1J6YA

Solution structure of pin1at from arabidopsis thaliana
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
120
structure length
120
Chain Sequence
HMASRDQVKASHILIKHQGSRRKASWKDPEGKIILTTTREAAVEQLKSIREDIVSGKANFEEVATRVSDCSSAKRGGDLGSFGRGQMQKPFEEATYALKVGDISDIVDTDSGVHIIKRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Single-domain Prolyl Cis/Trans Isomerase PIN1At from Arabidopsis thaliana
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Isomerase
molecule keywords peptidyl-prolyl cis-trans isomerase
total genus 17
structure length 120
sequence length 120
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j6yA00
1BKFA 1PINA 2MPHA 1L1PA 4U85A 3JYMA 4G50A 4ITZA 1Q6UA 1Q6IA 3O5QA 2LGOA 1NMVA 4DRIA 4JFJA 2ZR6A 2XPAA 3CGNA 1PBKA 2RSEA 1FKRA 2K8IA 2MLXA 2UZ5A 1FKIA 1ZCNA 2M08A 2Y78A 4IPXA 3O5JA 5HWBA 1JVWA 2N87A 3O5IA 4QT2A 4U86A 2PBCA 3O5FA 3UI6A 4BF8A 4ODLA 2AWGA 3JXVA 4ODKA 2XPBA 5BXJA 3JYJA 1M5YA 3O5DA 2XP6A 1B6CA 4W9PA 3O5OA 2FAPA 3LUOA 4GIVA 5DITA 3NI6A 4DRNA 2F21A 1R9HA 4DH0A 4TX0A 2ZR4A 2ZQTA 5HTGA 4DRHA 4LAVA 1FJDA 3WH0A 1Y0OA 2LPVA 2XP9A 3GPKA 3O5RA 4J4NA 2KFWA 3KAGA 1FKLA 2MNTA 1ZK6A 1FKTA 5J6EA 2D9FA 3B7XA 3O5GA 4TNSA 1TCOC 2PV2A 1D7JA 2VN1A 3EY6A 3TC5A 4DROA 3IKDA 1FKGA 2XP7A 2MLYA 1FKJA 3PRBA 3KCEA 4ODPA 3UI5A 4DZ3A 3KAIA 4FAPA 2RURA 3O5PA 5HW8A 2M2AA 2XP5A 3CGMA 3KACA 4N19A 5I98A 2PPOA 2ITKA 5HW6A 4TW7A 4JFMA 1FKDA 5HWCA 4JYSA 4TW8A 1Q6HA 4GGQA 3O5MA 1D7HA 4ODRA 4ODMA 3UI4A 3UQIA 4IQCA 3FAPA 1FKFA 2KR7A 3UF8A 3PA7A 4TYOA 1NSGA 2DG4A 2RUQA 3O5LA 4TW6A 1C9HA 2RQSA 5HT1A 4DT4A 1YATA 1A7XA 1KT1A 1QZ2A 1QPLA 4DRMA 2PPNA 5D75A 2ZQVA 3RGCA 1ROUA 5HW7A 2F4EA 1N1AA 4IQ2A 1FKSA 2FKEA 4LAYA 1KT0A 4DRKA 5HUAA 2XP4A 4O2TA 1ROTA 1W26A 1FKKA 4U84A 2KE0A 4LAXA 3RFWA 4JFKA 2ZQSA 4ODNA 3VAWA 1U79A 2LKNA 2KO7A 2RUCA 3NRKA 3MDYB 4NNRA 1T11A 3TCZA 1J4RA 3IKGA 4FN2A 4DZ2A 1P5QA 1FKBA 2KI3A 2VCDA 2ZQUA 4JFIA 3PRDA 3KAHA 4QT3A 1QPFA 4W9QA 3IHZA 2PV1A 2RUDA 4QIBA 3I6CA 2OFNA 2L2SA 1J4IA 2XP3A 1D6OA 4J4OA 3O5EA 4C02B 3KZ7A 1BL4A 1J4HA 1EYMA 2PV3A 2XP8A 3KABA 3KADA 3UQBA 2F2DA 4DRQA 4R0XA 1F8AB 1D7IA 1NMWA 5HKGA 3OOBA 3KAFA 2DG3A 4DIPA 2IF4A 3H9RB 2PPPA 4ODOA 2DG9A 4W9OA 1F40A 1JNTA 3O5KA 1FAPA 5GPGA 4DRJA 4DRPA 3NTPA 1FD9A 4G2PA 4MGVA 2LJ4A 4JFLA 2MLZA 5DIUA 3IK8A 1EQ3A 1JNSA 3ODKA 4MSPA 1Q1CA 2KGJA 1J6YA 2Q5AA 3UQAA 2ZR5A 2M1IA 2MF9A 1FKHA 2JZVA 5B8IC 4ODQA 4LAWA 3TDBA 1HXVA 1YW5A 5DIVA
chains in the Genus database with same CATH superfamily
1HJXA 1PINA 1HKKA 4G50A 1Q6UA 4JFJA 3CGNA 4MPKA 1FKIA 5HWBA 2M08A 4IPXA 2ESCA 2PBCA 4BF8A 3UI6A 3QOKA 3RMEA 3O5DA 1B6CA 4W9PA 3O5OA 4ZPVR 5DITA 3AS2A 1W1YA 4DRNA 4Z2HA 4DH0A 1W1VA 1LG2A 2LPVA 2XP9A 4AY1A 3KAGA 4QZVB 1LJYA 1ZK6A 2D9FA 3EY6A 4WJXA 3ARWA 3PR9A 3FXYA 3PRBA 4ODPA 4DZ3A 3KAIA 4WKFA 4ZPTR 4N19A 4P8XA 4HBEA 4TW7A 3GTYX 4Z2LA 3O5MA 4IQCA 3FAPA 3PA7A 1NSGA 2DG4A 4L3NA 4LGXA 1ROUA 5HUAA 4DRKA 1ROTA 4LAXA 3RFWA 1CTNA 4ODNA 1HKIA 2KO7A 2RUCA 4NNRA 4L72B 2KI3A 3CZ8A 1QPFA 2F23A 4W9QA 4QIBA 3I6CA 2OFNA 4P8WA 1ZB5A 2L2SA 4C02B 1K9TA 1RD6A 1BL4A 3KZ7A 4DWSB 2PV3A 1ITXA 1W9UA 3KADA 1ZU8A 2F2DA 3H9RB 4P8VA 1JNSA 4DRJA 3PRAA 1FD9A 1ZBVA 4MGVA 4XAKA 1Q1CA 3OA5A 2Q5AA 3WD4A 2ZR5A 2M1IA 4ZS6A 1FKHA 4ODQA 3ALGA 1BKFA 2LGOA 1NMVA 2ZR6A 2WLYA 3AS1A 3O5JA 3JXVA 3JYJA 1M5YA 1ZL1A 4Q7NA 3AROA 2FAPA 2PI6A 3NI6A 4WIWA 4S3KA 2F21A 4TX0A 1E9LA 4LAVA 3WH0A 1Y0OA 3GPKA 1FFQA 1O6IA 1LG1A 4NSBA 3B7XA 4TNSA 2PV2A 1D7JA 3IKDA 2XP7A 3UI5A 1EIBA 4Q22A 4FAPA 1W1TA 3ARQA 3UQIA 4GGQA 4ODRA 1FKFA 3UF8A 4S3JA 4R5EA 2RUQA 1E6ZA 3BXWA 1KT1A 3W4RA 1QZ2A 2B31A 1HKMA 5D75A 1LL4A 4UDMA 1GOIA 3RGCA 2F4EA 1N1AA 1FKSA 1NWTA 3B9DA 4DWSC 1KT0A 1FKKA 4JFKA 2LKNA 2QF8A 1NH6A 1P5QA 2VCDA 2ZQUA 4JFIA 1HKJA 3CHDA 1W1PA 4NZCA 4DWSA 1J4IA 2A3BA 4J4OA 4Z2IA 1J4HA 1EYMA 3WIJA 3UQBA 1NMWA 2DG3A 4DIPA 4ODOA 2DG9A 1H0GA 1E6NA 3O5KA 1E15A 5GPGA 1GUVA 4DRPA 4KR0B 1UR8A 4G2PA 3ODKA 1E44A 1J6YA 2MF9A 5JH8A 2JZVA 2PN0A 5DIVA 2O9OA 2MPHA 1W9VA 4U85A 4ITZA 1Q6IA 3RM8A 4DRIA 2EULA 2XPAA 1PBKA 2AOSA 2MLXA 1ZCNA 1VF8A 1JVWA 1GRJA 3O5IA 4QT2A 4U86A 4Z2GA 2DT3A 4KQZA 1NWUA 3WD2A 3ALFA 5HTGA 1HJWA 2ZQTA 3AQUA 4DRHA 5DO2A 1FJDA 2B5UB 4J4NA 1XHGA 5GPRA 1KFWA 4DWSD 1E6RA 1FKLA 2MNTA 2DT1A 1ZBCA 3O5GA 4PTMA 2G41A 3TC5A 4ZPWR 2MLYA 1FKJA 3WD3A 3KCEA 4MNLA 1NWRA 2RURA 1OGBA 3O5PA 4P8UA 5GQBA 2M2AA 2PPOA 4WK9A 5HW6A 4JFMA 5HWCA 4JYSA 1Q6HA 3UI4A 2YBUA 3G6LA 4URIA 3CHFA 4TW6A 4WKAA 2RQSA 5HT1A 1A7XA 2O92A 3AS0A 3WQVA 1QPLA 3AS3A 4LAYA 2XP4A 4O2TA 1EHNA 3B8SA 2DSUA 1JNDA 4U84A 1UR9A 2A3EA 2ZQSA 4IT6A 3VAWA 1U79A 4DZ2A 2DSWA 1FKBA 3CHCA 3WL0A 3IHZA 2RUDA 2XP3A 1D6OA 1OWQA 1LQ0A 1JCHB 4HARA 2A3AA 2FDMA 3KABA 4Z2KA 4DRQA 1NWSA 2IUZA 3OOBA 3KAFA 2DT2A 1LL6A 1WB0A 4W9OA 1JNTA 1D2KA 1HJVA 2DPEA 4JFLA 5DIUA 1EQ3A 3ARYA 3UQAA 4MNMA 5HBFA 1HXVA 5B8IC 3TDBA 3CH9A 3GU0A 2MLZA 5J6EA 4ML4A 3ARUA 1JNEA 2P4VA 3JYMA 3O5QA 2RSEA 1FKRA 2K8IA 1L1PA 2UZ5A 2Y78A 2N87A 3ARSA 3O5FA 3WQWA 4ODLA 2AWGA 4MNJA 1TFVA 2XPBA 4ODKA 5BXJA 3ARXA 2XP6A 3ARRA 3LUOA 4GIVA 1H0IA 1GPFA 1R9HA 2ZR4A 1ZBKA 3O5RA 2KFWA 2OLHA 3EIPA 1FKTA 3ARTA 1TCOC 2VN1A 3G6MA 1X6LA 4DROA 1FKGA 1WAWA 5HW8A 1EDQA 3CGMA 2XP5A 3KACA 5I98A 2ITKA 2DSZA 1FKDA 5DF0A 4TW8A 3WL1A 1D7HA 4ODMA 1LL7A 2KR7A 1ZBWA 4TYOA 3O5LA 1C9HA 4DT4A 1YATA 3ARVA 3RM9A 4DRMA 2PPNA 2ETNA 2WLZA 3B9AA 2ZQVA 4Z2JA 2A3CA 5HW7A 1E6PA 4IQ2A 2FKEA 1W26A 2KE0A 2G8ZA 4HBOA 4W5UA 3NRKA 3MDYB 1T11A 3TCZA 1J4RA 3IKGA 1XRVA 4FN2A 2YBTA 3PRDA 3KAHA 4QT3A 3WD1A 4MTVA 2PV1A 1IX5A 1OGGA 3O5EA 2XP8A 1WNOA 3CHEA 3ARPA 4R0XA 1F8AB 1D7IA 5HKGA 1FFRA 2IF4A 2PPPA 1F40A 2DT0A 4IT4A 1FAPA 3WKZA 3FY1A 1X6NA 1SR0A 3WD0A 3NTPA 2LJ4A 3BMBA 2WM0A 3IK8A 1W9PA 4MNKA 4MSPA 2WK2A 1SYTA 3B9EA 2KGJA 3ARZA 3RM4A 2DSVA 4MAVA 4LAWA 4WKHA 1YW5A 5DEZA
chains in the Genus database with same CATH topology
1HJXA 1PINA 1HKKA 4G50A 1Q6UA 4JFJA 3CGNA 4MPKA 1FKIA 5HWBA 2M08A 4IPXA 2ESCA 2PBCA 4BF8A 3UI6A 3QOKA 3RMEA 3O5DA 1B6CA 4W9PA 3O5OA 4ZPVR 5DITA 3AS2A 1W1YA 4DRNA 4Z2HA 4DH0A 1W1VA 1LG2A 2LPVA 2XP9A 4AY1A 3KAGA 4QZVB 1LJYA 1ZK6A 2D9FA 3EY6A 4WJXA 3ARWA 3PR9A 3FXYA 3PRBA 4ODPA 4DZ3A 3KAIA 4WKFA 4ZPTR 4N19A 4P8XA 4HBEA 4TW7A 4Z2LA 3O5MA 4IQCA 3FAPA 3PA7A 1NSGA 2DG4A 4L3NA 4LGXA 1ROUA 5HUAA 4DRKA 1ROTA 4LAXA 3RFWA 1CTNA 4ODNA 1HKIA 2KO7A 2RUCA 4NNRA 4L72B 2KI3A 3CZ8A 1QPFA 4W9QA 4QIBA 3I6CA 2OFNA 4P8WA 1ZB5A 2L2SA 4C02B 1K9TA 1RD6A 1BL4A 3KZ7A 4DWSB 2PV3A 1ITXA 1W9UA 3KADA 1ZU8A 2F2DA 3H9RB 4P8VA 1JNSA 4DRJA 3PRAA 1FD9A 1ZBVA 4MGVA 4XAKA 1Q1CA 3OA5A 2Q5AA 3WD4A 2ZR5A 2M1IA 4ZS6A 1FKHA 4ODQA 3ALGA 1BKFA 2LGOA 1NMVA 2ZR6A 2WLYA 3AS1A 3O5JA 3JXVA 3JYJA 1M5YA 1ZL1A 4Q7NA 3AROA 2FAPA 2PI6A 3NI6A 4WIWA 4S3KA 2F21A 4TX0A 1E9LA 4LAVA 3WH0A 1Y0OA 3GPKA 1FFQA 1O6IA 1LG1A 4NSBA 3B7XA 4TNSA 2PV2A 1D7JA 3IKDA 2XP7A 3UI5A 1EIBA 4Q22A 4FAPA 1W1TA 3ARQA 3UQIA 4GGQA 4ODRA 1FKFA 3UF8A 4S3JA 4R5EA 2RUQA 1E6ZA 3BXWA 1KT1A 3W4RA 1QZ2A 2B31A 1HKMA 5D75A 1LL4A 3RGCA 1GOIA 2F4EA 1N1AA 1FKSA 1NWTA 3B9DA 4DWSC 1KT0A 1FKKA 4JFKA 2LKNA 2QF8A 1NH6A 1P5QA 2VCDA 2ZQUA 4JFIA 1HKJA 3CHDA 1W1PA 4NZCA 4DWSA 1J4IA 2A3BA 4J4OA 4Z2IA 1J4HA 1EYMA 3WIJA 3UQBA 1NMWA 2DG3A 4DIPA 4ODOA 2DG9A 1H0GA 1E6NA 3O5KA 1E15A 5GPGA 1GUVA 4DRPA 4KR0B 1UR8A 4G2PA 3ODKA 1J6YA 2MF9A 5JH8A 2JZVA 5DIVA 2O9OA 2MPHA 1W9VA 4U85A 4ITZA 1Q6IA 3RM8A 4DRIA 2XPAA 1PBKA 2AOSA 2MLXA 1ZCNA 1VF8A 1JVWA 3O5IA 4QT2A 4U86A 4Z2GA 2DT3A 4KQZA 1NWUA 3WD2A 3ALFA 5HTGA 1HJWA 2ZQTA 3AQUA 4DRHA 5DO2A 1FJDA 4J4NA 1XHGA 5GPRA 1KFWA 4DWSD 1E6RA 1FKLA 2MNTA 2DT1A 1ZBCA 3O5GA 4PTMA 2G41A 3TC5A 4ZPWR 2MLYA 1FKJA 3WD3A 3KCEA 4MNLA 1NWRA 2RURA 1OGBA 3O5PA 4P8UA 5GQBA 2M2AA 2PPOA 4WK9A 5HW6A 4JFMA 5HWCA 4JYSA 1Q6HA 3UI4A 2YBUA 3G6LA 4URIA 3CHFA 4TW6A 4WKAA 2RQSA 5HT1A 1A7XA 2O92A 3AS0A 3WQVA 1QPLA 3AS3A 4LAYA 2XP4A 4O2TA 1EHNA 3B8SA 2DSUA 1JNDA 4U84A 1UR9A 2A3EA 2ZQSA 4IT6A 3VAWA 1U79A 4DZ2A 2DSWA 1FKBA 3CHCA 3WL0A 3IHZA 2RUDA 2XP3A 1D6OA 1LQ0A 1OWQA 4HARA 2A3AA 2FDMA 3KABA 4Z2KA 4DRQA 1NWSA 2IUZA 3OOBA 3KAFA 2DT2A 1LL6A 1WB0A 4W9OA 1JNTA 1D2KA 1HJVA 2DPEA 4JFLA 5DIUA 1EQ3A 3ARYA 3UQAA 4MNMA 5HBFA 1HXVA 5B8IC 3TDBA 3CH9A 2MLZA 5J6EA 4ML4A 3ARUA 1JNEA 3JYMA 3O5QA 2RSEA 1FKRA 2K8IA 1L1PA 2UZ5A 2Y78A 2N87A 3ARSA 3O5FA 3WQWA 4ODLA 2AWGA 4MNJA 1TFVA 2XPBA 4ODKA 5BXJA 3ARXA 2XP6A 3ARRA 3LUOA 4GIVA 1H0IA 1GPFA 1R9HA 2ZR4A 1ZBKA 3O5RA 2KFWA 2OLHA 1FKTA 3ARTA 1TCOC 2VN1A 3G6MA 1X6LA 4DROA 1FKGA 1WAWA 5HW8A 1EDQA 3CGMA 2XP5A 3KACA 5I98A 2ITKA 2DSZA 1FKDA 5DF0A 4TW8A 3WL1A 1D7HA 4ODMA 1LL7A 2KR7A 1ZBWA 4TYOA 3O5LA 1C9HA 4DT4A 1YATA 3ARVA 3RM9A 4DRMA 2PPNA 2WLZA 3B9AA 2ZQVA 4Z2JA 2A3CA 5HW7A 1E6PA 4IQ2A 2FKEA 1W26A 2KE0A 2G8ZA 4HBOA 4W5UA 3NRKA 3MDYB 1T11A 3TCZA 1J4RA 3IKGA 1XRVA 4FN2A 2YBTA 3PRDA 3KAHA 4QT3A 3WD1A 4MTVA 2PV1A 1IX5A 1OGGA 3O5EA 2XP8A 1WNOA 3CHEA 3ARPA 4R0XA 1F8AB 1D7IA 5HKGA 1FFRA 2IF4A 2PPPA 1F40A 2DT0A 4IT4A 1FAPA 3WKZA 3FY1A 1X6NA 1SR0A 3WD0A 3NTPA 2LJ4A 2WM0A 3IK8A 1W9PA 4MNKA 4MSPA 2WK2A 1SYTA 3B9EA 2KGJA 3ARZA 3RM4A 2DSVA 4MAVA 4LAWA 4WKHA 1YW5A 5DEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BKF A;  1PIN A;  2MPH A;  1L1P A;  4U85 A;  3JYM A;  4G50 A;  4ITZ A;  1Q6U A;  1Q6I A;  3O5Q A;  2LGO A;  1NMV A;  4DRI A;  4JFJ A;  2ZR6 A;  2XPA A;  3CGN A;  1PBK A;  2RSE A;  1FKR A;  2K8I A;  2MLX A;  2UZ5 A;  1FKI A;  1ZCN A;  2M08 A;  2Y78 A;  4IPX A;  3O5J A;  5HWB A;  1JVW A;  2N87 A;  3O5I A;  4QT2 A;  4U86 A;  2PBC A;  3O5F A;  3UI6 A;  4BF8 A;  4ODL A;  2AWG A;  3JXV A;  4ODK A;  2XPB A;  5BXJ A;  3JYJ A;  1M5Y A;  3O5D A;  2XP6 A;  1B6C A;  4W9P A;  3O5O A;  2FAP A;  3LUO A;  4GIV A;  5DIT A;  3NI6 A;  4DRN A;  2F21 A;  1R9H A;  4DH0 A;  4TX0 A;  2ZR4 A;  2ZQT A;  5HTG A;  4DRH A;  4LAV A;  1FJD A;  3WH0 A;  1Y0O A;  2LPV A;  2XP9 A;  3GPK A;  3O5R A;  4J4N A;  2KFW A;  3KAG A;  1FKL A;  2MNT A;  1ZK6 A;  1FKT A;  5J6E A;  2D9F A;  3B7X A;  3O5G A;  4TNS A;  1TCO C;  2PV2 A;  1D7J A;  2VN1 A;  3EY6 A;  3TC5 A;  4DRO A;  3IKD A;  1FKG A;  2XP7 A;  2MLY A;  1FKJ A;  3PRB A;  3KCE A;  4ODP A;  3UI5 A;  4DZ3 A;  3KAI A;  4FAP A;  2RUR A;  3O5P A;  5HW8 A;  2M2A A;  2XP5 A;  3CGM A;  3KAC A;  4N19 A;  5I98 A;  2PPO A;  2ITK A;  5HW6 A;  4TW7 A;  4JFM A;  1FKD A;  5HWC A;  4JYS A;  4TW8 A;  1Q6H A;  4GGQ A;  3O5M A;  1D7H A;  4ODR A;  4ODM A;  3UI4 A;  3UQI A;  4IQC A;  3FAP A;  1FKF A;  2KR7 A;  3UF8 A;  3PA7 A;  4TYO A;  1NSG A;  2DG4 A;  2RUQ A;  3O5L A;  4TW6 A;  1C9H A;  2RQS A;  5HT1 A;  4DT4 A;  1YAT A;  1A7X A;  1KT1 A;  1QZ2 A;  1QPL A;  4DRM A;  2PPN A;  5D75 A;  2ZQV A;  3RGC A;  1ROU A;  5HW7 A;  2F4E A;  1N1A A;  4IQ2 A;  1FKS A;  2FKE A;  4LAY A;  1KT0 A;  4DRK A;  5HUA A;  2XP4 A;  4O2T A;  1ROT A;  1W26 A;  1FKK A;  4U84 A;  2KE0 A;  4LAX A;  3RFW A;  4JFK A;  2ZQS A;  4ODN A;  3VAW A;  1U79 A;  2LKN A;  2KO7 A;  2RUC A;  3NRK A;  3MDY B;  4NNR A;  1T11 A;  3TCZ A;  1J4R A;  3IKG A;  4FN2 A;  4DZ2 A;  1P5Q A;  1FKB A;  2KI3 A;  2VCD A;  2ZQU A;  4JFI A;  3PRD A;  3KAH A;  4QT3 A;  1QPF A;  4W9Q A;  3IHZ A;  2PV1 A;  2RUD A;  4QIB A;  3I6C A;  2OFN A;  2L2S A;  1J4I A;  2XP3 A;  1D6O A;  4J4O A;  3O5E A;  4C02 B;  3KZ7 A;  1BL4 A;  1J4H A;  1EYM A;  2PV3 A;  2XP8 A;  3KAB A;  3KAD A;  3UQB A;  2F2D A;  4DRQ A;  4R0X A;  1F8A B;  1D7I A;  1NMW A;  5HKG A;  3OOB A;  3KAF A;  2DG3 A;  4DIP A;  2IF4 A;  3H9R B;  2PPP A;  4ODO A;  2DG9 A;  4W9O A;  1F40 A;  1JNT A;  3O5K A;  1FAP A;  5GPG A;  4DRJ A;  4DRP A;  3NTP A;  1FD9 A;  4G2P A;  4MGV A;  2LJ4 A;  4JFL A;  2MLZ A;  5DIU A;  3IK8 A;  1EQ3 A;  1JNS A;  3ODK A;  4MSP A;  1Q1C A;  2KGJ A;  1J6Y A;  2Q5A A;  3UQA A;  2ZR5 A;  2M1I A;  2MF9 A;  1FKH A;  2JZV A;  5B8I C;  4ODQ A;  4LAW A;  3TDB A;  1HXV A;  1YW5 A;  5DIV A; 
#chains in the Genus database with same CATH topology
 1HJX A;  1PIN A;  1HKK A;  4G50 A;  1Q6U A;  4JFJ A;  3CGN A;  4MPK A;  1FKI A;  5HWB A;  2M08 A;  4IPX A;  2ESC A;  2PBC A;  4BF8 A;  3UI6 A;  3QOK A;  3RME A;  3O5D A;  1B6C A;  4W9P A;  3O5O A;  4ZPV R;  5DIT A;  3AS2 A;  1W1Y A;  4DRN A;  4Z2H A;  4DH0 A;  1W1V A;  1LG2 A;  2LPV A;  2XP9 A;  4AY1 A;  3KAG A;  4QZV B;  1LJY A;  1ZK6 A;  2D9F A;  3EY6 A;  4WJX A;  3ARW A;  3PR9 A;  3FXY A;  3PRB A;  4ODP A;  4DZ3 A;  3KAI A;  4WKF A;  4ZPT R;  4N19 A;  4P8X A;  4HBE A;  4TW7 A;  3GTY X;  4Z2L A;  3O5M A;  4IQC A;  3FAP A;  3PA7 A;  1NSG A;  2DG4 A;  4L3N A;  4LGX A;  1ROU A;  5HUA A;  4DRK A;  1ROT A;  4LAX A;  3RFW A;  1CTN A;  4ODN A;  1HKI A;  2KO7 A;  2RUC A;  4NNR A;  4L72 B;  2KI3 A;  3CZ8 A;  1QPF A;  2F23 A;  4W9Q A;  4QIB A;  3I6C A;  2OFN A;  4P8W A;  1ZB5 A;  2L2S A;  4C02 B;  1K9T A;  1RD6 A;  1BL4 A;  3KZ7 A;  4DWS B;  2PV3 A;  1ITX A;  1W9U A;  3KAD A;  1ZU8 A;  2F2D A;  3H9R B;  4P8V A;  1JNS A;  4DRJ A;  3PRA A;  1FD9 A;  1ZBV A;  4MGV A;  4XAK A;  1Q1C A;  3OA5 A;  2Q5A A;  3WD4 A;  2ZR5 A;  2M1I A;  4ZS6 A;  1FKH A;  4ODQ A;  3ALG A;  1BKF A;  2LGO A;  1NMV A;  2ZR6 A;  2WLY A;  3AS1 A;  3O5J A;  3JXV A;  3JYJ A;  1M5Y A;  1ZL1 A;  4Q7N A;  3ARO A;  2FAP A;  2PI6 A;  3NI6 A;  4WIW A;  4S3K A;  2F21 A;  4TX0 A;  1E9L A;  4LAV A;  3WH0 A;  1Y0O A;  3GPK A;  1FFQ A;  1O6I A;  1LG1 A;  4NSB A;  3B7X A;  4TNS A;  2PV2 A;  1D7J A;  3IKD A;  2XP7 A;  3UI5 A;  1EIB A;  4Q22 A;  4FAP A;  1W1T A;  3ARQ A;  3UQI A;  4GGQ A;  4ODR A;  1FKF A;  3UF8 A;  4S3J A;  4R5E A;  2RUQ A;  1E6Z A;  3BXW A;  1KT1 A;  3W4R A;  1QZ2 A;  2B31 A;  1HKM A;  5D75 A;  1LL4 A;  4UDM A;  1GOI A;  3RGC A;  2F4E A;  1N1A A;  1FKS A;  1NWT A;  3B9D A;  4DWS C;  1KT0 A;  1FKK A;  4JFK A;  2LKN A;  2QF8 A;  1NH6 A;  1P5Q A;  2VCD A;  2ZQU A;  4JFI A;  1HKJ A;  3CHD A;  1W1P A;  4NZC A;  4DWS A;  1J4I A;  2A3B A;  4J4O A;  4Z2I A;  1J4H A;  1EYM A;  3WIJ A;  3UQB A;  1NMW A;  2DG3 A;  4DIP A;  4ODO A;  2DG9 A;  1H0G A;  1E6N A;  3O5K A;  1E15 A;  5GPG A;  1GUV A;  4DRP A;  4KR0 B;  1UR8 A;  4G2P A;  3ODK A;  1E44 A;  1J6Y A;  2MF9 A;  5JH8 A;  2JZV A;  2PN0 A;  5DIV A;  2O9O A;  2MPH A;  1W9V A;  4U85 A;  4ITZ A;  1Q6I A;  3RM8 A;  4DRI A;  2EUL A;  2XPA A;  1PBK A;  2AOS A;  2MLX A;  1ZCN A;  1VF8 A;  1JVW A;  1GRJ A;  3O5I A;  4QT2 A;  4U86 A;  4Z2G A;  2DT3 A;  4KQZ A;  1NWU A;  3WD2 A;  3ALF A;  5HTG A;  1HJW A;  2ZQT A;  3AQU A;  4DRH A;  5DO2 A;  1FJD A;  2B5U B;  4J4N A;  1XHG A;  5GPR A;  1KFW A;  4DWS D;  1E6R A;  1FKL A;  2MNT A;  2DT1 A;  1ZBC A;  3O5G A;  4PTM A;  2G41 A;  3TC5 A;  4ZPW R;  2MLY A;  1FKJ A;  3WD3 A;  3KCE A;  4MNL A;  1NWR A;  2RUR A;  1OGB A;  3O5P A;  4P8U A;  5GQB A;  2M2A A;  2PPO A;  4WK9 A;  5HW6 A;  4JFM A;  5HWC A;  4JYS A;  1Q6H A;  3UI4 A;  2YBU A;  3G6L A;  4URI A;  3CHF A;  4TW6 A;  4WKA A;  2RQS A;  5HT1 A;  1A7X A;  2O92 A;  3AS0 A;  3WQV A;  1QPL A;  3AS3 A;  4LAY A;  2XP4 A;  4O2T A;  1EHN A;  3B8S A;  2DSU A;  1JND A;  4U84 A;  1UR9 A;  2A3E A;  2ZQS A;  4IT6 A;  3VAW A;  1U79 A;  4DZ2 A;  2DSW A;  1FKB A;  3CHC A;  3WL0 A;  3IHZ A;  2RUD A;  2XP3 A;  1D6O A;  1OWQ A;  1LQ0 A;  1JCH B;  4HAR A;  2A3A A;  2FDM A;  3KAB A;  4Z2K A;  4DRQ A;  1NWS A;  2IUZ A;  3OOB A;  3KAF A;  2DT2 A;  1LL6 A;  1WB0 A;  4W9O A;  1JNT A;  1D2K A;  1HJV A;  2DPE A;  4JFL A;  5DIU A;  1EQ3 A;  3ARY A;  3UQA A;  4MNM A;  5HBF A;  1HXV A;  5B8I C;  3TDB A;  3CH9 A;  3GU0 A;  2MLZ A;  5J6E A;  4ML4 A;  3ARU A;  1JNE A;  2P4V A;  3JYM A;  3O5Q A;  2RSE A;  1FKR A;  2K8I A;  1L1P A;  2UZ5 A;  2Y78 A;  2N87 A;  3ARS A;  3O5F A;  3WQW A;  4ODL A;  2AWG A;  4MNJ A;  1TFV A;  2XPB A;  4ODK A;  5BXJ A;  3ARX A;  2XP6 A;  3ARR A;  3LUO A;  4GIV A;  1H0I A;  1GPF A;  1R9H A;  2ZR4 A;  1ZBK A;  3O5R A;  2KFW A;  2OLH A;  3EIP A;  1FKT A;  3ART A;  1TCO C;  2VN1 A;  3G6M A;  1X6L A;  4DRO A;  1FKG A;  1WAW A;  5HW8 A;  1EDQ A;  3CGM A;  2XP5 A;  3KAC A;  5I98 A;  2ITK A;  2DSZ A;  1FKD A;  5DF0 A;  4TW8 A;  3WL1 A;  1D7H A;  4ODM A;  1LL7 A;  2KR7 A;  1ZBW A;  4TYO A;  3O5L A;  1C9H A;  4DT4 A;  1YAT A;  3ARV A;  3RM9 A;  4DRM A;  2PPN A;  2ETN A;  2WLZ A;  3B9A A;  2ZQV A;  4Z2J A;  2A3C A;  5HW7 A;  1E6P A;  4IQ2 A;  2FKE A;  1W26 A;  2KE0 A;  2G8Z A;  4HBO A;  4W5U A;  3NRK A;  3MDY B;  1T11 A;  3TCZ A;  1J4R A;  3IKG A;  1XRV A;  4FN2 A;  2YBT A;  3PRD A;  3KAH A;  4QT3 A;  3WD1 A;  4MTV A;  2PV1 A;  1IX5 A;  1OGG A;  3O5E A;  2XP8 A;  1WNO A;  3CHE A;  3ARP A;  4R0X A;  1F8A B;  1D7I A;  5HKG A;  1FFR A;  2IF4 A;  2PPP A;  1F40 A;  2DT0 A;  4IT4 A;  1FAP A;  3WKZ A;  3FY1 A;  1X6N A;  1SR0 A;  3WD0 A;  3NTP A;  2LJ4 A;  3BMB A;  2WM0 A;  3IK8 A;  1W9P A;  4MNK A;  4MSP A;  2WK2 A;  1SYT A;  3B9E A;  2KGJ A;  3ARZ A;  3RM4 A;  2DSV A;  4MAV A;  4LAW A;  4WKH A;  1YW5 A;  5DEZ A; 
#chains in the Genus database with same CATH homology
 1HJX A;  1PIN A;  1HKK A;  4G50 A;  1Q6U A;  4JFJ A;  3CGN A;  4MPK A;  1FKI A;  5HWB A;  2M08 A;  4IPX A;  2ESC A;  2PBC A;  4BF8 A;  3UI6 A;  3QOK A;  3RME A;  3O5D A;  1B6C A;  4W9P A;  3O5O A;  4ZPV R;  5DIT A;  3AS2 A;  1W1Y A;  4DRN A;  4Z2H A;  4DH0 A;  1W1V A;  1LG2 A;  2LPV A;  2XP9 A;  4AY1 A;  3KAG A;  4QZV B;  1LJY A;  1ZK6 A;  2D9F A;  3EY6 A;  4WJX A;  3ARW A;  3PR9 A;  3FXY A;  3PRB A;  4ODP A;  4DZ3 A;  3KAI A;  4WKF A;  4ZPT R;  4N19 A;  4P8X A;  4HBE A;  4TW7 A;  4Z2L A;  3O5M A;  4IQC A;  3FAP A;  3PA7 A;  1NSG A;  2DG4 A;  4L3N A;  4LGX A;  1ROU A;  5HUA A;  4DRK A;  1ROT A;  4LAX A;  3RFW A;  1CTN A;  4ODN A;  1HKI A;  2KO7 A;  2RUC A;  4NNR A;  4L72 B;  2KI3 A;  3CZ8 A;  1QPF A;  4W9Q A;  4QIB A;  3I6C A;  2OFN A;  4P8W A;  1ZB5 A;  2L2S A;  4C02 B;  1K9T A;  1RD6 A;  1BL4 A;  3KZ7 A;  4DWS B;  2PV3 A;  1ITX A;  1W9U A;  3KAD A;  1ZU8 A;  2F2D A;  3H9R B;  4P8V A;  1JNS A;  4DRJ A;  3PRA A;  1FD9 A;  1ZBV A;  4MGV A;  4XAK A;  1Q1C A;  3OA5 A;  2Q5A A;  3WD4 A;  2ZR5 A;  2M1I A;  4ZS6 A;  1FKH A;  4ODQ A;  3ALG A;  1BKF A;  2LGO A;  1NMV A;  2ZR6 A;  2WLY A;  3AS1 A;  3O5J A;  3JXV A;  3JYJ A;  1M5Y A;  1ZL1 A;  4Q7N A;  3ARO A;  2FAP A;  2PI6 A;  3NI6 A;  4WIW A;  4S3K A;  2F21 A;  4TX0 A;  1E9L A;  4LAV A;  3WH0 A;  1Y0O A;  3GPK A;  1FFQ A;  1O6I A;  1LG1 A;  4NSB A;  3B7X A;  4TNS A;  2PV2 A;  1D7J A;  3IKD A;  2XP7 A;  3UI5 A;  1EIB A;  4Q22 A;  4FAP A;  1W1T A;  3ARQ A;  3UQI A;  4GGQ A;  4ODR A;  1FKF A;  3UF8 A;  4S3J A;  4R5E A;  2RUQ A;  1E6Z A;  3BXW A;  1KT1 A;  3W4R A;  1QZ2 A;  2B31 A;  1HKM A;  5D75 A;  1LL4 A;  3RGC A;  1GOI A;  2F4E A;  1N1A A;  1FKS A;  1NWT A;  3B9D A;  4DWS C;  1KT0 A;  1FKK A;  4JFK A;  2LKN A;  2QF8 A;  1NH6 A;  1P5Q A;  2VCD A;  2ZQU A;  4JFI A;  1HKJ A;  3CHD A;  1W1P A;  4NZC A;  4DWS A;  1J4I A;  2A3B A;  4J4O A;  4Z2I A;  1J4H A;  1EYM A;  3WIJ A;  3UQB A;  1NMW A;  2DG3 A;  4DIP A;  4ODO A;  2DG9 A;  1H0G A;  1E6N A;  3O5K A;  1E15 A;  5GPG A;  1GUV A;  4DRP A;  4KR0 B;  1UR8 A;  4G2P A;  3ODK A;  1J6Y A;  2MF9 A;  5JH8 A;  2JZV A;  5DIV A;  2O9O A;  2MPH A;  1W9V A;  4U85 A;  4ITZ A;  1Q6I A;  3RM8 A;  4DRI A;  2XPA A;  1PBK A;  2AOS A;  2MLX A;  1ZCN A;  1VF8 A;  1JVW A;  3O5I A;  4QT2 A;  4U86 A;  4Z2G A;  2DT3 A;  4KQZ A;  1NWU A;  3WD2 A;  3ALF A;  5HTG A;  1HJW A;  2ZQT A;  3AQU A;  4DRH A;  5DO2 A;  1FJD A;  4J4N A;  1XHG A;  5GPR A;  1KFW A;  4DWS D;  1E6R A;  1FKL A;  2MNT A;  2DT1 A;  1ZBC A;  3O5G A;  4PTM A;  2G41 A;  3TC5 A;  4ZPW R;  2MLY A;  1FKJ A;  3WD3 A;  3KCE A;  4MNL A;  1NWR A;  2RUR A;  1OGB A;  3O5P A;  4P8U A;  5GQB A;  2M2A A;  2PPO A;  4WK9 A;  5HW6 A;  4JFM A;  5HWC A;  4JYS A;  1Q6H A;  3UI4 A;  2YBU A;  3G6L A;  4URI A;  3CHF A;  4TW6 A;  4WKA A;  2RQS A;  5HT1 A;  1A7X A;  2O92 A;  3AS0 A;  3WQV A;  1QPL A;  3AS3 A;  4LAY A;  2XP4 A;  4O2T A;  1EHN A;  3B8S A;  2DSU A;  1JND A;  4U84 A;  1UR9 A;  2A3E A;  2ZQS A;  4IT6 A;  3VAW A;  1U79 A;  4DZ2 A;  2DSW A;  1FKB A;  3CHC A;  3WL0 A;  3IHZ A;  2RUD A;  2XP3 A;  1D6O A;  1LQ0 A;  1OWQ A;  4HAR A;  2A3A A;  2FDM A;  3KAB A;  4Z2K A;  4DRQ A;  1NWS A;  2IUZ A;  3OOB A;  3KAF A;  2DT2 A;  1LL6 A;  1WB0 A;  4W9O A;  1JNT A;  1D2K A;  1HJV A;  2DPE A;  4JFL A;  5DIU A;  1EQ3 A;  3ARY A;  3UQA A;  4MNM A;  5HBF A;  1HXV A;  5B8I C;  3TDB A;  3CH9 A;  2MLZ A;  5J6E A;  4ML4 A;  3ARU A;  1JNE A;  3JYM A;  3O5Q A;  2RSE A;  1FKR A;  2K8I A;  1L1P A;  2UZ5 A;  2Y78 A;  2N87 A;  3ARS A;  3O5F A;  3WQW A;  4ODL A;  2AWG A;  4MNJ A;  1TFV A;  2XPB A;  4ODK A;  5BXJ A;  3ARX A;  2XP6 A;  3ARR A;  3LUO A;  4GIV A;  1H0I A;  1GPF A;  1R9H A;  2ZR4 A;  1ZBK A;  3O5R A;  2KFW A;  2OLH A;  1FKT A;  3ART A;  1TCO C;  2VN1 A;  3G6M A;  1X6L A;  4DRO A;  1FKG A;  1WAW A;  5HW8 A;  1EDQ A;  3CGM A;  2XP5 A;  3KAC A;  5I98 A;  2ITK A;  2DSZ A;  1FKD A;  5DF0 A;  4TW8 A;  3WL1 A;  1D7H A;  4ODM A;  1LL7 A;  2KR7 A;  1ZBW A;  4TYO A;  3O5L A;  1C9H A;  4DT4 A;  1YAT A;  3ARV A;  3RM9 A;  4DRM A;  2PPN A;  2WLZ A;  3B9A A;  2ZQV A;  4Z2J A;  2A3C A;  5HW7 A;  1E6P A;  4IQ2 A;  2FKE A;  1W26 A;  2KE0 A;  2G8Z A;  4HBO A;  4W5U A;  3NRK A;  3MDY B;  1T11 A;  3TCZ A;  1J4R A;  3IKG A;  1XRV A;  4FN2 A;  2YBT A;  3PRD A;  3KAH A;  4QT3 A;  3WD1 A;  4MTV A;  2PV1 A;  1IX5 A;  1OGG A;  3O5E A;  2XP8 A;  1WNO A;  3CHE A;  3ARP A;  4R0X A;  1F8A B;  1D7I A;  5HKG A;  1FFR A;  2IF4 A;  2PPP A;  1F40 A;  2DT0 A;  4IT4 A;  1FAP A;  3WKZ A;  3FY1 A;  1X6N A;  1SR0 A;  3WD0 A;  3NTP A;  2LJ4 A;  2WM0 A;  3IK8 A;  1W9P A;  4MNK A;  4MSP A;  2WK2 A;  1SYT A;  3B9E A;  2KGJ A;  3ARZ A;  3RM4 A;  2DSV A;  4MAV A;  4LAW A;  4WKH A;  1YW5 A;  5DEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...