4IPX A;  1J4I A;  3RGC A;  5BXJ A;  3GPK A;  5HWC A;  5HUA A;  4JFI A;  4TX0 A;  3UQI A;  1Q1C A;  3H9R B;  4ODR A;  5HW7 A;  1ROU A;  4LAV A;  5D75 A;  3IK8 A;  2D9F A;  2MNT A;  4N19 A;  4DIP A;  3KAF A;  4GIV A;  2ZQT A;  2RUC A;  3CGM A;  3IHZ A;  3UQB A;  2VN1 A;  2PV3 A;  4DT4 A;  3VAW A;  2K8I A;  4LAY A;  2L2S A;  1F40 A;  4GGQ A;  4O2T A;  3O5G A;  3O5I A;  2OFN A;  2VCD A;  2XP4 A;  2ZQV A;  3O5P A;  3O5F A;  4W9O A;  2FAP A;  2AWG A;  2MPH A;  4TW6 A;  3NI6 A;  1A7X A;  3B7X A;  1NMV A;  1W26 A;  2N87 A;  1M5Y A;  1EYM A;  4QIB A;  3PRB A;  5DIU A;  4ODL A;  2PPP A;  2M2A A;  1JNS A;  1ZCN A;  1D7J A;  2LGO A;  1Q6H A;  2F21 A;  2KO7 A;  1P5Q A;  3JYJ A;  4BF8 A; 
#chains in the Genus database with same CATH topology
 5J6E A;  5HWB A;  1ROT A;  2Y78 A;  2XP7 A;  3OOB A;  4U84 A;  2A3C A;  1J4H A;  1N1A A;  3NTP A;  3O5J A;  1BL4 A;  3MDY B;  4DRH A;  3CHD A;  1EIB A;  2PPN A;  3WD4 A;  4UDM A;  4ODM A;  3RME A;  1L1P A;  3O5R A;  2OLH A;  1K9T A;  2MLZ A;  1XHG A;  1NSG A;  3LUO A;  1ZBC A;  1FKT A;  2F4E A;  1KT1 A;  1W1T A;  2PBC A;  2PV1 A;  2DSU A;  1HKJ A;  3IKD A;  1ZK6 A;  1E44 A;  1JNE A;  2A3B A;  1T11 A;  1D6O A;  1OGG A;  4DWS B;  3CZ8 A;  4DWS C;  1EDQ A;  2M1I A;  2Q5A A;  2ZR5 A;  4AY1 A;  3GU0 A;  1JCH B;  2F2D A;  1FKS A;  1LQ0 A;  1JVW A;  2KR7 A;  2FKE A;  1D7H A;  4ML4 A;  2DT2 A;  1GUV A;  4L72 B;  1FAP A;  1YAT A;  2B5U B;  3B8S A;  2YBT A;  4ZS6 A;  4Z2G A;  4MSP A;  3OA5 A;  1LG2 A;  4ODP A;  1ZBW A;  3O5E A;  2DG3 A;  1HKI A;  5DIT A;  3O5K A;  3EIP A;  3G6L A;  3O5D A;  3KCE A;  3RGC A;  1C9H A;  5HWC A;  2XP6 A;  2ZQU A;  3AS1 A;  3CHE A;  1X6N A;  5DEZ A;  5D75 A;  3IK8 A;  4N19 A;  1X6L A;  1W1P A;  1NWS A;  2K8I A;  3ARX A;  1F40 A;  3WD1 A;  3WL1 A;  2OFN A;  3O5P A;  3O5F A;  1FFR A;  2G8Z A;  4TW6 A;  3NI6 A;  2B31 A;  2PI6 A;  1M5Y A;  1UR8 A;  3CH9 A;  1JNS A;  1NWR A;  2KO7 A;  4ZPT R;  5DO2 A;  4BF8 A;  4DWS A;  4IT4 A;  2RUR A;  1U79 A;  3BXW A;  4TW7 A;  4DWS D;  2KI3 A;  4Q22 A;  1TFV A;  4W9Q A;  2YBU A;  3UI6 A;  2KE0 A;  3JXV A;  4DRO A;  3UF8 A;  3B9E A;  1OWQ A;  4U86 A;  3WD0 A;  3WQW A;  4J4O A;  4JFM A;  1J4R A;  1BKF A;  1GPF A;  2LKN A;  2XP8 A;  1ZL1 A;  1HXV A;  1R9H A;  1HKK A;  1KT0 A;  5GQB A;  4MTV A;  4TW8 A;  3RM4 A;  1HJW A;  1FKF A;  5GPR A;  4Z2J A;  1IX5 A;  1Q6U A;  3TC5 A;  1B6C A;  3KAI A;  3PA7 A;  3NRK A;  2QF8 A;  1KFW A;  4JFL A;  4Z2L A;  2ZR6 A;  1QZ2 A;  1E6P A;  2RUQ A;  2XP5 A;  3UI5 A;  4ODO A;  3O5L A;  4R0X A;  3ARO A;  1Y0O A;  4DRJ A;  1PBK A;  4MPK A;  3WKZ A;  1NWU A;  3RM9 A;  1JND A;  3WD3 A;  1J6Y A;  3GTY X;  4MGV A;  3KAB A;  2G41 A;  3TCZ A;  2A3E A;  1YW5 A;  4P8V A;  3ARV A;  2XP3 A;  1D7I A;  3B9A A;  3IKG A;  3WQV A;  3O5O A;  4G50 A;  5BXJ A;  2EUL A;  4MNL A;  1W9P A;  4TX0 A;  1H0G A;  3H9R B;  1LL7 A;  1RD6 A;  1WAW A;  4GIV A;  2RUC A;  3RM8 A;  3ARS A;  4R5E A;  1O6I A;  2VN1 A;  2PV3 A;  4Q7N A;  1FFQ A;  3ARQ A;  2DSV A;  3O5G A;  2DPE A;  4W9O A;  1E6N A;  2AWG A;  4WK9 A;  1E9L A;  1A7X A;  3B7X A;  1NMV A;  1W26 A;  1ZU8 A;  4ODL A;  2PPP A;  4QZV B;  2F21 A;  1P5Q A;  2A3A A;  3JYJ A;  4WKH A;  3KZ7 A;  4DZ3 A;  1FD9 A;  1LJY A;  4W9P A;  3AS3 A;  4ODN A;  1FJD A;  3FY1 A;  1HKM A;  4DH0 A;  5HW8 A;  3AS2 A;  2MLX A;  2RQS A;  5DIV A;  1FKD A;  1CTN A;  3O5M A;  4LAX A;  4DRM A;  4NZC A;  2LJ4 A;  3TDB A;  1SYT A;  1HJX A;  4JFK A;  4DRQ A;  1QPF A;  1Q6I A;  1F8A B;  4LGX A;  2ZR4 A;  5HT1 A;  3UQA A;  4G2P A;  1W1V A;  2DG9 A;  4U85 A;  1FKG A;  2PPO A;  2DT1 A;  2IF4 A;  1E6R A;  5HTG A;  2WM0 A;  5HW6 A;  4KR0 B;  1FKJ A;  4MNJ A;  2M08 A;  2KGJ A;  2DT0 A;  4S3K A;  4DRN A;  2ESC A;  3ALG A;  4ITZ A;  3AQU A;  2O92 A;  1W1Y A;  2WLY A;  4P8U A;  4QT2 A;  1FKH A;  3BMB A;  4JYS A;  4C02 B;  1NMW A;  3ARZ A;  4WKA A;  4LAW A;  3CGN A;  1NWT A;  2JZV A;  3CHC A;  3PRD A;  4TYO A;  1LG1 A;  3ARP A;  2XPB A;  1QPL A;  3FXY A;  3KAC A;  3RFW A;  4ODK A;  3KAD A;  4Z2I A;  3GPK A;  4JFI A;  4PTM A;  1Q1C A;  4HAR A;  4ODR A;  1WB0 A;  4LAV A;  1LL4 A;  2D9F A;  4DIP A;  3KAF A;  2WLZ A;  2ZQT A;  4URI A;  3CGM A;  3G6M A;  3IHZ A;  1SR0 A;  1E6Z A;  4GGQ A;  3WIJ A;  3O5I A;  4MNM A;  2VCD A;  3ALF A;  5JH8 A;  2ZQV A;  2MPH A;  4WJX A;  5DIU A;  3PRB A;  4S3J A;  2M2A A;  2LGO A;  1WNO A;  2UZ5 A;  3FAP A;  3PRA A;  5DF0 A;  4HBO A;  3WL0 A;  2DSZ A;  3ARW A;  1HJV A;  4FAP A;  3ARU A;  2WK2 A;  2ITK A;  2MLY A;  2IUZ A;  5I98 A;  1GOI A;  4KQZ A;  4IQ2 A;  1E15 A;  2PN0 A;  4MAV A;  3O5Q A;  1VF8 A;  1EHN A;  4Z2H A;  3ODK A;  4L3N A;  4P8W A;  4W5U A;  3JYM A;  2O9O A;  4ZPV R;  1FKR A;  5HBF A;  3WD2 A;  3UI4 A;  2PV2 A;  1PIN A;  1EQ3 A;  1NH6 A;  3KAH A;  3I6C A;  4DZ2 A;  2AOS A;  1JNT A;  2RUD A;  3QOK A;  2LPV A;  2ZQS A;  3ARY A;  3KAG A;  2DG4 A;  3ARR A;  4J4N A;  4IQC A;  5B8I C;  4P8X A;  4DRK A;  5GPG A;  3EY6 A;  1D2K A;  2KFW A;  1UR9 A;  4IT6 A;  4FN2 A;  1FKL A;  2MF9 A;  4ZPW R;  1ZB5 A;  1FKI A;  4HBE A;  1ZBK A;  2XPA A;  4ODQ A;  1TCO C;  4NSB A;  1FKB A;  1ITX A;  2ETN A;  2RSE A;  4QT3 A;  3B9D A;  2DSW A;  1W9V A;  1XRV A;  4DRI A;  5HKG A;  2DT3 A;  1FKK A;  1LL6 A;  1W9U A;  3CHF A;  3W4R A;  4TNS A;  4NNR A;  4XAK A;  4DRP A;  3AS0 A;  2XP9 A;  4WIW A;  3WH0 A;  4JFJ A;  3PR9 A;  4IPX A;  2FDM A;  4WKF A;  1J4I A;  1GRJ A;  5HUA A;  3UQI A;  5HW7 A;  1ZBV A;  1ROU A;  2MNT A;  4Z2K A;  3UQB A;  4DT4 A;  1H0I A;  3VAW A;  4LAY A;  2L2S A;  2P4V A;  4O2T A;  2XP4 A;  4MNK A;  2FAP A;  1OGB A;  2N87 A;  4QIB A;  1EYM A;  2F23 A;  1ZCN A;  1D7J A;  1Q6H A;  3ART A; 
#chains in the Genus database with same CATH homology
 5J6E A;  5HWB A;  1ROT A;  2Y78 A;  2XP7 A;  3OOB A;  4U84 A;  2A3C A;  1J4H A;  1N1A A;  3NTP A;  3O5J A;  1BL4 A;  3MDY B;  4DRH A;  3CHD A;  1EIB A;  2PPN A;  3WD4 A;  4ODM A;  3RME A;  1L1P A;  3O5R A;  2OLH A;  1K9T A;  2MLZ A;  1XHG A;  1NSG A;  3LUO A;  1ZBC A;  1FKT A;  2F4E A;  1KT1 A;  1W1T A;  2PBC A;  2PV1 A;  2DSU A;  1HKJ A;  3IKD A;  1ZK6 A;  1JNE A;  2A3B A;  1T11 A;  1D6O A;  1OGG A;  4DWS B;  3CZ8 A;  4DWS C;  1EDQ A;  2M1I A;  2Q5A A;  2ZR5 A;  4AY1 A;  2F2D A;  1FKS A;  1LQ0 A;  1JVW A;  2KR7 A;  2FKE A;  1D7H A;  4ML4 A;  2DT2 A;  1GUV A;  4L72 B;  1FAP A;  1YAT A;  3B8S A;  2YBT A;  4ZS6 A;  4Z2G A;  4MSP A;  3OA5 A;  1LG2 A;  4ODP A;  1ZBW A;  3O5E A;  2DG3 A;  1HKI A;  5DIT A;  3O5K A;  3G6L A;  3O5D A;  3KCE A;  3RGC A;  1C9H A;  5HWC A;  2XP6 A;  2ZQU A;  3AS1 A;  3CHE A;  1X6N A;  5DEZ A;  5D75 A;  3IK8 A;  4N19 A;  1X6L A;  1W1P A;  1NWS A;  2K8I A;  3ARX A;  1F40 A;  3WD1 A;  3WL1 A;  2OFN A;  3O5P A;  3O5F A;  1FFR A;  2G8Z A;  4TW6 A;  3NI6 A;  2B31 A;  2PI6 A;  1M5Y A;  1UR8 A;  3CH9 A;  1JNS A;  1NWR A;  2KO7 A;  4ZPT R;  5DO2 A;  4BF8 A;  4DWS A;  4IT4 A;  2RUR A;  1U79 A;  3BXW A;  4TW7 A;  4DWS D;  2KI3 A;  4Q22 A;  1TFV A;  4W9Q A;  2YBU A;  3UI6 A;  2KE0 A;  3JXV A;  4DRO A;  3UF8 A;  3B9E A;  1OWQ A;  4U86 A;  3WD0 A;  3WQW A;  4J4O A;  4JFM A;  1J4R A;  1BKF A;  1GPF A;  2LKN A;  2XP8 A;  1ZL1 A;  1HXV A;  1R9H A;  1HKK A;  1KT0 A;  5GQB A;  4MTV A;  4TW8 A;  3RM4 A;  1HJW A;  1FKF A;  5GPR A;  4Z2J A;  1IX5 A;  1Q6U A;  3TC5 A;  1B6C A;  3KAI A;  3PA7 A;  3NRK A;  2QF8 A;  1KFW A;  4JFL A;  4Z2L A;  2ZR6 A;  1QZ2 A;  1E6P A;  2RUQ A;  2XP5 A;  3UI5 A;  4ODO A;  3O5L A;  4R0X A;  3ARO A;  1Y0O A;  4DRJ A;  1PBK A;  4MPK A;  3WKZ A;  1NWU A;  3RM9 A;  1JND A;  3WD3 A;  1J6Y A;  4MGV A;  3KAB A;  2G41 A;  3TCZ A;  2A3E A;  1YW5 A;  4P8V A;  3ARV A;  2XP3 A;  1D7I A;  3B9A A;  3IKG A;  3WQV A;  3O5O A;  4G50 A;  5BXJ A;  4MNL A;  1W9P A;  4TX0 A;  1H0G A;  3H9R B;  1LL7 A;  1RD6 A;  1WAW A;  4GIV A;  2RUC A;  3RM8 A;  3ARS A;  4R5E A;  1O6I A;  2VN1 A;  2PV3 A;  4Q7N A;  1FFQ A;  3ARQ A;  2DSV A;  3O5G A;  2DPE A;  4W9O A;  1E6N A;  2AWG A;  4WK9 A;  1E9L A;  1A7X A;  3B7X A;  1NMV A;  1W26 A;  1ZU8 A;  4ODL A;  2PPP A;  4QZV B;  2F21 A;  1P5Q A;  2A3A A;  3JYJ A;  4WKH A;  3KZ7 A;  4DZ3 A;  1FD9 A;  1LJY A;  4W9P A;  3AS3 A;  4ODN A;  1FJD A;  3FY1 A;  1HKM A;  4DH0 A;  5HW8 A;  3AS2 A;  2MLX A;  2RQS A;  5DIV A;  1FKD A;  1CTN A;  3O5M A;  4LAX A;  4DRM A;  4NZC A;  2LJ4 A;  3TDB A;  1SYT A;  1HJX A;  4JFK A;  4DRQ A;  1QPF A;  1Q6I A;  1F8A B;  4LGX A;  2ZR4 A;  5HT1 A;  3UQA A;  4G2P A;  1W1V A;  2DG9 A;  4U85 A;  1FKG A;  2PPO A;  2DT1 A;  2IF4 A;  1E6R A;  5HTG A;  2WM0 A;  5HW6 A;  4KR0 B;  1FKJ A;  4MNJ A;  2M08 A;  2KGJ A;  2DT0 A;  4S3K A;  4DRN A;  2ESC A;  3ALG A;  4ITZ A;  3AQU A;  2O92 A;  1W1Y A;  2WLY A;  4P8U A;  4QT2 A;  1FKH A;  4C02 B;  4JYS A;  1NMW A;  3ARZ A;  4WKA A;  4LAW A;  3CGN A;  1NWT A;  2JZV A;  3CHC A;  3PRD A;  4TYO A;  1LG1 A;  3ARP A;  2XPB A;  1QPL A;  3FXY A;  3KAC A;  3RFW A;  4ODK A;  3KAD A;  4Z2I A;  3GPK A;  4JFI A;  4PTM A;  1Q1C A;  4HAR A;  4ODR A;  1WB0 A;  4LAV A;  1LL4 A;  2D9F A;  4DIP A;  3KAF A;  2WLZ A;  2ZQT A;  4URI A;  3CGM A;  3G6M A;  3IHZ A;  1SR0 A;  1E6Z A;  4GGQ A;  3WIJ A;  3O5I A;  4MNM A;  2VCD A;  3ALF A;  5JH8 A;  2ZQV A;  2MPH A;  4WJX A;  5DIU A;  3PRB A;  4S3J A;  2M2A A;  2LGO A;  1WNO A;  2UZ5 A;  3FAP A;  3PRA A;  5DF0 A;  4HBO A;  3WL0 A;  2DSZ A;  3ARW A;  1HJV A;  4FAP A;  3ARU A;  2WK2 A;  2ITK A;  2MLY A;  2IUZ A;  5I98 A;  1GOI A;  4KQZ A;  4IQ2 A;  1E15 A;  4MAV A;  3O5Q A;  1VF8 A;  1EHN A;  4Z2H A;  3ODK A;  4L3N A;  4P8W A;  4W5U A;  3JYM A;  2O9O A;  4ZPV R;  1FKR A;  5HBF A;  3WD2 A;  3UI4 A;  2PV2 A;  1PIN A;  1EQ3 A;  1NH6 A;  3KAH A;  3I6C A;  4DZ2 A;  2AOS A;  1JNT A;  2RUD A;  3QOK A;  2LPV A;  2ZQS A;  3ARY A;  3KAG A;  2DG4 A;  3ARR A;  4J4N A;  4IQC A;  5B8I C;  4P8X A;  4DRK A;  5GPG A;  3EY6 A;  1D2K A;  2KFW A;  1UR9 A;  4IT6 A;  4FN2 A;  1FKL A;  2MF9 A;  4ZPW R;  1ZB5 A;  1FKI A;  4HBE A;  1ZBK A;  2XPA A;  4ODQ A;  1TCO C;  4NSB A;  1FKB A;  1ITX A;  2RSE A;  4QT3 A;  3B9D A;  2DSW A;  1W9V A;  1XRV A;  4DRI A;  5HKG A;  2DT3 A;  1FKK A;  1LL6 A;  1W9U A;  3CHF A;  3W4R A;  4TNS A;  4NNR A;  4XAK A;  4DRP A;  3AS0 A;  2XP9 A;  4WIW A;  3WH0 A;  4JFJ A;  3PR9 A;  4IPX A;  2FDM A;  4WKF A;  1J4I A;  5HUA A;  3UQI A;  5HW7 A;  1ZBV A;  1ROU A;  2MNT A;  4Z2K A;  3UQB A;  4DT4 A;  1H0I A;  3VAW A;  4LAY A;  2L2S A;  4O2T A;  2XP4 A;  4MNK A;  2FAP A;  1OGB A;  2N87 A;  4QIB A;  1EYM A;  1ZCN A;  1D7J A;  1Q6H A;  3ART A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...