1IX5A

Solution structure of the methanococcus thermolithotrophicus fkbp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
151
structure length
151
Chain Sequence
b'MVDKGVKIKVDYIGKLESGDVFDTSIEEVAKEAGIYAPDREYEPLEFVVGEGQLIQGFEEAVLDMEVGDEKTVKIPAEKAYGNRNEMLIQKIPRDAFKEADFEPEEGMVILAEGIPATITEVTDNEVTLDFNHELAGKDLVFTIKIIEVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP
publication title Three-dimensional Solution Structure of an Archaeal FKBP with a Dual Function of Peptidyl Prolyl cis-trans Isomerase and Chaperone-like Activities
pubmed doi rcsb
source organism Methanothermococcus thermolithotrophicus
molecule tags Isomerase
total genus 17
structure length 151
sequence length 151
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.80 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1ix5A00
1IX5A 3PRAA 3PR9A
chains in the Genus database with same CATH superfamily
3RM9A 1E9LA 3ARPA 2RUDA 2ZQTA 1OGBA 2ZR6A 1KT0A 3B7XA 4G50A 4W9PA 4JFIA 1WAWA 3IHZA 2DPEA 2A3CA 4WJXA 1FKLA 2YBTA 1HKJA 4JYSA 3O5OA 3WD0A 4ODRA 1FKGA 3UQAA 2KO7A 4TW7A 4U85A 1NSGA 1E6PA 1NWRA 3ALFA 1NMVA 4J4OA 4MNMA 4O2TA 3RM4A 1FKKA 5DF0A 3WQVA 1FKIA 2VCDA 3KAFA 2OFNA 4C02B 4UDMA 1J4HA 1HJVA 4NNRA 4HBEA 4DRNA 4GIVA 2KR7A 2XP8A 3ARUA 4ZPVR 4IT4A 4DZ2A 1HKKA 3ARTA 1FKTA 1VF8A 2FDMA 4QT3A 3KADA 4FAPA 2PN0A 3KAHA 4W5UA 4Z2JA 3AS0A 4IQCA 1D7JA 2KGJA 1ZCNA 1E44A 1W1PA 4URIA 3NTPA 3RGCA 2K8IA 4Z2KA 1UR9A 4DWSD 1F8AB 4DRKA 2MLZA 4JFMA 3B8SA 2F2DA 2PV1A 1CTNA 2P4VA 1E6NA 1LG2A 3PA7A 3PR9A 2LGOA 4DWSC 1BKFA 1QPFA 4DWSA 1M5YA 1D7HA 4DRIA 1ZBVA 2PPPA 3NI6A 5HW7A 2L2SA 2FKEA 1NMWA 3G6LA 4KQZA 1ZBCA 2PPNA 5HWBA 3TCZA 4AY1A 4HBOA 4LAWA 3FAPA 2F21A 3KZ7A 5DIUA 2MNTA 2WLZA 2KI3A 2MLXA 2XPAA 4TYOA 1FKBA 1JNSA 3CZ8A 3ARXA 2XP4A 5I98A 3CH9A 3RM8A 2OLHA 1W1TA 1W26A 2DT3A 3WD3A 1FKHA 1W1YA 4L72B 1LL7A 3AS1A 2A3EA 1N1AA 5D75A 4NZCA 2O9OA 1UR8A 1Q1CA 1H0GA 4MNJA 4WKAA 3ARQA 3LUOA 4LAXA 4DWSB 2DG4A 4ODQA 5HTGA 5DEZA 1SYTA 3ARYA 2MPHA 2DG3A 4DZ3A 3WD2A 2UZ5A 1W9UA 3O5PA 1FKRA 1Q6IA 2XP6A 3QOKA 3O5IA 4XAKA 1ROUA 5HBFA 2DG9A 3PRDA 3BXWA 2EULA 3JXVA 4R5EA 3OA5A 3AS2A 5DO2A 5BXJA 5GPRA 5DIVA 1EDQA 3JYJA 1LG1A 2A3BA 1J4RA 4ITZA 3WL1A 4U86A 1X6NA 1ZU8A 1EYMA 4ODPA 5HT1A 2PV2A 2XP3A 4IQ2A 2PI6A 3CHFA 1O6IA 5HKGA 1JNDA 1R9HA 3ODKA 4Z2HA 1KT1A 1ZB5A 4WKFA 1OGGA 1GUVA 1YATA 2RURA 1BL4A 1T11A 4ZS6A 4J4NA 1J4IA 1LL6A 4Q22A 2RUQA 1GPFA 1GOIA 4JFJA 1D7IA 1HJXA 4Z2GA 1XRVA 4WIWA 1FKSA 2O92A 2ZR4A 4JFLA 4ODOA 1Q6UA 3H9RB 3IK8A 2LJ4A 2G8ZA 2M2AA 1U79A 3WD1A 2F4EA 4MNLA 1FKFA 3ARZA 4P8VA 1GRJA 1XHGA 2DSZA 1HXVA 1J6YA 3WD4A 2B5UB 1TCOC 4IPXA 2DSUA 3O5MA 3OOBA 2XPBA 2A3AA 3ALGA 4QT2A 4DRQA 1IX5A 1SR0A 1FAPA 3IKDA 1C9HA 2AOSA 3O5JA 1PBKA 4G2PA 2ETNA 4W9QA 4QZVB 5JH8A 2WLYA 2XP7A 2KE0A 3O5LA 2LKNA 1WB0A 4MPKA 1A7XA 3ARSA 3O5FA 4DRMA 2Q5AA 2M1IA 2N87A 1W9PA 1ZL1A 3KAGA 3AQUA 2QF8A 3AROA 4MNKA 4ODLA 1D2KA 3O5KA 3W4RA 4ODMA 4Q7NA 4DT4A 3UI5A 2ZQUA 4R0XA 1FFQA 2WK2A 4JFKA 3O5DA 4TW8A 3GPKA 3KAIA 1QPLA 4Z2IA 4S3JA 2G41A 4TX0A 1Q6HA 3UI4A 2JZVA 4W9OA 1K9TA 3WH0A 4N19A 1WNOA 3KACA 3O5RA 1ZK6A 2Y78A 2YBUA 4LAYA 1H0IA 1X6LA 2ESCA 2ZR5A 1JCHB 2MLYA 4DH0A 4ODKA 1L1PA 1FD9A 1LQ0A 2RUCA 3TC5A 3CHEA 1QZ2A 2RQSA 3FXYA 4HARA 3B9DA 3JYMA 4WKHA 3TDBA 2DT2A 1W1VA 5GPGA 4DRHA 3B9EA 1ROTA 2PPOA 3RMEA 1NWUA 1EHNA 3O5GA 2LPVA 2PV3A 3KCEA 5B8IC 3KABA 1W9VA 4DRPA 3BMBA 4MAVA 2ITKA 4ODNA 1LJYA 1P5QA 4PTMA 1FFRA 2DT0A 3WKZA 3UF8A 4GGQA 2AWGA 3WQWA 1E6RA 3EIPA 4QIBA 3O5EA 4IT6A 2RSEA 2M08A 1FKDA 1HKMA 3ARVA 3PRBA 4Z2LA 4S3KA 4U84A 4DRJA 4KR0B 4MGVA 4FN2A 5J6EA 1EQ3A 3WL0A 3UQIA 1KFWA 1PINA 4ML4A 5DITA 1D6OA 1NH6A 3IKGA 1JNTA 3PRAA 2XP5A 5HWCA 5GQBA 3CGNA 2ZQSA 4ZPTR 1ZBWA 4P8UA 3CHCA 3UQBA 3O5QA 1TFVA 3RFWA 3GTYX 1NWTA 4NSBA 2DSVA 1Y0OA 3EY6A 1HJWA 4P8WA 4TNSA 5HW8A 3AS3A 2WM0A 1NWSA 4LGXA 4MTVA 1F40A 2MF9A 1ITXA 1YW5A 2B31A 3CGMA 1HKIA 5HW6A 3G6MA 3CHDA 1LL4A 1JNEA 1E15A 1JVWA 3I6CA 2VN1A 3ARWA 4L3NA 3B9AA 4ZPWR 1FKJA 4MSPA 2D9FA 2XP9A 2PBCA 2IUZA 2DSWA 2F23A 4P8XA 4WK9A 3VAWA 3ARRA 3MDYB 2ZQVA 3WIJA 1OWQA 4TW6A 1ZBKA 3UI6A 2KFWA 1B6CA 4DIPA 3NRKA 4DROA 1RD6A 1FJDA 2DT1A 4BF8A 2IF4A 5HUAA 4LAVA 3GU0A 1EIBA 2FAPA 1E6ZA 3FY1A
chains in the Genus database with same CATH topology
3RM9A 1E9LA 3ARPA 2RUDA 2ZQTA 1OGBA 2ZR6A 1KT0A 3B7XA 4G50A 4W9PA 4JFIA 1WAWA 3IHZA 2DPEA 2A3CA 4WJXA 1FKLA 2YBTA 1HKJA 4JYSA 3O5OA 3WD0A 4ODRA 1FKGA 3UQAA 2KO7A 4TW7A 4U85A 1NSGA 1NWRA 1E6PA 3ALFA 1NMVA 4J4OA 4MNMA 4O2TA 3RM4A 1FKKA 5DF0A 3WQVA 1FKIA 2VCDA 3KAFA 2OFNA 4C02B 1J4HA 1HJVA 4NNRA 4HBEA 4DRNA 4GIVA 2KR7A 2XP8A 3ARUA 4ZPVR 4IT4A 4DZ2A 1HKKA 3ARTA 1FKTA 1VF8A 2FDMA 4QT3A 3KADA 4FAPA 3KAHA 4W5UA 4Z2JA 3AS0A 4IQCA 1D7JA 2KGJA 1ZCNA 1W1PA 4URIA 3NTPA 3RGCA 2K8IA 4Z2KA 1UR9A 4DWSD 1F8AB 4DRKA 2MLZA 4JFMA 3B8SA 2F2DA 2PV1A 1CTNA 1E6NA 1LG2A 3PA7A 3PR9A 2LGOA 4DWSC 1BKFA 1QPFA 4DWSA 1M5YA 1D7HA 4DRIA 1ZBVA 2PPPA 3NI6A 5HW7A 2L2SA 2FKEA 1NMWA 3G6LA 4KQZA 1ZBCA 2PPNA 5HWBA 3TCZA 4AY1A 4HBOA 4LAWA 3FAPA 2F21A 3KZ7A 5DIUA 2MNTA 2WLZA 2KI3A 2MLXA 2XPAA 4TYOA 1FKBA 1JNSA 3CZ8A 3ARXA 2XP4A 5I98A 3CH9A 3RM8A 2OLHA 1W1TA 1W26A 2DT3A 3WD3A 1FKHA 1W1YA 4L72B 1LL7A 3AS1A 2A3EA 1N1AA 5D75A 4NZCA 2O9OA 1UR8A 1Q1CA 1H0GA 4MNJA 4WKAA 3ARQA 3LUOA 4LAXA 4DWSB 2DG4A 4ODQA 5HTGA 5DEZA 1SYTA 3ARYA 2MPHA 2DG3A 4DZ3A 3WD2A 2UZ5A 1W9UA 3O5PA 1FKRA 1Q6IA 2XP6A 3QOKA 3O5IA 4XAKA 1ROUA 5HBFA 2DG9A 3PRDA 3BXWA 3JXVA 4R5EA 3OA5A 3AS2A 5DO2A 5BXJA 5GPRA 5DIVA 1EDQA 3JYJA 1LG1A 2A3BA 1J4RA 4ITZA 3WL1A 4U86A 1X6NA 1ZU8A 1EYMA 4ODPA 5HT1A 2PV2A 2XP3A 4IQ2A 2PI6A 3CHFA 1O6IA 5HKGA 1JNDA 1R9HA 3ODKA 4Z2HA 1KT1A 1ZB5A 4WKFA 1OGGA 1GUVA 1YATA 2RURA 1BL4A 1T11A 4ZS6A 4J4NA 1J4IA 1LL6A 4Q22A 2RUQA 1GPFA 1GOIA 4JFJA 1D7IA 1HJXA 4Z2GA 1XRVA 4WIWA 1FKSA 2O92A 2ZR4A 4JFLA 4ODOA 1Q6UA 3H9RB 3IK8A 2LJ4A 2G8ZA 2M2AA 1U79A 3WD1A 2F4EA 4MNLA 1FKFA 3ARZA 4P8VA 1XHGA 2DSZA 1HXVA 1J6YA 3WD4A 1TCOC 4IPXA 2DSUA 3O5MA 3OOBA 2XPBA 2A3AA 3ALGA 4QT2A 4DRQA 1IX5A 1SR0A 1FAPA 3IKDA 1C9HA 2AOSA 3O5JA 1PBKA 4G2PA 4W9QA 4QZVB 5JH8A 2WLYA 2XP7A 2KE0A 3O5LA 2LKNA 1WB0A 4MPKA 1A7XA 3ARSA 3O5FA 4DRMA 2Q5AA 2M1IA 2N87A 1W9PA 1ZL1A 3KAGA 3AQUA 2QF8A 3AROA 4MNKA 4ODLA 1D2KA 3O5KA 3W4RA 4ODMA 4Q7NA 4DT4A 3UI5A 2ZQUA 4R0XA 1FFQA 2WK2A 4JFKA 3O5DA 4TW8A 3GPKA 3KAIA 1QPLA 4Z2IA 4S3JA 2G41A 4TX0A 1Q6HA 3UI4A 2JZVA 4W9OA 1K9TA 3WH0A 4N19A 1WNOA 3KACA 3O5RA 1ZK6A 2Y78A 2YBUA 4LAYA 1H0IA 1X6LA 2ESCA 2ZR5A 2MLYA 4DH0A 4ODKA 1L1PA 1FD9A 1LQ0A 2RUCA 3TC5A 3CHEA 1QZ2A 2RQSA 3FXYA 4HARA 3B9DA 3JYMA 4WKHA 3TDBA 2DT2A 1W1VA 5GPGA 4DRHA 3B9EA 1ROTA 2PPOA 3RMEA 1NWUA 1EHNA 3O5GA 2LPVA 2PV3A 3KCEA 5B8IC 3KABA 1W9VA 4DRPA 4MAVA 2ITKA 4ODNA 1LJYA 1P5QA 4PTMA 1FFRA 2DT0A 3WKZA 3UF8A 4GGQA 2AWGA 3WQWA 1E6RA 4QIBA 3O5EA 4IT6A 2RSEA 2M08A 1FKDA 1HKMA 3ARVA 3PRBA 4Z2LA 4S3KA 4U84A 4DRJA 4KR0B 4MGVA 4FN2A 5J6EA 1EQ3A 3WL0A 3UQIA 1KFWA 1PINA 4ML4A 5DITA 1D6OA 1NH6A 3IKGA 1JNTA 3PRAA 2XP5A 5HWCA 5GQBA 3CGNA 2ZQSA 4ZPTR 1ZBWA 4P8UA 3CHCA 3UQBA 3O5QA 1TFVA 3RFWA 1NWTA 4NSBA 2DSVA 1Y0OA 3EY6A 1HJWA 4P8WA 4TNSA 5HW8A 3AS3A 2WM0A 1NWSA 4LGXA 4MTVA 1F40A 2MF9A 1ITXA 1YW5A 2B31A 3CGMA 1HKIA 5HW6A 3G6MA 3CHDA 1LL4A 1JNEA 1E15A 1JVWA 3I6CA 2VN1A 3ARWA 4L3NA 3B9AA 4ZPWR 1FKJA 4MSPA 2D9FA 2XP9A 2PBCA 2IUZA 2DSWA 4P8XA 4WK9A 3VAWA 3ARRA 3MDYB 2ZQVA 3WIJA 1OWQA 4TW6A 1ZBKA 3UI6A 2KFWA 1B6CA 4DIPA 3NRKA 4DROA 1RD6A 1FJDA 2DT1A 4BF8A 2IF4A 5HUAA 4LAVA 1EIBA 2FAPA 1E6ZA 3FY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IX5 A;  3PRA A;  3PR9 A; 
#chains in the Genus database with same CATH topology
 3RM9 A;  1E9L A;  3ARP A;  2RUD A;  2ZQT A;  1OGB A;  2ZR6 A;  1KT0 A;  3B7X A;  4G50 A;  4W9P A;  4JFI A;  1WAW A;  3IHZ A;  2DPE A;  2A3C A;  4WJX A;  1FKL A;  2YBT A;  1HKJ A;  4JYS A;  3O5O A;  3WD0 A;  4ODR A;  1FKG A;  3UQA A;  2KO7 A;  4TW7 A;  4U85 A;  1NSG A;  1E6P A;  1NWR A;  3ALF A;  1NMV A;  4J4O A;  4MNM A;  4O2T A;  3RM4 A;  1FKK A;  5DF0 A;  3WQV A;  1FKI A;  2VCD A;  3KAF A;  2OFN A;  4C02 B;  4UDM A;  1J4H A;  1HJV A;  4NNR A;  4HBE A;  4DRN A;  4GIV A;  2KR7 A;  2XP8 A;  3ARU A;  4ZPV R;  4IT4 A;  4DZ2 A;  1HKK A;  3ART A;  1FKT A;  1VF8 A;  2FDM A;  4QT3 A;  3KAD A;  4FAP A;  2PN0 A;  3KAH A;  4W5U A;  4Z2J A;  3AS0 A;  4IQC A;  1D7J A;  2KGJ A;  1ZCN A;  1E44 A;  1W1P A;  4URI A;  3NTP A;  3RGC A;  2K8I A;  4Z2K A;  1UR9 A;  4DWS D;  1F8A B;  4DRK A;  2MLZ A;  4JFM A;  3B8S A;  2F2D A;  2PV1 A;  1CTN A;  2P4V A;  1E6N A;  1LG2 A;  3PA7 A;  3PR9 A;  2LGO A;  4DWS C;  1BKF A;  1QPF A;  4DWS A;  1M5Y A;  1D7H A;  4DRI A;  1ZBV A;  2PPP A;  3NI6 A;  5HW7 A;  2L2S A;  2FKE A;  1NMW A;  3G6L A;  4KQZ A;  1ZBC A;  2PPN A;  5HWB A;  3TCZ A;  4AY1 A;  4HBO A;  4LAW A;  3FAP A;  2F21 A;  3KZ7 A;  5DIU A;  2MNT A;  2WLZ A;  2KI3 A;  2MLX A;  2XPA A;  4TYO A;  1FKB A;  1JNS A;  3CZ8 A;  3ARX A;  2XP4 A;  5I98 A;  3CH9 A;  3RM8 A;  2OLH A;  1W1T A;  1W26 A;  2DT3 A;  3WD3 A;  1FKH A;  1W1Y A;  4L72 B;  1LL7 A;  3AS1 A;  2A3E A;  1N1A A;  5D75 A;  4NZC A;  2O9O A;  1UR8 A;  1Q1C A;  1H0G A;  4MNJ A;  4WKA A;  3ARQ A;  3LUO A;  4LAX A;  4DWS B;  2DG4 A;  4ODQ A;  5HTG A;  5DEZ A;  1SYT A;  3ARY A;  2MPH A;  2DG3 A;  4DZ3 A;  3WD2 A;  2UZ5 A;  1W9U A;  3O5P A;  1FKR A;  1Q6I A;  2XP6 A;  3QOK A;  3O5I A;  4XAK A;  1ROU A;  5HBF A;  2DG9 A;  3PRD A;  3BXW A;  2EUL A;  3JXV A;  4R5E A;  3OA5 A;  3AS2 A;  5DO2 A;  5BXJ A;  5GPR A;  5DIV A;  1EDQ A;  3JYJ A;  1LG1 A;  2A3B A;  1J4R A;  4ITZ A;  3WL1 A;  4U86 A;  1X6N A;  1ZU8 A;  1EYM A;  4ODP A;  5HT1 A;  2PV2 A;  2XP3 A;  4IQ2 A;  2PI6 A;  3CHF A;  1O6I A;  5HKG A;  1JND A;  1R9H A;  3ODK A;  4Z2H A;  1KT1 A;  1ZB5 A;  4WKF A;  1OGG A;  1GUV A;  1YAT A;  2RUR A;  1BL4 A;  1T11 A;  4ZS6 A;  4J4N A;  1J4I A;  1LL6 A;  4Q22 A;  2RUQ A;  1GPF A;  1GOI A;  4JFJ A;  1D7I A;  1HJX A;  4Z2G A;  1XRV A;  4WIW A;  1FKS A;  2O92 A;  2ZR4 A;  4JFL A;  4ODO A;  1Q6U A;  3H9R B;  3IK8 A;  2LJ4 A;  2G8Z A;  2M2A A;  1U79 A;  3WD1 A;  2F4E A;  4MNL A;  1FKF A;  3ARZ A;  4P8V A;  1GRJ A;  1XHG A;  2DSZ A;  1HXV A;  1J6Y A;  3WD4 A;  2B5U B;  1TCO C;  4IPX A;  2DSU A;  3O5M A;  3OOB A;  2XPB A;  2A3A A;  3ALG A;  4QT2 A;  4DRQ A;  1IX5 A;  1SR0 A;  1FAP A;  3IKD A;  1C9H A;  2AOS A;  3O5J A;  1PBK A;  4G2P A;  2ETN A;  4W9Q A;  4QZV B;  5JH8 A;  2WLY A;  2XP7 A;  2KE0 A;  3O5L A;  2LKN A;  1WB0 A;  4MPK A;  1A7X A;  3ARS A;  3O5F A;  4DRM A;  2Q5A A;  2M1I A;  2N87 A;  1W9P A;  1ZL1 A;  3KAG A;  3AQU A;  2QF8 A;  3ARO A;  4MNK A;  4ODL A;  1D2K A;  3O5K A;  3W4R A;  4ODM A;  4Q7N A;  4DT4 A;  3UI5 A;  2ZQU A;  4R0X A;  1FFQ A;  2WK2 A;  4JFK A;  3O5D A;  4TW8 A;  3GPK A;  3KAI A;  1QPL A;  4Z2I A;  4S3J A;  2G41 A;  4TX0 A;  1Q6H A;  3UI4 A;  2JZV A;  4W9O A;  1K9T A;  3WH0 A;  4N19 A;  1WNO A;  3KAC A;  3O5R A;  1ZK6 A;  2Y78 A;  2YBU A;  4LAY A;  1H0I A;  1X6L A;  2ESC A;  2ZR5 A;  1JCH B;  2MLY A;  4DH0 A;  4ODK A;  1L1P A;  1FD9 A;  1LQ0 A;  2RUC A;  3TC5 A;  3CHE A;  1QZ2 A;  2RQS A;  3FXY A;  4HAR A;  3B9D A;  3JYM A;  4WKH A;  3TDB A;  2DT2 A;  1W1V A;  5GPG A;  4DRH A;  3B9E A;  1ROT A;  2PPO A;  3RME A;  1NWU A;  1EHN A;  3O5G A;  2LPV A;  2PV3 A;  3KCE A;  5B8I C;  3KAB A;  1W9V A;  4DRP A;  3BMB A;  4MAV A;  2ITK A;  4ODN A;  1LJY A;  1P5Q A;  4PTM A;  1FFR A;  2DT0 A;  3WKZ A;  3UF8 A;  4GGQ A;  2AWG A;  3WQW A;  1E6R A;  3EIP A;  4QIB A;  3O5E A;  4IT6 A;  2RSE A;  2M08 A;  1FKD A;  1HKM A;  3ARV A;  3PRB A;  4Z2L A;  4S3K A;  4U84 A;  4DRJ A;  4KR0 B;  4MGV A;  4FN2 A;  5J6E A;  1EQ3 A;  3WL0 A;  3UQI A;  1KFW A;  1PIN A;  4ML4 A;  5DIT A;  1D6O A;  1NH6 A;  3IKG A;  1JNT A;  3PRA A;  2XP5 A;  5HWC A;  5GQB A;  3CGN A;  2ZQS A;  4ZPT R;  1ZBW A;  4P8U A;  3CHC A;  3UQB A;  3O5Q A;  1TFV A;  3RFW A;  3GTY X;  1NWT A;  4NSB A;  2DSV A;  1Y0O A;  3EY6 A;  1HJW A;  4P8W A;  4TNS A;  5HW8 A;  3AS3 A;  2WM0 A;  1NWS A;  4LGX A;  4MTV A;  1F40 A;  2MF9 A;  1ITX A;  1YW5 A;  2B31 A;  3CGM A;  1HKI A;  5HW6 A;  3G6M A;  3CHD A;  1LL4 A;  1JNE A;  1E15 A;  1JVW A;  3I6C A;  2VN1 A;  3ARW A;  4L3N A;  3B9A A;  4ZPW R;  1FKJ A;  4MSP A;  2D9F A;  2XP9 A;  2PBC A;  2IUZ A;  2DSW A;  2F23 A;  4P8X A;  4WK9 A;  3VAW A;  3ARR A;  3MDY B;  2ZQV A;  3WIJ A;  1OWQ A;  4TW6 A;  1ZBK A;  3UI6 A;  2KFW A;  1B6C A;  4DIP A;  3NRK A;  4DRO A;  1RD6 A;  1FJD A;  2DT1 A;  4BF8 A;  2IF4 A;  5HUA A;  4LAV A;  3GU0 A;  1EIB A;  2FAP A;  1E6Z A;  3FY1 A; 
#chains in the Genus database with same CATH homology
 3RM9 A;  1E9L A;  3ARP A;  2RUD A;  2ZQT A;  1OGB A;  2ZR6 A;  1KT0 A;  3B7X A;  4G50 A;  4W9P A;  4JFI A;  1WAW A;  3IHZ A;  2DPE A;  2A3C A;  4WJX A;  1FKL A;  2YBT A;  1HKJ A;  4JYS A;  3O5O A;  3WD0 A;  4ODR A;  1FKG A;  3UQA A;  2KO7 A;  4TW7 A;  4U85 A;  1NSG A;  1NWR A;  1E6P A;  3ALF A;  1NMV A;  4J4O A;  4MNM A;  4O2T A;  3RM4 A;  1FKK A;  5DF0 A;  3WQV A;  1FKI A;  2VCD A;  3KAF A;  2OFN A;  4C02 B;  1J4H A;  1HJV A;  4NNR A;  4HBE A;  4DRN A;  4GIV A;  2KR7 A;  2XP8 A;  3ARU A;  4ZPV R;  4IT4 A;  4DZ2 A;  1HKK A;  3ART A;  1FKT A;  1VF8 A;  2FDM A;  4QT3 A;  3KAD A;  4FAP A;  3KAH A;  4W5U A;  4Z2J A;  3AS0 A;  4IQC A;  1D7J A;  2KGJ A;  1ZCN A;  1W1P A;  4URI A;  3NTP A;  3RGC A;  2K8I A;  4Z2K A;  1UR9 A;  4DWS D;  1F8A B;  4DRK A;  2MLZ A;  4JFM A;  3B8S A;  2F2D A;  2PV1 A;  1CTN A;  1E6N A;  1LG2 A;  3PA7 A;  3PR9 A;  2LGO A;  4DWS C;  1BKF A;  1QPF A;  4DWS A;  1M5Y A;  1D7H A;  4DRI A;  1ZBV A;  2PPP A;  3NI6 A;  5HW7 A;  2L2S A;  2FKE A;  1NMW A;  3G6L A;  4KQZ A;  1ZBC A;  2PPN A;  5HWB A;  3TCZ A;  4AY1 A;  4HBO A;  4LAW A;  3FAP A;  2F21 A;  3KZ7 A;  5DIU A;  2MNT A;  2WLZ A;  2KI3 A;  2MLX A;  2XPA A;  4TYO A;  1FKB A;  1JNS A;  3CZ8 A;  3ARX A;  2XP4 A;  5I98 A;  3CH9 A;  3RM8 A;  2OLH A;  1W1T A;  1W26 A;  2DT3 A;  3WD3 A;  1FKH A;  1W1Y A;  4L72 B;  1LL7 A;  3AS1 A;  2A3E A;  1N1A A;  5D75 A;  4NZC A;  2O9O A;  1UR8 A;  1Q1C A;  1H0G A;  4MNJ A;  4WKA A;  3ARQ A;  3LUO A;  4LAX A;  4DWS B;  2DG4 A;  4ODQ A;  5HTG A;  5DEZ A;  1SYT A;  3ARY A;  2MPH A;  2DG3 A;  4DZ3 A;  3WD2 A;  2UZ5 A;  1W9U A;  3O5P A;  1FKR A;  1Q6I A;  2XP6 A;  3QOK A;  3O5I A;  4XAK A;  1ROU A;  5HBF A;  2DG9 A;  3PRD A;  3BXW A;  3JXV A;  4R5E A;  3OA5 A;  3AS2 A;  5DO2 A;  5BXJ A;  5GPR A;  5DIV A;  1EDQ A;  3JYJ A;  1LG1 A;  2A3B A;  1J4R A;  4ITZ A;  3WL1 A;  4U86 A;  1X6N A;  1ZU8 A;  1EYM A;  4ODP A;  5HT1 A;  2PV2 A;  2XP3 A;  4IQ2 A;  2PI6 A;  3CHF A;  1O6I A;  5HKG A;  1JND A;  1R9H A;  3ODK A;  4Z2H A;  1KT1 A;  1ZB5 A;  4WKF A;  1OGG A;  1GUV A;  1YAT A;  2RUR A;  1BL4 A;  1T11 A;  4ZS6 A;  4J4N A;  1J4I A;  1LL6 A;  4Q22 A;  2RUQ A;  1GPF A;  1GOI A;  4JFJ A;  1D7I A;  1HJX A;  4Z2G A;  1XRV A;  4WIW A;  1FKS A;  2O92 A;  2ZR4 A;  4JFL A;  4ODO A;  1Q6U A;  3H9R B;  3IK8 A;  2LJ4 A;  2G8Z A;  2M2A A;  1U79 A;  3WD1 A;  2F4E A;  4MNL A;  1FKF A;  3ARZ A;  4P8V A;  1XHG A;  2DSZ A;  1HXV A;  1J6Y A;  3WD4 A;  1TCO C;  4IPX A;  2DSU A;  3O5M A;  3OOB A;  2XPB A;  2A3A A;  3ALG A;  4QT2 A;  4DRQ A;  1IX5 A;  1SR0 A;  1FAP A;  3IKD A;  1C9H A;  2AOS A;  3O5J A;  1PBK A;  4G2P A;  4W9Q A;  4QZV B;  5JH8 A;  2WLY A;  2XP7 A;  2KE0 A;  3O5L A;  2LKN A;  1WB0 A;  4MPK A;  1A7X A;  3ARS A;  3O5F A;  4DRM A;  2Q5A A;  2M1I A;  2N87 A;  1W9P A;  1ZL1 A;  3KAG A;  3AQU A;  2QF8 A;  3ARO A;  4MNK A;  4ODL A;  1D2K A;  3O5K A;  3W4R A;  4ODM A;  4Q7N A;  4DT4 A;  3UI5 A;  2ZQU A;  4R0X A;  1FFQ A;  2WK2 A;  4JFK A;  3O5D A;  4TW8 A;  3GPK A;  3KAI A;  1QPL A;  4Z2I A;  4S3J A;  2G41 A;  4TX0 A;  1Q6H A;  3UI4 A;  2JZV A;  4W9O A;  1K9T A;  3WH0 A;  4N19 A;  1WNO A;  3KAC A;  3O5R A;  1ZK6 A;  2Y78 A;  2YBU A;  4LAY A;  1H0I A;  1X6L A;  2ESC A;  2ZR5 A;  2MLY A;  4DH0 A;  4ODK A;  1L1P A;  1FD9 A;  1LQ0 A;  2RUC A;  3TC5 A;  3CHE A;  1QZ2 A;  2RQS A;  3FXY A;  4HAR A;  3B9D A;  3JYM A;  4WKH A;  3TDB A;  2DT2 A;  1W1V A;  5GPG A;  4DRH A;  3B9E A;  1ROT A;  2PPO A;  3RME A;  1NWU A;  1EHN A;  3O5G A;  2LPV A;  2PV3 A;  3KCE A;  5B8I C;  3KAB A;  1W9V A;  4DRP A;  4MAV A;  2ITK A;  4ODN A;  1LJY A;  1P5Q A;  4PTM A;  1FFR A;  2DT0 A;  3WKZ A;  3UF8 A;  4GGQ A;  2AWG A;  3WQW A;  1E6R A;  4QIB A;  3O5E A;  4IT6 A;  2RSE A;  2M08 A;  1FKD A;  1HKM A;  3ARV A;  3PRB A;  4Z2L A;  4S3K A;  4U84 A;  4DRJ A;  4KR0 B;  4MGV A;  4FN2 A;  5J6E A;  1EQ3 A;  3WL0 A;  3UQI A;  1KFW A;  1PIN A;  4ML4 A;  5DIT A;  1D6O A;  1NH6 A;  3IKG A;  1JNT A;  3PRA A;  2XP5 A;  5HWC A;  5GQB A;  3CGN A;  2ZQS A;  4ZPT R;  1ZBW A;  4P8U A;  3CHC A;  3UQB A;  3O5Q A;  1TFV A;  3RFW A;  1NWT A;  4NSB A;  2DSV A;  1Y0O A;  3EY6 A;  1HJW A;  4P8W A;  4TNS A;  5HW8 A;  3AS3 A;  2WM0 A;  1NWS A;  4LGX A;  4MTV A;  1F40 A;  2MF9 A;  1ITX A;  1YW5 A;  2B31 A;  3CGM A;  1HKI A;  5HW6 A;  3G6M A;  3CHD A;  1LL4 A;  1JNE A;  1E15 A;  1JVW A;  3I6C A;  2VN1 A;  3ARW A;  4L3N A;  3B9A A;  4ZPW R;  1FKJ A;  4MSP A;  2D9F A;  2XP9 A;  2PBC A;  2IUZ A;  2DSW A;  4P8X A;  4WK9 A;  3VAW A;  3ARR A;  3MDY B;  2ZQV A;  3WIJ A;  1OWQ A;  4TW6 A;  1ZBK A;  3UI6 A;  2KFW A;  1B6C A;  4DIP A;  3NRK A;  4DRO A;  1RD6 A;  1FJD A;  2DT1 A;  4BF8 A;  2IF4 A;  5HUA A;  4LAV A;  1EIB A;  2FAP A;  1E6Z A;  3FY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...