1J6YA

Solution structure of pin1at from arabidopsis thaliana
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
120
structure length
120
Chain Sequence
HMASRDQVKASHILIKHQGSRRKASWKDPEGKIILTTTREAAVEQLKSIREDIVSGKANFEEVATRVSDCSSAKRGGDLGSFGRGQMQKPFEEATYALKVGDISDIVDTDSGVHIIKRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords peptidyl-prolyl cis-trans isomerase
publication title Solution Structure of the Single-domain Prolyl Cis/Trans Isomerase PIN1At from Arabidopsis thaliana
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 17
structure length 120
sequence length 120
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j6yA00
1Q1CA 3JXVA 3KABA 2LJ4A 2MLZA 4QT2A 4J4OA 4O2TA 5HWCA 1BL4A 3TCZA 4W9OA 3JYMA 4BF8A 4ODLA 2PPNA 4LAXA 4TW8A 3MDYB 1J4RA 4U85A 2PPPA 4JYSA 4FN2A 3ODKA 3UF8A 4DT4A 2ZQUA 1PBKA 2KFWA 4JFKA 4TYOA 2MPHA 2PPOA 1J6YA 2K8IA 4ODNA 1JNSA 1QZ2A 1YW5A 1QPFA 3EY6A 2M2AA 1FAPA 4DRJA 3NTPA 5D75A 4DRMA 3LUOA 2MLYA 1N1AA 2D9FA 5GPGA 2FKEA 3UQAA 2Q5AA 1ROUA 2PBCA 2RUQA 2DG3A 1T11A 1ROTA 2ZR5A 1B6CA 2ZR4A 2IF4A 4LAWA 4MGVA 3KAFA 4ODRA 1HXVA 1NSGA 1TCOC 1J4IA 1Q6UA 4DH0A 3UQIA 3IKDA 4W9PA 4DRKA 1D6OA 4NNRA 1FKJA 4N19A 2F21A 3O5LA 2ZQTA 3KACA 3KAGA 3O5PA 4GIVA 2VN1A 4U86A 2XP3A 4J4NA 2XPBA 5I98A 5HKGA 3O5DA 1F8AB 4TW6A 4DRIA 4G2PA 4TNSA 5DITA 3OOBA 4LAYA 3B7XA 1NMWA 2MLXA 3UI5A 2F4EA 2PV3A 3KAIA 4TW7A 4TX0A 2RUCA 2KR7A 3JYJA 3UI4A 4DRPA 4GGQA 1FKKA 2XP8A 1D7JA 2LGOA 4ODPA 1FKIA 1F40A 2RUDA 1KT1A 4U84A 1BKFA 4DZ3A 5HWBA 1R9HA 3NI6A 3O5MA 3KAHA 1Q6HA 4R0XA 1QPLA 4DRHA 2ZQSA 4DRNA 3IHZA 1P5QA 3O5EA 1KT0A 3I6CA 4ODOA 3RGCA 2RSEA 1D7IA 1FKDA 4LAVA 4QIBA 2VCDA 2JZVA 3TDBA 3KADA 2N87A 4IQCA 3RFWA 3KCEA 2DG9A 1YATA 1M5YA 2PV2A 3O5KA 5B8IC 2MNTA 2XP4A 1U79A 3O5OA 2ITKA 3FAPA 1J4HA 2OFNA 4IQ2A 1FKFA 1ZK6A 5J6EA 5HT1A 3PA7A 3UI6A 4JFIA 1Y0OA 4DZ2A 1JVWA 4IPXA 3H9RB 4ODQA 4ODMA 1FKRA 4JFLA 3CGMA 5BXJA 5DIUA 1ZCNA 1D7HA 3UQBA 1FKBA 3VAWA 2UZ5A 3PRDA 2KGJA 2XP6A 3NRKA 1A7XA 3O5GA 3TC5A 2LPVA 2ZQVA 2M08A 5HW8A 4W9QA 1FJDA 2XP7A 4C02B 4DROA 2RURA 4G50A 2FAPA 3O5JA 3GPKA 2KO7A 4QT3A 1EQ3A 4ODKA 4DRQA 1EYMA 2LKNA 4JFMA 5HTGA 1FKTA 1Q6IA 2XPAA 5HW7A 2PV1A 3IK8A 4ITZA 1FKLA 2RQSA 3PRBA 5HW6A 2KI3A 2KE0A 3O5QA 5HUAA 3WH0A 2DG4A 1FKHA 3CGNA 1JNTA 1L1PA 2Y78A 1FD9A 1NMVA 1PINA 4FAPA 2ZR6A 1FKSA 3IKGA 3O5IA 2F2DA 3KZ7A 2XP5A 2M1IA 3O5RA 4MSPA 4DIPA 1FKGA 2AWGA 2L2SA 5DIVA 1C9HA 1W26A 2XP9A 4JFJA 2MF9A 3O5FA
chains in the Genus database with same CATH superfamily
1Q1CA 4O2TA 3TCZA 1E6RA 4BF8A 4LAXA 4ZPTR 2PPPA 4DT4A 1SYTA 1PBKA 2MPHA 4UDMA 2K8IA 2PN0A 2QF8A 4XAKA 3ARVA 4HARA 3LUOA 2D9FA 2DG3A 1GUVA 3WD0A 2DT2A 1HXVA 1NSGA 1J4IA 3AS1A 3UQIA 3IKDA 4HBOA 1X6LA 4W9PA 3KACA 3KAGA 4Z2IA 4DWSD 1ZU8A 3O5DA 1F8AB 1LG2A 1UR9A 4WKAA 1NMWA 2PV3A 3UI4A 4R5EA 1FKKA 1BKFA 4DZ3A 1CTNA 3O5MA 3WKZA 1Q6HA 1W9UA 4R0XA 1P5QA 3O5EA 4L72B 3I6CA 1O6IA 4QIBA 1FKDA 3CHFA 3AS3A 5GQBA 3RFWA 1GOIA 1YATA 2MNTA 2XP4A 3AROA 4MNKA 3WD3A 3FAPA 1J4HA 4MPKA 4ML4A 1GPFA 4DWSA 3OA5A 5HT1A 3PA7A 1Y0OA 5BXJA 4MNLA 4DWSB 3UQBA 1FKBA 2KGJA 1A7XA 3O5GA 1NWUA 2LPVA 1FJDA 1ZL1A 4WIWA 4DROA 1W9PA 3B8SA 4DRQA 3GU0A 2LKNA 1E6PA 1FKTA 4ITZA 2RQSA 3PRBA 4MAVA 4Z2GA 3CHEA 3WH0A 3CGNA 1L1PA 2ZR6A 1FKSA 3G6MA 4IT6A 2G8ZA 4MSPA 2L2SA 5DIVA 3WL0A 1C9HA 1W26A 1XRVA 3O5FA 3KABA 4QT2A 5DEZA 3ARXA 4W9OA 4ODLA 4TW8A 3ARQA 5DF0A 3UF8A 1JNSA 4ODNA 3EY6A 1FAPA 2P4VA 3NTPA 4P8UA 4P8VA 5GPGA 4S3KA 1LJYA 1LG1A 1E6NA 1ROTA 1B6CA 2ZR4A 3KAFA 1D2KA 1Q6UA 3WQWA 4N19A 4GIVA 4U86A 3WQVA 2XP3A 3FY1A 1ITXA 4TW6A 3WD1A 2PI6A 2F23A 1FFRA 4TNSA 3OOBA 3ARPA 3PRAA 2O9OA 1W9VA 2KR7A 4URIA 2LGOA 4MTVA 2RUDA 4U84A 3KAHA 4DRHA 1QPLA 2ZQSA 3ARUA 5GPRA 3WL1A 1D7IA 3ARRA 4LAVA 2VCDA 5HBFA 3KADA 2N87A 3KCEA 2DG9A 3O5KA 1M5YA 3O5OA 4IQ2A 4IT4A 4L3NA 1NH6A 1ZK6A 4MNMA 2YBUA 4JFIA 3BMBA 4Z2JA 4ODMA 4ODQA 2G41A 2DSUA 3B9DA 4Q22A 1ZCNA 1OGBA 3VAWA 2A3AA 3RM9A 2ZQVA 2M08A 5HW8A 4G50A 2KO7A 1EQ3A 5HTGA 4JFMA 2ETNA 5HW7A 3IK8A 5HW6A 5HUAA 3O5QA 3CHDA 4MNJA 1FKHA 1H0GA 1FD9A 1PINA 5DO2A 1W1PA 2F2DA 3KZ7A 2XP5A 4KR0B 2DT3A 1SR0A 3O5RA 4DIPA 1FKGA 2XP9A 4TX0A 3JXVA 2LJ4A 2MLZA 1VF8A 3JYMA 2PPNA 4JYSA 1J6YA 2ZQUA 4JFKA 4TYOA 2DSWA 4ZPWR 1YW5A 1QPFA 4KQZA 5D75A 4HBEA 2MLYA 4PTMA 4WJXA 3PR9A 3RM4A 2FKEA 3UQAA 2Q5AA 1ROUA 3B9AA 1W1TA 1LL7A 3CHCA 1ZBWA 1RD6A 1T11A 2WM0A 1W1VA 2IUZA 3ARYA 1ZBCA 2A3CA 1JNEA 3AS0A 1D6OA 2YBTA 4P8XA 5JH8A 1FKJA 2ZQTA 1IX5A 4J4NA 2XPBA 5I98A 1JNDA 5HKGA 4DRIA 4W5UA 4LAYA 1TFVA 3KAIA 4TW7A 2RUCA 1EDQA 3GTYX 4GGQA 1W1YA 1D7JA 4Z2LA 3ARTA 3AS2A 1KT1A 3BXWA 1R9HA 3NI6A 3G6LA 3IHZA 1KT0A 3RMEA 3RGCA 3QOKA 4LGXA 2FDMA 2JZVA 5B8IC 1HKMA 1XHGA 1OWQA 2ITKA 2OFNA 4NSBA 4QZVB 5J6EA 1NWTA 4ZS6A 1OGGA 1NWSA 1ZBVA 4DZ2A 1JVWA 4IPXA 3ARWA 4S3JA 2UZ5A 3PRDA 2XP6A 1HKKA 1JCHB 4W9QA 2XP7A 4C02B 3ALGA 3O5JA 3GPKA 4QT3A 1EYMA 2XPAA 2PV1A 1FKLA 2KE0A 3AQUA 2DG4A 1JNTA 2Y78A 4FAPA 1NMVA 3IKGA 2EULA 2M1IA 2WLZA 3NRKA 4Z2HA 4J4OA 5HWCA 1BL4A 1LL6A 4P8WA 3W4RA 4U85A 3MDYB 1J4RA 4FN2A 3ODKA 3WIJA 2KFWA 2O92A 2PPOA 2OLHA 1QZ2A 2M2AA 4DRJA 2DT1A 1GRJA 4DRMA 1HJVA 1N1AA 1E15A 2PBCA 2RUQA 1HJXA 2ZR5A 4LAWA 2IF4A 4MGVA 4ODRA 1KFWA 1TCOC 4DH0A 1X6NA 4Q7NA 3CZ8A 4WK9A 1WNOA 4DRKA 4NNRA 1EHNA 2F21A 2B5UB 3O5LA 3O5PA 3ALFA 2VN1A 3CH9A 2DPEA 1WB0A 4DWSC 4G2PA 5DITA 1HJWA 3B7XA 2MLXA 3UI5A 2F4EA 4DRPA 3EIPA 3JYJA 2XP8A 2WLYA 4ODPA 1K9TA 1FKIA 1F40A 5HWBA 1E9LA 1ZBKA 4DRNA 2DT0A 4ODOA 3WD4A 1HKIA 2RSEA 3ARZA 4AY1A 2DSZA 3FXYA 3TDBA 4IQCA 1E6ZA 1LL4A 2PV2A 3RM8A 1U79A 2ESCA 1H0IA 1FKFA 1HKJA 4WKFA 2A3BA 2DSVA 3UI6A 1E44A 2WK2A 3H9RB 1FKRA 4Z2KA 4JFLA 3CGMA 5DIUA 3WD2A 1D7HA 4WKHA 3TC5A 2RURA 2A3EA 2FAPA 1ZB5A 4ODKA 1Q6IA 2KI3A 4ZPVR 1LQ0A 1NWRA 1FFQA 1EIBA 3O5IA 4NZCA 2B31A 2AWGA 1WAWA 1UR8A 2AOSA 3ARSA 4JFJA 2MF9A 3B9EA
chains in the Genus database with same CATH topology
1Q1CA 4O2TA 3TCZA 1E6RA 4BF8A 4LAXA 4ZPTR 2PPPA 4DT4A 1SYTA 1PBKA 2MPHA 2K8IA 2QF8A 4XAKA 3ARVA 4HARA 3LUOA 2D9FA 2DG3A 1GUVA 3WD0A 2DT2A 1HXVA 1NSGA 1J4IA 3AS1A 3UQIA 3IKDA 4HBOA 1X6LA 4W9PA 3KACA 3KAGA 4Z2IA 4DWSD 1ZU8A 3O5DA 1F8AB 1LG2A 1UR9A 4WKAA 1NMWA 2PV3A 3UI4A 4R5EA 1FKKA 1BKFA 4DZ3A 1CTNA 3O5MA 3WKZA 1Q6HA 1W9UA 4R0XA 1P5QA 3O5EA 4L72B 3I6CA 1O6IA 4QIBA 1FKDA 3CHFA 3AS3A 5GQBA 3RFWA 1GOIA 1YATA 2MNTA 2XP4A 3AROA 4MNKA 3WD3A 3FAPA 1J4HA 4MPKA 4ML4A 1GPFA 4DWSA 3OA5A 5HT1A 3PA7A 1Y0OA 5BXJA 4MNLA 4DWSB 3UQBA 1FKBA 2KGJA 1A7XA 3O5GA 1NWUA 2LPVA 1FJDA 1ZL1A 4WIWA 4DROA 1W9PA 3B8SA 4DRQA 2LKNA 1E6PA 1FKTA 4ITZA 2RQSA 3PRBA 4MAVA 4Z2GA 3CHEA 3WH0A 3CGNA 1L1PA 2ZR6A 1FKSA 3G6MA 4IT6A 2G8ZA 4MSPA 2L2SA 5DIVA 3WL0A 1C9HA 1W26A 1XRVA 3O5FA 3KABA 4QT2A 5DEZA 3ARXA 4W9OA 4ODLA 4TW8A 3ARQA 5DF0A 3UF8A 1JNSA 4ODNA 3EY6A 1FAPA 3NTPA 4P8UA 4P8VA 5GPGA 4S3KA 1LJYA 1LG1A 1E6NA 1ROTA 1B6CA 2ZR4A 3KAFA 1D2KA 1Q6UA 3WQWA 4N19A 4GIVA 4U86A 3WQVA 2XP3A 3FY1A 1ITXA 4TW6A 3WD1A 2PI6A 1FFRA 4TNSA 3OOBA 3ARPA 3PRAA 2O9OA 1W9VA 2KR7A 4URIA 2LGOA 4MTVA 2RUDA 4U84A 3KAHA 4DRHA 1QPLA 2ZQSA 3ARUA 5GPRA 3WL1A 1D7IA 3ARRA 4LAVA 2VCDA 5HBFA 3KADA 2N87A 3KCEA 2DG9A 3O5KA 1M5YA 3O5OA 4IQ2A 4IT4A 4L3NA 1NH6A 1ZK6A 4MNMA 2YBUA 4JFIA 4Z2JA 4ODMA 4ODQA 2G41A 2DSUA 3B9DA 4Q22A 1ZCNA 1OGBA 3VAWA 2A3AA 3RM9A 2ZQVA 2M08A 5HW8A 4G50A 2KO7A 1EQ3A 5HTGA 4JFMA 5HW7A 3IK8A 5HW6A 5HUAA 3O5QA 3CHDA 4MNJA 1FKHA 1H0GA 1FD9A 1PINA 5DO2A 1W1PA 2F2DA 3KZ7A 2XP5A 4KR0B 2DT3A 1SR0A 3O5RA 4DIPA 1FKGA 2XP9A 4TX0A 3JXVA 2LJ4A 2MLZA 1VF8A 3JYMA 2PPNA 4JYSA 1J6YA 2ZQUA 4JFKA 4TYOA 2DSWA 4ZPWR 1YW5A 1QPFA 4KQZA 5D75A 4HBEA 2MLYA 4PTMA 4WJXA 3PR9A 3RM4A 2FKEA 3UQAA 2Q5AA 1ROUA 3B9AA 1W1TA 1LL7A 3CHCA 1ZBWA 1RD6A 1T11A 2WM0A 1W1VA 2IUZA 3ARYA 1ZBCA 2A3CA 1JNEA 3AS0A 1D6OA 2YBTA 4P8XA 5JH8A 1FKJA 2ZQTA 1IX5A 4J4NA 2XPBA 5I98A 1JNDA 5HKGA 4DRIA 4W5UA 4LAYA 1TFVA 3KAIA 4TW7A 2RUCA 1EDQA 4GGQA 1W1YA 1D7JA 4Z2LA 3ARTA 3AS2A 1KT1A 3BXWA 1R9HA 3NI6A 3G6LA 3IHZA 1KT0A 3RMEA 3RGCA 3QOKA 4LGXA 2FDMA 2JZVA 5B8IC 1HKMA 1XHGA 1OWQA 2ITKA 2OFNA 4NSBA 4QZVB 5J6EA 1NWTA 4ZS6A 1OGGA 1NWSA 1ZBVA 4DZ2A 1JVWA 4IPXA 3ARWA 4S3JA 2UZ5A 3PRDA 2XP6A 1HKKA 4W9QA 2XP7A 4C02B 3ALGA 3O5JA 3GPKA 4QT3A 1EYMA 2XPAA 2PV1A 1FKLA 2KE0A 3AQUA 2DG4A 1JNTA 2Y78A 4FAPA 1NMVA 3IKGA 2M1IA 2WLZA 3NRKA 4Z2HA 4J4OA 5HWCA 1BL4A 1LL6A 4P8WA 3W4RA 4U85A 3MDYB 1J4RA 4FN2A 3ODKA 3WIJA 2KFWA 2O92A 2PPOA 2OLHA 1QZ2A 2M2AA 4DRJA 2DT1A 4DRMA 1HJVA 1N1AA 1E15A 2PBCA 2RUQA 1HJXA 2ZR5A 4LAWA 2IF4A 4MGVA 4ODRA 1KFWA 1TCOC 4DH0A 1X6NA 4Q7NA 3CZ8A 4WK9A 1WNOA 4DRKA 4NNRA 1EHNA 2F21A 3O5LA 3O5PA 3ALFA 2VN1A 3CH9A 2DPEA 1WB0A 4DWSC 4G2PA 5DITA 1HJWA 3B7XA 2MLXA 3UI5A 2F4EA 4DRPA 3JYJA 2XP8A 2WLYA 4ODPA 1K9TA 1FKIA 1F40A 5HWBA 1E9LA 1ZBKA 4DRNA 2DT0A 4ODOA 3WD4A 1HKIA 2RSEA 3ARZA 4AY1A 2DSZA 3FXYA 3TDBA 4IQCA 1E6ZA 1LL4A 2PV2A 3RM8A 1U79A 2ESCA 1H0IA 1FKFA 1HKJA 4WKFA 2A3BA 2DSVA 3UI6A 2WK2A 3H9RB 1FKRA 4Z2KA 4JFLA 3CGMA 5DIUA 3WD2A 1D7HA 4WKHA 3TC5A 2RURA 2A3EA 2FAPA 1ZB5A 4ODKA 1Q6IA 2KI3A 4ZPVR 1LQ0A 1NWRA 1FFQA 1EIBA 3O5IA 4NZCA 2B31A 2AWGA 1WAWA 1UR8A 2AOSA 3ARSA 4JFJA 2MF9A 3B9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q1C A;  3JXV A;  3KAB A;  2LJ4 A;  2MLZ A;  4QT2 A;  4J4O A;  4O2T A;  5HWC A;  1BL4 A;  3TCZ A;  4W9O A;  3JYM A;  4BF8 A;  4ODL A;  2PPN A;  4LAX A;  4TW8 A;  3MDY B;  1J4R A;  4U85 A;  2PPP A;  4JYS A;  4FN2 A;  3ODK A;  3UF8 A;  4DT4 A;  2ZQU A;  1PBK A;  2KFW A;  4JFK A;  4TYO A;  2MPH A;  2PPO A;  1J6Y A;  2K8I A;  4ODN A;  1JNS A;  1QZ2 A;  1YW5 A;  1QPF A;  3EY6 A;  2M2A A;  1FAP A;  4DRJ A;  3NTP A;  5D75 A;  4DRM A;  3LUO A;  2MLY A;  1N1A A;  2D9F A;  5GPG A;  2FKE A;  3UQA A;  2Q5A A;  1ROU A;  2PBC A;  2RUQ A;  2DG3 A;  1T11 A;  1ROT A;  2ZR5 A;  1B6C A;  2ZR4 A;  2IF4 A;  4LAW A;  4MGV A;  3KAF A;  4ODR A;  1HXV A;  1NSG A;  1TCO C;  1J4I A;  1Q6U A;  4DH0 A;  3UQI A;  3IKD A;  4W9P A;  4DRK A;  1D6O A;  4NNR A;  1FKJ A;  4N19 A;  2F21 A;  3O5L A;  2ZQT A;  3KAC A;  3KAG A;  3O5P A;  4GIV A;  2VN1 A;  4U86 A;  2XP3 A;  4J4N A;  2XPB A;  5I98 A;  5HKG A;  3O5D A;  1F8A B;  4TW6 A;  4DRI A;  4G2P A;  4TNS A;  5DIT A;  3OOB A;  4LAY A;  3B7X A;  1NMW A;  2MLX A;  3UI5 A;  2F4E A;  2PV3 A;  3KAI A;  4TW7 A;  4TX0 A;  2RUC A;  2KR7 A;  3JYJ A;  3UI4 A;  4DRP A;  4GGQ A;  1FKK A;  2XP8 A;  1D7J A;  2LGO A;  4ODP A;  1FKI A;  1F40 A;  2RUD A;  1KT1 A;  4U84 A;  1BKF A;  4DZ3 A;  5HWB A;  1R9H A;  3NI6 A;  3O5M A;  3KAH A;  1Q6H A;  4R0X A;  1QPL A;  4DRH A;  2ZQS A;  4DRN A;  3IHZ A;  1P5Q A;  3O5E A;  1KT0 A;  3I6C A;  4ODO A;  3RGC A;  2RSE A;  1D7I A;  1FKD A;  4LAV A;  4QIB A;  2VCD A;  2JZV A;  3TDB A;  3KAD A;  2N87 A;  4IQC A;  3RFW A;  3KCE A;  2DG9 A;  1YAT A;  1M5Y A;  2PV2 A;  3O5K A;  5B8I C;  2MNT A;  2XP4 A;  1U79 A;  3O5O A;  2ITK A;  3FAP A;  1J4H A;  2OFN A;  4IQ2 A;  1FKF A;  1ZK6 A;  5J6E A;  5HT1 A;  3PA7 A;  3UI6 A;  4JFI A;  1Y0O A;  4DZ2 A;  1JVW A;  4IPX A;  3H9R B;  4ODQ A;  4ODM A;  1FKR A;  4JFL A;  3CGM A;  5BXJ A;  5DIU A;  1ZCN A;  1D7H A;  3UQB A;  1FKB A;  3VAW A;  2UZ5 A;  3PRD A;  2KGJ A;  2XP6 A;  3NRK A;  1A7X A;  3O5G A;  3TC5 A;  2LPV A;  2ZQV A;  2M08 A;  5HW8 A;  4W9Q A;  1FJD A;  2XP7 A;  4C02 B;  4DRO A;  2RUR A;  4G50 A;  2FAP A;  3O5J A;  3GPK A;  2KO7 A;  4QT3 A;  1EQ3 A;  4ODK A;  4DRQ A;  1EYM A;  2LKN A;  4JFM A;  5HTG A;  1FKT A;  1Q6I A;  2XPA A;  5HW7 A;  2PV1 A;  3IK8 A;  4ITZ A;  1FKL A;  2RQS A;  3PRB A;  5HW6 A;  2KI3 A;  2KE0 A;  3O5Q A;  5HUA A;  3WH0 A;  2DG4 A;  1FKH A;  3CGN A;  1JNT A;  1L1P A;  2Y78 A;  1FD9 A;  1NMV A;  1PIN A;  4FAP A;  2ZR6 A;  1FKS A;  3IKG A;  3O5I A;  2F2D A;  3KZ7 A;  2XP5 A;  2M1I A;  3O5R A;  4MSP A;  4DIP A;  1FKG A;  2AWG A;  2L2S A;  5DIV A;  1C9H A;  1W26 A;  2XP9 A;  4JFJ A;  2MF9 A;  3O5F A; 
#chains in the Genus database with same CATH topology
 1Q1C A;  4O2T A;  3TCZ A;  1E6R A;  4BF8 A;  4LAX A;  4ZPT R;  2PPP A;  4DT4 A;  1SYT A;  1PBK A;  2MPH A;  4UDM A;  2K8I A;  2PN0 A;  2QF8 A;  4XAK A;  3ARV A;  4HAR A;  3LUO A;  2D9F A;  2DG3 A;  1GUV A;  3WD0 A;  2DT2 A;  1HXV A;  1NSG A;  1J4I A;  3AS1 A;  3UQI A;  3IKD A;  4HBO A;  1X6L A;  4W9P A;  3KAC A;  3KAG A;  4Z2I A;  4DWS D;  1ZU8 A;  3O5D A;  1F8A B;  1LG2 A;  1UR9 A;  4WKA A;  1NMW A;  2PV3 A;  3UI4 A;  4R5E A;  1FKK A;  1BKF A;  4DZ3 A;  1CTN A;  3O5M A;  3WKZ A;  1Q6H A;  1W9U A;  4R0X A;  1P5Q A;  3O5E A;  4L72 B;  3I6C A;  1O6I A;  4QIB A;  1FKD A;  3CHF A;  3AS3 A;  5GQB A;  3RFW A;  1GOI A;  1YAT A;  2MNT A;  2XP4 A;  3ARO A;  4MNK A;  3WD3 A;  3FAP A;  1J4H A;  4MPK A;  4ML4 A;  1GPF A;  4DWS A;  3OA5 A;  5HT1 A;  3PA7 A;  1Y0O A;  5BXJ A;  4MNL A;  4DWS B;  3UQB A;  1FKB A;  2KGJ A;  1A7X A;  3O5G A;  1NWU A;  2LPV A;  1FJD A;  1ZL1 A;  4WIW A;  4DRO A;  1W9P A;  3B8S A;  4DRQ A;  3GU0 A;  2LKN A;  1E6P A;  1FKT A;  4ITZ A;  2RQS A;  3PRB A;  4MAV A;  4Z2G A;  3CHE A;  3WH0 A;  3CGN A;  1L1P A;  2ZR6 A;  1FKS A;  3G6M A;  4IT6 A;  2G8Z A;  4MSP A;  2L2S A;  5DIV A;  3WL0 A;  1C9H A;  1W26 A;  1XRV A;  3O5F A;  3KAB A;  4QT2 A;  5DEZ A;  3ARX A;  4W9O A;  4ODL A;  4TW8 A;  3ARQ A;  5DF0 A;  3UF8 A;  1JNS A;  4ODN A;  3EY6 A;  1FAP A;  2P4V A;  3NTP A;  4P8U A;  4P8V A;  5GPG A;  4S3K A;  1LJY A;  1LG1 A;  1E6N A;  1ROT A;  1B6C A;  2ZR4 A;  3KAF A;  1D2K A;  1Q6U A;  3WQW A;  4N19 A;  4GIV A;  4U86 A;  3WQV A;  2XP3 A;  3FY1 A;  1ITX A;  4TW6 A;  3WD1 A;  2PI6 A;  2F23 A;  1FFR A;  4TNS A;  3OOB A;  3ARP A;  3PRA A;  2O9O A;  1W9V A;  2KR7 A;  4URI A;  2LGO A;  4MTV A;  2RUD A;  4U84 A;  3KAH A;  4DRH A;  1QPL A;  2ZQS A;  3ARU A;  5GPR A;  3WL1 A;  1D7I A;  3ARR A;  4LAV A;  2VCD A;  5HBF A;  3KAD A;  2N87 A;  3KCE A;  2DG9 A;  3O5K A;  1M5Y A;  3O5O A;  4IQ2 A;  4IT4 A;  4L3N A;  1NH6 A;  1ZK6 A;  4MNM A;  2YBU A;  4JFI A;  3BMB A;  4Z2J A;  4ODM A;  4ODQ A;  2G41 A;  2DSU A;  3B9D A;  4Q22 A;  1ZCN A;  1OGB A;  3VAW A;  2A3A A;  3RM9 A;  2ZQV A;  2M08 A;  5HW8 A;  4G50 A;  2KO7 A;  1EQ3 A;  5HTG A;  4JFM A;  2ETN A;  5HW7 A;  3IK8 A;  5HW6 A;  5HUA A;  3O5Q A;  3CHD A;  4MNJ A;  1FKH A;  1H0G A;  1FD9 A;  1PIN A;  5DO2 A;  1W1P A;  2F2D A;  3KZ7 A;  2XP5 A;  4KR0 B;  2DT3 A;  1SR0 A;  3O5R A;  4DIP A;  1FKG A;  2XP9 A;  4TX0 A;  3JXV A;  2LJ4 A;  2MLZ A;  1VF8 A;  3JYM A;  2PPN A;  4JYS A;  1J6Y A;  2ZQU A;  4JFK A;  4TYO A;  2DSW A;  4ZPW R;  1YW5 A;  1QPF A;  4KQZ A;  5D75 A;  4HBE A;  2MLY A;  4PTM A;  4WJX A;  3PR9 A;  3RM4 A;  2FKE A;  3UQA A;  2Q5A A;  1ROU A;  3B9A A;  1W1T A;  1LL7 A;  3CHC A;  1ZBW A;  1RD6 A;  1T11 A;  2WM0 A;  1W1V A;  2IUZ A;  3ARY A;  1ZBC A;  2A3C A;  1JNE A;  3AS0 A;  1D6O A;  2YBT A;  4P8X A;  5JH8 A;  1FKJ A;  2ZQT A;  1IX5 A;  4J4N A;  2XPB A;  5I98 A;  1JND A;  5HKG A;  4DRI A;  4W5U A;  4LAY A;  1TFV A;  3KAI A;  4TW7 A;  2RUC A;  1EDQ A;  3GTY X;  4GGQ A;  1W1Y A;  1D7J A;  4Z2L A;  3ART A;  3AS2 A;  1KT1 A;  3BXW A;  1R9H A;  3NI6 A;  3G6L A;  3IHZ A;  1KT0 A;  3RME A;  3RGC A;  3QOK A;  4LGX A;  2FDM A;  2JZV A;  5B8I C;  1HKM A;  1XHG A;  1OWQ A;  2ITK A;  2OFN A;  4NSB A;  4QZV B;  5J6E A;  1NWT A;  4ZS6 A;  1OGG A;  1NWS A;  1ZBV A;  4DZ2 A;  1JVW A;  4IPX A;  3ARW A;  4S3J A;  2UZ5 A;  3PRD A;  2XP6 A;  1HKK A;  1JCH B;  4W9Q A;  2XP7 A;  4C02 B;  3ALG A;  3O5J A;  3GPK A;  4QT3 A;  1EYM A;  2XPA A;  2PV1 A;  1FKL A;  2KE0 A;  3AQU A;  2DG4 A;  1JNT A;  2Y78 A;  4FAP A;  1NMV A;  3IKG A;  2EUL A;  2M1I A;  2WLZ A;  3NRK A;  4Z2H A;  4J4O A;  5HWC A;  1BL4 A;  1LL6 A;  4P8W A;  3W4R A;  4U85 A;  3MDY B;  1J4R A;  4FN2 A;  3ODK A;  3WIJ A;  2KFW A;  2O92 A;  2PPO A;  2OLH A;  1QZ2 A;  2M2A A;  4DRJ A;  2DT1 A;  1GRJ A;  4DRM A;  1HJV A;  1N1A A;  1E15 A;  2PBC A;  2RUQ A;  1HJX A;  2ZR5 A;  4LAW A;  2IF4 A;  4MGV A;  4ODR A;  1KFW A;  1TCO C;  4DH0 A;  1X6N A;  4Q7N A;  3CZ8 A;  4WK9 A;  1WNO A;  4DRK A;  4NNR A;  1EHN A;  2F21 A;  2B5U B;  3O5L A;  3O5P A;  3ALF A;  2VN1 A;  3CH9 A;  2DPE A;  1WB0 A;  4DWS C;  4G2P A;  5DIT A;  1HJW A;  3B7X A;  2MLX A;  3UI5 A;  2F4E A;  4DRP A;  3EIP A;  3JYJ A;  2XP8 A;  2WLY A;  4ODP A;  1K9T A;  1FKI A;  1F40 A;  5HWB A;  1E9L A;  1ZBK A;  4DRN A;  2DT0 A;  4ODO A;  3WD4 A;  1HKI A;  2RSE A;  3ARZ A;  4AY1 A;  2DSZ A;  3FXY A;  3TDB A;  4IQC A;  1E6Z A;  1LL4 A;  2PV2 A;  3RM8 A;  1U79 A;  2ESC A;  1H0I A;  1FKF A;  1HKJ A;  4WKF A;  2A3B A;  2DSV A;  3UI6 A;  1E44 A;  2WK2 A;  3H9R B;  1FKR A;  4Z2K A;  4JFL A;  3CGM A;  5DIU A;  3WD2 A;  1D7H A;  4WKH A;  3TC5 A;  2RUR A;  2A3E A;  2FAP A;  1ZB5 A;  4ODK A;  1Q6I A;  2KI3 A;  4ZPV R;  1LQ0 A;  1NWR A;  1FFQ A;  1EIB A;  3O5I A;  4NZC A;  2B31 A;  2AWG A;  1WAW A;  1UR8 A;  2AOS A;  3ARS A;  4JFJ A;  2MF9 A;  3B9E A; 
#chains in the Genus database with same CATH homology
 1Q1C A;  4O2T A;  3TCZ A;  1E6R A;  4BF8 A;  4LAX A;  4ZPT R;  2PPP A;  4DT4 A;  1SYT A;  1PBK A;  2MPH A;  2K8I A;  2QF8 A;  4XAK A;  3ARV A;  4HAR A;  3LUO A;  2D9F A;  2DG3 A;  1GUV A;  3WD0 A;  2DT2 A;  1HXV A;  1NSG A;  1J4I A;  3AS1 A;  3UQI A;  3IKD A;  4HBO A;  1X6L A;  4W9P A;  3KAC A;  3KAG A;  4Z2I A;  4DWS D;  1ZU8 A;  3O5D A;  1F8A B;  1LG2 A;  1UR9 A;  4WKA A;  1NMW A;  2PV3 A;  3UI4 A;  4R5E A;  1FKK A;  1BKF A;  4DZ3 A;  1CTN A;  3O5M A;  3WKZ A;  1Q6H A;  1W9U A;  4R0X A;  1P5Q A;  3O5E A;  4L72 B;  3I6C A;  1O6I A;  4QIB A;  1FKD A;  3CHF A;  3AS3 A;  5GQB A;  3RFW A;  1GOI A;  1YAT A;  2MNT A;  2XP4 A;  3ARO A;  4MNK A;  3WD3 A;  3FAP A;  1J4H A;  4MPK A;  4ML4 A;  1GPF A;  4DWS A;  3OA5 A;  5HT1 A;  3PA7 A;  1Y0O A;  5BXJ A;  4MNL A;  4DWS B;  3UQB A;  1FKB A;  2KGJ A;  1A7X A;  3O5G A;  1NWU A;  2LPV A;  1FJD A;  1ZL1 A;  4WIW A;  4DRO A;  1W9P A;  3B8S A;  4DRQ A;  2LKN A;  1E6P A;  1FKT A;  4ITZ A;  2RQS A;  3PRB A;  4MAV A;  4Z2G A;  3CHE A;  3WH0 A;  3CGN A;  1L1P A;  2ZR6 A;  1FKS A;  3G6M A;  4IT6 A;  2G8Z A;  4MSP A;  2L2S A;  5DIV A;  3WL0 A;  1C9H A;  1W26 A;  1XRV A;  3O5F A;  3KAB A;  4QT2 A;  5DEZ A;  3ARX A;  4W9O A;  4ODL A;  4TW8 A;  3ARQ A;  5DF0 A;  3UF8 A;  1JNS A;  4ODN A;  3EY6 A;  1FAP A;  3NTP A;  4P8U A;  4P8V A;  5GPG A;  4S3K A;  1LJY A;  1LG1 A;  1E6N A;  1ROT A;  1B6C A;  2ZR4 A;  3KAF A;  1D2K A;  1Q6U A;  3WQW A;  4N19 A;  4GIV A;  4U86 A;  3WQV A;  2XP3 A;  3FY1 A;  1ITX A;  4TW6 A;  3WD1 A;  2PI6 A;  1FFR A;  4TNS A;  3OOB A;  3ARP A;  3PRA A;  2O9O A;  1W9V A;  2KR7 A;  4URI A;  2LGO A;  4MTV A;  2RUD A;  4U84 A;  3KAH A;  4DRH A;  1QPL A;  2ZQS A;  3ARU A;  5GPR A;  3WL1 A;  1D7I A;  3ARR A;  4LAV A;  2VCD A;  5HBF A;  3KAD A;  2N87 A;  3KCE A;  2DG9 A;  3O5K A;  1M5Y A;  3O5O A;  4IQ2 A;  4IT4 A;  4L3N A;  1NH6 A;  1ZK6 A;  4MNM A;  2YBU A;  4JFI A;  4Z2J A;  4ODM A;  4ODQ A;  2G41 A;  2DSU A;  3B9D A;  4Q22 A;  1ZCN A;  1OGB A;  3VAW A;  2A3A A;  3RM9 A;  2ZQV A;  2M08 A;  5HW8 A;  4G50 A;  2KO7 A;  1EQ3 A;  5HTG A;  4JFM A;  5HW7 A;  3IK8 A;  5HW6 A;  5HUA A;  3O5Q A;  3CHD A;  4MNJ A;  1FKH A;  1H0G A;  1FD9 A;  1PIN A;  5DO2 A;  1W1P A;  2F2D A;  3KZ7 A;  2XP5 A;  4KR0 B;  2DT3 A;  1SR0 A;  3O5R A;  4DIP A;  1FKG A;  2XP9 A;  4TX0 A;  3JXV A;  2LJ4 A;  2MLZ A;  1VF8 A;  3JYM A;  2PPN A;  4JYS A;  1J6Y A;  2ZQU A;  4JFK A;  4TYO A;  2DSW A;  4ZPW R;  1YW5 A;  1QPF A;  4KQZ A;  5D75 A;  4HBE A;  2MLY A;  4PTM A;  4WJX A;  3PR9 A;  3RM4 A;  2FKE A;  3UQA A;  2Q5A A;  1ROU A;  3B9A A;  1W1T A;  1LL7 A;  3CHC A;  1ZBW A;  1RD6 A;  1T11 A;  2WM0 A;  1W1V A;  2IUZ A;  3ARY A;  1ZBC A;  2A3C A;  1JNE A;  3AS0 A;  1D6O A;  2YBT A;  4P8X A;  5JH8 A;  1FKJ A;  2ZQT A;  1IX5 A;  4J4N A;  2XPB A;  5I98 A;  1JND A;  5HKG A;  4DRI A;  4W5U A;  4LAY A;  1TFV A;  3KAI A;  4TW7 A;  2RUC A;  1EDQ A;  4GGQ A;  1W1Y A;  1D7J A;  4Z2L A;  3ART A;  3AS2 A;  1KT1 A;  3BXW A;  1R9H A;  3NI6 A;  3G6L A;  3IHZ A;  1KT0 A;  3RME A;  3RGC A;  3QOK A;  4LGX A;  2FDM A;  2JZV A;  5B8I C;  1HKM A;  1XHG A;  1OWQ A;  2ITK A;  2OFN A;  4NSB A;  4QZV B;  5J6E A;  1NWT A;  4ZS6 A;  1OGG A;  1NWS A;  1ZBV A;  4DZ2 A;  1JVW A;  4IPX A;  3ARW A;  4S3J A;  2UZ5 A;  3PRD A;  2XP6 A;  1HKK A;  4W9Q A;  2XP7 A;  4C02 B;  3ALG A;  3O5J A;  3GPK A;  4QT3 A;  1EYM A;  2XPA A;  2PV1 A;  1FKL A;  2KE0 A;  3AQU A;  2DG4 A;  1JNT A;  2Y78 A;  4FAP A;  1NMV A;  3IKG A;  2M1I A;  2WLZ A;  3NRK A;  4Z2H A;  4J4O A;  5HWC A;  1BL4 A;  1LL6 A;  4P8W A;  3W4R A;  4U85 A;  3MDY B;  1J4R A;  4FN2 A;  3ODK A;  3WIJ A;  2KFW A;  2O92 A;  2PPO A;  2OLH A;  1QZ2 A;  2M2A A;  4DRJ A;  2DT1 A;  4DRM A;  1HJV A;  1N1A A;  1E15 A;  2PBC A;  2RUQ A;  1HJX A;  2ZR5 A;  4LAW A;  2IF4 A;  4MGV A;  4ODR A;  1KFW A;  1TCO C;  4DH0 A;  1X6N A;  4Q7N A;  3CZ8 A;  4WK9 A;  1WNO A;  4DRK A;  4NNR A;  1EHN A;  2F21 A;  3O5L A;  3O5P A;  3ALF A;  2VN1 A;  3CH9 A;  2DPE A;  1WB0 A;  4DWS C;  4G2P A;  5DIT A;  1HJW A;  3B7X A;  2MLX A;  3UI5 A;  2F4E A;  4DRP A;  3JYJ A;  2XP8 A;  2WLY A;  4ODP A;  1K9T A;  1FKI A;  1F40 A;  5HWB A;  1E9L A;  1ZBK A;  4DRN A;  2DT0 A;  4ODO A;  3WD4 A;  1HKI A;  2RSE A;  3ARZ A;  4AY1 A;  2DSZ A;  3FXY A;  3TDB A;  4IQC A;  1E6Z A;  1LL4 A;  2PV2 A;  3RM8 A;  1U79 A;  2ESC A;  1H0I A;  1FKF A;  1HKJ A;  4WKF A;  2A3B A;  2DSV A;  3UI6 A;  2WK2 A;  3H9R B;  1FKR A;  4Z2K A;  4JFL A;  3CGM A;  5DIU A;  3WD2 A;  1D7H A;  4WKH A;  3TC5 A;  2RUR A;  2A3E A;  2FAP A;  1ZB5 A;  4ODK A;  1Q6I A;  2KI3 A;  4ZPV R;  1LQ0 A;  1NWR A;  1FFQ A;  1EIB A;  3O5I A;  4NZC A;  2B31 A;  2AWG A;  1WAW A;  1UR8 A;  2AOS A;  3ARS A;  4JFJ A;  2MF9 A;  3B9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...