1L1PA

Solution structure of the ppiase domain from e. coli trigger factor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
106
structure length
106
Chain Sequence
GSHMQATWKEKDGAVEAEDRVTIDFTGSVDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKVEERELPELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords trigger factor
publication title Solution Structure of the Closed Form of a Peptidyl-Prolyl Isomerase Reveals the Mechanism of Protein Folding
rcsb
source organism Escherichia coli
total genus 8
structure length 106
sequence length 106
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1l1pA00
1F8AB 5BXJA 2PV1A 4ODNA 5I98A 2ZQVA 3IHZA 3JYMA 1F40A 2RUDA 3KAFA 3WH0A 5HWBA 1D7IA 1FKBA 4QT2A 1BL4A 1ZK6A 4DIPA 1FD9A 4U84A 1Y0OA 1FKFA 1TCOC 3KABA 5DITA 2MLYA 1J4HA 1D6OA 1C9HA 1FKLA 3OOBA 2PBCA 4JFMA 4NNRA 3IK8A 4LAXA 4ODRA 4DRQA 4DRPA 4DRJA 5HWCA 1JVWA 1T11A 4ODKA 1ZCNA 2M1IA 1FKSA 2RQSA 2XP8A 3O5GA 2KE0A 4IQCA 2VCDA 2LPVA 1PINA 4DZ3A 3MDYB 2PPOA 3O5KA 3KAGA 2L2SA 2PPNA 2ZQTA 2KGJA 3KAIA 4FN2A 1HXVA 2MLZA 3O5IA 2LKNA 3KACA 2IF4A 2XP7A 3CGMA 2M08A 2XP6A 4W9PA 1D7HA 4JFIA 4MGVA 5DIUA 3UQIA 4TX0A 4GIVA 4TYOA 3VAWA 5HUAA 1J4IA 2ZR4A 2F2DA 3O5RA 4MSPA 1M5YA 4ODOA 5J6EA 2RURA 2KO7A 1FKKA 2LGOA 4FAPA 3O5FA 4U86A 4DRNA 2MF9A 2PPPA 4ODLA 4TW6A 4DRKA 2KR7A 1R9HA 2XPBA 4ODPA 1N1AA 2PV2A 3JYJA 3NI6A 4W9OA 3NTPA 2ZR5A 3EY6A 4JFLA 1FKTA 3GPKA 5DIVA 5GPGA 1Q6IA 3B7XA 1J6YA 1EQ3A 2RSEA 2RUQA 1JNSA 3TC5A 4J4NA 1NMWA 2Q5AA 2AWGA 1J4RA 2M2AA 1FKJA 4QIBA 4DH0A 1Q6HA 1KT1A 2XP5A 2RUCA 2XP9A 1FKGA 3TDBA 5HTGA 2KI3A 2LJ4A 4QT3A 4DROA 3UQAA 3O5OA 3PRBA 1QPLA 1ROUA 3I6CA 2ITKA 3FAPA 4ODQA 3RGCA 5HW8A 3UI5A 4IPXA 3O5LA 4IQ2A 2DG9A 1KT0A 1ROTA 1QZ2A 2MLXA 2XP4A 1BKFA 5D75A 2Y78A 3O5QA 2D9FA 4ITZA 3KADA 4G50A 3TCZA 4JYSA 3LUOA 3KCEA 1Q6UA 3KZ7A 5B8IC 2FAPA 4TW7A 3UI4A 2F21A 2PV3A 3RFWA 3O5JA 1YW5A 3ODKA 5HKGA 1YATA 3O5EA 4N19A 3UF8A 2JZVA 2MPHA 3KAHA 1NMVA 4DRIA 1A7XA 4U85A 3PA7A 4J4OA 1Q1CA 4JFJA 3PRDA 4O2TA 2DG4A 4TNSA 1B6CA 1FKHA 3IKDA 1U79A 3O5DA 4GGQA 2OFNA 2F4EA 4R0XA 3UQBA 2XP3A 3NRKA 2N87A 2ZR6A 1W26A 2K8IA 3JXVA 3O5MA 1FAPA 4LAVA 4TW8A 2FKEA 1PBKA 1EYMA 4G2PA 4BF8A 2ZQUA 5HT1A 4C02B 4DT4A 2KFWA 1D7JA 4ODMA 4JFKA 3IKGA 5HW7A 1JNTA 5HW6A 1FJDA 4LAYA 3O5PA 4DZ2A 3CGNA 3UI6A 2MNTA 4DRHA 1FKRA 1P5QA 2VN1A 1L1PA 2ZQSA 4DRMA 2XPAA 1QPFA 1FKDA 3H9RB 2DG3A 4LAWA 2UZ5A 4W9QA 1FKIA 1NSGA
chains in the Genus database with same CATH superfamily
5BXJA 2PV1A 5I98A 1F40A 1O6IA 3PRAA 4QT2A 1FKBA 1GUVA 4ZS6A 4U84A 1FKFA 2PBCA 4DRQA 4LAXA 3RM4A 1H0GA 3PR9A 1JVWA 4DRJA 3ALGA 2KE0A 3CH9A 2LPVA 4DZ3A 4L3NA 1UR8A 3KAGA 4UDMA 1HXVA 2XP7A 4W9PA 1D7HA 5DIUA 3UQIA 1LG2A 1J4IA 2PI6A 4ODOA 5HBFA 4XAKA 4Z2HA 3ARUA 2LGOA 4ZPTR 3O5FA 4KR0B 4TW6A 4ODLA 2KR7A 3B9EA 2XPBA 3JYJA 1LQ0A 3NI6A 1LL6A 1FKTA 5GPGA 2OLHA 3B7XA 1OWQA 4QZVB 1GOIA 1JNSA 4P8VA 4J4NA 2Q5AA 1J4RA 2AWGA 2M2AA 1Q6HA 2WK2A 1KT1A 2DPEA 5HTGA 1E44A 2LJ4A 4QT3A 3PRBA 1ROUA 3FAPA 4DWSC 5HW8A 4IQ2A 1KT0A 1QZ2A 1BKFA 3WD3A 2Y78A 3O5QA 2D9FA 4ITZA 3KADA 4G50A 5GQBA 3WL0A 3RM8A 4IT6A 2DSUA 3KZ7A 2O92A 2EULA 2PV3A 1LG1A 4N19A 1SR0A 2A3CA 3BXWA 1NMVA 4J4OA 1GRJA 4O2TA 1HKIA 1U79A 4GGQA 2F4EA 1W1YA 2N87A 1FAPA 3BMBA 5HT1A 2F23A 3CHDA 1ZU8A 1NWUA 4WIWA 2PN0A 1FJDA 3G6MA 5HW6A 1NH6A 3O5PA 3CGNA 4HBOA 3WD2A 1QPFA 3CZ8A 3I6CA 1IX5A 1NSGA 4ODNA 2ZQVA 3JYMA 5GPRA 2DSZA 3KAFA 3WH0A 4MNMA 1D7IA 3RMEA 1ZK6A 4DIPA 1FD9A 5DO2A 3KABA 1E6NA 2DT0A 5DITA 2MLYA 3B8SA 1D6OA 4NNRA 3IK8A 5HWCA 1RD6A 1T11A 2M1IA 3ARZA 3O5GA 2VCDA 3MDYB 2PPOA 3WQVA 2PPNA 1HKMA 1NWSA 3KAIA 3QOKA 4FN2A 3O5IA 5DEZA 2M08A 4JFIA 3CHFA 3VAWA 3ARPA 5HUAA 3O5RA 4MSPA 1HKJA 3OA5A 4L72B 4FAPA 4MNKA 4DRKA 4ODPA 1N1AA 1ITXA 4W9OA 3ARYA 1Q6IA 4WKAA 1OGBA 4Z2GA 4WKFA 1W9PA 1HKKA 4R5EA 4ODQA 1QPLA 3RGCA 4S3KA 3WL1A 4IPXA 1FFQA 2DG9A 4MTVA 2O9OA 1ZB5A 5D75A 3TCZA 3KCEA 5B8IC 1ZL1A 3UI4A 4Z2JA 3RFWA 1YATA 2ETNA 3O5EA 4DRIA 2JZVA 2MPHA 3KAHA 4Z2LA 2B31A 1A7XA 4ZPWR 3ARXA 1Q1CA 1LL4A 4WJXA 1X6LA 3IKDA 3AQUA 1E6RA 3O5DA 4MAVA 1TFVA 1ZBCA 3NRKA 4P8UA 2ZR6A 3JXVA 1HJVA 2FKEA 4G2PA 3ARWA 4C02B 4DT4A 2YBTA 4WKHA 2KFWA 5HW7A 4JFKA 3IKGA 4DZ2A 2MNTA 1L1PA 1P5QA 4DWSB 3ARQA 3H9RB 2UZ5A 4W9QA 1WB0A 3FY1A 1FKIA 2XP8A 1F8AB 3CHCA 2ESCA 3IHZA 4HBEA 2RUDA 1BL4A 2A3BA 3AS0A 1TCOC 2IUZA 1FKLA 1C9HA 4URIA 4ODRA 1W1TA 4ODKA 1K9TA 1ZCNA 1XRVA 2WLZA 4IQCA 4P8XA 3AS3A 1PINA 5DF0A 3O5KA 2ZQTA 4MPKA 2MLZA 2LKNA 3ARVA 1X6NA 2IF4A 3B9DA 4IT4A 4NZCA 3CGMA 2XP6A 1JNDA 4MGVA 4TX0A 4GIVA 4TYOA 3RM9A 5J6EA 2ZR4A 2F2DA 1KFWA 1W1PA 2KO7A 1FKKA 4DRNA 1EIBA 2PPPA 1HJXA 1R9HA 1NWTA 2PV2A 3AROA 4HARA 2ZR5A 3WD0A 4WK9A 4P8WA 1EQ3A 3AS1A 2RSEA 2DT1A 2RUQA 3TC5A 4QIBA 4Q7NA 4DH0A 2XP5A 2XP9A 3TDBA 2KI3A 2FDMA 3UI5A 4Z2IA 3O5LA 1ROTA 2MLXA 2XP4A 3WD4A 5JH8A 1W9VA 1Q6UA 2FAPA 1OGGA 2F21A 1YW5A 2WLYA 2YBUA 5HKGA 1LL7A 4S3JA 4U85A 4MNJA 2DG4A 4TNSA 1B6CA 1CTNA 2DT2A 2OFNA 1JNEA 4TW8A 3W4RA 1W26A 1EHNA 3O5MA 4LAVA 1LJYA 1PBKA 4BF8A 4LGXA 2ZQUA 1ZBWA 2P4VA 2A3EA 4KQZA 4DRHA 3UI6A 1FKRA 2VN1A 1E9LA 2ZQSA 2XPAA 1WNOA 1FKDA 1HJWA 4LAWA 1E6ZA 4DWSA 3GTYX 5HWBA 2DSVA 1Y0OA 2G8ZA 3EIPA 3CHEA 1J4HA 1XHGA 3OOBA 3FXYA 4JFMA 4DRPA 1H0IA 2A3AA 3ARSA 1FKSA 2RQSA 1E15A 2L2SA 2KGJA 3GU0A 3KACA 1UR9A 3WKZA 2DT3A 3B9AA 1W9UA 1M5YA 2RURA 1FFRA 4U86A 2MF9A 1E6PA 4AY1A 4Z2KA 3NTPA 1JCHB 3EY6A 4JFLA 3GPKA 4W5UA 5DIVA 2WM0A 1J6YA 1VF8A 2AOSA 1NMWA 4DWSD 1FKJA 2RUCA 1FKGA 4Q22A 1WAWA 1NWRA 1ZBVA 4DROA 3UQAA 3O5OA 2G41A 4MNLA 2ITKA 3ALFA 4ML4A 1ZBKA 4PTMA 4JYSA 1EDQA 3LUOA 3WD1A 3AS2A 4TW7A 1D2KA 4NSBA 3O5JA 3ODKA 3UF8A 2B5UB 1SYTA 3PA7A 4JFJA 1GPFA 3ARTA 3PRDA 3WQWA 1FKHA 4ZPVR 1W1VA 3ARRA 2DSWA 4R0XA 3UQBA 2XP3A 2K8IA 3G6LA 2QF8A 1EYMA 1D7JA 4ODMA 3WIJA 1JNTA 4LAYA 4DRMA 2DG3A
chains in the Genus database with same CATH topology
5BXJA 2PV1A 5I98A 1F40A 1O6IA 3PRAA 4QT2A 1FKBA 1GUVA 4ZS6A 4U84A 1FKFA 2PBCA 4DRQA 4LAXA 3RM4A 1H0GA 3PR9A 1JVWA 4DRJA 3ALGA 2KE0A 3CH9A 2LPVA 4DZ3A 4L3NA 1UR8A 3KAGA 1HXVA 2XP7A 4W9PA 1D7HA 5DIUA 3UQIA 1LG2A 1J4IA 2PI6A 4ODOA 5HBFA 4XAKA 4Z2HA 3ARUA 2LGOA 4ZPTR 3O5FA 4KR0B 4TW6A 4ODLA 2KR7A 3B9EA 2XPBA 3JYJA 1LQ0A 3NI6A 1LL6A 1FKTA 5GPGA 2OLHA 3B7XA 1OWQA 4QZVB 1GOIA 1JNSA 4P8VA 4J4NA 2Q5AA 1J4RA 2AWGA 2M2AA 1Q6HA 2WK2A 1KT1A 2DPEA 5HTGA 2LJ4A 4QT3A 3PRBA 1ROUA 3FAPA 4DWSC 5HW8A 4IQ2A 1KT0A 1QZ2A 1BKFA 3WD3A 2Y78A 3O5QA 2D9FA 4ITZA 3KADA 4G50A 5GQBA 3WL0A 3RM8A 4IT6A 2DSUA 3KZ7A 2O92A 2PV3A 1LG1A 4N19A 1SR0A 2A3CA 3BXWA 1NMVA 4J4OA 4O2TA 1HKIA 1U79A 4GGQA 2F4EA 1W1YA 2N87A 1FAPA 5HT1A 3CHDA 1ZU8A 1NWUA 4WIWA 1FJDA 3G6MA 5HW6A 1NH6A 3O5PA 3CGNA 4HBOA 3WD2A 1QPFA 3CZ8A 3I6CA 1IX5A 1NSGA 4ODNA 2ZQVA 3JYMA 5GPRA 2DSZA 3KAFA 3WH0A 4MNMA 1D7IA 3RMEA 1ZK6A 4DIPA 1FD9A 5DO2A 3KABA 1E6NA 2DT0A 5DITA 2MLYA 3B8SA 1D6OA 4NNRA 3IK8A 5HWCA 1RD6A 1T11A 2M1IA 3ARZA 3O5GA 2VCDA 3MDYB 2PPOA 3WQVA 2PPNA 1HKMA 1NWSA 3KAIA 3QOKA 4FN2A 3O5IA 5DEZA 2M08A 4JFIA 3CHFA 3VAWA 3ARPA 5HUAA 3O5RA 4MSPA 1HKJA 3OA5A 4L72B 4FAPA 4MNKA 4DRKA 4ODPA 1N1AA 1ITXA 4W9OA 3ARYA 1Q6IA 4WKAA 1OGBA 4Z2GA 4WKFA 1W9PA 1HKKA 4R5EA 4ODQA 1QPLA 3RGCA 4S3KA 3WL1A 4IPXA 1FFQA 2DG9A 4MTVA 2O9OA 1ZB5A 5D75A 3TCZA 3KCEA 5B8IC 1ZL1A 3UI4A 4Z2JA 3RFWA 1YATA 3O5EA 4DRIA 4Z2LA 2JZVA 2MPHA 3KAHA 2B31A 1A7XA 4ZPWR 3ARXA 1Q1CA 1LL4A 4WJXA 1X6LA 3IKDA 3AQUA 1E6RA 3O5DA 4MAVA 1TFVA 1ZBCA 3NRKA 4P8UA 2ZR6A 3JXVA 1HJVA 2FKEA 4G2PA 3ARWA 4C02B 4DT4A 2YBTA 4WKHA 2KFWA 5HW7A 4JFKA 3IKGA 4DZ2A 2MNTA 1L1PA 1P5QA 4DWSB 3ARQA 3H9RB 2UZ5A 4W9QA 1WB0A 3FY1A 1FKIA 2XP8A 1F8AB 3CHCA 2ESCA 3IHZA 4HBEA 2RUDA 1BL4A 2A3BA 3AS0A 1TCOC 2IUZA 1FKLA 1C9HA 4URIA 4ODRA 1W1TA 4ODKA 1K9TA 1ZCNA 1XRVA 2WLZA 4IQCA 4P8XA 3AS3A 1PINA 5DF0A 3O5KA 2ZQTA 4MPKA 2MLZA 2LKNA 3ARVA 1X6NA 2IF4A 3B9DA 4IT4A 4NZCA 3CGMA 2XP6A 1JNDA 4MGVA 4TX0A 4GIVA 4TYOA 3RM9A 5J6EA 2ZR4A 2F2DA 1KFWA 1W1PA 2KO7A 1FKKA 4DRNA 1EIBA 2PPPA 1HJXA 1R9HA 1NWTA 2PV2A 3AROA 4HARA 2ZR5A 3WD0A 4WK9A 4P8WA 1EQ3A 3AS1A 2RSEA 2DT1A 2RUQA 3TC5A 4QIBA 4Q7NA 4DH0A 2XP5A 2XP9A 3TDBA 2KI3A 2FDMA 3UI5A 4Z2IA 3O5LA 1ROTA 2MLXA 2XP4A 3WD4A 5JH8A 1W9VA 1Q6UA 2FAPA 1OGGA 2F21A 1YW5A 2WLYA 2YBUA 5HKGA 1LL7A 4S3JA 4U85A 4MNJA 2DG4A 4TNSA 1B6CA 1CTNA 2DT2A 2OFNA 1JNEA 4TW8A 3W4RA 1W26A 1EHNA 3O5MA 4LAVA 1LJYA 1PBKA 4BF8A 4LGXA 2ZQUA 1ZBWA 2A3EA 4KQZA 4DRHA 3UI6A 1FKRA 2VN1A 1E9LA 2ZQSA 2XPAA 1WNOA 1FKDA 1HJWA 4LAWA 1E6ZA 4DWSA 5HWBA 2DSVA 1Y0OA 2G8ZA 3CHEA 1J4HA 1XHGA 3OOBA 3FXYA 4JFMA 4DRPA 1H0IA 2A3AA 3ARSA 1FKSA 2RQSA 1E15A 2L2SA 2KGJA 3KACA 1UR9A 3WKZA 2DT3A 3B9AA 1W9UA 1M5YA 2RURA 1FFRA 4U86A 2MF9A 1E6PA 4AY1A 4Z2KA 3NTPA 3EY6A 4JFLA 3GPKA 4W5UA 5DIVA 2WM0A 1J6YA 1VF8A 2AOSA 1NMWA 4DWSD 1FKJA 2RUCA 1FKGA 4Q22A 1WAWA 1NWRA 1ZBVA 4DROA 3UQAA 3O5OA 2G41A 4MNLA 2ITKA 3ALFA 4ML4A 1ZBKA 4PTMA 4JYSA 1EDQA 3LUOA 3WD1A 3AS2A 4TW7A 1D2KA 4NSBA 3O5JA 3ODKA 3UF8A 1SYTA 3PA7A 4JFJA 1GPFA 3ARTA 3PRDA 3WQWA 1FKHA 4ZPVR 1W1VA 3ARRA 2DSWA 4R0XA 3UQBA 2XP3A 2K8IA 3G6LA 2QF8A 1EYMA 1D7JA 4ODMA 3WIJA 1JNTA 4LAYA 4DRMA 2DG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8A B;  5BXJ A;  2PV1 A;  4ODN A;  5I98 A;  2ZQV A;  3IHZ A;  3JYM A;  1F40 A;  2RUD A;  3KAF A;  3WH0 A;  5HWB A;  1D7I A;  1FKB A;  4QT2 A;  1BL4 A;  1ZK6 A;  4DIP A;  1FD9 A;  4U84 A;  1Y0O A;  1FKF A;  1TCO C;  3KAB A;  5DIT A;  2MLY A;  1J4H A;  1D6O A;  1C9H A;  1FKL A;  3OOB A;  2PBC A;  4JFM A;  4NNR A;  3IK8 A;  4LAX A;  4ODR A;  4DRQ A;  4DRP A;  4DRJ A;  5HWC A;  1JVW A;  1T11 A;  4ODK A;  1ZCN A;  2M1I A;  1FKS A;  2RQS A;  2XP8 A;  3O5G A;  2KE0 A;  4IQC A;  2VCD A;  2LPV A;  1PIN A;  4DZ3 A;  3MDY B;  2PPO A;  3O5K A;  3KAG A;  2L2S A;  2PPN A;  2ZQT A;  2KGJ A;  3KAI A;  4FN2 A;  1HXV A;  2MLZ A;  3O5I A;  2LKN A;  3KAC A;  2IF4 A;  2XP7 A;  3CGM A;  2M08 A;  2XP6 A;  4W9P A;  1D7H A;  4JFI A;  4MGV A;  5DIU A;  3UQI A;  4TX0 A;  4GIV A;  4TYO A;  3VAW A;  5HUA A;  1J4I A;  2ZR4 A;  2F2D A;  3O5R A;  4MSP A;  1M5Y A;  4ODO A;  5J6E A;  2RUR A;  2KO7 A;  1FKK A;  2LGO A;  4FAP A;  3O5F A;  4U86 A;  4DRN A;  2MF9 A;  2PPP A;  4ODL A;  4TW6 A;  4DRK A;  2KR7 A;  1R9H A;  2XPB A;  4ODP A;  1N1A A;  2PV2 A;  3JYJ A;  3NI6 A;  4W9O A;  3NTP A;  2ZR5 A;  3EY6 A;  4JFL A;  1FKT A;  3GPK A;  5DIV A;  5GPG A;  1Q6I A;  3B7X A;  1J6Y A;  1EQ3 A;  2RSE A;  2RUQ A;  1JNS A;  3TC5 A;  4J4N A;  1NMW A;  2Q5A A;  2AWG A;  1J4R A;  2M2A A;  1FKJ A;  4QIB A;  4DH0 A;  1Q6H A;  1KT1 A;  2XP5 A;  2RUC A;  2XP9 A;  1FKG A;  3TDB A;  5HTG A;  2KI3 A;  2LJ4 A;  4QT3 A;  4DRO A;  3UQA A;  3O5O A;  3PRB A;  1QPL A;  1ROU A;  3I6C A;  2ITK A;  3FAP A;  4ODQ A;  3RGC A;  5HW8 A;  3UI5 A;  4IPX A;  3O5L A;  4IQ2 A;  2DG9 A;  1KT0 A;  1ROT A;  1QZ2 A;  2MLX A;  2XP4 A;  1BKF A;  5D75 A;  2Y78 A;  3O5Q A;  2D9F A;  4ITZ A;  3KAD A;  4G50 A;  3TCZ A;  4JYS A;  3LUO A;  3KCE A;  1Q6U A;  3KZ7 A;  5B8I C;  2FAP A;  4TW7 A;  3UI4 A;  2F21 A;  2PV3 A;  3RFW A;  3O5J A;  1YW5 A;  3ODK A;  5HKG A;  1YAT A;  3O5E A;  4N19 A;  3UF8 A;  2JZV A;  2MPH A;  3KAH A;  1NMV A;  4DRI A;  1A7X A;  4U85 A;  3PA7 A;  4J4O A;  1Q1C A;  4JFJ A;  3PRD A;  4O2T A;  2DG4 A;  4TNS A;  1B6C A;  1FKH A;  3IKD A;  1U79 A;  3O5D A;  4GGQ A;  2OFN A;  2F4E A;  4R0X A;  3UQB A;  2XP3 A;  3NRK A;  2N87 A;  2ZR6 A;  1W26 A;  2K8I A;  3JXV A;  3O5M A;  1FAP A;  4LAV A;  4TW8 A;  2FKE A;  1PBK A;  1EYM A;  4G2P A;  4BF8 A;  2ZQU A;  5HT1 A;  4C02 B;  4DT4 A;  2KFW A;  1D7J A;  4ODM A;  4JFK A;  3IKG A;  5HW7 A;  1JNT A;  5HW6 A;  1FJD A;  4LAY A;  3O5P A;  4DZ2 A;  3CGN A;  3UI6 A;  2MNT A;  4DRH A;  1FKR A;  1P5Q A;  2VN1 A;  1L1P A;  2ZQS A;  4DRM A;  2XPA A;  1QPF A;  1FKD A;  3H9R B;  2DG3 A;  4LAW A;  2UZ5 A;  4W9Q A;  1FKI A;  1NSG A; 
#chains in the Genus database with same CATH topology
 5BXJ A;  2PV1 A;  5I98 A;  1F40 A;  1O6I A;  3PRA A;  4QT2 A;  1FKB A;  1GUV A;  4ZS6 A;  4U84 A;  1FKF A;  2PBC A;  4DRQ A;  4LAX A;  3RM4 A;  1H0G A;  3PR9 A;  1JVW A;  4DRJ A;  3ALG A;  2KE0 A;  3CH9 A;  2LPV A;  4DZ3 A;  4L3N A;  1UR8 A;  3KAG A;  4UDM A;  1HXV A;  2XP7 A;  4W9P A;  1D7H A;  5DIU A;  3UQI A;  1LG2 A;  1J4I A;  2PI6 A;  4ODO A;  5HBF A;  4XAK A;  4Z2H A;  3ARU A;  2LGO A;  4ZPT R;  3O5F A;  4KR0 B;  4TW6 A;  4ODL A;  2KR7 A;  3B9E A;  2XPB A;  3JYJ A;  1LQ0 A;  3NI6 A;  1LL6 A;  1FKT A;  5GPG A;  2OLH A;  3B7X A;  1OWQ A;  4QZV B;  1GOI A;  1JNS A;  4P8V A;  4J4N A;  2Q5A A;  1J4R A;  2AWG A;  2M2A A;  1Q6H A;  2WK2 A;  1KT1 A;  2DPE A;  5HTG A;  1E44 A;  2LJ4 A;  4QT3 A;  3PRB A;  1ROU A;  3FAP A;  4DWS C;  5HW8 A;  4IQ2 A;  1KT0 A;  1QZ2 A;  1BKF A;  3WD3 A;  2Y78 A;  3O5Q A;  2D9F A;  4ITZ A;  3KAD A;  4G50 A;  5GQB A;  3WL0 A;  3RM8 A;  4IT6 A;  2DSU A;  3KZ7 A;  2O92 A;  2EUL A;  2PV3 A;  1LG1 A;  4N19 A;  1SR0 A;  2A3C A;  3BXW A;  1NMV A;  4J4O A;  1GRJ A;  4O2T A;  1HKI A;  1U79 A;  4GGQ A;  2F4E A;  1W1Y A;  2N87 A;  1FAP A;  3BMB A;  5HT1 A;  2F23 A;  3CHD A;  1ZU8 A;  1NWU A;  4WIW A;  2PN0 A;  1FJD A;  3G6M A;  5HW6 A;  1NH6 A;  3O5P A;  3CGN A;  4HBO A;  3WD2 A;  1QPF A;  3CZ8 A;  3I6C A;  1IX5 A;  1NSG A;  4ODN A;  2ZQV A;  3JYM A;  5GPR A;  2DSZ A;  3KAF A;  3WH0 A;  4MNM A;  1D7I A;  3RME A;  1ZK6 A;  4DIP A;  1FD9 A;  5DO2 A;  3KAB A;  1E6N A;  2DT0 A;  5DIT A;  2MLY A;  3B8S A;  1D6O A;  4NNR A;  3IK8 A;  5HWC A;  1RD6 A;  1T11 A;  2M1I A;  3ARZ A;  3O5G A;  2VCD A;  3MDY B;  2PPO A;  3WQV A;  2PPN A;  1HKM A;  1NWS A;  3KAI A;  3QOK A;  4FN2 A;  3O5I A;  5DEZ A;  2M08 A;  4JFI A;  3CHF A;  3VAW A;  3ARP A;  5HUA A;  3O5R A;  4MSP A;  1HKJ A;  3OA5 A;  4L72 B;  4FAP A;  4MNK A;  4DRK A;  4ODP A;  1N1A A;  1ITX A;  4W9O A;  3ARY A;  1Q6I A;  4WKA A;  1OGB A;  4Z2G A;  4WKF A;  1W9P A;  1HKK A;  4R5E A;  4ODQ A;  1QPL A;  3RGC A;  4S3K A;  3WL1 A;  4IPX A;  1FFQ A;  2DG9 A;  4MTV A;  2O9O A;  1ZB5 A;  5D75 A;  3TCZ A;  3KCE A;  5B8I C;  1ZL1 A;  3UI4 A;  4Z2J A;  3RFW A;  1YAT A;  2ETN A;  3O5E A;  4DRI A;  2JZV A;  2MPH A;  3KAH A;  4Z2L A;  2B31 A;  1A7X A;  4ZPW R;  3ARX A;  1Q1C A;  1LL4 A;  4WJX A;  1X6L A;  3IKD A;  3AQU A;  1E6R A;  3O5D A;  4MAV A;  1TFV A;  1ZBC A;  3NRK A;  4P8U A;  2ZR6 A;  3JXV A;  1HJV A;  2FKE A;  4G2P A;  3ARW A;  4C02 B;  4DT4 A;  2YBT A;  4WKH A;  2KFW A;  5HW7 A;  4JFK A;  3IKG A;  4DZ2 A;  2MNT A;  1L1P A;  1P5Q A;  4DWS B;  3ARQ A;  3H9R B;  2UZ5 A;  4W9Q A;  1WB0 A;  3FY1 A;  1FKI A;  2XP8 A;  1F8A B;  3CHC A;  2ESC A;  3IHZ A;  4HBE A;  2RUD A;  1BL4 A;  2A3B A;  3AS0 A;  1TCO C;  2IUZ A;  1FKL A;  1C9H A;  4URI A;  4ODR A;  1W1T A;  4ODK A;  1K9T A;  1ZCN A;  1XRV A;  2WLZ A;  4IQC A;  4P8X A;  3AS3 A;  1PIN A;  5DF0 A;  3O5K A;  2ZQT A;  4MPK A;  2MLZ A;  2LKN A;  3ARV A;  1X6N A;  2IF4 A;  3B9D A;  4IT4 A;  4NZC A;  3CGM A;  2XP6 A;  1JND A;  4MGV A;  4TX0 A;  4GIV A;  4TYO A;  3RM9 A;  5J6E A;  2ZR4 A;  2F2D A;  1KFW A;  1W1P A;  2KO7 A;  1FKK A;  4DRN A;  1EIB A;  2PPP A;  1HJX A;  1R9H A;  1NWT A;  2PV2 A;  3ARO A;  4HAR A;  2ZR5 A;  3WD0 A;  4WK9 A;  4P8W A;  1EQ3 A;  3AS1 A;  2RSE A;  2DT1 A;  2RUQ A;  3TC5 A;  4QIB A;  4Q7N A;  4DH0 A;  2XP5 A;  2XP9 A;  3TDB A;  2KI3 A;  2FDM A;  3UI5 A;  4Z2I A;  3O5L A;  1ROT A;  2MLX A;  2XP4 A;  3WD4 A;  5JH8 A;  1W9V A;  1Q6U A;  2FAP A;  1OGG A;  2F21 A;  1YW5 A;  2WLY A;  2YBU A;  5HKG A;  1LL7 A;  4S3J A;  4U85 A;  4MNJ A;  2DG4 A;  4TNS A;  1B6C A;  1CTN A;  2DT2 A;  2OFN A;  1JNE A;  4TW8 A;  3W4R A;  1W26 A;  1EHN A;  3O5M A;  4LAV A;  1LJY A;  1PBK A;  4BF8 A;  4LGX A;  2ZQU A;  1ZBW A;  2P4V A;  2A3E A;  4KQZ A;  4DRH A;  3UI6 A;  1FKR A;  2VN1 A;  1E9L A;  2ZQS A;  2XPA A;  1WNO A;  1FKD A;  1HJW A;  4LAW A;  1E6Z A;  4DWS A;  3GTY X;  5HWB A;  2DSV A;  1Y0O A;  2G8Z A;  3EIP A;  3CHE A;  1J4H A;  1XHG A;  3OOB A;  3FXY A;  4JFM A;  4DRP A;  1H0I A;  2A3A A;  3ARS A;  1FKS A;  2RQS A;  1E15 A;  2L2S A;  2KGJ A;  3GU0 A;  3KAC A;  1UR9 A;  3WKZ A;  2DT3 A;  3B9A A;  1W9U A;  1M5Y A;  2RUR A;  1FFR A;  4U86 A;  2MF9 A;  1E6P A;  4AY1 A;  4Z2K A;  3NTP A;  1JCH B;  3EY6 A;  4JFL A;  3GPK A;  4W5U A;  5DIV A;  2WM0 A;  1J6Y A;  1VF8 A;  2AOS A;  1NMW A;  4DWS D;  1FKJ A;  2RUC A;  1FKG A;  4Q22 A;  1WAW A;  1NWR A;  1ZBV A;  4DRO A;  3UQA A;  3O5O A;  2G41 A;  4MNL A;  2ITK A;  3ALF A;  4ML4 A;  1ZBK A;  4PTM A;  4JYS A;  1EDQ A;  3LUO A;  3WD1 A;  3AS2 A;  4TW7 A;  1D2K A;  4NSB A;  3O5J A;  3ODK A;  3UF8 A;  2B5U B;  1SYT A;  3PA7 A;  4JFJ A;  1GPF A;  3ART A;  3PRD A;  3WQW A;  1FKH A;  4ZPV R;  1W1V A;  3ARR A;  2DSW A;  4R0X A;  3UQB A;  2XP3 A;  2K8I A;  3G6L A;  2QF8 A;  1EYM A;  1D7J A;  4ODM A;  3WIJ A;  1JNT A;  4LAY A;  4DRM A;  2DG3 A; 
#chains in the Genus database with same CATH homology
 5BXJ A;  2PV1 A;  5I98 A;  1F40 A;  1O6I A;  3PRA A;  4QT2 A;  1FKB A;  1GUV A;  4ZS6 A;  4U84 A;  1FKF A;  2PBC A;  4DRQ A;  4LAX A;  3RM4 A;  1H0G A;  3PR9 A;  1JVW A;  4DRJ A;  3ALG A;  2KE0 A;  3CH9 A;  2LPV A;  4DZ3 A;  4L3N A;  1UR8 A;  3KAG A;  1HXV A;  2XP7 A;  4W9P A;  1D7H A;  5DIU A;  3UQI A;  1LG2 A;  1J4I A;  2PI6 A;  4ODO A;  5HBF A;  4XAK A;  4Z2H A;  3ARU A;  2LGO A;  4ZPT R;  3O5F A;  4KR0 B;  4TW6 A;  4ODL A;  2KR7 A;  3B9E A;  2XPB A;  3JYJ A;  1LQ0 A;  3NI6 A;  1LL6 A;  1FKT A;  5GPG A;  2OLH A;  3B7X A;  1OWQ A;  4QZV B;  1GOI A;  1JNS A;  4P8V A;  4J4N A;  2Q5A A;  1J4R A;  2AWG A;  2M2A A;  1Q6H A;  2WK2 A;  1KT1 A;  2DPE A;  5HTG A;  2LJ4 A;  4QT3 A;  3PRB A;  1ROU A;  3FAP A;  4DWS C;  5HW8 A;  4IQ2 A;  1KT0 A;  1QZ2 A;  1BKF A;  3WD3 A;  2Y78 A;  3O5Q A;  2D9F A;  4ITZ A;  3KAD A;  4G50 A;  5GQB A;  3WL0 A;  3RM8 A;  4IT6 A;  2DSU A;  3KZ7 A;  2O92 A;  2PV3 A;  1LG1 A;  4N19 A;  1SR0 A;  2A3C A;  3BXW A;  1NMV A;  4J4O A;  4O2T A;  1HKI A;  1U79 A;  4GGQ A;  2F4E A;  1W1Y A;  2N87 A;  1FAP A;  5HT1 A;  3CHD A;  1ZU8 A;  1NWU A;  4WIW A;  1FJD A;  3G6M A;  5HW6 A;  1NH6 A;  3O5P A;  3CGN A;  4HBO A;  3WD2 A;  1QPF A;  3CZ8 A;  3I6C A;  1IX5 A;  1NSG A;  4ODN A;  2ZQV A;  3JYM A;  5GPR A;  2DSZ A;  3KAF A;  3WH0 A;  4MNM A;  1D7I A;  3RME A;  1ZK6 A;  4DIP A;  1FD9 A;  5DO2 A;  3KAB A;  1E6N A;  2DT0 A;  5DIT A;  2MLY A;  3B8S A;  1D6O A;  4NNR A;  3IK8 A;  5HWC A;  1RD6 A;  1T11 A;  2M1I A;  3ARZ A;  3O5G A;  2VCD A;  3MDY B;  2PPO A;  3WQV A;  2PPN A;  1HKM A;  1NWS A;  3KAI A;  3QOK A;  4FN2 A;  3O5I A;  5DEZ A;  2M08 A;  4JFI A;  3CHF A;  3VAW A;  3ARP A;  5HUA A;  3O5R A;  4MSP A;  1HKJ A;  3OA5 A;  4L72 B;  4FAP A;  4MNK A;  4DRK A;  4ODP A;  1N1A A;  1ITX A;  4W9O A;  3ARY A;  1Q6I A;  4WKA A;  1OGB A;  4Z2G A;  4WKF A;  1W9P A;  1HKK A;  4R5E A;  4ODQ A;  1QPL A;  3RGC A;  4S3K A;  3WL1 A;  4IPX A;  1FFQ A;  2DG9 A;  4MTV A;  2O9O A;  1ZB5 A;  5D75 A;  3TCZ A;  3KCE A;  5B8I C;  1ZL1 A;  3UI4 A;  4Z2J A;  3RFW A;  1YAT A;  3O5E A;  4DRI A;  4Z2L A;  2JZV A;  2MPH A;  3KAH A;  2B31 A;  1A7X A;  4ZPW R;  3ARX A;  1Q1C A;  1LL4 A;  4WJX A;  1X6L A;  3IKD A;  3AQU A;  1E6R A;  3O5D A;  4MAV A;  1TFV A;  1ZBC A;  3NRK A;  4P8U A;  2ZR6 A;  3JXV A;  1HJV A;  2FKE A;  4G2P A;  3ARW A;  4C02 B;  4DT4 A;  2YBT A;  4WKH A;  2KFW A;  5HW7 A;  4JFK A;  3IKG A;  4DZ2 A;  2MNT A;  1L1P A;  1P5Q A;  4DWS B;  3ARQ A;  3H9R B;  2UZ5 A;  4W9Q A;  1WB0 A;  3FY1 A;  1FKI A;  2XP8 A;  1F8A B;  3CHC A;  2ESC A;  3IHZ A;  4HBE A;  2RUD A;  1BL4 A;  2A3B A;  3AS0 A;  1TCO C;  2IUZ A;  1FKL A;  1C9H A;  4URI A;  4ODR A;  1W1T A;  4ODK A;  1K9T A;  1ZCN A;  1XRV A;  2WLZ A;  4IQC A;  4P8X A;  3AS3 A;  1PIN A;  5DF0 A;  3O5K A;  2ZQT A;  4MPK A;  2MLZ A;  2LKN A;  3ARV A;  1X6N A;  2IF4 A;  3B9D A;  4IT4 A;  4NZC A;  3CGM A;  2XP6 A;  1JND A;  4MGV A;  4TX0 A;  4GIV A;  4TYO A;  3RM9 A;  5J6E A;  2ZR4 A;  2F2D A;  1KFW A;  1W1P A;  2KO7 A;  1FKK A;  4DRN A;  1EIB A;  2PPP A;  1HJX A;  1R9H A;  1NWT A;  2PV2 A;  3ARO A;  4HAR A;  2ZR5 A;  3WD0 A;  4WK9 A;  4P8W A;  1EQ3 A;  3AS1 A;  2RSE A;  2DT1 A;  2RUQ A;  3TC5 A;  4QIB A;  4Q7N A;  4DH0 A;  2XP5 A;  2XP9 A;  3TDB A;  2KI3 A;  2FDM A;  3UI5 A;  4Z2I A;  3O5L A;  1ROT A;  2MLX A;  2XP4 A;  3WD4 A;  5JH8 A;  1W9V A;  1Q6U A;  2FAP A;  1OGG A;  2F21 A;  1YW5 A;  2WLY A;  2YBU A;  5HKG A;  1LL7 A;  4S3J A;  4U85 A;  4MNJ A;  2DG4 A;  4TNS A;  1B6C A;  1CTN A;  2DT2 A;  2OFN A;  1JNE A;  4TW8 A;  3W4R A;  1W26 A;  1EHN A;  3O5M A;  4LAV A;  1LJY A;  1PBK A;  4BF8 A;  4LGX A;  2ZQU A;  1ZBW A;  2A3E A;  4KQZ A;  4DRH A;  3UI6 A;  1FKR A;  2VN1 A;  1E9L A;  2ZQS A;  2XPA A;  1WNO A;  1FKD A;  1HJW A;  4LAW A;  1E6Z A;  4DWS A;  5HWB A;  2DSV A;  1Y0O A;  2G8Z A;  3CHE A;  1J4H A;  1XHG A;  3OOB A;  3FXY A;  4JFM A;  4DRP A;  1H0I A;  2A3A A;  3ARS A;  1FKS A;  2RQS A;  1E15 A;  2L2S A;  2KGJ A;  3KAC A;  1UR9 A;  3WKZ A;  2DT3 A;  3B9A A;  1W9U A;  1M5Y A;  2RUR A;  1FFR A;  4U86 A;  2MF9 A;  1E6P A;  4AY1 A;  4Z2K A;  3NTP A;  3EY6 A;  4JFL A;  3GPK A;  4W5U A;  5DIV A;  2WM0 A;  1J6Y A;  1VF8 A;  2AOS A;  1NMW A;  4DWS D;  1FKJ A;  2RUC A;  1FKG A;  4Q22 A;  1WAW A;  1NWR A;  1ZBV A;  4DRO A;  3UQA A;  3O5O A;  2G41 A;  4MNL A;  2ITK A;  3ALF A;  4ML4 A;  1ZBK A;  4PTM A;  4JYS A;  1EDQ A;  3LUO A;  3WD1 A;  3AS2 A;  4TW7 A;  1D2K A;  4NSB A;  3O5J A;  3ODK A;  3UF8 A;  1SYT A;  3PA7 A;  4JFJ A;  1GPF A;  3ART A;  3PRD A;  3WQW A;  1FKH A;  4ZPV R;  1W1V A;  3ARR A;  2DSW A;  4R0X A;  3UQB A;  2XP3 A;  2K8I A;  3G6L A;  2QF8 A;  1EYM A;  1D7J A;  4ODM A;  3WIJ A;  1JNT A;  4LAY A;  4DRM A;  2DG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...