4C02B

Crystal structure of human acvr1 (alk2) in complex with fkbp12.6 and dorsomorphin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/isomerase
molecule keywords ACTIVIN RECEPTOR TYPE-1
publication title Crystal Structure of Human Acvr1 (Alk2) in Complex with Fkbp12.6 And Dorsomorphin
rcsb
source organism Homo sapiens
total genus 24
structure length 108
sequence length 108
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4c02B00
2FKEA 3KACA 5DITA 4O2TA 2Q5AA 3CGMA 1FKSA 2PPNA 4ODQA 1EQ3A 4MSPA 2M1IA 1J6YA 1U79A 2JZVA 2XP8A 2ZR4A 4J4OA 1FKHA 1JVWA 4BF8A 2VN1A 5J6EA 3MDYB 4GIVA 1ROUA 2RSEA 3O5MA 4TYOA 4W9QA 2VCDA 4J4NA 4TNSA 2M2AA 3LUOA 1J4IA 4QT3A 1FKFA 2MLYA 3O5IA 1A7XA 1FKJA 5HUAA 5I98A 1JNSA 1EYMA 1N1AA 1YATA 1FAPA 2MPHA 4ODOA 4W9OA 1Q6UA 4DRKA 3TDBA 2KO7A 2K8IA 2XP7A 2MLXA 1Q1CA 3PRBA 4IQCA 4TX0A 1KT0A 2PPOA 3IHZA 3RFWA 1D6OA 1FD9A 3O5JA 3O5QA 5GPGA 1YW5A 2F4EA 4NNRA 2F21A 2IF4A 1Y0OA 1FKLA 3O5GA 5HKGA 2ZR5A 3UQBA 2PV2A 2RUQA 1D7HA 2RUDA 1NMWA 2FAPA 2KR7A 5HWBA 3O5KA 4LAWA 2LKNA 2RQSA 3IK8A 1B6CA 4DRJA 1D7JA 1FKBA 3CGNA 4FN2A 3NTPA 2PV1A 4QIBA 3TCZA 1FKTA 4DRIA 4DROA 2ZQUA 1TCOC 5HWCA 2ZQTA 1F8AB 4JFMA 3ODKA 2ZR6A 1QPFA 4LAXA 1L1PA 2N87A 1Q6IA 1J4RA 3NI6A 3O5FA 4TW6A 1J4HA 3H9RB 4DIPA 1M5YA 4DH0A 3O5LA 3JYMA 2DG4A 2XP4A 2ZQSA 5HT1A 1C9HA 3O5EA 1NSGA 1QPLA 4ODLA 3UQIA 1ZK6A 1QZ2A 1F40A 2MLZA 1FKKA 5DIUA 2MF9A 3I6CA 3RGCA 3GPKA 2KFWA 1Q6HA 3JXVA 3JYJA 4ITZA 4LAYA 2PV3A 4ODRA 2PPPA 2D9FA 2RURA 3KAHA 2LGOA 1FKGA 2ITKA 2XP6A 2LJ4A 4G2PA 4W9PA 3UF8A 4DZ3A 3NRKA 4ODKA 2KI3A 5HW6A 2KE0A 2ZQVA 3O5RA 2XP9A 4JFJA 4DRHA 4IPXA 2MNTA 4U84A 3KCEA 4U86A 4DRPA 4JFKA 2DG3A 1BL4A 4FAPA 2PBCA 2M08A 2Y78A 3EY6A 1BKFA 4ODPA 2F2DA 1D7IA 4JYSA 4MGVA 5B8IC 4DRMA 4DRNA 2LPVA 2XP3A 3IKGA 3KAGA 2XPAA 4DRQA 2L2SA 4QT2A 1NMVA 2AWGA 3B7XA 3IKDA 2OFNA 4GGQA 5D75A 4DT4A 3PRDA 4ODNA 3KAIA 3WH0A 3KZ7A 4R0XA 4TW8A 1FJDA 1ROTA 2XPBA 1T11A 1ZCNA 4U85A 1FKDA 3FAPA 5HW8A 3PA7A 3O5DA 4G50A 3O5OA 4JFIA 3VAWA 1FKIA 4TW7A 1R9HA 1PINA 3UQAA 3UI5A 1PBKA 5BXJA 1FKRA 2KGJA 2UZ5A 4N19A 5DIVA 4ODMA 4IQ2A 3KADA 1W26A 3KABA 3TC5A 2XP5A 5HW7A 4C02B 2RUCA 3KAFA 3O5PA 1HXVA 4JFLA 5HTGA 3UI4A 4DZ2A 1JNTA 4LAVA 3UI6A 3OOBA 1P5QA 2DG9A 1KT1A
chains in the Genus database with same CATH superfamily
5DITA 1EQ3A 2O92A 2Q5AA 3CGMA 4O2TA 1U79A 1ZBWA 1FKHA 4DWSC 4TYOA 4DWSA 1RD6A 2VCDA 3CZ8A 4AY1A 2MLYA 1A7XA 1YATA 4W9OA 1FAPA 5GPRA 1Q6UA 4DRKA 1WAWA 2KO7A 3ARVA 3CHFA 3PRBA 5DF0A 3RFWA 3IHZA 4Z2KA 1E9LA 2F4EA 2F21A 2IF4A 2QF8A 3O5GA 2G8ZA 1HJVA 4WKHA 3GTYX 4DRJA 4KR0B 2ZQUA 1F8AB 1X6NA 1HKJA 1GPFA 3B9AA 3W4RA 1EIBA 3JYMA 4MTVA 1QPLA 1ZK6A 3ALFA 1WNOA 4MAVA 1E15A 3B9EA 3ARZA 2LGOA 1FKGA 1ZBKA 4ODKA 2KI3A 4U84A 3ARTA 3KCEA 4U86A 2IUZA 4JFKA 2DG3A 2Y78A 1BKFA 1D7IA 1KFWA 4DRQA 2AWGA 5D75A 3AS2A 3PRDA 4ODNA 4R0XA 4TW8A 1HKIA 2XPBA 2B31A 1T11A 2DSWA 3WIJA 1ZCNA 3ARRA 2PN0A 4UDMA 3O5DA 4JFIA 3O5OA 2P4VA 3CH9A 3UI5A 4N19A 4Q22A 2DSUA 1E6RA 1HXVA 1E44A 1JNEA 4DZ2A 1EDQA 1JNTA 3OA5A 4MNMA 1P5QA 1L1PA 1FKSA 4WJXA 1HKKA 2M1IA 3FY1A 2XP8A 3AS3A 4J4OA 1JVWA 4L3NA 4BF8A 3WD1A 4Z2LA 1ROUA 1NH6A 2RSEA 3BXWA 2WM0A 1FFRA 2FDMA 3FXYA 1J4IA 3LUOA 4XAKA 2G41A 5HUAA 3TDBA 1FFQA 1H0IA 4TX0A 2PPOA 4PTMA 3AROA 1D6OA 1FD9A 1YW5A 2YBTA 1Y0OA 2A3EA 2ZR5A 2PV2A 2FAPA 3IK8A 1B6CA 1FKBA 4MNJA 2PV1A 4DWSD 1FKTA 3WL1A 5HWCA 4JFMA 1QPFA 4LAXA 1J4RA 3H9RB 4DIPA 2A3CA 3O5LA 1F40A 1FKKA 5DIUA 3RGCA 3JXVA 3JYJA 1IX5A 1XHGA 3KAHA 2ITKA 4G2PA 3ARSA 2LJ4A 1W1TA 4IT4A 3G6MA 5HW6A 1LG1A 3O5RA 3WD4A 1NWUA 4DRHA 4R5EA 4DRPA 4P8VA 4FAPA 1OGGA 2ETNA 3EY6A 4JYSA 3RM8A 2DT1A 2ESCA 2XP3A 2XPAA 1UR8A 1SR0A 1NMVA 4GGQA 4WK9A 3KAIA 3KZ7A 5GQBA 1ROTA 1ZBVA 4ZPTR 2F23A 3B8SA 4ZPWR 4U85A 4ML4A 1FKDA 3PA7A 4G50A 3WQWA 4Z2IA 4NZCA 1PINA 3UQAA 1FKRA 1CTNA 3RM4A 4ZPVR 2DPEA 5DIVA 4ODMA 4IQ2A 4P8XA 3QOKA 3TC5A 2XP5A 5HW7A 4C02B 4ZS6A 4JFLA 1NWTA 3UI6A 2DG9A 4DH0A 2PPNA 4ODQA 4MNLA 2JZVA 2ZR4A 1XRVA 4GIVA 1GUVA 1X6LA 2OLHA 3O5MA 4Z2JA 4J4NA 1H0GA 4HARA 4QT3A 1FKFA 1GRJA 3ARWA 5I98A 1JNSA 1N1AA 4ODOA 1HKMA 3CHEA 1ZL1A 2XP7A 2MLXA 4IQCA 1KT0A 4MPKA 3GU0A 3O5JA 3O5QA 5GPGA 3WD0A 3UQBA 2RUQA 2RUDA 4S3KA 1D7JA 1ITXA 3CGNA 1W9VA 2B5UB 3NTPA 4FN2A 4QIBA 2DT0A 4DRIA 4DROA 3CHCA 3ODKA 1OWQA 2N87A 1Q6IA 3O5FA 4TW6A 1M5YA 1W1YA 2DG4A 4WIWA 3O5EA 3UQIA 1EHNA 4ODLA 1QZ2A 1D2KA 2MLZA 3ARQA 2MF9A 3GPKA 2KFWA 4ODRA 4LAYA 5JH8A 2D9FA 5J6EA 1W1VA 3NRKA 4HBEA 4JFJA 2MNTA 3ARPA 1E6NA 1VF8A 4ODPA 2F2DA 2A3AA 1JNDA 5B8IC 4DRNA 4NSBA 1E6ZA 3KAGA 1OGBA 5DEZA 4QT2A 3B7XA 3IKDA 4Q7NA 1LQ0A 3WH0A 5HBFA 1NWSA 3BMBA 4W5UA 3FAPA 2WLZA 5HW8A 3VAWA 1FKIA 3PRAA 4L72B 1PBKA 2KGJA 3WD3A 1UR9A 1W26A 1HJWA 3KABA 3KAFA 3O5PA 2DT2A 3OOBA 2ZQSA 1KT1A 2FKEA 3KACA 4MSPA 1J6YA 1W9PA 1LL6A 3EIPA 4WKFA 2VN1A 3MDYB 4W9QA 3AS0A 2EULA 4TNSA 2M2AA 4HBOA 4P8UA 3O5IA 1FKJA 1LJYA 1ZBCA 4P8WA 1EYMA 2MPHA 1GOIA 4DWSB 4Z2GA 2K8IA 1NWRA 1Q1CA 1K9TA 3AQUA 2DSZA 4NNRA 3WD2A 1FKLA 5HKGA 4IT6A 1D7HA 1NMWA 2KR7A 5HWBA 3O5KA 4LAWA 2A3BA 1LL7A 2LKNA 2RQSA 4KQZA 3TCZA 1O6IA 1TCOC 2ZQTA 1SYTA 2ZR6A 1JCHB 1ZU8A 3NI6A 1J4HA 2WK2A 4Z2HA 2YBUA 2XP4A 5HT1A 1C9HA 1NSGA 3ALGA 3I6CA 1Q6HA 3ARYA 4ITZA 2PV3A 2PPPA 2RURA 1W9UA 2XP6A 4S3JA 4W9PA 3UF8A 4DZ3A 3B9DA 3ARUA 2KE0A 2ZQVA 2XP9A 4IPXA 3WQVA 2PI6A 2AOSA 4WKAA 2O9OA 1BL4A 1TFVA 2PBCA 2M08A 5DO2A 4MGVA 4DRMA 1LL4A 2LPVA 3IKGA 4LGXA 2L2SA 1ZB5A 1LG2A 4DT4A 2WLYA 4QZVB 3RM9A 4URIA 4TW7A 1R9HA 5BXJA 2UZ5A 3ARXA 3PR9A 3CHDA 3WKZA 3RMEA 3KADA 3G6LA 1W1PA 2RUCA 3AS1A 1WB0A 1E6PA 2DSVA 1HJXA 5HTGA 2DT3A 3UI4A 4MNKA 3WL0A 4LAVA 2OFNA 1FJDA
chains in the Genus database with same CATH topology
5DITA 1EQ3A 2O92A 2Q5AA 3CGMA 4O2TA 1U79A 1ZBWA 1FKHA 4DWSC 4TYOA 4DWSA 1RD6A 2VCDA 3CZ8A 4AY1A 2MLYA 1A7XA 1YATA 4W9OA 1FAPA 5GPRA 1Q6UA 4DRKA 1WAWA 2KO7A 3ARVA 3CHFA 3PRBA 5DF0A 3RFWA 3IHZA 4Z2KA 1E9LA 2F4EA 2F21A 2IF4A 2QF8A 3O5GA 2G8ZA 1HJVA 4WKHA 4DRJA 4KR0B 2ZQUA 1F8AB 1X6NA 1HKJA 1GPFA 3B9AA 3W4RA 1EIBA 3JYMA 4MTVA 1QPLA 1ZK6A 3ALFA 1WNOA 4MAVA 1E15A 3B9EA 3ARZA 2LGOA 1FKGA 1ZBKA 4ODKA 2KI3A 4U84A 3ARTA 3KCEA 4U86A 2IUZA 4JFKA 2DG3A 2Y78A 1BKFA 1D7IA 1KFWA 4DRQA 2AWGA 5D75A 3AS2A 3PRDA 4ODNA 4R0XA 4TW8A 1HKIA 2XPBA 2B31A 1T11A 2DSWA 3WIJA 1ZCNA 3ARRA 3O5DA 4JFIA 3O5OA 3CH9A 3UI5A 4N19A 4Q22A 2DSUA 1E6RA 1HXVA 1JNEA 4DZ2A 1EDQA 1JNTA 3OA5A 4MNMA 1P5QA 1L1PA 1FKSA 4WJXA 1HKKA 2M1IA 3FY1A 2XP8A 3AS3A 4J4OA 1JVWA 4L3NA 4BF8A 3WD1A 4Z2LA 1ROUA 1NH6A 2RSEA 3BXWA 2WM0A 1FFRA 2FDMA 3FXYA 1J4IA 3LUOA 4XAKA 2G41A 5HUAA 3TDBA 1FFQA 1H0IA 4TX0A 2PPOA 4PTMA 3AROA 1D6OA 1FD9A 1YW5A 2YBTA 1Y0OA 2A3EA 2ZR5A 2PV2A 2FAPA 3IK8A 1B6CA 1FKBA 4MNJA 2PV1A 4DWSD 1FKTA 3WL1A 5HWCA 4JFMA 1QPFA 4LAXA 1J4RA 3H9RB 4DIPA 2A3CA 3O5LA 1F40A 1FKKA 5DIUA 3RGCA 3JXVA 3JYJA 1IX5A 1XHGA 3KAHA 2ITKA 4G2PA 3ARSA 2LJ4A 1W1TA 4IT4A 3G6MA 5HW6A 1LG1A 3O5RA 3WD4A 1NWUA 4DRHA 4R5EA 4DRPA 4P8VA 4FAPA 1OGGA 3EY6A 4JYSA 3RM8A 2DT1A 2ESCA 2XP3A 2XPAA 1UR8A 1SR0A 1NMVA 4GGQA 4WK9A 3KAIA 3KZ7A 5GQBA 1ROTA 1ZBVA 4ZPTR 3B8SA 4ZPWR 4U85A 4ML4A 1FKDA 3PA7A 4G50A 3WQWA 4Z2IA 4NZCA 1PINA 3UQAA 1FKRA 1CTNA 3RM4A 4ZPVR 2DPEA 5DIVA 4ODMA 4IQ2A 4P8XA 3QOKA 3TC5A 2XP5A 5HW7A 4C02B 4ZS6A 4JFLA 1NWTA 3UI6A 2DG9A 4DH0A 2PPNA 4ODQA 4MNLA 2JZVA 2ZR4A 1XRVA 4GIVA 1GUVA 1X6LA 2OLHA 3O5MA 4Z2JA 4J4NA 1H0GA 4HARA 4QT3A 1FKFA 3ARWA 5I98A 1JNSA 1N1AA 4ODOA 1HKMA 3CHEA 1ZL1A 2XP7A 2MLXA 4IQCA 1KT0A 4MPKA 3O5JA 3O5QA 5GPGA 3WD0A 3UQBA 2RUQA 2RUDA 4S3KA 1D7JA 1ITXA 3CGNA 1W9VA 3NTPA 4FN2A 4QIBA 2DT0A 4DRIA 4DROA 3CHCA 3ODKA 1OWQA 2N87A 1Q6IA 3O5FA 4TW6A 1M5YA 1W1YA 2DG4A 4WIWA 3O5EA 3UQIA 1EHNA 4ODLA 1QZ2A 1D2KA 2MLZA 3ARQA 2MF9A 3GPKA 2KFWA 4ODRA 4LAYA 5JH8A 2D9FA 5J6EA 1W1VA 3NRKA 4HBEA 4JFJA 2MNTA 3ARPA 1E6NA 1VF8A 4ODPA 2F2DA 2A3AA 1JNDA 5B8IC 4DRNA 4NSBA 1E6ZA 3KAGA 1OGBA 5DEZA 4QT2A 3B7XA 3IKDA 4Q7NA 1LQ0A 3WH0A 5HBFA 1NWSA 4W5UA 3FAPA 2WLZA 5HW8A 3VAWA 1FKIA 3PRAA 4L72B 1PBKA 2KGJA 3WD3A 1UR9A 1W26A 1HJWA 3KABA 3KAFA 3O5PA 2DT2A 3OOBA 2ZQSA 1KT1A 2FKEA 3KACA 4MSPA 1J6YA 1W9PA 1LL6A 4WKFA 2VN1A 3MDYB 4W9QA 3AS0A 4TNSA 2M2AA 4HBOA 4P8UA 3O5IA 1FKJA 1LJYA 1ZBCA 4P8WA 1EYMA 2MPHA 1GOIA 4DWSB 4Z2GA 2K8IA 1NWRA 1Q1CA 1K9TA 3AQUA 2DSZA 4NNRA 3WD2A 1FKLA 5HKGA 4IT6A 1D7HA 1NMWA 2KR7A 5HWBA 3O5KA 4LAWA 2A3BA 1LL7A 2LKNA 2RQSA 4KQZA 3TCZA 1O6IA 1TCOC 2ZQTA 1SYTA 2ZR6A 1ZU8A 3NI6A 1J4HA 2WK2A 4Z2HA 2YBUA 2XP4A 5HT1A 1C9HA 1NSGA 3ALGA 3I6CA 1Q6HA 3ARYA 4ITZA 2PV3A 2PPPA 2RURA 1W9UA 2XP6A 4S3JA 4W9PA 3UF8A 4DZ3A 3B9DA 3ARUA 2KE0A 2ZQVA 2XP9A 4IPXA 3WQVA 2PI6A 2AOSA 4WKAA 2O9OA 1BL4A 1TFVA 2PBCA 2M08A 5DO2A 4MGVA 4DRMA 1LL4A 2LPVA 3IKGA 4LGXA 2L2SA 1ZB5A 1LG2A 4DT4A 2WLYA 4QZVB 3RM9A 4URIA 4TW7A 1R9HA 5BXJA 2UZ5A 3ARXA 3PR9A 3CHDA 3WKZA 3RMEA 3KADA 3G6LA 1W1PA 2RUCA 3AS1A 1WB0A 1E6PA 2DSVA 1HJXA 5HTGA 2DT3A 3UI4A 4MNKA 3WL0A 4LAVA 2OFNA 1FJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKE A;  3KAC A;  5DIT A;  4O2T A;  2Q5A A;  3CGM A;  1FKS A;  2PPN A;  4ODQ A;  1EQ3 A;  4MSP A;  2M1I A;  1J6Y A;  1U79 A;  2JZV A;  2XP8 A;  2ZR4 A;  4J4O A;  1FKH A;  1JVW A;  4BF8 A;  2VN1 A;  5J6E A;  3MDY B;  4GIV A;  1ROU A;  2RSE A;  3O5M A;  4TYO A;  4W9Q A;  2VCD A;  4J4N A;  4TNS A;  2M2A A;  3LUO A;  1J4I A;  4QT3 A;  1FKF A;  2MLY A;  3O5I A;  1A7X A;  1FKJ A;  5HUA A;  5I98 A;  1JNS A;  1EYM A;  1N1A A;  1YAT A;  1FAP A;  2MPH A;  4ODO A;  4W9O A;  1Q6U A;  4DRK A;  3TDB A;  2KO7 A;  2K8I A;  2XP7 A;  2MLX A;  1Q1C A;  3PRB A;  4IQC A;  4TX0 A;  1KT0 A;  2PPO A;  3IHZ A;  3RFW A;  1D6O A;  1FD9 A;  3O5J A;  3O5Q A;  5GPG A;  1YW5 A;  2F4E A;  4NNR A;  2F21 A;  2IF4 A;  1Y0O A;  1FKL A;  3O5G A;  5HKG A;  2ZR5 A;  3UQB A;  2PV2 A;  2RUQ A;  1D7H A;  2RUD A;  1NMW A;  2FAP A;  2KR7 A;  5HWB A;  3O5K A;  4LAW A;  2LKN A;  2RQS A;  3IK8 A;  1B6C A;  4DRJ A;  1D7J A;  1FKB A;  3CGN A;  4FN2 A;  3NTP A;  2PV1 A;  4QIB A;  3TCZ A;  1FKT A;  4DRI A;  4DRO A;  2ZQU A;  1TCO C;  5HWC A;  2ZQT A;  1F8A B;  4JFM A;  3ODK A;  2ZR6 A;  1QPF A;  4LAX A;  1L1P A;  2N87 A;  1Q6I A;  1J4R A;  3NI6 A;  3O5F A;  4TW6 A;  1J4H A;  3H9R B;  4DIP A;  1M5Y A;  4DH0 A;  3O5L A;  3JYM A;  2DG4 A;  2XP4 A;  2ZQS A;  5HT1 A;  1C9H A;  3O5E A;  1NSG A;  1QPL A;  4ODL A;  3UQI A;  1ZK6 A;  1QZ2 A;  1F40 A;  2MLZ A;  1FKK A;  5DIU A;  2MF9 A;  3I6C A;  3RGC A;  3GPK A;  2KFW A;  1Q6H A;  3JXV A;  3JYJ A;  4ITZ A;  4LAY A;  2PV3 A;  4ODR A;  2PPP A;  2D9F A;  2RUR A;  3KAH A;  2LGO A;  1FKG A;  2ITK A;  2XP6 A;  2LJ4 A;  4G2P A;  4W9P A;  3UF8 A;  4DZ3 A;  3NRK A;  4ODK A;  2KI3 A;  5HW6 A;  2KE0 A;  2ZQV A;  3O5R A;  2XP9 A;  4JFJ A;  4DRH A;  4IPX A;  2MNT A;  4U84 A;  3KCE A;  4U86 A;  4DRP A;  4JFK A;  2DG3 A;  1BL4 A;  4FAP A;  2PBC A;  2M08 A;  2Y78 A;  3EY6 A;  1BKF A;  4ODP A;  2F2D A;  1D7I A;  4JYS A;  4MGV A;  5B8I C;  4DRM A;  4DRN A;  2LPV A;  2XP3 A;  3IKG A;  3KAG A;  2XPA A;  4DRQ A;  2L2S A;  4QT2 A;  1NMV A;  2AWG A;  3B7X A;  3IKD A;  2OFN A;  4GGQ A;  5D75 A;  4DT4 A;  3PRD A;  4ODN A;  3KAI A;  3WH0 A;  3KZ7 A;  4R0X A;  4TW8 A;  1FJD A;  1ROT A;  2XPB A;  1T11 A;  1ZCN A;  4U85 A;  1FKD A;  3FAP A;  5HW8 A;  3PA7 A;  3O5D A;  4G50 A;  3O5O A;  4JFI A;  3VAW A;  1FKI A;  4TW7 A;  1R9H A;  1PIN A;  3UQA A;  3UI5 A;  1PBK A;  5BXJ A;  1FKR A;  2KGJ A;  2UZ5 A;  4N19 A;  5DIV A;  4ODM A;  4IQ2 A;  3KAD A;  1W26 A;  3KAB A;  3TC5 A;  2XP5 A;  5HW7 A;  4C02 B;  2RUC A;  3KAF A;  3O5P A;  1HXV A;  4JFL A;  5HTG A;  3UI4 A;  4DZ2 A;  1JNT A;  4LAV A;  3UI6 A;  3OOB A;  1P5Q A;  2DG9 A;  1KT1 A; 
#chains in the Genus database with same CATH topology
 5DIT A;  1EQ3 A;  2O92 A;  2Q5A A;  3CGM A;  4O2T A;  1U79 A;  1ZBW A;  1FKH A;  4DWS C;  4TYO A;  4DWS A;  1RD6 A;  2VCD A;  3CZ8 A;  4AY1 A;  2MLY A;  1A7X A;  1YAT A;  4W9O A;  1FAP A;  5GPR A;  1Q6U A;  4DRK A;  1WAW A;  2KO7 A;  3ARV A;  3CHF A;  3PRB A;  5DF0 A;  3RFW A;  3IHZ A;  4Z2K A;  1E9L A;  2F4E A;  2F21 A;  2IF4 A;  2QF8 A;  3O5G A;  2G8Z A;  1HJV A;  4WKH A;  3GTY X;  4DRJ A;  4KR0 B;  2ZQU A;  1F8A B;  1X6N A;  1HKJ A;  1GPF A;  3B9A A;  3W4R A;  1EIB A;  3JYM A;  4MTV A;  1QPL A;  1ZK6 A;  3ALF A;  1WNO A;  4MAV A;  1E15 A;  3B9E A;  3ARZ A;  2LGO A;  1FKG A;  1ZBK A;  4ODK A;  2KI3 A;  4U84 A;  3ART A;  3KCE A;  4U86 A;  2IUZ A;  4JFK A;  2DG3 A;  2Y78 A;  1BKF A;  1D7I A;  1KFW A;  4DRQ A;  2AWG A;  5D75 A;  3AS2 A;  3PRD A;  4ODN A;  4R0X A;  4TW8 A;  1HKI A;  2XPB A;  2B31 A;  1T11 A;  2DSW A;  3WIJ A;  1ZCN A;  3ARR A;  2PN0 A;  4UDM A;  3O5D A;  4JFI A;  3O5O A;  2P4V A;  3CH9 A;  3UI5 A;  4N19 A;  4Q22 A;  2DSU A;  1E6R A;  1HXV A;  1E44 A;  1JNE A;  4DZ2 A;  1EDQ A;  1JNT A;  3OA5 A;  4MNM A;  1P5Q A;  1L1P A;  1FKS A;  4WJX A;  1HKK A;  2M1I A;  3FY1 A;  2XP8 A;  3AS3 A;  4J4O A;  1JVW A;  4L3N A;  4BF8 A;  3WD1 A;  4Z2L A;  1ROU A;  1NH6 A;  2RSE A;  3BXW A;  2WM0 A;  1FFR A;  2FDM A;  3FXY A;  1J4I A;  3LUO A;  4XAK A;  2G41 A;  5HUA A;  3TDB A;  1FFQ A;  1H0I A;  4TX0 A;  2PPO A;  4PTM A;  3ARO A;  1D6O A;  1FD9 A;  1YW5 A;  2YBT A;  1Y0O A;  2A3E A;  2ZR5 A;  2PV2 A;  2FAP A;  3IK8 A;  1B6C A;  1FKB A;  4MNJ A;  2PV1 A;  4DWS D;  1FKT A;  3WL1 A;  5HWC A;  4JFM A;  1QPF A;  4LAX A;  1J4R A;  3H9R B;  4DIP A;  2A3C A;  3O5L A;  1F40 A;  1FKK A;  5DIU A;  3RGC A;  3JXV A;  3JYJ A;  1IX5 A;  1XHG A;  3KAH A;  2ITK A;  4G2P A;  3ARS A;  2LJ4 A;  1W1T A;  4IT4 A;  3G6M A;  5HW6 A;  1LG1 A;  3O5R A;  3WD4 A;  1NWU A;  4DRH A;  4R5E A;  4DRP A;  4P8V A;  4FAP A;  1OGG A;  2ETN A;  3EY6 A;  4JYS A;  3RM8 A;  2DT1 A;  2ESC A;  2XP3 A;  2XPA A;  1UR8 A;  1SR0 A;  1NMV A;  4GGQ A;  4WK9 A;  3KAI A;  3KZ7 A;  5GQB A;  1ROT A;  1ZBV A;  4ZPT R;  2F23 A;  3B8S A;  4ZPW R;  4U85 A;  4ML4 A;  1FKD A;  3PA7 A;  4G50 A;  3WQW A;  4Z2I A;  4NZC A;  1PIN A;  3UQA A;  1FKR A;  1CTN A;  3RM4 A;  4ZPV R;  2DPE A;  5DIV A;  4ODM A;  4IQ2 A;  4P8X A;  3QOK A;  3TC5 A;  2XP5 A;  5HW7 A;  4C02 B;  4ZS6 A;  4JFL A;  1NWT A;  3UI6 A;  2DG9 A;  4DH0 A;  2PPN A;  4ODQ A;  4MNL A;  2JZV A;  2ZR4 A;  1XRV A;  4GIV A;  1GUV A;  1X6L A;  2OLH A;  3O5M A;  4Z2J A;  4J4N A;  1H0G A;  4HAR A;  4QT3 A;  1FKF A;  1GRJ A;  3ARW A;  5I98 A;  1JNS A;  1N1A A;  4ODO A;  1HKM A;  3CHE A;  1ZL1 A;  2XP7 A;  2MLX A;  4IQC A;  1KT0 A;  4MPK A;  3GU0 A;  3O5J A;  3O5Q A;  5GPG A;  3WD0 A;  3UQB A;  2RUQ A;  2RUD A;  4S3K A;  1D7J A;  1ITX A;  3CGN A;  1W9V A;  2B5U B;  3NTP A;  4FN2 A;  4QIB A;  2DT0 A;  4DRI A;  4DRO A;  3CHC A;  3ODK A;  1OWQ A;  2N87 A;  1Q6I A;  3O5F A;  4TW6 A;  1M5Y A;  1W1Y A;  2DG4 A;  4WIW A;  3O5E A;  3UQI A;  1EHN A;  4ODL A;  1QZ2 A;  1D2K A;  2MLZ A;  3ARQ A;  2MF9 A;  3GPK A;  2KFW A;  4ODR A;  4LAY A;  5JH8 A;  2D9F A;  5J6E A;  1W1V A;  3NRK A;  4HBE A;  4JFJ A;  2MNT A;  3ARP A;  1E6N A;  1VF8 A;  4ODP A;  2F2D A;  2A3A A;  1JND A;  5B8I C;  4DRN A;  4NSB A;  1E6Z A;  3KAG A;  1OGB A;  5DEZ A;  4QT2 A;  3B7X A;  3IKD A;  4Q7N A;  1LQ0 A;  3WH0 A;  5HBF A;  1NWS A;  3BMB A;  4W5U A;  3FAP A;  2WLZ A;  5HW8 A;  3VAW A;  1FKI A;  3PRA A;  4L72 B;  1PBK A;  2KGJ A;  3WD3 A;  1UR9 A;  1W26 A;  1HJW A;  3KAB A;  3KAF A;  3O5P A;  2DT2 A;  3OOB A;  2ZQS A;  1KT1 A;  2FKE A;  3KAC A;  4MSP A;  1J6Y A;  1W9P A;  1LL6 A;  3EIP A;  4WKF A;  2VN1 A;  3MDY B;  4W9Q A;  3AS0 A;  2EUL A;  4TNS A;  2M2A A;  4HBO A;  4P8U A;  3O5I A;  1FKJ A;  1LJY A;  1ZBC A;  4P8W A;  1EYM A;  2MPH A;  1GOI A;  4DWS B;  4Z2G A;  2K8I A;  1NWR A;  1Q1C A;  1K9T A;  3AQU A;  2DSZ A;  4NNR A;  3WD2 A;  1FKL A;  5HKG A;  4IT6 A;  1D7H A;  1NMW A;  2KR7 A;  5HWB A;  3O5K A;  4LAW A;  2A3B A;  1LL7 A;  2LKN A;  2RQS A;  4KQZ A;  3TCZ A;  1O6I A;  1TCO C;  2ZQT A;  1SYT A;  2ZR6 A;  1JCH B;  1ZU8 A;  3NI6 A;  1J4H A;  2WK2 A;  4Z2H A;  2YBU A;  2XP4 A;  5HT1 A;  1C9H A;  1NSG A;  3ALG A;  3I6C A;  1Q6H A;  3ARY A;  4ITZ A;  2PV3 A;  2PPP A;  2RUR A;  1W9U A;  2XP6 A;  4S3J A;  4W9P A;  3UF8 A;  4DZ3 A;  3B9D A;  3ARU A;  2KE0 A;  2ZQV A;  2XP9 A;  4IPX A;  3WQV A;  2PI6 A;  2AOS A;  4WKA A;  2O9O A;  1BL4 A;  1TFV A;  2PBC A;  2M08 A;  5DO2 A;  4MGV A;  4DRM A;  1LL4 A;  2LPV A;  3IKG A;  4LGX A;  2L2S A;  1ZB5 A;  1LG2 A;  4DT4 A;  2WLY A;  4QZV B;  3RM9 A;  4URI A;  4TW7 A;  1R9H A;  5BXJ A;  2UZ5 A;  3ARX A;  3PR9 A;  3CHD A;  3WKZ A;  3RME A;  3KAD A;  3G6L A;  1W1P A;  2RUC A;  3AS1 A;  1WB0 A;  1E6P A;  2DSV A;  1HJX A;  5HTG A;  2DT3 A;  3UI4 A;  4MNK A;  3WL0 A;  4LAV A;  2OFN A;  1FJD A; 
#chains in the Genus database with same CATH homology
 5DIT A;  1EQ3 A;  2O92 A;  2Q5A A;  3CGM A;  4O2T A;  1U79 A;  1ZBW A;  1FKH A;  4DWS C;  4TYO A;  4DWS A;  1RD6 A;  2VCD A;  3CZ8 A;  4AY1 A;  2MLY A;  1A7X A;  1YAT A;  4W9O A;  1FAP A;  5GPR A;  1Q6U A;  4DRK A;  1WAW A;  2KO7 A;  3ARV A;  3CHF A;  3PRB A;  5DF0 A;  3RFW A;  3IHZ A;  4Z2K A;  1E9L A;  2F4E A;  2F21 A;  2IF4 A;  2QF8 A;  3O5G A;  2G8Z A;  1HJV A;  4WKH A;  4DRJ A;  4KR0 B;  2ZQU A;  1F8A B;  1X6N A;  1HKJ A;  1GPF A;  3B9A A;  3W4R A;  1EIB A;  3JYM A;  4MTV A;  1QPL A;  1ZK6 A;  3ALF A;  1WNO A;  4MAV A;  1E15 A;  3B9E A;  3ARZ A;  2LGO A;  1FKG A;  1ZBK A;  4ODK A;  2KI3 A;  4U84 A;  3ART A;  3KCE A;  4U86 A;  2IUZ A;  4JFK A;  2DG3 A;  2Y78 A;  1BKF A;  1D7I A;  1KFW A;  4DRQ A;  2AWG A;  5D75 A;  3AS2 A;  3PRD A;  4ODN A;  4R0X A;  4TW8 A;  1HKI A;  2XPB A;  2B31 A;  1T11 A;  2DSW A;  3WIJ A;  1ZCN A;  3ARR A;  3O5D A;  4JFI A;  3O5O A;  3CH9 A;  3UI5 A;  4N19 A;  4Q22 A;  2DSU A;  1E6R A;  1HXV A;  1JNE A;  4DZ2 A;  1EDQ A;  1JNT A;  3OA5 A;  4MNM A;  1P5Q A;  1L1P A;  1FKS A;  4WJX A;  1HKK A;  2M1I A;  3FY1 A;  2XP8 A;  3AS3 A;  4J4O A;  1JVW A;  4L3N A;  4BF8 A;  3WD1 A;  4Z2L A;  1ROU A;  1NH6 A;  2RSE A;  3BXW A;  2WM0 A;  1FFR A;  2FDM A;  3FXY A;  1J4I A;  3LUO A;  4XAK A;  2G41 A;  5HUA A;  3TDB A;  1FFQ A;  1H0I A;  4TX0 A;  2PPO A;  4PTM A;  3ARO A;  1D6O A;  1FD9 A;  1YW5 A;  2YBT A;  1Y0O A;  2A3E A;  2ZR5 A;  2PV2 A;  2FAP A;  3IK8 A;  1B6C A;  1FKB A;  4MNJ A;  2PV1 A;  4DWS D;  1FKT A;  3WL1 A;  5HWC A;  4JFM A;  1QPF A;  4LAX A;  1J4R A;  3H9R B;  4DIP A;  2A3C A;  3O5L A;  1F40 A;  1FKK A;  5DIU A;  3RGC A;  3JXV A;  3JYJ A;  1IX5 A;  1XHG A;  3KAH A;  2ITK A;  4G2P A;  3ARS A;  2LJ4 A;  1W1T A;  4IT4 A;  3G6M A;  5HW6 A;  1LG1 A;  3O5R A;  3WD4 A;  1NWU A;  4DRH A;  4R5E A;  4DRP A;  4P8V A;  4FAP A;  1OGG A;  3EY6 A;  4JYS A;  3RM8 A;  2DT1 A;  2ESC A;  2XP3 A;  2XPA A;  1UR8 A;  1SR0 A;  1NMV A;  4GGQ A;  4WK9 A;  3KAI A;  3KZ7 A;  5GQB A;  1ROT A;  1ZBV A;  4ZPT R;  3B8S A;  4ZPW R;  4U85 A;  4ML4 A;  1FKD A;  3PA7 A;  4G50 A;  3WQW A;  4Z2I A;  4NZC A;  1PIN A;  3UQA A;  1FKR A;  1CTN A;  3RM4 A;  4ZPV R;  2DPE A;  5DIV A;  4ODM A;  4IQ2 A;  4P8X A;  3QOK A;  3TC5 A;  2XP5 A;  5HW7 A;  4C02 B;  4ZS6 A;  4JFL A;  1NWT A;  3UI6 A;  2DG9 A;  4DH0 A;  2PPN A;  4ODQ A;  4MNL A;  2JZV A;  2ZR4 A;  1XRV A;  4GIV A;  1GUV A;  1X6L A;  2OLH A;  3O5M A;  4Z2J A;  4J4N A;  1H0G A;  4HAR A;  4QT3 A;  1FKF A;  3ARW A;  5I98 A;  1JNS A;  1N1A A;  4ODO A;  1HKM A;  3CHE A;  1ZL1 A;  2XP7 A;  2MLX A;  4IQC A;  1KT0 A;  4MPK A;  3O5J A;  3O5Q A;  5GPG A;  3WD0 A;  3UQB A;  2RUQ A;  2RUD A;  4S3K A;  1D7J A;  1ITX A;  3CGN A;  1W9V A;  3NTP A;  4FN2 A;  4QIB A;  2DT0 A;  4DRI A;  4DRO A;  3CHC A;  3ODK A;  1OWQ A;  2N87 A;  1Q6I A;  3O5F A;  4TW6 A;  1M5Y A;  1W1Y A;  2DG4 A;  4WIW A;  3O5E A;  3UQI A;  1EHN A;  4ODL A;  1QZ2 A;  1D2K A;  2MLZ A;  3ARQ A;  2MF9 A;  3GPK A;  2KFW A;  4ODR A;  4LAY A;  5JH8 A;  2D9F A;  5J6E A;  1W1V A;  3NRK A;  4HBE A;  4JFJ A;  2MNT A;  3ARP A;  1E6N A;  1VF8 A;  4ODP A;  2F2D A;  2A3A A;  1JND A;  5B8I C;  4DRN A;  4NSB A;  1E6Z A;  3KAG A;  1OGB A;  5DEZ A;  4QT2 A;  3B7X A;  3IKD A;  4Q7N A;  1LQ0 A;  3WH0 A;  5HBF A;  1NWS A;  4W5U A;  3FAP A;  2WLZ A;  5HW8 A;  3VAW A;  1FKI A;  3PRA A;  4L72 B;  1PBK A;  2KGJ A;  3WD3 A;  1UR9 A;  1W26 A;  1HJW A;  3KAB A;  3KAF A;  3O5P A;  2DT2 A;  3OOB A;  2ZQS A;  1KT1 A;  2FKE A;  3KAC A;  4MSP A;  1J6Y A;  1W9P A;  1LL6 A;  4WKF A;  2VN1 A;  3MDY B;  4W9Q A;  3AS0 A;  4TNS A;  2M2A A;  4HBO A;  4P8U A;  3O5I A;  1FKJ A;  1LJY A;  1ZBC A;  4P8W A;  1EYM A;  2MPH A;  1GOI A;  4DWS B;  4Z2G A;  2K8I A;  1NWR A;  1Q1C A;  1K9T A;  3AQU A;  2DSZ A;  4NNR A;  3WD2 A;  1FKL A;  5HKG A;  4IT6 A;  1D7H A;  1NMW A;  2KR7 A;  5HWB A;  3O5K A;  4LAW A;  2A3B A;  1LL7 A;  2LKN A;  2RQS A;  4KQZ A;  3TCZ A;  1O6I A;  1TCO C;  2ZQT A;  1SYT A;  2ZR6 A;  1ZU8 A;  3NI6 A;  1J4H A;  2WK2 A;  4Z2H A;  2YBU A;  2XP4 A;  5HT1 A;  1C9H A;  1NSG A;  3ALG A;  3I6C A;  1Q6H A;  3ARY A;  4ITZ A;  2PV3 A;  2PPP A;  2RUR A;  1W9U A;  2XP6 A;  4S3J A;  4W9P A;  3UF8 A;  4DZ3 A;  3B9D A;  3ARU A;  2KE0 A;  2ZQV A;  2XP9 A;  4IPX A;  3WQV A;  2PI6 A;  2AOS A;  4WKA A;  2O9O A;  1BL4 A;  1TFV A;  2PBC A;  2M08 A;  5DO2 A;  4MGV A;  4DRM A;  1LL4 A;  2LPV A;  3IKG A;  4LGX A;  2L2S A;  1ZB5 A;  1LG2 A;  4DT4 A;  2WLY A;  4QZV B;  3RM9 A;  4URI A;  4TW7 A;  1R9H A;  5BXJ A;  2UZ5 A;  3ARX A;  3PR9 A;  3CHD A;  3WKZ A;  3RME A;  3KAD A;  3G6L A;  1W1P A;  2RUC A;  3AS1 A;  1WB0 A;  1E6P A;  2DSV A;  1HJX A;  5HTG A;  2DT3 A;  3UI4 A;  4MNK A;  3WL0 A;  4LAV A;  2OFN A;  1FJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...