1J6YA

Solution structure of pin1at from arabidopsis thaliana
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
120
structure length
120
Chain Sequence
b'HMASRDQVKASHILIKHQGSRRKASWKDPEGKIILTTTREAAVEQLKSIREDIVSGKANFEEVATRVSDCSSAKRGGDLGSFGRGQMQKPFEEATYALKVGDISDIVDTDSGVHIIKRTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peptidyl-prolyl cis-trans isomerase
publication title Solution Structure of the Single-domain Prolyl Cis/Trans Isomerase PIN1At from Arabidopsis thaliana
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Isomerase
total genus 17
structure length 120
sequence length 120
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j6yA00
3CGMA 2AWGA 3WH0A 4G2PA 3FAPA 3KAFA 5DIUA 1Y0OA 4ODQA 4G50A 5HTGA 2RSEA 2ZR4A 3OOBA 1QPLA 3TCZA 3B7XA 3RFWA 1M5YA 2F2DA 1ROTA 3UI6A 2MF9A 4FAPA 2RUQA 3KAGA 1FKFA 3KABA 3KZ7A 2Q5AA 3PRDA 5BXJA 5HWCA 1A7XA 3IKDA 2LKNA 4JFMA 4R0XA 4JFKA 4DRKA 3JYMA 1FAPA 2KO7A 3O5LA 1FKJA 3IK8A 1KT0A 4TYOA 4DRNA 1NMWA 2FAPA 2PV2A 2ZQSA 4ODOA 4DRMA 2RUDA 2N87A 1PBKA 1Q1CA 4ODLA 4DZ3A 5D75A 1J4IA 4LAWA 3O5EA 2PPOA 4DIPA 3KCEA 1FKHA 1FD9A 3RGCA 2M2AA 3JYJA 2KGJA 4DRJA 3UQAA 3KAIA 2PV1A 1FKDA 2XP3A 2IF4A 2PPPA 1FJDA 3CGNA 1JNSA 4TW6A 2OFNA 2XP6A 4DROA 3KADA 5HUAA 1FKLA 2KE0A 2RQSA 3O5FA 2LPVA 3UF8A 2UZ5A 3O5JA 4JFLA 4TW7A 1FKKA 4DRHA 1D7IA 1ZCNA 2ZR5A 3GPKA 4MSPA 4BF8A 5J6EA 3UQIA 1W26A 2XPAA 4J4OA 2XP5A 3TC5A 1J6YA 2Y78A 4GGQA 1BL4A 1FKGA 1TCOC 1PINA 1F8AB 4IQ2A 1ROUA 2MNTA 3O5PA 1D7JA 2LGOA 4JFJA 4ODMA 2XP9A 1T11A 2DG9A 1YATA 3O5GA 4W9QA 4QT3A 2L2SA 3ODKA 1FKBA 1ZK6A 3KAHA 2KFWA 3TDBA 3O5IA 1J4RA 2MLYA 4GIVA 2D9FA 4LAXA 4QIBA 4DT4A 1QPFA 4ODKA 2XPBA 4W9PA 1NMVA 2JZVA 1C9HA 3O5QA 1NSGA 3O5DA 1P5QA 3O5KA 4J4NA 4DZ2A 1FKSA 2ZQUA 2ZQVA 4QT2A 4ODPA 1FKIA 2M1IA 4LAYA 2PV3A 3KACA 5DIVA 1HXVA 2XP4A 2ZR6A 5HW7A 2ITKA 3O5MA 4ODNA 1JNTA 4U85A 1Q6HA 4O2TA 4U86A 4IQCA 1BKFA 1JVWA 4MGVA 5I98A 4C02B 5DITA 3I6CA 3PRBA 2F21A 4DRIA 2FKEA 1N1AA 3IKGA 2VN1A 3UQBA 3IHZA 2M08A 1F40A 1L1PA 1B6CA 3O5RA 3UI4A 4DH0A 2KR7A 1EQ3A 3JXVA 2LJ4A 2VCDA 3NRKA 2F4EA 4IPXA 4NNRA 3MDYB 3LUOA 1FKTA 3H9RB 4DRPA 1Q6UA 1EYMA 3PA7A 4JFIA 4FN2A 1Q6IA 2ZQTA 1QZ2A 1J4HA 2XP8A 4JYSA 1D7HA 4U84A 2K8IA 5HW8A 2XP7A 3O5OA 1FKRA 4ODRA 2MLZA 4W9OA 3NI6A 4TW8A 3VAWA 5GPGA 2PBCA 2MLXA 3EY6A 1KT1A 5HW6A 4DRQA 2RURA 4TNSA 5HKGA 4TX0A 5HWBA 2DG3A 1R9HA 4LAVA 1D6OA 4N19A 1U79A 5HT1A 5B8IC 4ITZA 2MPHA 2KI3A 2PPNA 2RUCA 3NTPA 3UI5A 2DG4A 1YW5A
chains in the Genus database with same CATH superfamily
3ARTA 3B9EA 3KAFA 4MAVA 5DIUA 1Y0OA 4G50A 4DWSD 1W1YA 2RSEA 3OOBA 1ZBWA 3UI6A 1WNOA 4MNJA 3KABA 2F23A 3KZ7A 5BXJA 4S3JA 5HWCA 4JFMA 4JFKA 3WD1A 1FAPA 1FKJA 1LG1A 1KT0A 1W9VA 3G6MA 2PV2A 3ARYA 4DRMA 3BMBA 2N87A 3BXWA 1NWSA 1NWRA 1ITXA 5D75A 4LAWA 3WQVA 1NH6A 4URIA 3JYJA 4DRJA 1HKKA 2PPPA 1ZB5A 2WLZA 1FJDA 2OFNA 2XP6A 3KADA 1FKLA 3O5JA 3CHFA 2ZR5A 4MNMA 1K9TA 1J6YA 3TC5A 2Y78A 4IQ2A 2LGOA 1YATA 3ODKA 3KAHA 4P8XA 4WIWA 2ZQVA 3WQWA 4DWSA 2A3EA 1FKIA 1OWQA 5DIVA 1HXVA 3WIJA 4U86A 4MGVA 5DITA 3PRBA 2O92A 3OA5A 3IKGA 1CTNA 2B5UB 3CH9A 3UI4A 4L72B 1EQ3A 4DT4A 3NRKA 2F4EA 1NWTA 3LUOA 1E9LA 4KR0B 1Q6UA 1HKMA 4JFIA 4FN2A 1Q6IA 4QZVB 1QZ2A 1J4HA 2XP8A 2XP7A 4W9OA 3NI6A 3VAWA 2PBCA 3EY6A 2DSVA 4TX0A 4LAVA 1D6OA 4N19A 1U79A 4Z2KA 4ITZA 3UI5A 2DG4A 1W1VA 3CGMA 4W5UA 3WH0A 1WB0A 3FAPA 4DWSC 2ZR4A 1QPLA 3TCZA 3B7XA 3RFWA 1M5YA 2MF9A 2RUQA 4WKHA 2Q5AA 3PRDA 3IKDA 4DRKA 2P4VA 2WK2A 3O5LA 3G6LA 4IT4A 5HBFA 4TYOA 1ZBCA 1Q1CA 4ODLA 1GOIA 3AS3A 1J4IA 3ARZA 1E6NA 3KCEA 4DWSB 1FKHA 3RGCA 3UQAA 3WL0A 3RM4A 3RMEA 4LGXA 3KAIA 3WD2A 1FKDA 4P8UA 3CGNA 4DROA 5HUAA 2WLYA 1E44A 1ZU8A 1OGGA 2WM0A 1FKKA 2DSWA 4PTMA 1D7IA 1XRVA 4BF8A 1LJYA 3ARXA 2OLHA 1F8AB 2MNTA 3O5PA 4JFJA 4Q7NA 2XP9A 3O5GA 3ARRA 4QT3A 1FKBA 2PN0A 3O5IA 1J4RA 1H0IA 3CHCA 4S3KA 4GIVA 4QIBA 4KQZA 2XPBA 3O5QA 1C9HA 1P5QA 4NZCA 1SR0A 4Z2HA 3CHDA 1JNEA 3RM9A 4ODPA 1H0GA 1LL4A 2XP4A 2ITKA 4ODNA 5GQBA 1Q6HA 4O2TA 1ZBVA 1BKFA 4IQCA 3AS0A 1UR9A 4WKFA 3IHZA 3PR9A 1L1PA 1E6ZA 3FY1A 4DH0A 1VF8A 4NNRA 3CZ8A 1EYMA 3PA7A 1LG2A 1E6RA 5DO2A 1E15A 1GRJA 1KT1A 2A3AA 2RURA 4TNSA 3ARUA 4NSBA 2MPHA 3ARWA 2KI3A 2PPNA 3NTPA 2G8ZA 3ALGA 4G2PA 1LQ0A 1HKJA 4Z2GA 1RD6A 3ARPA 4FAPA 3KAGA 2O9OA 1A7XA 3JYMA 3IK8A 4DRNA 3WD3A 1NMWA 2FAPA 3FXYA 2DSUA 4ODOA 1HJWA 2RUDA 5GPRA 3ALFA 3O5EA 4IT6A 2PPOA 2DSZA 5DF0A 2G41A 1JNDA 2XP3A 2IF4A 1HJXA 1HKIA 4TW6A 3B8SA 3O5FA 3UF8A 3QOKA 2UZ5A 1FFQA 4DRHA 3PRAA 1FFRA 1ZCNA 4L3NA 4MSPA 3WD0A 3UQIA 1W26A 1X6NA 2XPAA 2XP5A 4J4OA 4Z2IA 1FKGA 2IUZA 2ESCA 4HBOA 4ODMA 1D7JA 1D2KA 4MNKA 1EHNA 2L2SA 3TDBA 3AS2A 4W9PA 1NMVA 2JZVA 4J4NA 1NSGA 3O5DA 1OGBA 1FKSA 2DT0A 4P8VA 4QT2A 2ZR6A 5HW7A 3O5MA 4UDMA 1JNTA 4MNLA 3WKZA 1JVWA 2A3BA 4C02B 2F21A 1N1AA 3UQBA 4MTVA 4HARA 2B31A 2M08A 3EIPA 1F40A 1B6CA 3RM8A 4Z2JA 2KR7A 3JXVA 2VCDA 3MDYB 1FKTA 3H9RB 4DRPA 2DT1A 4WK9A 2DT2A 2EULA 4JYSA 4U84A 2K8IA 3O5OA 4ML4A 4ODRA 2MLZA 1JCHB 1NWUA 5GPGA 2MLXA 1W1PA 4DRQA 5HWBA 4Q22A 3AQUA 5HT1A 5B8IC 2RUCA 2AOSA 4WKAA 1E6PA 1YW5A 3AS1A 1EIBA 2AWGA 1EDQA 4ODQA 3ARSA 5HTGA 5DEZA 1TFVA 2F2DA 1ROTA 4AY1A 3AROA 1FKFA 1GPFA 2DPEA 2LKNA 4R0XA 2KO7A 2QF8A 2ZQSA 2PI6A 3ARVA 1PBKA 4ZPTR 1IX5A 4DZ3A 2A3CA 4WJXA 4DIPA 1HJVA 1FD9A 2M2AA 1W9PA 2KGJA 2PV1A 1W1TA 4P8WA 1JNSA 1UR8A 1WAWA 2KE0A 1ZL1A 3GTYX 2RQSA 2LPVA 3W4RA 4JFLA 4TW7A 3WL1A 5J6EA 3GPKA 4ZS6A 4GGQA 1BL4A 1TCOC 1PINA 1ROUA 3GU0A 4R5EA 1T11A 2DG9A 4W9QA 4XAKA 1ZK6A 2KFWA 2MLYA 2D9FA 1KFWA 4LAXA 4Z2LA 4HBEA 1QPFA 4ODKA 3O5KA 4DZ2A 2ZQUA 4MPKA 2M1IA 4LAYA 2PV3A 3KACA 1LL7A 4ZPVR 4U85A 1XHGA 3CHEA 1O6IA 5I98A 1X6LA 3I6CA 4DRIA 2ETNA 2FKEA 2DT3A 2VN1A 2FDMA 2YBUA 3O5RA 3ARQA 1ZBKA 2LJ4A 4IPXA 1GUVA 3B9DA 2ZQTA 1D7HA 5HW8A 1FKRA 4TW8A 1W9UA 5HW6A 1SYTA 5JH8A 5HKGA 2YBTA 2DG3A 1R9HA 1LL6A 3WD4A 3B9AA 4ZPWR
chains in the Genus database with same CATH topology
3ARTA 3B9EA 3KAFA 4MAVA 5DIUA 1Y0OA 4G50A 4DWSD 1W1YA 2RSEA 3OOBA 1ZBWA 3UI6A 1WNOA 4MNJA 3KABA 3KZ7A 5BXJA 4S3JA 5HWCA 4JFMA 4JFKA 3WD1A 1FAPA 1FKJA 1LG1A 1KT0A 1W9VA 3G6MA 2PV2A 3ARYA 4DRMA 2N87A 3BXWA 1NWSA 1NWRA 1ITXA 5D75A 4LAWA 3WQVA 1NH6A 4URIA 3JYJA 4DRJA 1HKKA 2PPPA 1ZB5A 2WLZA 1FJDA 2OFNA 2XP6A 3KADA 1FKLA 3O5JA 3CHFA 2ZR5A 4MNMA 1K9TA 1J6YA 3TC5A 2Y78A 4IQ2A 2LGOA 1YATA 3ODKA 3KAHA 4P8XA 4WIWA 2ZQVA 3WQWA 4DWSA 2A3EA 1FKIA 1OWQA 5DIVA 1HXVA 3WIJA 4U86A 4MGVA 5DITA 3PRBA 2O92A 3OA5A 3IKGA 1CTNA 3CH9A 3UI4A 4L72B 1EQ3A 4DT4A 3NRKA 2F4EA 1NWTA 3LUOA 1E9LA 4KR0B 1Q6UA 1HKMA 4JFIA 4FN2A 1Q6IA 4QZVB 1QZ2A 1J4HA 2XP8A 2XP7A 4W9OA 3NI6A 3VAWA 2PBCA 3EY6A 2DSVA 4TX0A 4LAVA 1D6OA 4N19A 1U79A 4Z2KA 4ITZA 3UI5A 2DG4A 1W1VA 3CGMA 4W5UA 3WH0A 1WB0A 3FAPA 4DWSC 2ZR4A 1QPLA 3TCZA 3B7XA 3RFWA 1M5YA 2MF9A 2RUQA 4WKHA 2Q5AA 3PRDA 3IKDA 4DRKA 2WK2A 3O5LA 3G6LA 4IT4A 5HBFA 4TYOA 1ZBCA 1Q1CA 4ODLA 1GOIA 3AS3A 1J4IA 3ARZA 1E6NA 3KCEA 4DWSB 1FKHA 3RGCA 3UQAA 3WL0A 3RM4A 3RMEA 4LGXA 3KAIA 3WD2A 1FKDA 4P8UA 3CGNA 4DROA 5HUAA 2WLYA 1ZU8A 1OGGA 2WM0A 1FKKA 2DSWA 4PTMA 1D7IA 1XRVA 4BF8A 1LJYA 3ARXA 2OLHA 1F8AB 2MNTA 3O5PA 4JFJA 4Q7NA 2XP9A 3O5GA 3ARRA 4QT3A 1FKBA 3O5IA 1J4RA 1H0IA 3CHCA 4S3KA 4GIVA 4QIBA 4KQZA 2XPBA 3O5QA 1C9HA 1P5QA 4NZCA 1SR0A 4Z2HA 3CHDA 1JNEA 3RM9A 4ODPA 1H0GA 1LL4A 2XP4A 2ITKA 4ODNA 5GQBA 1Q6HA 4O2TA 1ZBVA 1BKFA 4IQCA 3AS0A 1UR9A 4WKFA 3IHZA 3PR9A 1L1PA 1E6ZA 3FY1A 4DH0A 1VF8A 4NNRA 3CZ8A 1EYMA 3PA7A 1LG2A 1E6RA 5DO2A 1E15A 1KT1A 2A3AA 2RURA 4TNSA 3ARUA 4NSBA 2MPHA 3ARWA 2KI3A 2PPNA 3NTPA 2G8ZA 3ALGA 4G2PA 1LQ0A 1HKJA 4Z2GA 1RD6A 3ARPA 4FAPA 3KAGA 2O9OA 1A7XA 3JYMA 3IK8A 4DRNA 3WD3A 1NMWA 2FAPA 3FXYA 2DSUA 4ODOA 1HJWA 2RUDA 5GPRA 3ALFA 3O5EA 4IT6A 2PPOA 2DSZA 5DF0A 2G41A 1JNDA 2XP3A 2IF4A 1HJXA 1HKIA 4TW6A 3B8SA 3O5FA 3UF8A 3QOKA 2UZ5A 1FFQA 4DRHA 3PRAA 1FFRA 1ZCNA 4L3NA 4MSPA 3WD0A 3UQIA 1W26A 1X6NA 2XPAA 2XP5A 4J4OA 4Z2IA 1FKGA 2IUZA 2ESCA 4HBOA 4ODMA 1D7JA 1D2KA 4MNKA 1EHNA 2L2SA 3TDBA 3AS2A 4W9PA 1NMVA 2JZVA 4J4NA 1NSGA 3O5DA 1OGBA 1FKSA 2DT0A 4P8VA 4QT2A 2ZR6A 5HW7A 3O5MA 1JNTA 4MNLA 3WKZA 1JVWA 2A3BA 4C02B 2F21A 1N1AA 3UQBA 4MTVA 4HARA 2B31A 2M08A 1F40A 1B6CA 3RM8A 4Z2JA 2KR7A 3JXVA 2VCDA 3MDYB 1FKTA 3H9RB 4DRPA 2DT1A 4WK9A 2DT2A 4JYSA 4U84A 2K8IA 3O5OA 4ML4A 4ODRA 2MLZA 1NWUA 5GPGA 2MLXA 1W1PA 4DRQA 5HWBA 4Q22A 3AQUA 5HT1A 5B8IC 2RUCA 2AOSA 4WKAA 1E6PA 1YW5A 3AS1A 1EIBA 2AWGA 1EDQA 4ODQA 3ARSA 5HTGA 5DEZA 1TFVA 2F2DA 1ROTA 4AY1A 3AROA 1FKFA 1GPFA 2DPEA 2LKNA 4R0XA 2KO7A 2QF8A 2ZQSA 2PI6A 3ARVA 1PBKA 4ZPTR 1IX5A 4DZ3A 2A3CA 4WJXA 4DIPA 1HJVA 1FD9A 2M2AA 1W9PA 2KGJA 2PV1A 1W1TA 4P8WA 1JNSA 1UR8A 1WAWA 2KE0A 1ZL1A 2RQSA 2LPVA 3W4RA 4JFLA 4TW7A 3WL1A 5J6EA 3GPKA 4ZS6A 4GGQA 1BL4A 1TCOC 1PINA 1ROUA 4R5EA 1T11A 2DG9A 4W9QA 4XAKA 1ZK6A 2KFWA 2MLYA 2D9FA 1KFWA 4LAXA 4Z2LA 4HBEA 1QPFA 4ODKA 3O5KA 4DZ2A 2ZQUA 4MPKA 2M1IA 4LAYA 2PV3A 3KACA 1LL7A 4ZPVR 4U85A 1XHGA 3CHEA 1O6IA 5I98A 1X6LA 3I6CA 4DRIA 2FKEA 2DT3A 2VN1A 2FDMA 2YBUA 3O5RA 3ARQA 1ZBKA 2LJ4A 4IPXA 1GUVA 3B9DA 2ZQTA 1D7HA 5HW8A 1FKRA 4TW8A 1W9UA 5HW6A 1SYTA 5JH8A 5HKGA 2YBTA 2DG3A 1R9HA 1LL6A 3WD4A 3B9AA 4ZPWR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CGM A;  2AWG A;  3WH0 A;  4G2P A;  3FAP A;  3KAF A;  5DIU A;  1Y0O A;  4ODQ A;  4G50 A;  5HTG A;  2RSE A;  2ZR4 A;  3OOB A;  1QPL A;  3TCZ A;  3B7X A;  3RFW A;  1M5Y A;  2F2D A;  1ROT A;  3UI6 A;  2MF9 A;  4FAP A;  2RUQ A;  3KAG A;  1FKF A;  3KAB A;  3KZ7 A;  2Q5A A;  3PRD A;  5BXJ A;  5HWC A;  1A7X A;  3IKD A;  2LKN A;  4JFM A;  4R0X A;  4JFK A;  4DRK A;  3JYM A;  1FAP A;  2KO7 A;  3O5L A;  1FKJ A;  3IK8 A;  1KT0 A;  4TYO A;  4DRN A;  1NMW A;  2FAP A;  2PV2 A;  2ZQS A;  4ODO A;  4DRM A;  2RUD A;  2N87 A;  1PBK A;  1Q1C A;  4ODL A;  4DZ3 A;  5D75 A;  1J4I A;  4LAW A;  3O5E A;  2PPO A;  4DIP A;  3KCE A;  1FKH A;  1FD9 A;  3RGC A;  2M2A A;  3JYJ A;  2KGJ A;  4DRJ A;  3UQA A;  3KAI A;  2PV1 A;  1FKD A;  2XP3 A;  2IF4 A;  2PPP A;  1FJD A;  3CGN A;  1JNS A;  4TW6 A;  2OFN A;  2XP6 A;  4DRO A;  3KAD A;  5HUA A;  1FKL A;  2KE0 A;  2RQS A;  3O5F A;  2LPV A;  3UF8 A;  2UZ5 A;  3O5J A;  4JFL A;  4TW7 A;  1FKK A;  4DRH A;  1D7I A;  1ZCN A;  2ZR5 A;  3GPK A;  4MSP A;  4BF8 A;  5J6E A;  3UQI A;  1W26 A;  2XPA A;  4J4O A;  2XP5 A;  3TC5 A;  1J6Y A;  2Y78 A;  4GGQ A;  1BL4 A;  1FKG A;  1TCO C;  1PIN A;  1F8A B;  4IQ2 A;  1ROU A;  2MNT A;  3O5P A;  1D7J A;  2LGO A;  4JFJ A;  4ODM A;  2XP9 A;  1T11 A;  2DG9 A;  1YAT A;  3O5G A;  4W9Q A;  4QT3 A;  2L2S A;  3ODK A;  1FKB A;  1ZK6 A;  3KAH A;  2KFW A;  3TDB A;  3O5I A;  1J4R A;  2MLY A;  4GIV A;  2D9F A;  4LAX A;  4QIB A;  4DT4 A;  1QPF A;  4ODK A;  2XPB A;  4W9P A;  1NMV A;  2JZV A;  1C9H A;  3O5Q A;  1NSG A;  3O5D A;  1P5Q A;  3O5K A;  4J4N A;  4DZ2 A;  1FKS A;  2ZQU A;  2ZQV A;  4QT2 A;  4ODP A;  1FKI A;  2M1I A;  4LAY A;  2PV3 A;  3KAC A;  5DIV A;  1HXV A;  2XP4 A;  2ZR6 A;  5HW7 A;  2ITK A;  3O5M A;  4ODN A;  1JNT A;  4U85 A;  1Q6H A;  4O2T A;  4U86 A;  4IQC A;  1BKF A;  1JVW A;  4MGV A;  5I98 A;  4C02 B;  5DIT A;  3I6C A;  3PRB A;  2F21 A;  4DRI A;  2FKE A;  1N1A A;  3IKG A;  2VN1 A;  3UQB A;  3IHZ A;  2M08 A;  1F40 A;  1L1P A;  1B6C A;  3O5R A;  3UI4 A;  4DH0 A;  2KR7 A;  1EQ3 A;  3JXV A;  2LJ4 A;  2VCD A;  3NRK A;  2F4E A;  4IPX A;  4NNR A;  3MDY B;  3LUO A;  1FKT A;  3H9R B;  4DRP A;  1Q6U A;  1EYM A;  3PA7 A;  4JFI A;  4FN2 A;  1Q6I A;  2ZQT A;  1QZ2 A;  1J4H A;  2XP8 A;  4JYS A;  1D7H A;  4U84 A;  2K8I A;  5HW8 A;  2XP7 A;  3O5O A;  1FKR A;  4ODR A;  2MLZ A;  4W9O A;  3NI6 A;  4TW8 A;  3VAW A;  5GPG A;  2PBC A;  2MLX A;  3EY6 A;  1KT1 A;  5HW6 A;  4DRQ A;  2RUR A;  4TNS A;  5HKG A;  4TX0 A;  5HWB A;  2DG3 A;  1R9H A;  4LAV A;  1D6O A;  4N19 A;  1U79 A;  5HT1 A;  5B8I C;  4ITZ A;  2MPH A;  2KI3 A;  2PPN A;  2RUC A;  3NTP A;  3UI5 A;  2DG4 A;  1YW5 A; 
#chains in the Genus database with same CATH topology
 3ART A;  3B9E A;  3KAF A;  4MAV A;  5DIU A;  1Y0O A;  4G50 A;  4DWS D;  1W1Y A;  2RSE A;  3OOB A;  1ZBW A;  3UI6 A;  1WNO A;  4MNJ A;  3KAB A;  2F23 A;  3KZ7 A;  5BXJ A;  4S3J A;  5HWC A;  4JFM A;  4JFK A;  3WD1 A;  1FAP A;  1FKJ A;  1LG1 A;  1KT0 A;  1W9V A;  3G6M A;  2PV2 A;  3ARY A;  4DRM A;  3BMB A;  2N87 A;  3BXW A;  1NWS A;  1NWR A;  1ITX A;  5D75 A;  4LAW A;  3WQV A;  1NH6 A;  4URI A;  3JYJ A;  4DRJ A;  1HKK A;  2PPP A;  1ZB5 A;  2WLZ A;  1FJD A;  2OFN A;  2XP6 A;  3KAD A;  1FKL A;  3O5J A;  3CHF A;  2ZR5 A;  4MNM A;  1K9T A;  1J6Y A;  3TC5 A;  2Y78 A;  4IQ2 A;  2LGO A;  1YAT A;  3ODK A;  3KAH A;  4P8X A;  4WIW A;  2ZQV A;  3WQW A;  4DWS A;  2A3E A;  1FKI A;  1OWQ A;  5DIV A;  1HXV A;  3WIJ A;  4U86 A;  4MGV A;  5DIT A;  3PRB A;  2O92 A;  3OA5 A;  3IKG A;  1CTN A;  2B5U B;  3CH9 A;  3UI4 A;  4L72 B;  1EQ3 A;  4DT4 A;  3NRK A;  2F4E A;  1NWT A;  3LUO A;  1E9L A;  4KR0 B;  1Q6U A;  1HKM A;  4JFI A;  4FN2 A;  1Q6I A;  4QZV B;  1QZ2 A;  1J4H A;  2XP8 A;  2XP7 A;  4W9O A;  3NI6 A;  3VAW A;  2PBC A;  3EY6 A;  2DSV A;  4TX0 A;  4LAV A;  1D6O A;  4N19 A;  1U79 A;  4Z2K A;  4ITZ A;  3UI5 A;  2DG4 A;  1W1V A;  3CGM A;  4W5U A;  3WH0 A;  1WB0 A;  3FAP A;  4DWS C;  2ZR4 A;  1QPL A;  3TCZ A;  3B7X A;  3RFW A;  1M5Y A;  2MF9 A;  2RUQ A;  4WKH A;  2Q5A A;  3PRD A;  3IKD A;  4DRK A;  2P4V A;  2WK2 A;  3O5L A;  3G6L A;  4IT4 A;  5HBF A;  4TYO A;  1ZBC A;  1Q1C A;  4ODL A;  1GOI A;  3AS3 A;  1J4I A;  3ARZ A;  1E6N A;  3KCE A;  4DWS B;  1FKH A;  3RGC A;  3UQA A;  3WL0 A;  3RM4 A;  3RME A;  4LGX A;  3KAI A;  3WD2 A;  1FKD A;  4P8U A;  3CGN A;  4DRO A;  5HUA A;  2WLY A;  1E44 A;  1ZU8 A;  1OGG A;  2WM0 A;  1FKK A;  2DSW A;  4PTM A;  1D7I A;  1XRV A;  4BF8 A;  1LJY A;  3ARX A;  2OLH A;  1F8A B;  2MNT A;  3O5P A;  4JFJ A;  4Q7N A;  2XP9 A;  3O5G A;  3ARR A;  4QT3 A;  1FKB A;  2PN0 A;  3O5I A;  1J4R A;  1H0I A;  3CHC A;  4S3K A;  4GIV A;  4QIB A;  4KQZ A;  2XPB A;  3O5Q A;  1C9H A;  1P5Q A;  4NZC A;  1SR0 A;  4Z2H A;  3CHD A;  1JNE A;  3RM9 A;  4ODP A;  1H0G A;  1LL4 A;  2XP4 A;  2ITK A;  4ODN A;  5GQB A;  1Q6H A;  4O2T A;  1ZBV A;  1BKF A;  4IQC A;  3AS0 A;  1UR9 A;  4WKF A;  3IHZ A;  3PR9 A;  1L1P A;  1E6Z A;  3FY1 A;  4DH0 A;  1VF8 A;  4NNR A;  3CZ8 A;  1EYM A;  3PA7 A;  1LG2 A;  1E6R A;  5DO2 A;  1E15 A;  1GRJ A;  1KT1 A;  2A3A A;  2RUR A;  4TNS A;  3ARU A;  4NSB A;  2MPH A;  3ARW A;  2KI3 A;  2PPN A;  3NTP A;  2G8Z A;  3ALG A;  4G2P A;  1LQ0 A;  1HKJ A;  4Z2G A;  1RD6 A;  3ARP A;  4FAP A;  3KAG A;  2O9O A;  1A7X A;  3JYM A;  3IK8 A;  4DRN A;  3WD3 A;  1NMW A;  2FAP A;  3FXY A;  2DSU A;  4ODO A;  1HJW A;  2RUD A;  5GPR A;  3ALF A;  3O5E A;  4IT6 A;  2PPO A;  2DSZ A;  5DF0 A;  2G41 A;  1JND A;  2XP3 A;  2IF4 A;  1HJX A;  1HKI A;  4TW6 A;  3B8S A;  3O5F A;  3UF8 A;  3QOK A;  2UZ5 A;  1FFQ A;  4DRH A;  3PRA A;  1FFR A;  1ZCN A;  4L3N A;  4MSP A;  3WD0 A;  3UQI A;  1W26 A;  1X6N A;  2XPA A;  2XP5 A;  4J4O A;  4Z2I A;  1FKG A;  2IUZ A;  2ESC A;  4HBO A;  4ODM A;  1D7J A;  1D2K A;  4MNK A;  1EHN A;  2L2S A;  3TDB A;  3AS2 A;  4W9P A;  1NMV A;  2JZV A;  4J4N A;  1NSG A;  3O5D A;  1OGB A;  1FKS A;  2DT0 A;  4P8V A;  4QT2 A;  2ZR6 A;  5HW7 A;  3O5M A;  4UDM A;  1JNT A;  4MNL A;  3WKZ A;  1JVW A;  2A3B A;  4C02 B;  2F21 A;  1N1A A;  3UQB A;  4MTV A;  4HAR A;  2B31 A;  2M08 A;  3EIP A;  1F40 A;  1B6C A;  3RM8 A;  4Z2J A;  2KR7 A;  3JXV A;  2VCD A;  3MDY B;  1FKT A;  3H9R B;  4DRP A;  2DT1 A;  4WK9 A;  2DT2 A;  2EUL A;  4JYS A;  4U84 A;  2K8I A;  3O5O A;  4ML4 A;  4ODR A;  2MLZ A;  1JCH B;  1NWU A;  5GPG A;  2MLX A;  1W1P A;  4DRQ A;  5HWB A;  4Q22 A;  3AQU A;  5HT1 A;  5B8I C;  2RUC A;  2AOS A;  4WKA A;  1E6P A;  1YW5 A;  3AS1 A;  1EIB A;  2AWG A;  1EDQ A;  4ODQ A;  3ARS A;  5HTG A;  5DEZ A;  1TFV A;  2F2D A;  1ROT A;  4AY1 A;  3ARO A;  1FKF A;  1GPF A;  2DPE A;  2LKN A;  4R0X A;  2KO7 A;  2QF8 A;  2ZQS A;  2PI6 A;  3ARV A;  1PBK A;  4ZPT R;  1IX5 A;  4DZ3 A;  2A3C A;  4WJX A;  4DIP A;  1HJV A;  1FD9 A;  2M2A A;  1W9P A;  2KGJ A;  2PV1 A;  1W1T A;  4P8W A;  1JNS A;  1UR8 A;  1WAW A;  2KE0 A;  1ZL1 A;  3GTY X;  2RQS A;  2LPV A;  3W4R A;  4JFL A;  4TW7 A;  3WL1 A;  5J6E A;  3GPK A;  4ZS6 A;  4GGQ A;  1BL4 A;  1TCO C;  1PIN A;  1ROU A;  3GU0 A;  4R5E A;  1T11 A;  2DG9 A;  4W9Q A;  4XAK A;  1ZK6 A;  2KFW A;  2MLY A;  2D9F A;  1KFW A;  4LAX A;  4Z2L A;  4HBE A;  1QPF A;  4ODK A;  3O5K A;  4DZ2 A;  2ZQU A;  4MPK A;  2M1I A;  4LAY A;  2PV3 A;  3KAC A;  1LL7 A;  4ZPV R;  4U85 A;  1XHG A;  3CHE A;  1O6I A;  5I98 A;  1X6L A;  3I6C A;  4DRI A;  2ETN A;  2FKE A;  2DT3 A;  2VN1 A;  2FDM A;  2YBU A;  3O5R A;  3ARQ A;  1ZBK A;  2LJ4 A;  4IPX A;  1GUV A;  3B9D A;  2ZQT A;  1D7H A;  5HW8 A;  1FKR A;  4TW8 A;  1W9U A;  5HW6 A;  1SYT A;  5JH8 A;  5HKG A;  2YBT A;  2DG3 A;  1R9H A;  1LL6 A;  3WD4 A;  3B9A A;  4ZPW R; 
#chains in the Genus database with same CATH homology
 3ART A;  3B9E A;  3KAF A;  4MAV A;  5DIU A;  1Y0O A;  4G50 A;  4DWS D;  1W1Y A;  2RSE A;  3OOB A;  1ZBW A;  3UI6 A;  1WNO A;  4MNJ A;  3KAB A;  3KZ7 A;  5BXJ A;  4S3J A;  5HWC A;  4JFM A;  4JFK A;  3WD1 A;  1FAP A;  1FKJ A;  1LG1 A;  1KT0 A;  1W9V A;  3G6M A;  2PV2 A;  3ARY A;  4DRM A;  2N87 A;  3BXW A;  1NWS A;  1NWR A;  1ITX A;  5D75 A;  4LAW A;  3WQV A;  1NH6 A;  4URI A;  3JYJ A;  4DRJ A;  1HKK A;  2PPP A;  1ZB5 A;  2WLZ A;  1FJD A;  2OFN A;  2XP6 A;  3KAD A;  1FKL A;  3O5J A;  3CHF A;  2ZR5 A;  4MNM A;  1K9T A;  1J6Y A;  3TC5 A;  2Y78 A;  4IQ2 A;  2LGO A;  1YAT A;  3ODK A;  3KAH A;  4P8X A;  4WIW A;  2ZQV A;  3WQW A;  4DWS A;  2A3E A;  1FKI A;  1OWQ A;  5DIV A;  1HXV A;  3WIJ A;  4U86 A;  4MGV A;  5DIT A;  3PRB A;  2O92 A;  3OA5 A;  3IKG A;  1CTN A;  3CH9 A;  3UI4 A;  4L72 B;  1EQ3 A;  4DT4 A;  3NRK A;  2F4E A;  1NWT A;  3LUO A;  1E9L A;  4KR0 B;  1Q6U A;  1HKM A;  4JFI A;  4FN2 A;  1Q6I A;  4QZV B;  1QZ2 A;  1J4H A;  2XP8 A;  2XP7 A;  4W9O A;  3NI6 A;  3VAW A;  2PBC A;  3EY6 A;  2DSV A;  4TX0 A;  4LAV A;  1D6O A;  4N19 A;  1U79 A;  4Z2K A;  4ITZ A;  3UI5 A;  2DG4 A;  1W1V A;  3CGM A;  4W5U A;  3WH0 A;  1WB0 A;  3FAP A;  4DWS C;  2ZR4 A;  1QPL A;  3TCZ A;  3B7X A;  3RFW A;  1M5Y A;  2MF9 A;  2RUQ A;  4WKH A;  2Q5A A;  3PRD A;  3IKD A;  4DRK A;  2WK2 A;  3O5L A;  3G6L A;  4IT4 A;  5HBF A;  4TYO A;  1ZBC A;  1Q1C A;  4ODL A;  1GOI A;  3AS3 A;  1J4I A;  3ARZ A;  1E6N A;  3KCE A;  4DWS B;  1FKH A;  3RGC A;  3UQA A;  3WL0 A;  3RM4 A;  3RME A;  4LGX A;  3KAI A;  3WD2 A;  1FKD A;  4P8U A;  3CGN A;  4DRO A;  5HUA A;  2WLY A;  1ZU8 A;  1OGG A;  2WM0 A;  1FKK A;  2DSW A;  4PTM A;  1D7I A;  1XRV A;  4BF8 A;  1LJY A;  3ARX A;  2OLH A;  1F8A B;  2MNT A;  3O5P A;  4JFJ A;  4Q7N A;  2XP9 A;  3O5G A;  3ARR A;  4QT3 A;  1FKB A;  3O5I A;  1J4R A;  1H0I A;  3CHC A;  4S3K A;  4GIV A;  4QIB A;  4KQZ A;  2XPB A;  3O5Q A;  1C9H A;  1P5Q A;  4NZC A;  1SR0 A;  4Z2H A;  3CHD A;  1JNE A;  3RM9 A;  4ODP A;  1H0G A;  1LL4 A;  2XP4 A;  2ITK A;  4ODN A;  5GQB A;  1Q6H A;  4O2T A;  1ZBV A;  1BKF A;  4IQC A;  3AS0 A;  1UR9 A;  4WKF A;  3IHZ A;  3PR9 A;  1L1P A;  1E6Z A;  3FY1 A;  4DH0 A;  1VF8 A;  4NNR A;  3CZ8 A;  1EYM A;  3PA7 A;  1LG2 A;  1E6R A;  5DO2 A;  1E15 A;  1KT1 A;  2A3A A;  2RUR A;  4TNS A;  3ARU A;  4NSB A;  2MPH A;  3ARW A;  2KI3 A;  2PPN A;  3NTP A;  2G8Z A;  3ALG A;  4G2P A;  1LQ0 A;  1HKJ A;  4Z2G A;  1RD6 A;  3ARP A;  4FAP A;  3KAG A;  2O9O A;  1A7X A;  3JYM A;  3IK8 A;  4DRN A;  3WD3 A;  1NMW A;  2FAP A;  3FXY A;  2DSU A;  4ODO A;  1HJW A;  2RUD A;  5GPR A;  3ALF A;  3O5E A;  4IT6 A;  2PPO A;  2DSZ A;  5DF0 A;  2G41 A;  1JND A;  2XP3 A;  2IF4 A;  1HJX A;  1HKI A;  4TW6 A;  3B8S A;  3O5F A;  3UF8 A;  3QOK A;  2UZ5 A;  1FFQ A;  4DRH A;  3PRA A;  1FFR A;  1ZCN A;  4L3N A;  4MSP A;  3WD0 A;  3UQI A;  1W26 A;  1X6N A;  2XPA A;  2XP5 A;  4J4O A;  4Z2I A;  1FKG A;  2IUZ A;  2ESC A;  4HBO A;  4ODM A;  1D7J A;  1D2K A;  4MNK A;  1EHN A;  2L2S A;  3TDB A;  3AS2 A;  4W9P A;  1NMV A;  2JZV A;  4J4N A;  1NSG A;  3O5D A;  1OGB A;  1FKS A;  2DT0 A;  4P8V A;  4QT2 A;  2ZR6 A;  5HW7 A;  3O5M A;  1JNT A;  4MNL A;  3WKZ A;  1JVW A;  2A3B A;  4C02 B;  2F21 A;  1N1A A;  3UQB A;  4MTV A;  4HAR A;  2B31 A;  2M08 A;  1F40 A;  1B6C A;  3RM8 A;  4Z2J A;  2KR7 A;  3JXV A;  2VCD A;  3MDY B;  1FKT A;  3H9R B;  4DRP A;  2DT1 A;  4WK9 A;  2DT2 A;  4JYS A;  4U84 A;  2K8I A;  3O5O A;  4ML4 A;  4ODR A;  2MLZ A;  1NWU A;  5GPG A;  2MLX A;  1W1P A;  4DRQ A;  5HWB A;  4Q22 A;  3AQU A;  5HT1 A;  5B8I C;  2RUC A;  2AOS A;  4WKA A;  1E6P A;  1YW5 A;  3AS1 A;  1EIB A;  2AWG A;  1EDQ A;  4ODQ A;  3ARS A;  5HTG A;  5DEZ A;  1TFV A;  2F2D A;  1ROT A;  4AY1 A;  3ARO A;  1FKF A;  1GPF A;  2DPE A;  2LKN A;  4R0X A;  2KO7 A;  2QF8 A;  2ZQS A;  2PI6 A;  3ARV A;  1PBK A;  4ZPT R;  1IX5 A;  4DZ3 A;  2A3C A;  4WJX A;  4DIP A;  1HJV A;  1FD9 A;  2M2A A;  1W9P A;  2KGJ A;  2PV1 A;  1W1T A;  4P8W A;  1JNS A;  1UR8 A;  1WAW A;  2KE0 A;  1ZL1 A;  2RQS A;  2LPV A;  3W4R A;  4JFL A;  4TW7 A;  3WL1 A;  5J6E A;  3GPK A;  4ZS6 A;  4GGQ A;  1BL4 A;  1TCO C;  1PIN A;  1ROU A;  4R5E A;  1T11 A;  2DG9 A;  4W9Q A;  4XAK A;  1ZK6 A;  2KFW A;  2MLY A;  2D9F A;  1KFW A;  4LAX A;  4Z2L A;  4HBE A;  1QPF A;  4ODK A;  3O5K A;  4DZ2 A;  2ZQU A;  4MPK A;  2M1I A;  4LAY A;  2PV3 A;  3KAC A;  1LL7 A;  4ZPV R;  4U85 A;  1XHG A;  3CHE A;  1O6I A;  5I98 A;  1X6L A;  3I6C A;  4DRI A;  2FKE A;  2DT3 A;  2VN1 A;  2FDM A;  2YBU A;  3O5R A;  3ARQ A;  1ZBK A;  2LJ4 A;  4IPX A;  1GUV A;  3B9D A;  2ZQT A;  1D7H A;  5HW8 A;  1FKR A;  4TW8 A;  1W9U A;  5HW6 A;  1SYT A;  5JH8 A;  5HKG A;  2YBT A;  2DG3 A;  1R9H A;  1LL6 A;  3WD4 A;  3B9A A;  4ZPW R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...