1JNSA

Nmr structure of the e. coli peptidyl-prolyl cis/trans-isomerase parvulin 10
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
AKTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE C
publication title Solution structure of Escherichia coli Par10: The prototypic member of the Parvulin family of peptidyl-prolyl cis/trans isomerases.
pubmed doi rcsb
source organism Escherichia coli
total genus 16
structure length 92
sequence length 92
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jnsA00
1KT1A 1NMWA 2XP7A 3KAHA 4ODKA 3KACA 4G50A 4DRHA 1ROTA 4TYOA 3KAGA 4JFIA 4TW7A 1J4HA 1N1AA 2RUQA 2ZQVA 3IKDA 4LAWA 2XP5A 1Q6IA 4ODOA 1FKLA 1J4RA 2VN1A 1F8AB 1P5QA 4FN2A 2KGJA 2OFNA 2PBCA 2Y78A 3FAPA 3O5PA 1FKFA 3I6CA 4J4OA 4TX0A 3TC5A 4DRKA 2Q5AA 1J4IA 2IF4A 2RURA 2XP4A 4C02B 2DG3A 2RSEA 5J6EA 4JYSA 4W9PA 2AWGA 2PV2A 3MDYB 1Q6HA 1NSGA 2VCDA 3JXVA 3JYMA 3O5GA 1D6OA 3PA7A 3JYJA 4JFJA 4LAXA 4ODMA 5HWCA 1BKFA 1D7HA 4N19A 4ODPA 3UI6A 2UZ5A 4DH0A 4JFMA 2MLXA 2F4EA 3B7XA 4U86A 1ROUA 1A7XA 1EYMA 4ODRA 4BF8A 1TCOC 4DROA 3IK8A 3WH0A 4DZ2A 1EQ3A 1D7IA 2RUDA 2PPOA 3O5JA 4DT4A 2XP8A 3ODKA 1FJDA 2LPVA 1FKGA 2ZR5A 2F2DA 3O5EA 3KADA 4GIVA 3KZ7A 4LAVA 2KR7A 5DIVA 1U79A 4ODNA 3UF8A 1FKSA 2XP9A 3NI6A 2KFWA 1FKHA 4ODLA 3UQBA 2XPAA 3O5QA 3UQAA 1QPLA 3LUOA 4LAYA 1FKDA 4DRNA 1FKIA 5B8IC 2ZR6A 4DRIA 2MPHA 4DRMA 1FKRA 2FKEA 4FAPA 1YW5A 3NTPA 5HUAA 3PRBA 1FKKA 2MF9A 2LGOA 4TW6A 3H9RB 2LKNA 2MLYA 4QIBA 5HW6A 1FKBA 1QZ2A 3O5KA 1ZK6A 3KAIA 2K8IA 3OOBA 4MGVA 5GPGA 4GGQA 5HT1A 2DG4A 2ITKA 3UI5A 1J6YA 3O5IA 5HW7A 3O5RA 3PRDA 4NNRA 5I98A 1FKTA 1Q6UA 2MLZA 3O5FA 4O2TA 2PPPA 3KCEA 3UI4A 2RQSA 2L2SA 2RUCA 3RFWA 1F40A 4DZ3A 1NMVA 2XPBA 2N87A 1Y0OA 1KT0A 2XP3A 2PV3A 2LJ4A 4DRQA 4MSPA 5HKGA 1M5YA 2D9FA 2FAPA 4W9QA 3GPKA 4R0XA 1HXVA 2ZQTA 3RGCA 2KO7A 1B6CA 4QT2A 4IQ2A 4ITZA 2PPNA 1FKJA 4JFKA 2M08A 5HTGA 1PINA 2M2AA 2DG9A 2ZQUA 2KE0A 3EY6A 4U85A 1W26A 1ZCNA 4IPXA 4QT3A 1FAPA 1JVWA 1Q1CA 1BL4A 1T11A 2ZR4A 3CGMA 2ZQSA 3IHZA 4ODQA 3O5OA 4DRJA 3O5LA 4G2PA 1FD9A 5DITA 5DIUA 1R9HA 4JFLA 3UQIA 3O5DA 5D75A 3TCZA 2MNTA 3KAFA 3TDBA 1L1PA 3O5MA 5BXJA 1QPFA 2M1IA 4IQCA 4TW8A 3NRKA 4DIPA 2KI3A 2PV1A 2XP6A 1YATA 5HWBA 1PBKA 3KABA 2JZVA 3IKGA 1JNTA 3CGNA 3VAWA 4W9OA 1C9HA 1D7JA 4TNSA 2F21A 4DRPA 5HW8A 4U84A 1JNSA 4J4NA
chains in the Genus database with same CATH superfamily
4AY1A 4TW7A 2RUQA 4DIPA 1F8AB 3UQBA 4NZCA 1FFQA 3FAPA 4DRKA 2IF4A 1GOIA 2AWGA 1Q6HA 1NSGA 1E6RA 4LAXA 4JFJA 2ETNA 1D2KA 3CH9A 1BKFA 1D7HA 4N19A 4WKFA 2UZ5A 2DT3A 2YBUA 4Q22A 3RM9A 4DT4A 2XP8A 4HBOA 1HJVA 1FJDA 2ZR5A 5DEZA 1E44A 4LAVA 3KADA 3KZ7A 4WK9A 3NI6A 2KFWA 1O6IA 4L72B 2G8ZA 1FKDA 4UDMA 4MNMA 3WQVA 4DRMA 4FAPA 1YW5A 4DWSB 3PRBA 1FKKA 2LGOA 2AOSA 5JH8A 4MNKA 3KAIA 4S3KA 4GGQA 2ITKA 1FKTA 2MLZA 3O5FA 2PPPA 3KCEA 2RUCA 3RFWA 3PRAA 2PI6A 2N87A 2XP3A 4WKAA 1W1TA 3WL0A 4MSPA 1M5YA 2D9FA 4R0XA 1B6CA 4Z2LA 4IQ2A 4ITZA 1HKIA 4JFKA 2O92A 1JNEA 1H0GA 2ZQUA 4Z2GA 3ALFA 1T11A 4P8VA 4ODQA 5DITA 1HKMA 3GU0A 3UQIA 5D75A 4ZPWR 4TW8A 4PTMA 3ARZA 2DT2A 2DT1A 3IKGA 4IT4A 3CGNA 4P8UA 4MTVA 5HW8A 2XP7A 1ROTA 3ARTA 1HKKA 1Q6IA 3QOKA 1FKLA 5BXJA 3O5PA 2Y78A 2Q5AA 2XP4A 1EDQA 3MDYB 3BXWA 2DPEA 3JYMA 1D6OA 4ODPA 1W9UA 4DH0A 4JFMA 2F4EA 4U86A 1ROUA 1A7XA 3B8SA 3ARXA 1TCOC 3WKZA 3IK8A 2O9OA 4DROA 4DZ2A 1EQ3A 1D7IA 4Z2KA 1W9VA 1OGBA 2WLZA 1GRJA 3O5EA 2WK2A 2KR7A 5DIVA 1LQ0A 1ZBCA 1FFRA 3RMEA 1FKSA 2XP9A 4P8XA 4ODLA 1QPLA 3LUOA 4LAYA 4Z2IA 1HKJA 3ARVA 3CHCA 4WJXA 2MPHA 1NH6A 1VF8A 3RM4A 3CHDA 3WD1A 4TW6A 3H9RB 2LKNA 1ZBKA 1FKBA 2DT0A 1ZK6A 3OOBA 4MGVA 5GPGA 5HT1A 3UI5A 3O5IA 5HW7A 1NWTA 3O5RA 4WKHA 4NNRA 5I98A 1UR8A 3ALGA 2L2SA 3AS1A 1E6ZA 3AQUA 1TFVA 4DZ3A 4ZPVR 2PV3A 4DRQA 2FAPA 1HXVA 3GPKA 1WNOA 3RGCA 4IT6A 1FKJA 5HTGA 3ARPA 2M2AA 2DG9A 1W26A 3ARRA 1RD6A 1JVWA 1SR0A 1Q1CA 3IHZA 2ZR4A 2ZQSA 4URIA 1R9HA 1ZBVA 1NWRA 4ZPTR 2MNTA 3ARQA 1IX5A 3O5MA 2M1IA 2PV1A 2JZVA 3WD2A 4MAVA 1XRVA 1D7JA 2F21A 4DRPA 1HJXA 2YBTA 1JNSA 5HWBA 3KAHA 1NMWA 1ZU8A 3KACA 1ZBWA 4ODKA 1J4HA 1N1AA 4ODOA 3IKDA 2XP5A 1J4RA 2VN1A 1P5QA 2KGJA 2OFNA 4Q7NA 4J4OA 3RM8A 3WL1A 1FKFA 3I6CA 3WD0A 2A3BA 3TC5A 1KFWA 2RURA 2DG3A 2RSEA 4JYSA 4W9PA 2VCDA 3O5GA 3WD3A 3PA7A 3JYJA 4ODMA 1E9LA 2A3EA 2MLXA 2EULA 3B7XA 1EYMA 1GPFA 3B9DA 2RUDA 3CHEA 3ODKA 2LPVA 1E6PA 3OA5A 2F2DA 4GIVA 1EHNA 3UF8A 3WD4A 1H0IA 4R5EA 4S3JA 2XPAA 2A3CA 4Z2JA 2WM0A 2A3AA 4DRNA 4KR0B 1W1PA 1X6NA 1XHGA 5B8IC 2ZR6A 4W5UA 3NTPA 5HUAA 1UR9A 3AROA 4QIBA 3O5KA 4MNLA 3GTYX 1J6YA 4NSBA 1OWQA 1LL4A 3WIJA 3AS3A 2RQSA 1F40A 2B5UB 1GUVA 4HBEA 1ITXA 3B9AA 4W9QA 2ZQTA 3FY1A 2KO7A 4QT2A 3AS0A 2PPNA 2M08A 5HBFA 1LJYA 2DSZA 1PINA 2KE0A 1ZCNA 4U85A 1WAWA 1OGGA 1FAPA 4IPXA 1BL4A 3CGMA 1SYTA 5DO2A 3O5LA 4G2PA 1FD9A 3O5DA 3TCZA 4DWSA 1L1PA 3AS2A 1QPFA 2F23A 3CZ8A 5GQBA 2KI3A 1PBKA 2DSWA 2P4VA 3VAWA 4WIWA 4W9OA 1C9HA 4TNSA 3G6LA 4U84A 1KT1A 5GPRA 4G50A 4DRHA 4TYOA 3KAGA 4JFIA 1JNDA 2ZQVA 1E15A 4LAWA 4XAKA 4FN2A 3B9EA 2PBCA 4TX0A 1J4IA 4P8WA 4C02B 5J6EA 2PV2A 3JXVA 4DWSC 4HARA 5HWCA 3UI6A 1EIBA 4ODRA 4BF8A 3WH0A 1WB0A 1W9PA 2FDMA 2PPOA 3O5JA 1ZB5A 2ESCA 1FKGA 3ARUA 3BMBA 1W1VA 1U79A 4ODNA 1FKHA 2WLYA 3O5QA 3UQAA 1FKIA 4DRIA 1W1YA 1FKRA 2FKEA 1HJWA 4LGXA 2MF9A 2G41A 2MLYA 5HW6A 1LL6A 1QZ2A 2K8IA 2DG4A 4KQZA 3PRDA 1Q6UA 4O2TA 3UI4A 2QF8A 4Z2HA 4L3NA 3ARYA 1JCHB 1NMVA 2B31A 1CTNA 2XPBA 4QZVB 1Y0OA 1KT0A 3PR9A 4MPKA 2LJ4A 1X6LA 1ZL1A 4ML4A 5HKGA 1LG2A 3ARWA 1K9TA 1NWSA 4ZS6A 3EY6A 4DWSD 4QT3A 2DSUA 3O5OA 4DRJA 3CHFA 4MNJA 1LG1A 5DIUA 4JFLA 1LL7A 3FXYA 3ARSA 2DSVA 3KAFA 3TDBA 3G6MA 4IQCA 3WQWA 3NRKA 2OLHA 2PN0A 1E6NA 1NWUA 2XP6A 1YATA 3KABA 3W4RA 3EIPA 2IUZA 5DF0A 1JNTA 4J4NA
chains in the Genus database with same CATH topology
4AY1A 4TW7A 2RUQA 4DIPA 1F8AB 3UQBA 4NZCA 1FFQA 3FAPA 4DRKA 2IF4A 1GOIA 2AWGA 1Q6HA 1NSGA 1E6RA 4LAXA 4JFJA 1D2KA 3CH9A 1BKFA 1D7HA 4N19A 4WKFA 2UZ5A 2DT3A 2YBUA 4Q22A 3RM9A 4DT4A 2XP8A 4HBOA 1HJVA 1FJDA 2ZR5A 5DEZA 4LAVA 3KADA 3KZ7A 4WK9A 3NI6A 2KFWA 1O6IA 4L72B 2G8ZA 1FKDA 4MNMA 3WQVA 4DRMA 4FAPA 1YW5A 4DWSB 3PRBA 1FKKA 2LGOA 2AOSA 5JH8A 4MNKA 3KAIA 4S3KA 4GGQA 2ITKA 1FKTA 2MLZA 3O5FA 2PPPA 3KCEA 2RUCA 3RFWA 3PRAA 2PI6A 2N87A 2XP3A 4WKAA 1W1TA 3WL0A 4MSPA 1M5YA 2D9FA 4R0XA 1B6CA 4Z2LA 4IQ2A 4ITZA 1HKIA 4JFKA 2O92A 1JNEA 1H0GA 2ZQUA 4Z2GA 3ALFA 1T11A 4P8VA 4ODQA 5DITA 1HKMA 3UQIA 5D75A 4ZPWR 4TW8A 4PTMA 3ARZA 2DT2A 2DT1A 3IKGA 4IT4A 3CGNA 4P8UA 4MTVA 5HW8A 2XP7A 1ROTA 3ARTA 1HKKA 1Q6IA 3QOKA 1FKLA 5BXJA 3O5PA 2Y78A 2Q5AA 2XP4A 1EDQA 3MDYB 3BXWA 2DPEA 3JYMA 1D6OA 4ODPA 1W9UA 4DH0A 4JFMA 2F4EA 4U86A 1ROUA 1A7XA 3B8SA 3ARXA 1TCOC 3WKZA 3IK8A 2O9OA 4DROA 4DZ2A 1EQ3A 1D7IA 4Z2KA 1W9VA 1OGBA 2WLZA 3O5EA 2WK2A 2KR7A 5DIVA 1LQ0A 1ZBCA 1FFRA 3RMEA 1FKSA 2XP9A 4P8XA 4ODLA 1QPLA 3LUOA 4LAYA 4Z2IA 1HKJA 3ARVA 3CHCA 4WJXA 2MPHA 1NH6A 1VF8A 3RM4A 3CHDA 3WD1A 4TW6A 3H9RB 2LKNA 1ZBKA 1FKBA 2DT0A 1ZK6A 3OOBA 4MGVA 5GPGA 5HT1A 3UI5A 3O5IA 5HW7A 1NWTA 3O5RA 4WKHA 4NNRA 5I98A 1UR8A 3ALGA 2L2SA 1E6ZA 3AS1A 3AQUA 1TFVA 4DZ3A 4ZPVR 2PV3A 4DRQA 2FAPA 1HXVA 3GPKA 1WNOA 3RGCA 4IT6A 1FKJA 5HTGA 3ARPA 2M2AA 2DG9A 1W26A 3ARRA 1RD6A 1JVWA 1SR0A 1Q1CA 3IHZA 2ZR4A 2ZQSA 4URIA 1R9HA 1ZBVA 1NWRA 4ZPTR 2MNTA 3ARQA 1IX5A 3O5MA 2M1IA 2PV1A 2JZVA 3WD2A 4MAVA 1XRVA 1D7JA 2F21A 4DRPA 1HJXA 2YBTA 1JNSA 5HWBA 3KAHA 1NMWA 1ZU8A 3KACA 1ZBWA 4ODKA 1J4HA 1N1AA 4ODOA 3IKDA 2XP5A 1J4RA 2VN1A 1P5QA 2KGJA 2OFNA 4Q7NA 4J4OA 3RM8A 3WL1A 1FKFA 3I6CA 3WD0A 2A3BA 3TC5A 1KFWA 2RURA 2DG3A 2RSEA 4JYSA 4W9PA 2VCDA 3O5GA 3WD3A 3PA7A 3JYJA 4ODMA 1E9LA 2A3EA 2MLXA 3B7XA 1EYMA 1GPFA 3B9DA 2RUDA 3CHEA 3ODKA 2LPVA 1E6PA 3OA5A 2F2DA 4GIVA 1EHNA 3UF8A 3WD4A 1H0IA 4R5EA 4S3JA 2XPAA 2A3CA 4Z2JA 2WM0A 2A3AA 4DRNA 4KR0B 1W1PA 1X6NA 1XHGA 5B8IC 2ZR6A 4W5UA 3NTPA 5HUAA 1UR9A 3AROA 4QIBA 3O5KA 4MNLA 1J6YA 4NSBA 1OWQA 1LL4A 3WIJA 3AS3A 2RQSA 1F40A 1GUVA 4HBEA 1ITXA 3B9AA 4W9QA 2ZQTA 3FY1A 2KO7A 4QT2A 3AS0A 2PPNA 2M08A 5HBFA 1LJYA 2DSZA 1PINA 2KE0A 1ZCNA 4U85A 1WAWA 1OGGA 1FAPA 4IPXA 1BL4A 3CGMA 1SYTA 5DO2A 3O5LA 4G2PA 1FD9A 3O5DA 3TCZA 4DWSA 1L1PA 3AS2A 1QPFA 3CZ8A 5GQBA 2KI3A 1PBKA 2DSWA 3VAWA 4WIWA 4W9OA 1C9HA 4TNSA 3G6LA 4U84A 1KT1A 5GPRA 4G50A 4DRHA 4TYOA 3KAGA 4JFIA 1JNDA 2ZQVA 1E15A 4LAWA 4XAKA 4FN2A 3B9EA 2PBCA 4TX0A 1J4IA 4P8WA 4C02B 5J6EA 2PV2A 3JXVA 4DWSC 4HARA 5HWCA 3UI6A 1EIBA 4ODRA 4BF8A 3WH0A 1WB0A 1W9PA 2FDMA 2PPOA 3O5JA 1ZB5A 2ESCA 1FKGA 3ARUA 1W1VA 1U79A 4ODNA 1FKHA 2WLYA 3O5QA 3UQAA 1FKIA 4DRIA 1W1YA 1FKRA 2FKEA 1HJWA 4LGXA 2MF9A 2G41A 2MLYA 5HW6A 1LL6A 1QZ2A 2K8IA 2DG4A 4KQZA 3PRDA 1Q6UA 4O2TA 3UI4A 2QF8A 4Z2HA 4L3NA 3ARYA 1NMVA 2B31A 1CTNA 2XPBA 4QZVB 1Y0OA 1KT0A 3PR9A 4MPKA 2LJ4A 1X6LA 1ZL1A 4ML4A 5HKGA 1LG2A 3ARWA 1K9TA 1NWSA 4ZS6A 3EY6A 4DWSD 4QT3A 2DSUA 3O5OA 4DRJA 3CHFA 4MNJA 1LG1A 5DIUA 4JFLA 1LL7A 3FXYA 3ARSA 2DSVA 3KAFA 3TDBA 3G6MA 4IQCA 3WQWA 3NRKA 2OLHA 1E6NA 1NWUA 2XP6A 1YATA 3KABA 3W4RA 2IUZA 5DF0A 1JNTA 4J4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KT1 A;  1NMW A;  2XP7 A;  3KAH A;  4ODK A;  3KAC A;  4G50 A;  4DRH A;  1ROT A;  4TYO A;  3KAG A;  4JFI A;  4TW7 A;  1J4H A;  1N1A A;  2RUQ A;  2ZQV A;  3IKD A;  4LAW A;  2XP5 A;  1Q6I A;  4ODO A;  1FKL A;  1J4R A;  2VN1 A;  1F8A B;  1P5Q A;  4FN2 A;  2KGJ A;  2OFN A;  2PBC A;  2Y78 A;  3FAP A;  3O5P A;  1FKF A;  3I6C A;  4J4O A;  4TX0 A;  3TC5 A;  4DRK A;  2Q5A A;  1J4I A;  2IF4 A;  2RUR A;  2XP4 A;  4C02 B;  2DG3 A;  2RSE A;  5J6E A;  4JYS A;  4W9P A;  2AWG A;  2PV2 A;  3MDY B;  1Q6H A;  1NSG A;  2VCD A;  3JXV A;  3JYM A;  3O5G A;  1D6O A;  3PA7 A;  3JYJ A;  4JFJ A;  4LAX A;  4ODM A;  5HWC A;  1BKF A;  1D7H A;  4N19 A;  4ODP A;  3UI6 A;  2UZ5 A;  4DH0 A;  4JFM A;  2MLX A;  2F4E A;  3B7X A;  4U86 A;  1ROU A;  1A7X A;  1EYM A;  4ODR A;  4BF8 A;  1TCO C;  4DRO A;  3IK8 A;  3WH0 A;  4DZ2 A;  1EQ3 A;  1D7I A;  2RUD A;  2PPO A;  3O5J A;  4DT4 A;  2XP8 A;  3ODK A;  1FJD A;  2LPV A;  1FKG A;  2ZR5 A;  2F2D A;  3O5E A;  3KAD A;  4GIV A;  3KZ7 A;  4LAV A;  2KR7 A;  5DIV A;  1U79 A;  4ODN A;  3UF8 A;  1FKS A;  2XP9 A;  3NI6 A;  2KFW A;  1FKH A;  4ODL A;  3UQB A;  2XPA A;  3O5Q A;  3UQA A;  1QPL A;  3LUO A;  4LAY A;  1FKD A;  4DRN A;  1FKI A;  5B8I C;  2ZR6 A;  4DRI A;  2MPH A;  4DRM A;  1FKR A;  2FKE A;  4FAP A;  1YW5 A;  3NTP A;  5HUA A;  3PRB A;  1FKK A;  2MF9 A;  2LGO A;  4TW6 A;  3H9R B;  2LKN A;  2MLY A;  4QIB A;  5HW6 A;  1FKB A;  1QZ2 A;  3O5K A;  1ZK6 A;  3KAI A;  2K8I A;  3OOB A;  4MGV A;  5GPG A;  4GGQ A;  5HT1 A;  2DG4 A;  2ITK A;  3UI5 A;  1J6Y A;  3O5I A;  5HW7 A;  3O5R A;  3PRD A;  4NNR A;  5I98 A;  1FKT A;  1Q6U A;  2MLZ A;  3O5F A;  4O2T A;  2PPP A;  3KCE A;  3UI4 A;  2RQS A;  2L2S A;  2RUC A;  3RFW A;  1F40 A;  4DZ3 A;  1NMV A;  2XPB A;  2N87 A;  1Y0O A;  1KT0 A;  2XP3 A;  2PV3 A;  2LJ4 A;  4DRQ A;  4MSP A;  5HKG A;  1M5Y A;  2D9F A;  2FAP A;  4W9Q A;  3GPK A;  4R0X A;  1HXV A;  2ZQT A;  3RGC A;  2KO7 A;  1B6C A;  4QT2 A;  4IQ2 A;  4ITZ A;  2PPN A;  1FKJ A;  4JFK A;  2M08 A;  5HTG A;  1PIN A;  2M2A A;  2DG9 A;  2ZQU A;  2KE0 A;  3EY6 A;  4U85 A;  1W26 A;  1ZCN A;  4IPX A;  4QT3 A;  1FAP A;  1JVW A;  1Q1C A;  1BL4 A;  1T11 A;  2ZR4 A;  3CGM A;  2ZQS A;  3IHZ A;  4ODQ A;  3O5O A;  4DRJ A;  3O5L A;  4G2P A;  1FD9 A;  5DIT A;  5DIU A;  1R9H A;  4JFL A;  3UQI A;  3O5D A;  5D75 A;  3TCZ A;  2MNT A;  3KAF A;  3TDB A;  1L1P A;  3O5M A;  5BXJ A;  1QPF A;  2M1I A;  4IQC A;  4TW8 A;  3NRK A;  4DIP A;  2KI3 A;  2PV1 A;  2XP6 A;  1YAT A;  5HWB A;  1PBK A;  3KAB A;  2JZV A;  3IKG A;  1JNT A;  3CGN A;  3VAW A;  4W9O A;  1C9H A;  1D7J A;  4TNS A;  2F21 A;  4DRP A;  5HW8 A;  4U84 A;  1JNS A;  4J4N A; 
#chains in the Genus database with same CATH topology
 4AY1 A;  4TW7 A;  2RUQ A;  4DIP A;  1F8A B;  3UQB A;  4NZC A;  1FFQ A;  3FAP A;  4DRK A;  2IF4 A;  1GOI A;  2AWG A;  1Q6H A;  1NSG A;  1E6R A;  4LAX A;  4JFJ A;  2ETN A;  1D2K A;  3CH9 A;  1BKF A;  1D7H A;  4N19 A;  4WKF A;  2UZ5 A;  2DT3 A;  2YBU A;  4Q22 A;  3RM9 A;  4DT4 A;  2XP8 A;  4HBO A;  1HJV A;  1FJD A;  2ZR5 A;  5DEZ A;  1E44 A;  4LAV A;  3KAD A;  3KZ7 A;  4WK9 A;  3NI6 A;  2KFW A;  1O6I A;  4L72 B;  2G8Z A;  1FKD A;  4UDM A;  4MNM A;  3WQV A;  4DRM A;  4FAP A;  1YW5 A;  4DWS B;  3PRB A;  1FKK A;  2LGO A;  2AOS A;  5JH8 A;  4MNK A;  3KAI A;  4S3K A;  4GGQ A;  2ITK A;  1FKT A;  2MLZ A;  3O5F A;  2PPP A;  3KCE A;  2RUC A;  3RFW A;  3PRA A;  2PI6 A;  2N87 A;  2XP3 A;  4WKA A;  1W1T A;  3WL0 A;  4MSP A;  1M5Y A;  2D9F A;  4R0X A;  1B6C A;  4Z2L A;  4IQ2 A;  4ITZ A;  1HKI A;  4JFK A;  2O92 A;  1JNE A;  1H0G A;  2ZQU A;  4Z2G A;  3ALF A;  1T11 A;  4P8V A;  4ODQ A;  5DIT A;  1HKM A;  3GU0 A;  3UQI A;  5D75 A;  4ZPW R;  4TW8 A;  4PTM A;  3ARZ A;  2DT2 A;  2DT1 A;  3IKG A;  4IT4 A;  3CGN A;  4P8U A;  4MTV A;  5HW8 A;  2XP7 A;  1ROT A;  3ART A;  1HKK A;  1Q6I A;  3QOK A;  1FKL A;  5BXJ A;  3O5P A;  2Y78 A;  2Q5A A;  2XP4 A;  1EDQ A;  3MDY B;  3BXW A;  2DPE A;  3JYM A;  1D6O A;  4ODP A;  1W9U A;  4DH0 A;  4JFM A;  2F4E A;  4U86 A;  1ROU A;  1A7X A;  3B8S A;  3ARX A;  1TCO C;  3WKZ A;  3IK8 A;  2O9O A;  4DRO A;  4DZ2 A;  1EQ3 A;  1D7I A;  4Z2K A;  1W9V A;  1OGB A;  2WLZ A;  1GRJ A;  3O5E A;  2WK2 A;  2KR7 A;  5DIV A;  1LQ0 A;  1ZBC A;  1FFR A;  3RME A;  1FKS A;  2XP9 A;  4P8X A;  4ODL A;  1QPL A;  3LUO A;  4LAY A;  4Z2I A;  1HKJ A;  3ARV A;  3CHC A;  4WJX A;  2MPH A;  1NH6 A;  1VF8 A;  3RM4 A;  3CHD A;  3WD1 A;  4TW6 A;  3H9R B;  2LKN A;  1ZBK A;  1FKB A;  2DT0 A;  1ZK6 A;  3OOB A;  4MGV A;  5GPG A;  5HT1 A;  3UI5 A;  3O5I A;  5HW7 A;  1NWT A;  3O5R A;  4WKH A;  4NNR A;  5I98 A;  1UR8 A;  3ALG A;  2L2S A;  3AS1 A;  1E6Z A;  3AQU A;  1TFV A;  4DZ3 A;  4ZPV R;  2PV3 A;  4DRQ A;  2FAP A;  1HXV A;  3GPK A;  1WNO A;  3RGC A;  4IT6 A;  1FKJ A;  5HTG A;  3ARP A;  2M2A A;  2DG9 A;  1W26 A;  3ARR A;  1RD6 A;  1JVW A;  1SR0 A;  1Q1C A;  3IHZ A;  2ZR4 A;  2ZQS A;  4URI A;  1R9H A;  1ZBV A;  1NWR A;  4ZPT R;  2MNT A;  3ARQ A;  1IX5 A;  3O5M A;  2M1I A;  2PV1 A;  2JZV A;  3WD2 A;  4MAV A;  1XRV A;  1D7J A;  2F21 A;  4DRP A;  1HJX A;  2YBT A;  1JNS A;  5HWB A;  3KAH A;  1NMW A;  1ZU8 A;  3KAC A;  1ZBW A;  4ODK A;  1J4H A;  1N1A A;  4ODO A;  3IKD A;  2XP5 A;  1J4R A;  2VN1 A;  1P5Q A;  2KGJ A;  2OFN A;  4Q7N A;  4J4O A;  3RM8 A;  3WL1 A;  1FKF A;  3I6C A;  3WD0 A;  2A3B A;  3TC5 A;  1KFW A;  2RUR A;  2DG3 A;  2RSE A;  4JYS A;  4W9P A;  2VCD A;  3O5G A;  3WD3 A;  3PA7 A;  3JYJ A;  4ODM A;  1E9L A;  2A3E A;  2MLX A;  2EUL A;  3B7X A;  1EYM A;  1GPF A;  3B9D A;  2RUD A;  3CHE A;  3ODK A;  2LPV A;  1E6P A;  3OA5 A;  2F2D A;  4GIV A;  1EHN A;  3UF8 A;  3WD4 A;  1H0I A;  4R5E A;  4S3J A;  2XPA A;  2A3C A;  4Z2J A;  2WM0 A;  2A3A A;  4DRN A;  4KR0 B;  1W1P A;  1X6N A;  1XHG A;  5B8I C;  2ZR6 A;  4W5U A;  3NTP A;  5HUA A;  1UR9 A;  3ARO A;  4QIB A;  3O5K A;  4MNL A;  3GTY X;  1J6Y A;  4NSB A;  1OWQ A;  1LL4 A;  3WIJ A;  3AS3 A;  2RQS A;  1F40 A;  2B5U B;  1GUV A;  4HBE A;  1ITX A;  3B9A A;  4W9Q A;  2ZQT A;  3FY1 A;  2KO7 A;  4QT2 A;  3AS0 A;  2PPN A;  2M08 A;  5HBF A;  1LJY A;  2DSZ A;  1PIN A;  2KE0 A;  1ZCN A;  4U85 A;  1WAW A;  1OGG A;  1FAP A;  4IPX A;  1BL4 A;  3CGM A;  1SYT A;  5DO2 A;  3O5L A;  4G2P A;  1FD9 A;  3O5D A;  3TCZ A;  4DWS A;  1L1P A;  3AS2 A;  1QPF A;  2F23 A;  3CZ8 A;  5GQB A;  2KI3 A;  1PBK A;  2DSW A;  2P4V A;  3VAW A;  4WIW A;  4W9O A;  1C9H A;  4TNS A;  3G6L A;  4U84 A;  1KT1 A;  5GPR A;  4G50 A;  4DRH A;  4TYO A;  3KAG A;  4JFI A;  1JND A;  2ZQV A;  1E15 A;  4LAW A;  4XAK A;  4FN2 A;  3B9E A;  2PBC A;  4TX0 A;  1J4I A;  4P8W A;  4C02 B;  5J6E A;  2PV2 A;  3JXV A;  4DWS C;  4HAR A;  5HWC A;  3UI6 A;  1EIB A;  4ODR A;  4BF8 A;  3WH0 A;  1WB0 A;  1W9P A;  2FDM A;  2PPO A;  3O5J A;  1ZB5 A;  2ESC A;  1FKG A;  3ARU A;  3BMB A;  1W1V A;  1U79 A;  4ODN A;  1FKH A;  2WLY A;  3O5Q A;  3UQA A;  1FKI A;  4DRI A;  1W1Y A;  1FKR A;  2FKE A;  1HJW A;  4LGX A;  2MF9 A;  2G41 A;  2MLY A;  5HW6 A;  1LL6 A;  1QZ2 A;  2K8I A;  2DG4 A;  4KQZ A;  3PRD A;  1Q6U A;  4O2T A;  3UI4 A;  2QF8 A;  4Z2H A;  4L3N A;  3ARY A;  1JCH B;  1NMV A;  2B31 A;  1CTN A;  2XPB A;  4QZV B;  1Y0O A;  1KT0 A;  3PR9 A;  4MPK A;  2LJ4 A;  1X6L A;  1ZL1 A;  4ML4 A;  5HKG A;  1LG2 A;  3ARW A;  1K9T A;  1NWS A;  4ZS6 A;  3EY6 A;  4DWS D;  4QT3 A;  2DSU A;  3O5O A;  4DRJ A;  3CHF A;  4MNJ A;  1LG1 A;  5DIU A;  4JFL A;  1LL7 A;  3FXY A;  3ARS A;  2DSV A;  3KAF A;  3TDB A;  3G6M A;  4IQC A;  3WQW A;  3NRK A;  2OLH A;  2PN0 A;  1E6N A;  1NWU A;  2XP6 A;  1YAT A;  3KAB A;  3W4R A;  3EIP A;  2IUZ A;  5DF0 A;  1JNT A;  4J4N A; 
#chains in the Genus database with same CATH homology
 4AY1 A;  4TW7 A;  2RUQ A;  4DIP A;  1F8A B;  3UQB A;  4NZC A;  1FFQ A;  3FAP A;  4DRK A;  2IF4 A;  1GOI A;  2AWG A;  1Q6H A;  1NSG A;  1E6R A;  4LAX A;  4JFJ A;  1D2K A;  3CH9 A;  1BKF A;  1D7H A;  4N19 A;  4WKF A;  2UZ5 A;  2DT3 A;  2YBU A;  4Q22 A;  3RM9 A;  4DT4 A;  2XP8 A;  4HBO A;  1HJV A;  1FJD A;  2ZR5 A;  5DEZ A;  4LAV A;  3KAD A;  3KZ7 A;  4WK9 A;  3NI6 A;  2KFW A;  1O6I A;  4L72 B;  2G8Z A;  1FKD A;  4MNM A;  3WQV A;  4DRM A;  4FAP A;  1YW5 A;  4DWS B;  3PRB A;  1FKK A;  2LGO A;  2AOS A;  5JH8 A;  4MNK A;  3KAI A;  4S3K A;  4GGQ A;  2ITK A;  1FKT A;  2MLZ A;  3O5F A;  2PPP A;  3KCE A;  2RUC A;  3RFW A;  3PRA A;  2PI6 A;  2N87 A;  2XP3 A;  4WKA A;  1W1T A;  3WL0 A;  4MSP A;  1M5Y A;  2D9F A;  4R0X A;  1B6C A;  4Z2L A;  4IQ2 A;  4ITZ A;  1HKI A;  4JFK A;  2O92 A;  1JNE A;  1H0G A;  2ZQU A;  4Z2G A;  3ALF A;  1T11 A;  4P8V A;  4ODQ A;  5DIT A;  1HKM A;  3UQI A;  5D75 A;  4ZPW R;  4TW8 A;  4PTM A;  3ARZ A;  2DT2 A;  2DT1 A;  3IKG A;  4IT4 A;  3CGN A;  4P8U A;  4MTV A;  5HW8 A;  2XP7 A;  1ROT A;  3ART A;  1HKK A;  1Q6I A;  3QOK A;  1FKL A;  5BXJ A;  3O5P A;  2Y78 A;  2Q5A A;  2XP4 A;  1EDQ A;  3MDY B;  3BXW A;  2DPE A;  3JYM A;  1D6O A;  4ODP A;  1W9U A;  4DH0 A;  4JFM A;  2F4E A;  4U86 A;  1ROU A;  1A7X A;  3B8S A;  3ARX A;  1TCO C;  3WKZ A;  3IK8 A;  2O9O A;  4DRO A;  4DZ2 A;  1EQ3 A;  1D7I A;  4Z2K A;  1W9V A;  1OGB A;  2WLZ A;  3O5E A;  2WK2 A;  2KR7 A;  5DIV A;  1LQ0 A;  1ZBC A;  1FFR A;  3RME A;  1FKS A;  2XP9 A;  4P8X A;  4ODL A;  1QPL A;  3LUO A;  4LAY A;  4Z2I A;  1HKJ A;  3ARV A;  3CHC A;  4WJX A;  2MPH A;  1NH6 A;  1VF8 A;  3RM4 A;  3CHD A;  3WD1 A;  4TW6 A;  3H9R B;  2LKN A;  1ZBK A;  1FKB A;  2DT0 A;  1ZK6 A;  3OOB A;  4MGV A;  5GPG A;  5HT1 A;  3UI5 A;  3O5I A;  5HW7 A;  1NWT A;  3O5R A;  4WKH A;  4NNR A;  5I98 A;  1UR8 A;  3ALG A;  2L2S A;  1E6Z A;  3AS1 A;  3AQU A;  1TFV A;  4DZ3 A;  4ZPV R;  2PV3 A;  4DRQ A;  2FAP A;  1HXV A;  3GPK A;  1WNO A;  3RGC A;  4IT6 A;  1FKJ A;  5HTG A;  3ARP A;  2M2A A;  2DG9 A;  1W26 A;  3ARR A;  1RD6 A;  1JVW A;  1SR0 A;  1Q1C A;  3IHZ A;  2ZR4 A;  2ZQS A;  4URI A;  1R9H A;  1ZBV A;  1NWR A;  4ZPT R;  2MNT A;  3ARQ A;  1IX5 A;  3O5M A;  2M1I A;  2PV1 A;  2JZV A;  3WD2 A;  4MAV A;  1XRV A;  1D7J A;  2F21 A;  4DRP A;  1HJX A;  2YBT A;  1JNS A;  5HWB A;  3KAH A;  1NMW A;  1ZU8 A;  3KAC A;  1ZBW A;  4ODK A;  1J4H A;  1N1A A;  4ODO A;  3IKD A;  2XP5 A;  1J4R A;  2VN1 A;  1P5Q A;  2KGJ A;  2OFN A;  4Q7N A;  4J4O A;  3RM8 A;  3WL1 A;  1FKF A;  3I6C A;  3WD0 A;  2A3B A;  3TC5 A;  1KFW A;  2RUR A;  2DG3 A;  2RSE A;  4JYS A;  4W9P A;  2VCD A;  3O5G A;  3WD3 A;  3PA7 A;  3JYJ A;  4ODM A;  1E9L A;  2A3E A;  2MLX A;  3B7X A;  1EYM A;  1GPF A;  3B9D A;  2RUD A;  3CHE A;  3ODK A;  2LPV A;  1E6P A;  3OA5 A;  2F2D A;  4GIV A;  1EHN A;  3UF8 A;  3WD4 A;  1H0I A;  4R5E A;  4S3J A;  2XPA A;  2A3C A;  4Z2J A;  2WM0 A;  2A3A A;  4DRN A;  4KR0 B;  1W1P A;  1X6N A;  1XHG A;  5B8I C;  2ZR6 A;  4W5U A;  3NTP A;  5HUA A;  1UR9 A;  3ARO A;  4QIB A;  3O5K A;  4MNL A;  1J6Y A;  4NSB A;  1OWQ A;  1LL4 A;  3WIJ A;  3AS3 A;  2RQS A;  1F40 A;  1GUV A;  4HBE A;  1ITX A;  3B9A A;  4W9Q A;  2ZQT A;  3FY1 A;  2KO7 A;  4QT2 A;  3AS0 A;  2PPN A;  2M08 A;  5HBF A;  1LJY A;  2DSZ A;  1PIN A;  2KE0 A;  1ZCN A;  4U85 A;  1WAW A;  1OGG A;  1FAP A;  4IPX A;  1BL4 A;  3CGM A;  1SYT A;  5DO2 A;  3O5L A;  4G2P A;  1FD9 A;  3O5D A;  3TCZ A;  4DWS A;  1L1P A;  3AS2 A;  1QPF A;  3CZ8 A;  5GQB A;  2KI3 A;  1PBK A;  2DSW A;  3VAW A;  4WIW A;  4W9O A;  1C9H A;  4TNS A;  3G6L A;  4U84 A;  1KT1 A;  5GPR A;  4G50 A;  4DRH A;  4TYO A;  3KAG A;  4JFI A;  1JND A;  2ZQV A;  1E15 A;  4LAW A;  4XAK A;  4FN2 A;  3B9E A;  2PBC A;  4TX0 A;  1J4I A;  4P8W A;  4C02 B;  5J6E A;  2PV2 A;  3JXV A;  4DWS C;  4HAR A;  5HWC A;  3UI6 A;  1EIB A;  4ODR A;  4BF8 A;  3WH0 A;  1WB0 A;  1W9P A;  2FDM A;  2PPO A;  3O5J A;  1ZB5 A;  2ESC A;  1FKG A;  3ARU A;  1W1V A;  1U79 A;  4ODN A;  1FKH A;  2WLY A;  3O5Q A;  3UQA A;  1FKI A;  4DRI A;  1W1Y A;  1FKR A;  2FKE A;  1HJW A;  4LGX A;  2MF9 A;  2G41 A;  2MLY A;  5HW6 A;  1LL6 A;  1QZ2 A;  2K8I A;  2DG4 A;  4KQZ A;  3PRD A;  1Q6U A;  4O2T A;  3UI4 A;  2QF8 A;  4Z2H A;  4L3N A;  3ARY A;  1NMV A;  2B31 A;  1CTN A;  2XPB A;  4QZV B;  1Y0O A;  1KT0 A;  3PR9 A;  4MPK A;  2LJ4 A;  1X6L A;  1ZL1 A;  4ML4 A;  5HKG A;  1LG2 A;  3ARW A;  1K9T A;  1NWS A;  4ZS6 A;  3EY6 A;  4DWS D;  4QT3 A;  2DSU A;  3O5O A;  4DRJ A;  3CHF A;  4MNJ A;  1LG1 A;  5DIU A;  4JFL A;  1LL7 A;  3FXY A;  3ARS A;  2DSV A;  3KAF A;  3TDB A;  3G6M A;  4IQC A;  3WQW A;  3NRK A;  2OLH A;  1E6N A;  1NWU A;  2XP6 A;  1YAT A;  3KAB A;  3W4R A;  2IUZ A;  5DF0 A;  1JNT A;  4J4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...