1IX5A

Solution structure of the methanococcus thermolithotrophicus fkbp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
151
structure length
151
Chain Sequence
MVDKGVKIKVDYIGKLESGDVFDTSIEEVAKEAGIYAPDREYEPLEFVVGEGQLIQGFEEAVLDMEVGDEKTVKIPAEKAYGNRNEMLIQKIPRDAFKEADFEPEEGMVILAEGIPATITEVTDNEVTLDFNHELAGKDLVFTIKIIEVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FKBP
publication title Three-dimensional Solution Structure of an Archaeal FKBP with a Dual Function of Peptidyl Prolyl cis-trans Isomerase and Chaperone-like Activities
pubmed doi rcsb
source organism Methanothermococcus thermolithotrophicus
total genus 17
structure length 151
sequence length 151
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.80 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1ix5A00
1IX5A 3PRAA 3PR9A
chains in the Genus database with same CATH superfamily
3NTPA 4UDMA 1D2KA 1SYTA 4ODRA 4DRQA 3PA7A 4J4OA 1W1PA 1ZCNA 1ZB5A 2PI6A 2K8IA 3KABA 4MNKA 4R5EA 2FDMA 3KAHA 4DZ3A 5HW8A 4DIPA 3KACA 4WK9A 2MNTA 1E9LA 1Q1CA 3IK8A 1Q6IA 4Q7NA 2XPBA 4TX0A 1TCOC 3AS0A 5GQBA 4WJXA 1TFVA 1H0GA 1J4HA 3ARVA 4DH0A 1U79A 1OGBA 1F40A 1Y0OA 4S3JA 3UI6A 1J4IA 1L1PA 2DG4A 5D75A 2WM0A 2Q5AA 3EY6A 4Z2HA 2DSWA 3PR9A 1WNOA 1LG2A 3KAIA 3FXYA 4NNRA 3RMEA 1B6CA 3ARXA 2G8ZA 1ZBCA 3B9EA 2DT1A 2O9OA 4GIVA 4DT4A 5JH8A 1ITXA 5HBFA 1HKMA 1EHNA 3TC5A 4IT6A 4JFMA 3RM8A 4JYSA 3JYMA 4Z2JA 4JFJA 1F8AB 4JFLA 4ODQA 2G41A 1ZL1A 3ARTA 4Q22A 4LAXA 1W26A 4Z2KA 2KI3A 3GU0A 4O2TA 4DWSA 2B31A 1CTNA 4NSBA 2ITKA 4W9OA 4DRPA 5DO2A 2KFWA 1NMVA 1X6LA 1JCHB 1YW5A 2DPEA 2ZQTA 1O6IA 4KQZA 3KAFA 4P8XA 1XRVA 4S3KA 4G50A 3WQWA 3B9AA 1FKRA 4MAVA 3CGMA 4TW8A 3KZ7A 3UQBA 2A3AA 3ARZA 1GRJA 3O5GA 3B7XA 1PBKA 4JFKA 1E15A 5DIUA 5HW6A 1FKGA 4ZS6A 2RURA 1HKKA 1P5QA 4ZPTR 4DRIA 4FAPA 3JXVA 3ODKA 2DG3A 4KR0B 4MGVA 4WKHA 4ZPWR 1FKKA 1W9UA 2MPHA 3ALGA 1HJWA 5HUAA 4XAKA 3AROA 1M5YA 4W5UA 2A3BA 3WIJA 4ODLA 4Z2IA 4W9PA 1ROUA 3O5QA 3IKDA 1NWSA 1HJXA 1Q6UA 5HKGA 1KFWA 3BMBA 4LGXA 4IQ2A 2M08A 3WD1A 3AS1A 1HXVA 3KADA 1R9HA 3O5MA 4AY1A 2KGJA 4P8WA 2XP9A 3ARPA 4MSPA 1ZBWA 2LPVA 1J6YA 1LL7A 2IF4A 4U85A 4MNMA 5DIVA 2VN1A 5DEZA 3O5JA 1OWQA 2LJ4A 1W1TA 3PRDA 1T11A 4J4NA 2P4VA 3LUOA 4DWSB 3GPKA 4LAVA 1C9HA 3CHEA 3I6CA 3ARUA 5GPRA 4G2PA 1FFQA 1ZU8A 1FJDA 3TCZA 3UI4A 2XPAA 2JZVA 3WL0A 1FKLA 2ZR6A 5B8IC 3O5IA 2FAPA 5HWBA 1GPFA 3ARRA 3VAWA 3UQAA 4ZPVR 3JYJA 1ROTA 2F4EA 5HWCA 2MF9A 1GOIA 3CGNA 1WAWA 1BKFA 1D6OA 1E6RA 4P8UA 1BL4A 2UZ5A 3KCEA 3CHCA 4HBEA 3QOKA 2RUQA 3WD4A 1D7IA 2O92A 4ML4A 4DZ2A 4DRNA 1EIBA 3OOBA 3ARSA 3AQUA 2PPPA 4IQCA 2LGOA 1N1AA 4MTVA 4Z2GA 4MPKA 4U86A 3O5KA 2A3EA 2KO7A 4DRMA 2KR7A 3ALFA 3PRBA 3UI5A 2DT3A 2RUDA 1UR9A 3RM4A 5I98A 2DSUA 1OGGA 3CHDA 1HKJA 1LQ0A 1ZK6A 1EQ3A 3UF8A 5J6EA 1X6NA 1H0IA 1W9VA 2F23A 2KE0A 3O5OA 4DWSD 4HBOA 3CZ8A 1E6ZA 2WLYA 4N19A 1GUVA 4QZVB 3G6MA 1EYMA 2B5UB 4LAYA 2ZR4A 1JNEA 3RFWA 2OFNA 3WKZA 1JNDA 4ITZA 4BF8A 2F2DA 4FN2A 2AWGA 5GPGA 4IPXA 1JNSA 3ARWA 2DSZA 1FKJA 3UQIA 2F21A 1KT0A 4TW6A 4TNSA 2XP5A 2ZQUA 4DRHA 1FKTA 1SR0A 3O5EA 3G6LA 1EDQA 4DRJA 1JVWA 4HARA 5DITA 3CHFA 1E6NA 2PBCA 1NMWA 2LKNA 1W1VA 4WKFA 2FKEA 3B9DA 2YBTA 3RGCA 2AOSA 2PN0A 2N87A 2XP4A 4ODPA 1JNTA 4W9QA 1HJVA 4L3NA 1FKHA 1Q6HA 3MDYB 4LAWA 2IUZA 2OLHA 4URIA 1PINA 1FD9A 3WL1A 2DT2A 1FFRA 3EIPA 2QF8A 4ODOA 3WD2A 1FKSA 4QT2A 3PRAA 1VF8A 2RUCA 3BXWA 3NRKA 1NWTA 1W9PA 2WK2A 4U84A 4QIBA 1ZBVA 2ESCA 3FAPA 4PTMA 2XP3A 2WLZA 4C02B 3AS3A 5HW7A 1E44A 1K9TA 1FAPA 1NWRA 1YATA 2XP7A 1W1YA 2EULA 3O5LA 2ZQVA 3O5PA 4ODMA 3O5FA 2MLXA 4GGQA 4NZCA 4L72B 3WH0A 3TDBA 3O5RA 1IX5A 1QPLA 1UR8A 4TW7A 1J4RA 2L2SA 1NWUA 3AS2A 2PPNA 1RD6A 4ODKA 4WKAA 1KT1A 3KAGA 1FKDA 2A3CA 1FKBA 3NI6A 2M1IA 2DSVA 4DWSC 2XP6A 3ARYA 2MLYA 3WD0A 3H9RB 4TYOA 5HT1A 1D7HA 1LG1A 4DROA 1NSGA 4DRKA 2D9FA 2Y78A 4MNLA 1FKIA 2MLZA 3IHZA 2XP8A 1E6PA 2DT0A 1XHGA 4Z2LA 2PPOA 3ARQA 2RQSA 2ZR5A 2ETNA 1LJYA 3RM9A 2VCDA 2ZQSA 4JFIA 3WQVA 1LL4A 5HTGA 1LL6A 3CH9A 5DF0A 2PV1A 5BXJA 1HKIA 3WD3A 1WB0A 2DG9A 4QT3A 1FKFA 1QPFA 1QZ2A 1ZBKA 2YBUA 1D7JA 4P8VA 4ODNA 4MNJA 3OA5A 4WIWA 3IKGA 3W4RA 3O5DA 2M2AA 4IT4A 1NH6A 1A7XA 2PV2A 3GTYX 3FY1A 3B8SA 2PV3A 2RSEA 4R0XA
chains in the Genus database with same CATH topology
3NTPA 1D2KA 1SYTA 4ODRA 4DRQA 3PA7A 4J4OA 1W1PA 1ZCNA 1ZB5A 2PI6A 2K8IA 3KABA 4MNKA 4R5EA 2FDMA 3KAHA 4DZ3A 5HW8A 4DIPA 3KACA 4WK9A 2MNTA 1E9LA 1Q1CA 3IK8A 1Q6IA 4Q7NA 2XPBA 4TX0A 1TCOC 3AS0A 5GQBA 4WJXA 1TFVA 1H0GA 1J4HA 3ARVA 4DH0A 1U79A 1OGBA 1F40A 1Y0OA 4S3JA 3UI6A 1J4IA 1L1PA 2DG4A 5D75A 2WM0A 2Q5AA 3EY6A 4Z2HA 2DSWA 3PR9A 1WNOA 1LG2A 3KAIA 3FXYA 4NNRA 3RMEA 1B6CA 3ARXA 2G8ZA 1ZBCA 3B9EA 2DT1A 2O9OA 4GIVA 4DT4A 5JH8A 1ITXA 5HBFA 1HKMA 1EHNA 3TC5A 4IT6A 4JFMA 3RM8A 4JYSA 3JYMA 4Z2JA 4JFJA 1F8AB 4JFLA 4ODQA 2G41A 1ZL1A 3ARTA 4Q22A 4LAXA 1W26A 4Z2KA 2KI3A 4O2TA 4DWSA 2B31A 1CTNA 4NSBA 2ITKA 4W9OA 4DRPA 5DO2A 2KFWA 1NMVA 1X6LA 1YW5A 2DPEA 2ZQTA 1O6IA 4KQZA 3KAFA 4P8XA 1XRVA 4S3KA 4G50A 3WQWA 3B9AA 1FKRA 4MAVA 3CGMA 4TW8A 3KZ7A 3UQBA 2A3AA 3ARZA 3O5GA 3B7XA 1PBKA 4JFKA 1E15A 5DIUA 5HW6A 1FKGA 4ZS6A 2RURA 1HKKA 1P5QA 4ZPTR 4DRIA 4FAPA 3JXVA 3ODKA 2DG3A 4KR0B 4MGVA 4WKHA 4ZPWR 1FKKA 1W9UA 2MPHA 3ALGA 1HJWA 5HUAA 4XAKA 3AROA 1M5YA 4W5UA 2A3BA 3WIJA 4ODLA 4Z2IA 4W9PA 1ROUA 3O5QA 3IKDA 1NWSA 1HJXA 1Q6UA 5HKGA 1KFWA 4LGXA 4IQ2A 2M08A 3WD1A 3AS1A 1HXVA 3KADA 1R9HA 3O5MA 4AY1A 2KGJA 4P8WA 2XP9A 3ARPA 4MSPA 1ZBWA 2LPVA 1J6YA 1LL7A 2IF4A 4U85A 4MNMA 5DIVA 2VN1A 5DEZA 3O5JA 1OWQA 2LJ4A 1W1TA 3PRDA 1T11A 4J4NA 3LUOA 4DWSB 3GPKA 4LAVA 1C9HA 3CHEA 3I6CA 3ARUA 5GPRA 4G2PA 1FFQA 1ZU8A 1FJDA 3TCZA 3UI4A 2XPAA 2JZVA 3WL0A 1FKLA 2ZR6A 5B8IC 3O5IA 2FAPA 5HWBA 1GPFA 3ARRA 3VAWA 3UQAA 4ZPVR 3JYJA 1ROTA 2F4EA 5HWCA 2MF9A 1GOIA 3CGNA 1WAWA 1BKFA 1D6OA 1E6RA 4P8UA 1BL4A 2UZ5A 3KCEA 3CHCA 4HBEA 3QOKA 2RUQA 3WD4A 1D7IA 2O92A 4ML4A 4DZ2A 4DRNA 1EIBA 3OOBA 3ARSA 3AQUA 2PPPA 4IQCA 2LGOA 1N1AA 4MTVA 4Z2GA 4MPKA 4U86A 3O5KA 2A3EA 2KO7A 4DRMA 2KR7A 3ALFA 3PRBA 3UI5A 2DT3A 2RUDA 1UR9A 3RM4A 5I98A 2DSUA 1OGGA 3CHDA 1HKJA 1LQ0A 1ZK6A 1EQ3A 3UF8A 5J6EA 1X6NA 1H0IA 1W9VA 2KE0A 3O5OA 4DWSD 4HBOA 3CZ8A 1E6ZA 2WLYA 4N19A 1GUVA 4QZVB 3G6MA 1EYMA 4LAYA 2ZR4A 1JNEA 3RFWA 2OFNA 3WKZA 1JNDA 4ITZA 4BF8A 2F2DA 4FN2A 2AWGA 5GPGA 4IPXA 1JNSA 3ARWA 2DSZA 1FKJA 3UQIA 2F21A 1KT0A 4TW6A 4TNSA 2XP5A 2ZQUA 4DRHA 1FKTA 1SR0A 3O5EA 3G6LA 1EDQA 4DRJA 1JVWA 4HARA 5DITA 3CHFA 1E6NA 2PBCA 1NMWA 2LKNA 1W1VA 4WKFA 2FKEA 3B9DA 2YBTA 3RGCA 2AOSA 2N87A 2XP4A 4ODPA 1JNTA 4W9QA 1HJVA 4L3NA 1FKHA 1Q6HA 3MDYB 4LAWA 2IUZA 2OLHA 4URIA 1PINA 1FD9A 3WL1A 2DT2A 1FFRA 2QF8A 4ODOA 3WD2A 1FKSA 4QT2A 3PRAA 1VF8A 2RUCA 3BXWA 3NRKA 1NWTA 1W9PA 2WK2A 4U84A 4QIBA 1ZBVA 2ESCA 3FAPA 4PTMA 2XP3A 2WLZA 4C02B 3AS3A 5HW7A 1K9TA 1FAPA 1NWRA 1YATA 2XP7A 1W1YA 3O5LA 2ZQVA 3O5PA 4ODMA 3O5FA 2MLXA 4GGQA 4NZCA 4L72B 3WH0A 3TDBA 3O5RA 1IX5A 1QPLA 1UR8A 4TW7A 1J4RA 2L2SA 1NWUA 3AS2A 2PPNA 1RD6A 4ODKA 4WKAA 1KT1A 3KAGA 1FKDA 2A3CA 1FKBA 3NI6A 2M1IA 2DSVA 4DWSC 2XP6A 3ARYA 2MLYA 3WD0A 3H9RB 4TYOA 5HT1A 1D7HA 1LG1A 4DROA 1NSGA 4DRKA 2D9FA 2Y78A 4MNLA 1FKIA 2MLZA 3IHZA 2XP8A 1E6PA 2DT0A 1XHGA 4Z2LA 2PPOA 3ARQA 2RQSA 2ZR5A 1LJYA 3RM9A 2VCDA 2ZQSA 4JFIA 3WQVA 1LL4A 5HTGA 1LL6A 3CH9A 5DF0A 2PV1A 5BXJA 1HKIA 3WD3A 1WB0A 2DG9A 4QT3A 1FKFA 1QPFA 1QZ2A 1ZBKA 2YBUA 1D7JA 4P8VA 4ODNA 4MNJA 3OA5A 4WIWA 3IKGA 3W4RA 3O5DA 2M2AA 4IT4A 1NH6A 1A7XA 2PV2A 3FY1A 3B8SA 2PV3A 2RSEA 4R0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IX5 A;  3PRA A;  3PR9 A; 
#chains in the Genus database with same CATH topology
 3NTP A;  4UDM A;  1D2K A;  1SYT A;  4ODR A;  4DRQ A;  3PA7 A;  4J4O A;  1W1P A;  1ZCN A;  1ZB5 A;  2PI6 A;  2K8I A;  3KAB A;  4MNK A;  4R5E A;  2FDM A;  3KAH A;  4DZ3 A;  5HW8 A;  4DIP A;  3KAC A;  4WK9 A;  2MNT A;  1E9L A;  1Q1C A;  3IK8 A;  1Q6I A;  4Q7N A;  2XPB A;  4TX0 A;  1TCO C;  3AS0 A;  5GQB A;  4WJX A;  1TFV A;  1H0G A;  1J4H A;  3ARV A;  4DH0 A;  1U79 A;  1OGB A;  1F40 A;  1Y0O A;  4S3J A;  3UI6 A;  1J4I A;  1L1P A;  2DG4 A;  5D75 A;  2WM0 A;  2Q5A A;  3EY6 A;  4Z2H A;  2DSW A;  3PR9 A;  1WNO A;  1LG2 A;  3KAI A;  3FXY A;  4NNR A;  3RME A;  1B6C A;  3ARX A;  2G8Z A;  1ZBC A;  3B9E A;  2DT1 A;  2O9O A;  4GIV A;  4DT4 A;  5JH8 A;  1ITX A;  5HBF A;  1HKM A;  1EHN A;  3TC5 A;  4IT6 A;  4JFM A;  3RM8 A;  4JYS A;  3JYM A;  4Z2J A;  4JFJ A;  1F8A B;  4JFL A;  4ODQ A;  2G41 A;  1ZL1 A;  3ART A;  4Q22 A;  4LAX A;  1W26 A;  4Z2K A;  2KI3 A;  3GU0 A;  4O2T A;  4DWS A;  2B31 A;  1CTN A;  4NSB A;  2ITK A;  4W9O A;  4DRP A;  5DO2 A;  2KFW A;  1NMV A;  1X6L A;  1JCH B;  1YW5 A;  2DPE A;  2ZQT A;  1O6I A;  4KQZ A;  3KAF A;  4P8X A;  1XRV A;  4S3K A;  4G50 A;  3WQW A;  3B9A A;  1FKR A;  4MAV A;  3CGM A;  4TW8 A;  3KZ7 A;  3UQB A;  2A3A A;  3ARZ A;  1GRJ A;  3O5G A;  3B7X A;  1PBK A;  4JFK A;  1E15 A;  5DIU A;  5HW6 A;  1FKG A;  4ZS6 A;  2RUR A;  1HKK A;  1P5Q A;  4ZPT R;  4DRI A;  4FAP A;  3JXV A;  3ODK A;  2DG3 A;  4KR0 B;  4MGV A;  4WKH A;  4ZPW R;  1FKK A;  1W9U A;  2MPH A;  3ALG A;  1HJW A;  5HUA A;  4XAK A;  3ARO A;  1M5Y A;  4W5U A;  2A3B A;  3WIJ A;  4ODL A;  4Z2I A;  4W9P A;  1ROU A;  3O5Q A;  3IKD A;  1NWS A;  1HJX A;  1Q6U A;  5HKG A;  1KFW A;  3BMB A;  4LGX A;  4IQ2 A;  2M08 A;  3WD1 A;  3AS1 A;  1HXV A;  3KAD A;  1R9H A;  3O5M A;  4AY1 A;  2KGJ A;  4P8W A;  2XP9 A;  3ARP A;  4MSP A;  1ZBW A;  2LPV A;  1J6Y A;  1LL7 A;  2IF4 A;  4U85 A;  4MNM A;  5DIV A;  2VN1 A;  5DEZ A;  3O5J A;  1OWQ A;  2LJ4 A;  1W1T A;  3PRD A;  1T11 A;  4J4N A;  2P4V A;  3LUO A;  4DWS B;  3GPK A;  4LAV A;  1C9H A;  3CHE A;  3I6C A;  3ARU A;  5GPR A;  4G2P A;  1FFQ A;  1ZU8 A;  1FJD A;  3TCZ A;  3UI4 A;  2XPA A;  2JZV A;  3WL0 A;  1FKL A;  2ZR6 A;  5B8I C;  3O5I A;  2FAP A;  5HWB A;  1GPF A;  3ARR A;  3VAW A;  3UQA A;  4ZPV R;  3JYJ A;  1ROT A;  2F4E A;  5HWC A;  2MF9 A;  1GOI A;  3CGN A;  1WAW A;  1BKF A;  1D6O A;  1E6R A;  4P8U A;  1BL4 A;  2UZ5 A;  3KCE A;  3CHC A;  4HBE A;  3QOK A;  2RUQ A;  3WD4 A;  1D7I A;  2O92 A;  4ML4 A;  4DZ2 A;  4DRN A;  1EIB A;  3OOB A;  3ARS A;  3AQU A;  2PPP A;  4IQC A;  2LGO A;  1N1A A;  4MTV A;  4Z2G A;  4MPK A;  4U86 A;  3O5K A;  2A3E A;  2KO7 A;  4DRM A;  2KR7 A;  3ALF A;  3PRB A;  3UI5 A;  2DT3 A;  2RUD A;  1UR9 A;  3RM4 A;  5I98 A;  2DSU A;  1OGG A;  3CHD A;  1HKJ A;  1LQ0 A;  1ZK6 A;  1EQ3 A;  3UF8 A;  5J6E A;  1X6N A;  1H0I A;  1W9V A;  2F23 A;  2KE0 A;  3O5O A;  4DWS D;  4HBO A;  3CZ8 A;  1E6Z A;  2WLY A;  4N19 A;  1GUV A;  4QZV B;  3G6M A;  1EYM A;  2B5U B;  4LAY A;  2ZR4 A;  1JNE A;  3RFW A;  2OFN A;  3WKZ A;  1JND A;  4ITZ A;  4BF8 A;  2F2D A;  4FN2 A;  2AWG A;  5GPG A;  4IPX A;  1JNS A;  3ARW A;  2DSZ A;  1FKJ A;  3UQI A;  2F21 A;  1KT0 A;  4TW6 A;  4TNS A;  2XP5 A;  2ZQU A;  4DRH A;  1FKT A;  1SR0 A;  3O5E A;  3G6L A;  1EDQ A;  4DRJ A;  1JVW A;  4HAR A;  5DIT A;  3CHF A;  1E6N A;  2PBC A;  1NMW A;  2LKN A;  1W1V A;  4WKF A;  2FKE A;  3B9D A;  2YBT A;  3RGC A;  2AOS A;  2PN0 A;  2N87 A;  2XP4 A;  4ODP A;  1JNT A;  4W9Q A;  1HJV A;  4L3N A;  1FKH A;  1Q6H A;  3MDY B;  4LAW A;  2IUZ A;  2OLH A;  4URI A;  1PIN A;  1FD9 A;  3WL1 A;  2DT2 A;  1FFR A;  3EIP A;  2QF8 A;  4ODO A;  3WD2 A;  1FKS A;  4QT2 A;  3PRA A;  1VF8 A;  2RUC A;  3BXW A;  3NRK A;  1NWT A;  1W9P A;  2WK2 A;  4U84 A;  4QIB A;  1ZBV A;  2ESC A;  3FAP A;  4PTM A;  2XP3 A;  2WLZ A;  4C02 B;  3AS3 A;  5HW7 A;  1E44 A;  1K9T A;  1FAP A;  1NWR A;  1YAT A;  2XP7 A;  1W1Y A;  2EUL A;  3O5L A;  2ZQV A;  3O5P A;  4ODM A;  3O5F A;  2MLX A;  4GGQ A;  4NZC A;  4L72 B;  3WH0 A;  3TDB A;  3O5R A;  1IX5 A;  1QPL A;  1UR8 A;  4TW7 A;  1J4R A;  2L2S A;  1NWU A;  3AS2 A;  2PPN A;  1RD6 A;  4ODK A;  4WKA A;  1KT1 A;  3KAG A;  1FKD A;  2A3C A;  1FKB A;  3NI6 A;  2M1I A;  2DSV A;  4DWS C;  2XP6 A;  3ARY A;  2MLY A;  3WD0 A;  3H9R B;  4TYO A;  5HT1 A;  1D7H A;  1LG1 A;  4DRO A;  1NSG A;  4DRK A;  2D9F A;  2Y78 A;  4MNL A;  1FKI A;  2MLZ A;  3IHZ A;  2XP8 A;  1E6P A;  2DT0 A;  1XHG A;  4Z2L A;  2PPO A;  3ARQ A;  2RQS A;  2ZR5 A;  2ETN A;  1LJY A;  3RM9 A;  2VCD A;  2ZQS A;  4JFI A;  3WQV A;  1LL4 A;  5HTG A;  1LL6 A;  3CH9 A;  5DF0 A;  2PV1 A;  5BXJ A;  1HKI A;  3WD3 A;  1WB0 A;  2DG9 A;  4QT3 A;  1FKF A;  1QPF A;  1QZ2 A;  1ZBK A;  2YBU A;  1D7J A;  4P8V A;  4ODN A;  4MNJ A;  3OA5 A;  4WIW A;  3IKG A;  3W4R A;  3O5D A;  2M2A A;  4IT4 A;  1NH6 A;  1A7X A;  2PV2 A;  3GTY X;  3FY1 A;  3B8S A;  2PV3 A;  2RSE A;  4R0X A; 
#chains in the Genus database with same CATH homology
 3NTP A;  1D2K A;  1SYT A;  4ODR A;  4DRQ A;  3PA7 A;  4J4O A;  1W1P A;  1ZCN A;  1ZB5 A;  2PI6 A;  2K8I A;  3KAB A;  4MNK A;  4R5E A;  2FDM A;  3KAH A;  4DZ3 A;  5HW8 A;  4DIP A;  3KAC A;  4WK9 A;  2MNT A;  1E9L A;  1Q1C A;  3IK8 A;  1Q6I A;  4Q7N A;  2XPB A;  4TX0 A;  1TCO C;  3AS0 A;  5GQB A;  4WJX A;  1TFV A;  1H0G A;  1J4H A;  3ARV A;  4DH0 A;  1U79 A;  1OGB A;  1F40 A;  1Y0O A;  4S3J A;  3UI6 A;  1J4I A;  1L1P A;  2DG4 A;  5D75 A;  2WM0 A;  2Q5A A;  3EY6 A;  4Z2H A;  2DSW A;  3PR9 A;  1WNO A;  1LG2 A;  3KAI A;  3FXY A;  4NNR A;  3RME A;  1B6C A;  3ARX A;  2G8Z A;  1ZBC A;  3B9E A;  2DT1 A;  2O9O A;  4GIV A;  4DT4 A;  5JH8 A;  1ITX A;  5HBF A;  1HKM A;  1EHN A;  3TC5 A;  4IT6 A;  4JFM A;  3RM8 A;  4JYS A;  3JYM A;  4Z2J A;  4JFJ A;  1F8A B;  4JFL A;  4ODQ A;  2G41 A;  1ZL1 A;  3ART A;  4Q22 A;  4LAX A;  1W26 A;  4Z2K A;  2KI3 A;  4O2T A;  4DWS A;  2B31 A;  1CTN A;  4NSB A;  2ITK A;  4W9O A;  4DRP A;  5DO2 A;  2KFW A;  1NMV A;  1X6L A;  1YW5 A;  2DPE A;  2ZQT A;  1O6I A;  4KQZ A;  3KAF A;  4P8X A;  1XRV A;  4S3K A;  4G50 A;  3WQW A;  3B9A A;  1FKR A;  4MAV A;  3CGM A;  4TW8 A;  3KZ7 A;  3UQB A;  2A3A A;  3ARZ A;  3O5G A;  3B7X A;  1PBK A;  4JFK A;  1E15 A;  5DIU A;  5HW6 A;  1FKG A;  4ZS6 A;  2RUR A;  1HKK A;  1P5Q A;  4ZPT R;  4DRI A;  4FAP A;  3JXV A;  3ODK A;  2DG3 A;  4KR0 B;  4MGV A;  4WKH A;  4ZPW R;  1FKK A;  1W9U A;  2MPH A;  3ALG A;  1HJW A;  5HUA A;  4XAK A;  3ARO A;  1M5Y A;  4W5U A;  2A3B A;  3WIJ A;  4ODL A;  4Z2I A;  4W9P A;  1ROU A;  3O5Q A;  3IKD A;  1NWS A;  1HJX A;  1Q6U A;  5HKG A;  1KFW A;  4LGX A;  4IQ2 A;  2M08 A;  3WD1 A;  3AS1 A;  1HXV A;  3KAD A;  1R9H A;  3O5M A;  4AY1 A;  2KGJ A;  4P8W A;  2XP9 A;  3ARP A;  4MSP A;  1ZBW A;  2LPV A;  1J6Y A;  1LL7 A;  2IF4 A;  4U85 A;  4MNM A;  5DIV A;  2VN1 A;  5DEZ A;  3O5J A;  1OWQ A;  2LJ4 A;  1W1T A;  3PRD A;  1T11 A;  4J4N A;  3LUO A;  4DWS B;  3GPK A;  4LAV A;  1C9H A;  3CHE A;  3I6C A;  3ARU A;  5GPR A;  4G2P A;  1FFQ A;  1ZU8 A;  1FJD A;  3TCZ A;  3UI4 A;  2XPA A;  2JZV A;  3WL0 A;  1FKL A;  2ZR6 A;  5B8I C;  3O5I A;  2FAP A;  5HWB A;  1GPF A;  3ARR A;  3VAW A;  3UQA A;  4ZPV R;  3JYJ A;  1ROT A;  2F4E A;  5HWC A;  2MF9 A;  1GOI A;  3CGN A;  1WAW A;  1BKF A;  1D6O A;  1E6R A;  4P8U A;  1BL4 A;  2UZ5 A;  3KCE A;  3CHC A;  4HBE A;  3QOK A;  2RUQ A;  3WD4 A;  1D7I A;  2O92 A;  4ML4 A;  4DZ2 A;  4DRN A;  1EIB A;  3OOB A;  3ARS A;  3AQU A;  2PPP A;  4IQC A;  2LGO A;  1N1A A;  4MTV A;  4Z2G A;  4MPK A;  4U86 A;  3O5K A;  2A3E A;  2KO7 A;  4DRM A;  2KR7 A;  3ALF A;  3PRB A;  3UI5 A;  2DT3 A;  2RUD A;  1UR9 A;  3RM4 A;  5I98 A;  2DSU A;  1OGG A;  3CHD A;  1HKJ A;  1LQ0 A;  1ZK6 A;  1EQ3 A;  3UF8 A;  5J6E A;  1X6N A;  1H0I A;  1W9V A;  2KE0 A;  3O5O A;  4DWS D;  4HBO A;  3CZ8 A;  1E6Z A;  2WLY A;  4N19 A;  1GUV A;  4QZV B;  3G6M A;  1EYM A;  4LAY A;  2ZR4 A;  1JNE A;  3RFW A;  2OFN A;  3WKZ A;  1JND A;  4ITZ A;  4BF8 A;  2F2D A;  4FN2 A;  2AWG A;  5GPG A;  4IPX A;  1JNS A;  3ARW A;  2DSZ A;  1FKJ A;  3UQI A;  2F21 A;  1KT0 A;  4TW6 A;  4TNS A;  2XP5 A;  2ZQU A;  4DRH A;  1FKT A;  1SR0 A;  3O5E A;  3G6L A;  1EDQ A;  4DRJ A;  1JVW A;  4HAR A;  5DIT A;  3CHF A;  1E6N A;  2PBC A;  1NMW A;  2LKN A;  1W1V A;  4WKF A;  2FKE A;  3B9D A;  2YBT A;  3RGC A;  2AOS A;  2N87 A;  2XP4 A;  4ODP A;  1JNT A;  4W9Q A;  1HJV A;  4L3N A;  1FKH A;  1Q6H A;  3MDY B;  4LAW A;  2IUZ A;  2OLH A;  4URI A;  1PIN A;  1FD9 A;  3WL1 A;  2DT2 A;  1FFR A;  2QF8 A;  4ODO A;  3WD2 A;  1FKS A;  4QT2 A;  3PRA A;  1VF8 A;  2RUC A;  3BXW A;  3NRK A;  1NWT A;  1W9P A;  2WK2 A;  4U84 A;  4QIB A;  1ZBV A;  2ESC A;  3FAP A;  4PTM A;  2XP3 A;  2WLZ A;  4C02 B;  3AS3 A;  5HW7 A;  1K9T A;  1FAP A;  1NWR A;  1YAT A;  2XP7 A;  1W1Y A;  3O5L A;  2ZQV A;  3O5P A;  4ODM A;  3O5F A;  2MLX A;  4GGQ A;  4NZC A;  4L72 B;  3WH0 A;  3TDB A;  3O5R A;  1IX5 A;  1QPL A;  1UR8 A;  4TW7 A;  1J4R A;  2L2S A;  1NWU A;  3AS2 A;  2PPN A;  1RD6 A;  4ODK A;  4WKA A;  1KT1 A;  3KAG A;  1FKD A;  2A3C A;  1FKB A;  3NI6 A;  2M1I A;  2DSV A;  4DWS C;  2XP6 A;  3ARY A;  2MLY A;  3WD0 A;  3H9R B;  4TYO A;  5HT1 A;  1D7H A;  1LG1 A;  4DRO A;  1NSG A;  4DRK A;  2D9F A;  2Y78 A;  4MNL A;  1FKI A;  2MLZ A;  3IHZ A;  2XP8 A;  1E6P A;  2DT0 A;  1XHG A;  4Z2L A;  2PPO A;  3ARQ A;  2RQS A;  2ZR5 A;  1LJY A;  3RM9 A;  2VCD A;  2ZQS A;  4JFI A;  3WQV A;  1LL4 A;  5HTG A;  1LL6 A;  3CH9 A;  5DF0 A;  2PV1 A;  5BXJ A;  1HKI A;  3WD3 A;  1WB0 A;  2DG9 A;  4QT3 A;  1FKF A;  1QPF A;  1QZ2 A;  1ZBK A;  2YBU A;  1D7J A;  4P8V A;  4ODN A;  4MNJ A;  3OA5 A;  4WIW A;  3IKG A;  3W4R A;  3O5D A;  2M2A A;  4IT4 A;  1NH6 A;  1A7X A;  2PV2 A;  3FY1 A;  3B8S A;  2PV3 A;  2RSE A;  4R0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...