1HXVA

Ppiase domain of the mycoplasma genitalium trigger factor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
85
structure length
85
Chain Sequence
KLANGDIAIIDFTGIVDNKKLASASAQNYELTIGSNSFIKGFETGLIAMKVNQKKTLALTFPSDYHVKELQSKPVTFEVVLKAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords TRIGGER FACTOR
publication title NMR solution structure and dynamics of the peptidyl-prolyl cis-trans isomerase domain of the trigger factor from Mycoplasma genitalium compared to FK506-binding protein.
pubmed doi rcsb
source organism Mycoplasma genitalium
total genus 8
structure length 85
sequence length 85
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hxvA00
3H9RB 2RUCA 4TNSA 1Q6IA 2M1IA 2XP3A 3CGNA 2AWGA 3O5JA 2LGOA 4LAWA 4DRIA 4JFKA 4GGQA 1QPFA 4G2PA 2DG4A 1FKHA 3RGCA 2DG3A 3UQIA 1D7IA 2FAPA 3FAPA 4IQCA 4ODKA 5HT1A 1P5QA 1FJDA 4TW6A 2XP9A 1FKKA 1JVWA 2ZR5A 4O2TA 4U84A 1ZCNA 2F21A 1J4RA 1M5YA 3O5RA 2KI3A 2Y78A 1QPLA 1HXVA 2RURA 4ODMA 4MGVA 1FKTA 4J4NA 4R0XA 1YATA 4JFLA 1R9HA 5DIVA 5HW6A 1YW5A 3KAGA 1BKFA 3KAHA 1J4HA 2FKEA 2MNTA 2PV3A 4BF8A 4JFIA 1Q6UA 2KGJA 3KCEA 4DRJA 1Q6HA 2PPNA 3O5GA 2XP6A 2VCDA 4C02B 2KR7A 1J4IA 2LJ4A 3O5DA 1U79A 3IK8A 3O5IA 3TDBA 5HUAA 4W9QA 3O5PA 5HKGA 4ITZA 1W26A 2MLYA 1B6CA 1ROTA 4DZ3A 1QZ2A 3EY6A 5I98A 1FKJA 2ZQTA 2XPAA 2KE0A 3KADA 2ZR6A 1N1AA 3KAFA 1KT1A 1BL4A 3UI6A 1FD9A 1PBKA 1NMWA 1EQ3A 3UI4A 1F8AB 1FKLA 4DROA 2RUQA 4IPXA 3OOBA 3KACA 3MDYB 4GIVA 4N19A 2VN1A 2PBCA 4LAYA 4TW7A 4DRNA 1JNSA 4JFMA 4ODNA 5D75A 1A7XA 2ZQVA 1PINA 3ODKA 5HW8A 2PPOA 4FN2A 4TX0A 4JFJA 4QIBA 1L1PA 1F40A 2PV1A 2RSEA 3KZ7A 3PA7A 1D6OA 4DRQA 1NMVA 2DG9A 4G50A 4W9OA 2PPPA 3O5OA 5B8IC 2D9FA 3O5KA 4QT2A 5BXJA 1ZK6A 2ITKA 2XPBA 2F4EA 4LAVA 4LAXA 4U85A 1FKBA 4U86A 1FKRA 2L2SA 3LUOA 2K8IA 5HWBA 2KFWA 2UZ5A 3IHZA 1KT0A 2XP4A 3WH0A 3IKGA 2KO7A 2ZQUA 3TCZA 1D7HA 5J6EA 2RQSA 1FKIA 3KABA 3O5QA 1FAPA 3VAWA 4JYSA 2MF9A 1D7JA 4TW8A 1EYMA 5DITA 1T11A 3NI6A 3CGMA 4FAPA 1FKGA 2XP8A 3O5LA 4ODOA 3IKDA 5HTGA 3UQBA 3O5MA 5HWCA 1FKSA 2M08A 4DIPA 1FKDA 3JXVA 3NRKA 3KAIA 2M2AA 5GPGA 3RFWA 3UF8A 1FKFA 4DRKA 2LPVA 3TC5A 2XP5A 2XP7A 2PV2A 4QT3A 4DRPA 4DZ2A 3B7XA 3I6CA 4IQ2A 2OFNA 4DRHA 2MLXA 2F2DA 4DRMA 4TYOA 2N87A 3JYMA 2MPHA 4NNRA 3UQAA 4ODQA 2RUDA 4DH0A 3PRDA 4W9PA 1NSGA 2ZR4A 1ROUA 2LKNA 3UI5A 2Q5AA 4J4OA 3O5EA 1TCOC 4ODPA 4DT4A 2IF4A 1JNTA 1C9HA 3NTPA 2JZVA 4ODLA 3GPKA 2MLZA 1J6YA 1Q1CA 1Y0OA 2ZQSA 5DIUA 4MSPA 5HW7A 3PRBA 3JYJA 3O5FA 4ODRA
chains in the Genus database with same CATH superfamily
2RUCA 1VF8A 1J6YA 2AWGA 4DRIA 4JFKA 4GGQA 4HBOA 1UR8A 4QZVB 3CHFA 5GPRA 1NWSA 2DPEA 3FAPA 1O6IA 2YBTA 4U84A 2F21A 1M5YA 1E6ZA 3O5RA 3WQVA 1YATA 1W1YA 3WD4A 2DSWA 4BF8A 1Q6UA 4DRJA 3TDBA 4W9QA 2IUZA 1B6CA 1WNOA 1NWTA 4DWSB 3ARZA 3UI6A 1LJYA 1F8AB 4DROA 4IPXA 4N19A 3CHCA 4P8XA 4ODNA 1HKMA 1ITXA 2PV1A 1ZL1A 3GTYX 3KZ7A 3PA7A 4P8VA 5DO2A 1ZBWA 1GPFA 4R5EA 4WKHA 3O5KA 5BXJA 1ZK6A 2ESCA 2F4EA 1D2KA 4XAKA 1E44A 3PR9A 3ARQA 4U86A 2L2SA 2K8IA 2UZ5A 3IHZA 1KT0A 2ZQUA 3ALFA 3O5QA 1FAPA 3ARPA 1T11A 3NI6A 2PN0A 3CGMA 3O5LA 2DT0A 3UQBA 1FKSA 3AQUA 4HARA 2M2AA 3FXYA 2XP5A 3WQWA 1SR0A 3B7XA 3OA5A 4DRHA 2MLXA 3B9DA 3RM4A 1KFWA 4W9PA 3W4RA 1ROUA 1LG1A 1JNTA 2DT1A 3ARUA 1EHNA 2MLZA 1NWRA 1Q1CA 3WL0A 1FFRA 1RD6A 3H9RB 4TNSA 3WKZA 2G8ZA 3BMBA 1HJVA 3UQIA 1SYTA 4IQCA 4ODKA 5HT1A 1EDQA 4Z2HA 3PRAA 4LGXA 3ALGA 2KI3A 1GRJA 4ODMA 4J4NA 4MTVA 4R0XA 5HW6A 1R9HA 5DIVA 3KAGA 3QOKA 1J4HA 2MNTA 4JFIA 2KGJA 4S3KA 3O5GA 1ZBKA 2XP6A 3G6MA 1W9UA 3O5IA 1W26A 2MLYA 3GU0A 1IX5A 3ARWA 3EY6A 4Q22A 5I98A 4L72B 2ZR6A 3KAFA 1KT1A 1BL4A 1PBKA 3AROA 4WKAA 1EQ3A 2DSZA 1FKLA 2RUQA 3OOBA 2B31A 4GIVA 2VN1A 4KQZA 4PTMA 4JFMA 4Z2IA 5D75A 5HW8A 2WM0A 2PPOA 4TX0A 1W1VA 1X6LA 2A3CA 4MNMA 2RSEA 4Z2GA 4G50A 4W9OA 2PPPA 5HBFA 3O5OA 4AY1A 2D9FA 4QT2A 2B5UB 1FKBA 1FKRA 4P8WA 3FY1A 2XP4A 2KO7A 3CHDA 1LQ0A 3TCZA 1D7HA 1FKIA 1D7JA 3ARRA 4TW8A 1EYMA 2A3EA 1NWUA 3ARSA 3WD3A 1ZU8A 1WB0A 1ZBVA 5GPGA 1HKIA 1ZBCA 4ZS6A 3UQAA 1HJWA 2MPHA 4NNRA 4S3JA 3UI5A 3O5EA 2WLYA 2G41A 3GPKA 3RM9A 4Z2KA 1Q6IA 2M1IA 3O5JA 4LAWA 1QPFA 1W9PA 2DG4A 3RGCA 1D7IA 2FAPA 4IT4A 1EIBA 1P5QA 1FJDA 1FKKA 2ZR5A 5JH8A 2Y78A 1QPLA 2O9OA 4MGVA 1FKTA 3ARXA 4JFLA 1YW5A 3KAHA 1HKKA 3CZ8A 3WD0A 1OWQA 2OLHA 2ETNA 1Q6HA 1GOIA 2PPNA 2VCDA 4ZPWR 3O5DA 3IK8A 1H0GA 3O5PA 2WK2A 1ROTA 3RMEA 1QZ2A 4WIWA 1FKJA 1GUVA 2KE0A 3KADA 4DWSD 1N1AA 1W9VA 1FD9A 1W1TA 4WJXA 3UI4A 1E6RA 3WD1A 4TW7A 3KACA 1JCHB 3MDYB 4DRNA 4LAYA 4URIA 4ZPVR 2ZQVA 4FN2A 4JFJA 2O92A 4QIBA 1F40A 4DWSA 4DRQA 1NMVA 2DG9A 3EIPA 4DWSC 2A3BA 4LAVA 4U85A 4WKFA 1E9LA 4L3NA 3G6LA 3LUOA 3WH0A 3B9EA 2F23A 1JNDA 4P8UA 2AOSA 1E6NA 2RQSA 3KABA 3VAWA 4WK9A 2MF9A 1XRVA 1FKGA 2XP8A 4ODOA 4FAPA 5HTGA 3O5MA 3JXVA 3KAIA 2P4VA 3RFWA 3UF8A 1FKFA 4DRKA 2XP7A 4DRPA 4QT3A 4DZ2A 4IQ2A 4W5UA 4Q7NA 4DRMA 4TYOA 1LL4A 2N87A 4ODQA 2RUDA 4DH0A 2ZR4A 2Q5AA 2WLZA 2IF4A 3NTPA 3BXWA 1Y0OA 5DIUA 5HW7A 4MSPA 4Z2JA 3JYJA 3WL1A 4ODRA 2YBUA 3CH9A 2XP3A 5J6EA 3CGNA 1E15A 2LGOA 1LL7A 3RM8A 2DT2A 4G2PA 1FKHA 1HJXA 2DG3A 1X6NA 2PI6A 2FDMA 2A3AA 2DSVA 4TW6A 2XP9A 1JVWA 4O2TA 1ZCNA 1W1PA 1J4RA 5DEZA 1HXVA 2RURA 3ARTA 1HKJA 4NSBA 4NZCA 1BKFA 2QF8A 2FKEA 2PV3A 3B8SA 4MPKA 4UDMA 3KCEA 3AS2A 1OGBA 4C02B 1FFQA 2KR7A 1J4IA 2LJ4A 1U79A 5HUAA 5HKGA 4ITZA 4DZ3A 4MAVA 2ZQTA 2XPAA 1NMWA 3AS1A 1LL6A 3WD2A 2PBCA 4KR0B 1JNSA 3B9AA 1TFVA 1A7XA 1PINA 3ODKA 4ZPTR 1L1PA 1XHGA 1D6OA 4IT6A 3CHEA 4MNLA 5B8IC 2XPBA 2ITKA 4LAXA 1H0IA 1OGGA 5HWBA 2KFWA 1UR9A 2EULA 1LG2A 3IKGA 4MNKA 3WIJA 4ML4A 1CTNA 4JYSA 5DITA 2DT3A 3IKDA 5HWCA 2M08A 3AS0A 1ZB5A 4DIPA 4Z2LA 1FKDA 3NRKA 2DSUA 2LPVA 3TC5A 2PV2A 3I6CA 2OFNA 4HBEA 4MNJA 1E6PA 1WAWA 2F2DA 3JYMA 3PRDA 1NSGA 1JNEA 3ARVA 2LKNA 1NH6A 4J4OA 4ODPA 1K9TA 1TCOC 4DT4A 5GQBA 5DF0A 1C9HA 4ODLA 2JZVA 3AS3A 2ZQSA 3ARYA 3PRBA 3O5FA
chains in the Genus database with same CATH topology
2RUCA 1VF8A 1J6YA 2AWGA 4DRIA 4JFKA 4GGQA 4HBOA 1UR8A 4QZVB 3CHFA 5GPRA 1NWSA 2DPEA 3FAPA 1O6IA 2YBTA 4U84A 2F21A 1M5YA 1E6ZA 3O5RA 3WQVA 1YATA 1W1YA 3WD4A 2DSWA 4BF8A 1Q6UA 4DRJA 3TDBA 4W9QA 2IUZA 1B6CA 1WNOA 1NWTA 4DWSB 3ARZA 3UI6A 1LJYA 1F8AB 4DROA 4IPXA 4N19A 3CHCA 4P8XA 4ODNA 1HKMA 1ITXA 2PV1A 1ZL1A 3KZ7A 3PA7A 4P8VA 5DO2A 1ZBWA 1GPFA 4R5EA 4WKHA 3O5KA 5BXJA 1ZK6A 2ESCA 2F4EA 1D2KA 4XAKA 3PR9A 3ARQA 4U86A 2L2SA 2K8IA 2UZ5A 3IHZA 1KT0A 2ZQUA 3ALFA 3O5QA 1FAPA 3ARPA 1T11A 3NI6A 3CGMA 3O5LA 2DT0A 3UQBA 1FKSA 3AQUA 4HARA 2M2AA 3FXYA 2XP5A 3WQWA 1SR0A 3B7XA 3OA5A 4DRHA 2MLXA 3B9DA 3RM4A 1KFWA 4W9PA 3W4RA 1ROUA 1LG1A 1JNTA 2DT1A 3ARUA 1EHNA 2MLZA 1NWRA 1Q1CA 3WL0A 1FFRA 1RD6A 3H9RB 4TNSA 3WKZA 2G8ZA 1HJVA 3UQIA 1SYTA 4IQCA 4ODKA 5HT1A 1EDQA 4Z2HA 3PRAA 4LGXA 3ALGA 2KI3A 4ODMA 4J4NA 4MTVA 4R0XA 5HW6A 1R9HA 5DIVA 3KAGA 3QOKA 1J4HA 2MNTA 4JFIA 2KGJA 4S3KA 3O5GA 1ZBKA 2XP6A 3G6MA 1W9UA 3O5IA 1W26A 2MLYA 1IX5A 3ARWA 3EY6A 4Q22A 5I98A 4L72B 2ZR6A 3KAFA 1KT1A 1BL4A 1PBKA 3AROA 4WKAA 1EQ3A 2DSZA 1FKLA 2RUQA 3OOBA 2B31A 4GIVA 2VN1A 4KQZA 4PTMA 4JFMA 4Z2IA 5D75A 5HW8A 2WM0A 2PPOA 4TX0A 1W1VA 1X6LA 2A3CA 4MNMA 2RSEA 4Z2GA 4G50A 4W9OA 2PPPA 5HBFA 3O5OA 4AY1A 2D9FA 4QT2A 1FKBA 1FKRA 4P8WA 3FY1A 2XP4A 2KO7A 3CHDA 1LQ0A 3TCZA 1D7HA 1FKIA 1D7JA 3ARRA 4TW8A 1EYMA 2A3EA 1NWUA 3ARSA 3WD3A 1ZU8A 1WB0A 1ZBVA 5GPGA 1HKIA 1ZBCA 4ZS6A 3UQAA 1HJWA 2MPHA 4NNRA 4S3JA 3UI5A 3O5EA 2WLYA 2G41A 3GPKA 3RM9A 4Z2KA 1Q6IA 2M1IA 3O5JA 4LAWA 1QPFA 1W9PA 2DG4A 3RGCA 1D7IA 2FAPA 4IT4A 1EIBA 1P5QA 1FJDA 1FKKA 2ZR5A 5JH8A 2Y78A 1QPLA 2O9OA 4MGVA 1FKTA 3ARXA 4JFLA 1YW5A 3KAHA 1HKKA 3CZ8A 3WD0A 1OWQA 2OLHA 1Q6HA 1GOIA 2PPNA 2VCDA 4ZPWR 3O5DA 3IK8A 1H0GA 3O5PA 2WK2A 1ROTA 3RMEA 1QZ2A 4WIWA 1FKJA 1GUVA 2KE0A 3KADA 4DWSD 1N1AA 1W9VA 1FD9A 1W1TA 4WJXA 3UI4A 1E6RA 3WD1A 4TW7A 3KACA 3MDYB 4DRNA 4LAYA 4URIA 4ZPVR 2ZQVA 4FN2A 4JFJA 2O92A 4QIBA 1F40A 4DWSA 4DRQA 1NMVA 2DG9A 4DWSC 2A3BA 4LAVA 4U85A 4WKFA 1E9LA 4L3NA 3G6LA 3LUOA 3WH0A 3B9EA 1JNDA 4P8UA 2AOSA 1E6NA 2RQSA 3KABA 3VAWA 4WK9A 2MF9A 1XRVA 1FKGA 2XP8A 4ODOA 4FAPA 5HTGA 3O5MA 3JXVA 3KAIA 3RFWA 3UF8A 1FKFA 4DRKA 2XP7A 4DRPA 4QT3A 4DZ2A 4IQ2A 4W5UA 4Q7NA 4DRMA 4TYOA 1LL4A 2N87A 4ODQA 2RUDA 4DH0A 2ZR4A 2Q5AA 2WLZA 2IF4A 3NTPA 3BXWA 1Y0OA 5DIUA 5HW7A 4MSPA 4Z2JA 3JYJA 3WL1A 4ODRA 2YBUA 3CH9A 2XP3A 5J6EA 3CGNA 1E15A 2LGOA 1LL7A 3RM8A 2DT2A 4G2PA 1FKHA 1HJXA 2DG3A 1X6NA 2PI6A 2FDMA 2A3AA 2DSVA 4TW6A 2XP9A 1JVWA 4O2TA 1ZCNA 1W1PA 1J4RA 5DEZA 1HXVA 2RURA 3ARTA 1HKJA 4NSBA 4NZCA 1BKFA 2QF8A 2FKEA 2PV3A 3B8SA 4MPKA 3KCEA 3AS2A 1OGBA 4C02B 1FFQA 2KR7A 1J4IA 2LJ4A 1U79A 5HUAA 5HKGA 4ITZA 4DZ3A 4MAVA 2ZQTA 2XPAA 1NMWA 3AS1A 1LL6A 3WD2A 2PBCA 4KR0B 1JNSA 3B9AA 1TFVA 1A7XA 1PINA 3ODKA 4ZPTR 1L1PA 1XHGA 1D6OA 4IT6A 3CHEA 4MNLA 5B8IC 2XPBA 2ITKA 4LAXA 1H0IA 1OGGA 5HWBA 2KFWA 1UR9A 1LG2A 3IKGA 4MNKA 3WIJA 4ML4A 1CTNA 4JYSA 5DITA 2DT3A 3IKDA 5HWCA 2M08A 3AS0A 1ZB5A 4DIPA 4Z2LA 1FKDA 3NRKA 2DSUA 2LPVA 3TC5A 2PV2A 3I6CA 2OFNA 4HBEA 4MNJA 1E6PA 1WAWA 2F2DA 3JYMA 3PRDA 1NSGA 1JNEA 3ARVA 2LKNA 1NH6A 4J4OA 4ODPA 1K9TA 1TCOC 4DT4A 5GQBA 5DF0A 1C9HA 4ODLA 2JZVA 3AS3A 2ZQSA 3ARYA 3PRBA 3O5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H9R B;  2RUC A;  4TNS A;  1Q6I A;  2M1I A;  2XP3 A;  3CGN A;  2AWG A;  3O5J A;  2LGO A;  4LAW A;  4DRI A;  4JFK A;  4GGQ A;  1QPF A;  4G2P A;  2DG4 A;  1FKH A;  3RGC A;  2DG3 A;  3UQI A;  1D7I A;  2FAP A;  3FAP A;  4IQC A;  4ODK A;  5HT1 A;  1P5Q A;  1FJD A;  4TW6 A;  2XP9 A;  1FKK A;  1JVW A;  2ZR5 A;  4O2T A;  4U84 A;  1ZCN A;  2F21 A;  1J4R A;  1M5Y A;  3O5R A;  2KI3 A;  2Y78 A;  1QPL A;  1HXV A;  2RUR A;  4ODM A;  4MGV A;  1FKT A;  4J4N A;  4R0X A;  1YAT A;  4JFL A;  1R9H A;  5DIV A;  5HW6 A;  1YW5 A;  3KAG A;  1BKF A;  3KAH A;  1J4H A;  2FKE A;  2MNT A;  2PV3 A;  4BF8 A;  4JFI A;  1Q6U A;  2KGJ A;  3KCE A;  4DRJ A;  1Q6H A;  2PPN A;  3O5G A;  2XP6 A;  2VCD A;  4C02 B;  2KR7 A;  1J4I A;  2LJ4 A;  3O5D A;  1U79 A;  3IK8 A;  3O5I A;  3TDB A;  5HUA A;  4W9Q A;  3O5P A;  5HKG A;  4ITZ A;  1W26 A;  2MLY A;  1B6C A;  1ROT A;  4DZ3 A;  1QZ2 A;  3EY6 A;  5I98 A;  1FKJ A;  2ZQT A;  2XPA A;  2KE0 A;  3KAD A;  2ZR6 A;  1N1A A;  3KAF A;  1KT1 A;  1BL4 A;  3UI6 A;  1FD9 A;  1PBK A;  1NMW A;  1EQ3 A;  3UI4 A;  1F8A B;  1FKL A;  4DRO A;  2RUQ A;  4IPX A;  3OOB A;  3KAC A;  3MDY B;  4GIV A;  4N19 A;  2VN1 A;  2PBC A;  4LAY A;  4TW7 A;  4DRN A;  1JNS A;  4JFM A;  4ODN A;  5D75 A;  1A7X A;  2ZQV A;  1PIN A;  3ODK A;  5HW8 A;  2PPO A;  4FN2 A;  4TX0 A;  4JFJ A;  4QIB A;  1L1P A;  1F40 A;  2PV1 A;  2RSE A;  3KZ7 A;  3PA7 A;  1D6O A;  4DRQ A;  1NMV A;  2DG9 A;  4G50 A;  4W9O A;  2PPP A;  3O5O A;  5B8I C;  2D9F A;  3O5K A;  4QT2 A;  5BXJ A;  1ZK6 A;  2ITK A;  2XPB A;  2F4E A;  4LAV A;  4LAX A;  4U85 A;  1FKB A;  4U86 A;  1FKR A;  2L2S A;  3LUO A;  2K8I A;  5HWB A;  2KFW A;  2UZ5 A;  3IHZ A;  1KT0 A;  2XP4 A;  3WH0 A;  3IKG A;  2KO7 A;  2ZQU A;  3TCZ A;  1D7H A;  5J6E A;  2RQS A;  1FKI A;  3KAB A;  3O5Q A;  1FAP A;  3VAW A;  4JYS A;  2MF9 A;  1D7J A;  4TW8 A;  1EYM A;  5DIT A;  1T11 A;  3NI6 A;  3CGM A;  4FAP A;  1FKG A;  2XP8 A;  3O5L A;  4ODO A;  3IKD A;  5HTG A;  3UQB A;  3O5M A;  5HWC A;  1FKS A;  2M08 A;  4DIP A;  1FKD A;  3JXV A;  3NRK A;  3KAI A;  2M2A A;  5GPG A;  3RFW A;  3UF8 A;  1FKF A;  4DRK A;  2LPV A;  3TC5 A;  2XP5 A;  2XP7 A;  2PV2 A;  4QT3 A;  4DRP A;  4DZ2 A;  3B7X A;  3I6C A;  4IQ2 A;  2OFN A;  4DRH A;  2MLX A;  2F2D A;  4DRM A;  4TYO A;  2N87 A;  3JYM A;  2MPH A;  4NNR A;  3UQA A;  4ODQ A;  2RUD A;  4DH0 A;  3PRD A;  4W9P A;  1NSG A;  2ZR4 A;  1ROU A;  2LKN A;  3UI5 A;  2Q5A A;  4J4O A;  3O5E A;  1TCO C;  4ODP A;  4DT4 A;  2IF4 A;  1JNT A;  1C9H A;  3NTP A;  2JZV A;  4ODL A;  3GPK A;  2MLZ A;  1J6Y A;  1Q1C A;  1Y0O A;  2ZQS A;  5DIU A;  4MSP A;  5HW7 A;  3PRB A;  3JYJ A;  3O5F A;  4ODR A; 
#chains in the Genus database with same CATH topology
 2RUC A;  1VF8 A;  1J6Y A;  2AWG A;  4DRI A;  4JFK A;  4GGQ A;  4HBO A;  1UR8 A;  4QZV B;  3CHF A;  5GPR A;  1NWS A;  2DPE A;  3FAP A;  1O6I A;  2YBT A;  4U84 A;  2F21 A;  1M5Y A;  1E6Z A;  3O5R A;  3WQV A;  1YAT A;  1W1Y A;  3WD4 A;  2DSW A;  4BF8 A;  1Q6U A;  4DRJ A;  3TDB A;  4W9Q A;  2IUZ A;  1B6C A;  1WNO A;  1NWT A;  4DWS B;  3ARZ A;  3UI6 A;  1LJY A;  1F8A B;  4DRO A;  4IPX A;  4N19 A;  3CHC A;  4P8X A;  4ODN A;  1HKM A;  1ITX A;  2PV1 A;  1ZL1 A;  3GTY X;  3KZ7 A;  3PA7 A;  4P8V A;  5DO2 A;  1ZBW A;  1GPF A;  4R5E A;  4WKH A;  3O5K A;  5BXJ A;  1ZK6 A;  2ESC A;  2F4E A;  1D2K A;  4XAK A;  1E44 A;  3PR9 A;  3ARQ A;  4U86 A;  2L2S A;  2K8I A;  2UZ5 A;  3IHZ A;  1KT0 A;  2ZQU A;  3ALF A;  3O5Q A;  1FAP A;  3ARP A;  1T11 A;  3NI6 A;  2PN0 A;  3CGM A;  3O5L A;  2DT0 A;  3UQB A;  1FKS A;  3AQU A;  4HAR A;  2M2A A;  3FXY A;  2XP5 A;  3WQW A;  1SR0 A;  3B7X A;  3OA5 A;  4DRH A;  2MLX A;  3B9D A;  3RM4 A;  1KFW A;  4W9P A;  3W4R A;  1ROU A;  1LG1 A;  1JNT A;  2DT1 A;  3ARU A;  1EHN A;  2MLZ A;  1NWR A;  1Q1C A;  3WL0 A;  1FFR A;  1RD6 A;  3H9R B;  4TNS A;  3WKZ A;  2G8Z A;  3BMB A;  1HJV A;  3UQI A;  1SYT A;  4IQC A;  4ODK A;  5HT1 A;  1EDQ A;  4Z2H A;  3PRA A;  4LGX A;  3ALG A;  2KI3 A;  1GRJ A;  4ODM A;  4J4N A;  4MTV A;  4R0X A;  5HW6 A;  1R9H A;  5DIV A;  3KAG A;  3QOK A;  1J4H A;  2MNT A;  4JFI A;  2KGJ A;  4S3K A;  3O5G A;  1ZBK A;  2XP6 A;  3G6M A;  1W9U A;  3O5I A;  1W26 A;  2MLY A;  3GU0 A;  1IX5 A;  3ARW A;  3EY6 A;  4Q22 A;  5I98 A;  4L72 B;  2ZR6 A;  3KAF A;  1KT1 A;  1BL4 A;  1PBK A;  3ARO A;  4WKA A;  1EQ3 A;  2DSZ A;  1FKL A;  2RUQ A;  3OOB A;  2B31 A;  4GIV A;  2VN1 A;  4KQZ A;  4PTM A;  4JFM A;  4Z2I A;  5D75 A;  5HW8 A;  2WM0 A;  2PPO A;  4TX0 A;  1W1V A;  1X6L A;  2A3C A;  4MNM A;  2RSE A;  4Z2G A;  4G50 A;  4W9O A;  2PPP A;  5HBF A;  3O5O A;  4AY1 A;  2D9F A;  4QT2 A;  2B5U B;  1FKB A;  1FKR A;  4P8W A;  3FY1 A;  2XP4 A;  2KO7 A;  3CHD A;  1LQ0 A;  3TCZ A;  1D7H A;  1FKI A;  1D7J A;  3ARR A;  4TW8 A;  1EYM A;  2A3E A;  1NWU A;  3ARS A;  3WD3 A;  1ZU8 A;  1WB0 A;  1ZBV A;  5GPG A;  1HKI A;  1ZBC A;  4ZS6 A;  3UQA A;  1HJW A;  2MPH A;  4NNR A;  4S3J A;  3UI5 A;  3O5E A;  2WLY A;  2G41 A;  3GPK A;  3RM9 A;  4Z2K A;  1Q6I A;  2M1I A;  3O5J A;  4LAW A;  1QPF A;  1W9P A;  2DG4 A;  3RGC A;  1D7I A;  2FAP A;  4IT4 A;  1EIB A;  1P5Q A;  1FJD A;  1FKK A;  2ZR5 A;  5JH8 A;  2Y78 A;  1QPL A;  2O9O A;  4MGV A;  1FKT A;  3ARX A;  4JFL A;  1YW5 A;  3KAH A;  1HKK A;  3CZ8 A;  3WD0 A;  1OWQ A;  2OLH A;  2ETN A;  1Q6H A;  1GOI A;  2PPN A;  2VCD A;  4ZPW R;  3O5D A;  3IK8 A;  1H0G A;  3O5P A;  2WK2 A;  1ROT A;  3RME A;  1QZ2 A;  4WIW A;  1FKJ A;  1GUV A;  2KE0 A;  3KAD A;  4DWS D;  1N1A A;  1W9V A;  1FD9 A;  1W1T A;  4WJX A;  3UI4 A;  1E6R A;  3WD1 A;  4TW7 A;  3KAC A;  1JCH B;  3MDY B;  4DRN A;  4LAY A;  4URI A;  4ZPV R;  2ZQV A;  4FN2 A;  4JFJ A;  2O92 A;  4QIB A;  1F40 A;  4DWS A;  4DRQ A;  1NMV A;  2DG9 A;  3EIP A;  4DWS C;  2A3B A;  4LAV A;  4U85 A;  4WKF A;  1E9L A;  4L3N A;  3G6L A;  3LUO A;  3WH0 A;  3B9E A;  2F23 A;  1JND A;  4P8U A;  2AOS A;  1E6N A;  2RQS A;  3KAB A;  3VAW A;  4WK9 A;  2MF9 A;  1XRV A;  1FKG A;  2XP8 A;  4ODO A;  4FAP A;  5HTG A;  3O5M A;  3JXV A;  3KAI A;  2P4V A;  3RFW A;  3UF8 A;  1FKF A;  4DRK A;  2XP7 A;  4DRP A;  4QT3 A;  4DZ2 A;  4IQ2 A;  4W5U A;  4Q7N A;  4DRM A;  4TYO A;  1LL4 A;  2N87 A;  4ODQ A;  2RUD A;  4DH0 A;  2ZR4 A;  2Q5A A;  2WLZ A;  2IF4 A;  3NTP A;  3BXW A;  1Y0O A;  5DIU A;  5HW7 A;  4MSP A;  4Z2J A;  3JYJ A;  3WL1 A;  4ODR A;  2YBU A;  3CH9 A;  2XP3 A;  5J6E A;  3CGN A;  1E15 A;  2LGO A;  1LL7 A;  3RM8 A;  2DT2 A;  4G2P A;  1FKH A;  1HJX A;  2DG3 A;  1X6N A;  2PI6 A;  2FDM A;  2A3A A;  2DSV A;  4TW6 A;  2XP9 A;  1JVW A;  4O2T A;  1ZCN A;  1W1P A;  1J4R A;  5DEZ A;  1HXV A;  2RUR A;  3ART A;  1HKJ A;  4NSB A;  4NZC A;  1BKF A;  2QF8 A;  2FKE A;  2PV3 A;  3B8S A;  4MPK A;  4UDM A;  3KCE A;  3AS2 A;  1OGB A;  4C02 B;  1FFQ A;  2KR7 A;  1J4I A;  2LJ4 A;  1U79 A;  5HUA A;  5HKG A;  4ITZ A;  4DZ3 A;  4MAV A;  2ZQT A;  2XPA A;  1NMW A;  3AS1 A;  1LL6 A;  3WD2 A;  2PBC A;  4KR0 B;  1JNS A;  3B9A A;  1TFV A;  1A7X A;  1PIN A;  3ODK A;  4ZPT R;  1L1P A;  1XHG A;  1D6O A;  4IT6 A;  3CHE A;  4MNL A;  5B8I C;  2XPB A;  2ITK A;  4LAX A;  1H0I A;  1OGG A;  5HWB A;  2KFW A;  1UR9 A;  2EUL A;  1LG2 A;  3IKG A;  4MNK A;  3WIJ A;  4ML4 A;  1CTN A;  4JYS A;  5DIT A;  2DT3 A;  3IKD A;  5HWC A;  2M08 A;  3AS0 A;  1ZB5 A;  4DIP A;  4Z2L A;  1FKD A;  3NRK A;  2DSU A;  2LPV A;  3TC5 A;  2PV2 A;  3I6C A;  2OFN A;  4HBE A;  4MNJ A;  1E6P A;  1WAW A;  2F2D A;  3JYM A;  3PRD A;  1NSG A;  1JNE A;  3ARV A;  2LKN A;  1NH6 A;  4J4O A;  4ODP A;  1K9T A;  1TCO C;  4DT4 A;  5GQB A;  5DF0 A;  1C9H A;  4ODL A;  2JZV A;  3AS3 A;  2ZQS A;  3ARY A;  3PRB A;  3O5F A; 
#chains in the Genus database with same CATH homology
 2RUC A;  1VF8 A;  1J6Y A;  2AWG A;  4DRI A;  4JFK A;  4GGQ A;  4HBO A;  1UR8 A;  4QZV B;  3CHF A;  5GPR A;  1NWS A;  2DPE A;  3FAP A;  1O6I A;  2YBT A;  4U84 A;  2F21 A;  1M5Y A;  1E6Z A;  3O5R A;  3WQV A;  1YAT A;  1W1Y A;  3WD4 A;  2DSW A;  4BF8 A;  1Q6U A;  4DRJ A;  3TDB A;  4W9Q A;  2IUZ A;  1B6C A;  1WNO A;  1NWT A;  4DWS B;  3ARZ A;  3UI6 A;  1LJY A;  1F8A B;  4DRO A;  4IPX A;  4N19 A;  3CHC A;  4P8X A;  4ODN A;  1HKM A;  1ITX A;  2PV1 A;  1ZL1 A;  3KZ7 A;  3PA7 A;  4P8V A;  5DO2 A;  1ZBW A;  1GPF A;  4R5E A;  4WKH A;  3O5K A;  5BXJ A;  1ZK6 A;  2ESC A;  2F4E A;  1D2K A;  4XAK A;  3PR9 A;  3ARQ A;  4U86 A;  2L2S A;  2K8I A;  2UZ5 A;  3IHZ A;  1KT0 A;  2ZQU A;  3ALF A;  3O5Q A;  1FAP A;  3ARP A;  1T11 A;  3NI6 A;  3CGM A;  3O5L A;  2DT0 A;  3UQB A;  1FKS A;  3AQU A;  4HAR A;  2M2A A;  3FXY A;  2XP5 A;  3WQW A;  1SR0 A;  3B7X A;  3OA5 A;  4DRH A;  2MLX A;  3B9D A;  3RM4 A;  1KFW A;  4W9P A;  3W4R A;  1ROU A;  1LG1 A;  1JNT A;  2DT1 A;  3ARU A;  1EHN A;  2MLZ A;  1NWR A;  1Q1C A;  3WL0 A;  1FFR A;  1RD6 A;  3H9R B;  4TNS A;  3WKZ A;  2G8Z A;  1HJV A;  3UQI A;  1SYT A;  4IQC A;  4ODK A;  5HT1 A;  1EDQ A;  4Z2H A;  3PRA A;  4LGX A;  3ALG A;  2KI3 A;  4ODM A;  4J4N A;  4MTV A;  4R0X A;  5HW6 A;  1R9H A;  5DIV A;  3KAG A;  3QOK A;  1J4H A;  2MNT A;  4JFI A;  2KGJ A;  4S3K A;  3O5G A;  1ZBK A;  2XP6 A;  3G6M A;  1W9U A;  3O5I A;  1W26 A;  2MLY A;  1IX5 A;  3ARW A;  3EY6 A;  4Q22 A;  5I98 A;  4L72 B;  2ZR6 A;  3KAF A;  1KT1 A;  1BL4 A;  1PBK A;  3ARO A;  4WKA A;  1EQ3 A;  2DSZ A;  1FKL A;  2RUQ A;  3OOB A;  2B31 A;  4GIV A;  2VN1 A;  4KQZ A;  4PTM A;  4JFM A;  4Z2I A;  5D75 A;  5HW8 A;  2WM0 A;  2PPO A;  4TX0 A;  1W1V A;  1X6L A;  2A3C A;  4MNM A;  2RSE A;  4Z2G A;  4G50 A;  4W9O A;  2PPP A;  5HBF A;  3O5O A;  4AY1 A;  2D9F A;  4QT2 A;  1FKB A;  1FKR A;  4P8W A;  3FY1 A;  2XP4 A;  2KO7 A;  3CHD A;  1LQ0 A;  3TCZ A;  1D7H A;  1FKI A;  1D7J A;  3ARR A;  4TW8 A;  1EYM A;  2A3E A;  1NWU A;  3ARS A;  3WD3 A;  1ZU8 A;  1WB0 A;  1ZBV A;  5GPG A;  1HKI A;  1ZBC A;  4ZS6 A;  3UQA A;  1HJW A;  2MPH A;  4NNR A;  4S3J A;  3UI5 A;  3O5E A;  2WLY A;  2G41 A;  3GPK A;  3RM9 A;  4Z2K A;  1Q6I A;  2M1I A;  3O5J A;  4LAW A;  1QPF A;  1W9P A;  2DG4 A;  3RGC A;  1D7I A;  2FAP A;  4IT4 A;  1EIB A;  1P5Q A;  1FJD A;  1FKK A;  2ZR5 A;  5JH8 A;  2Y78 A;  1QPL A;  2O9O A;  4MGV A;  1FKT A;  3ARX A;  4JFL A;  1YW5 A;  3KAH A;  1HKK A;  3CZ8 A;  3WD0 A;  1OWQ A;  2OLH A;  1Q6H A;  1GOI A;  2PPN A;  2VCD A;  4ZPW R;  3O5D A;  3IK8 A;  1H0G A;  3O5P A;  2WK2 A;  1ROT A;  3RME A;  1QZ2 A;  4WIW A;  1FKJ A;  1GUV A;  2KE0 A;  3KAD A;  4DWS D;  1N1A A;  1W9V A;  1FD9 A;  1W1T A;  4WJX A;  3UI4 A;  1E6R A;  3WD1 A;  4TW7 A;  3KAC A;  3MDY B;  4DRN A;  4LAY A;  4URI A;  4ZPV R;  2ZQV A;  4FN2 A;  4JFJ A;  2O92 A;  4QIB A;  1F40 A;  4DWS A;  4DRQ A;  1NMV A;  2DG9 A;  4DWS C;  2A3B A;  4LAV A;  4U85 A;  4WKF A;  1E9L A;  4L3N A;  3G6L A;  3LUO A;  3WH0 A;  3B9E A;  1JND A;  4P8U A;  2AOS A;  1E6N A;  2RQS A;  3KAB A;  3VAW A;  4WK9 A;  2MF9 A;  1XRV A;  1FKG A;  2XP8 A;  4ODO A;  4FAP A;  5HTG A;  3O5M A;  3JXV A;  3KAI A;  3RFW A;  3UF8 A;  1FKF A;  4DRK A;  2XP7 A;  4DRP A;  4QT3 A;  4DZ2 A;  4IQ2 A;  4W5U A;  4Q7N A;  4DRM A;  4TYO A;  1LL4 A;  2N87 A;  4ODQ A;  2RUD A;  4DH0 A;  2ZR4 A;  2Q5A A;  2WLZ A;  2IF4 A;  3NTP A;  3BXW A;  1Y0O A;  5DIU A;  5HW7 A;  4MSP A;  4Z2J A;  3JYJ A;  3WL1 A;  4ODR A;  2YBU A;  3CH9 A;  2XP3 A;  5J6E A;  3CGN A;  1E15 A;  2LGO A;  1LL7 A;  3RM8 A;  2DT2 A;  4G2P A;  1FKH A;  1HJX A;  2DG3 A;  1X6N A;  2PI6 A;  2FDM A;  2A3A A;  2DSV A;  4TW6 A;  2XP9 A;  1JVW A;  4O2T A;  1ZCN A;  1W1P A;  1J4R A;  5DEZ A;  1HXV A;  2RUR A;  3ART A;  1HKJ A;  4NSB A;  4NZC A;  1BKF A;  2QF8 A;  2FKE A;  2PV3 A;  3B8S A;  4MPK A;  3KCE A;  3AS2 A;  1OGB A;  4C02 B;  1FFQ A;  2KR7 A;  1J4I A;  2LJ4 A;  1U79 A;  5HUA A;  5HKG A;  4ITZ A;  4DZ3 A;  4MAV A;  2ZQT A;  2XPA A;  1NMW A;  3AS1 A;  1LL6 A;  3WD2 A;  2PBC A;  4KR0 B;  1JNS A;  3B9A A;  1TFV A;  1A7X A;  1PIN A;  3ODK A;  4ZPT R;  1L1P A;  1XHG A;  1D6O A;  4IT6 A;  3CHE A;  4MNL A;  5B8I C;  2XPB A;  2ITK A;  4LAX A;  1H0I A;  1OGG A;  5HWB A;  2KFW A;  1UR9 A;  1LG2 A;  3IKG A;  4MNK A;  3WIJ A;  4ML4 A;  1CTN A;  4JYS A;  5DIT A;  2DT3 A;  3IKD A;  5HWC A;  2M08 A;  3AS0 A;  1ZB5 A;  4DIP A;  4Z2L A;  1FKD A;  3NRK A;  2DSU A;  2LPV A;  3TC5 A;  2PV2 A;  3I6C A;  2OFN A;  4HBE A;  4MNJ A;  1E6P A;  1WAW A;  2F2D A;  3JYM A;  3PRD A;  1NSG A;  1JNE A;  3ARV A;  2LKN A;  1NH6 A;  4J4O A;  4ODP A;  1K9T A;  1TCO C;  4DT4 A;  5GQB A;  5DF0 A;  1C9H A;  4ODL A;  2JZV A;  3AS3 A;  2ZQS A;  3ARY A;  3PRB A;  3O5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...