4DH0A

X-ray crystal structure of 28-o-methylrapamycin complexed with fkbp12: is the cyclohexyl moiety part of the effector domain of rapamycin?
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/immunosuppressant
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
publication title X-ray Crystal Structure of 28-O-Methylrapamycin complexed with FKBP12: Is the Cyclohexyl Moiety Part of the Effector Domain of Rapamycin?
doi rcsb
source organism Homo sapiens
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dh0A00
1A7XA 2VN1A 2XPAA 1D7JA 4U84A 4DIPA 4DRNA 3MDYB 3UI5A 4QT3A 4DRIA 3KADA 2UZ5A 3IHZA 1Y0OA 2LKNA 4U85A 5HW7A 3CGNA 5J6EA 2N87A 4IQCA 4TW6A 3O5LA 4ODMA 4QIBA 4W9QA 4O2TA 1FKTA 3KAIA 4GIVA 4IPXA 4MGVA 1JNSA 4U86A 2XP7A 4DZ2A 3NI6A 3O5GA 4W9PA 1J4IA 1PINA 3O5IA 4NNRA 4ODPA 1QPFA 3TDBA 4DRJA 2RQSA 3NTPA 1FKHA 2RUQA 1W26A 3KABA 1C9HA 3O5DA 4MSPA 5HT1A 2MLYA 2F4EA 2ZQVA 1YW5A 4W9OA 2KE0A 3UF8A 1EQ3A 1Q6IA 4ODRA 5HTGA 4ODOA 1U79A 2L2SA 1FKRA 3ODKA 2DG9A 1J4RA 4IQ2A 5DIVA 2ZR4A 3O5KA 4TNSA 4TX0A 3O5RA 2LGOA 2XP8A 2F21A 5HW6A 4TW7A 2LPVA 2RUCA 1Q1CA 1Q6HA 2ZQSA 2LJ4A 1Q6UA 3JXVA 4DRQA 1L1PA 2D9FA 1ZK6A 4DRKA 2XP9A 2PPPA 4DRPA 5HKGA 1FAPA 1KT0A 4DRMA 3CGMA 4JYSA 5D75A 2ZQTA 2MNTA 2M2AA 2OFNA 4N19A 1J6YA 3IKGA 2Q5AA 4ITZA 2Y78A 3O5OA 4G50A 2MLXA 2ZR5A 1FKDA 1TCOC 4JFIA 3UQBA 1F8AB 2PV2A 4DROA 3KAFA 2MF9A 3RFWA 4C02B 5HWCA 2PBCA 1D7HA 1JNTA 4ODLA 1FKLA 3KACA 3I6CA 1M5YA 2FAPA 1YATA 2PV3A 1KT1A 2VCDA 2XP6A 3UQAA 1F40A 4FAPA 3KZ7A 1BL4A 3LUOA 3PA7A 5GPGA 1BKFA 2M1IA 4LAVA 2KR7A 3UI4A 2F2DA 5BXJA 3O5FA 2RUDA 4ODQA 1NSGA 2RSEA 1B6CA 4DZ3A 1FKGA 5HW8A 1NMWA 2K8IA 2FKEA 3B7XA 4JFKA 3EY6A 4G2PA 2IF4A 1PBKA 2KI3A 3O5QA 3TCZA 1FKSA 2ZR6A 4LAYA 4QT2A 3KAGA 1FKFA 1N1AA 3WH0A 1NMVA 3O5JA 3O5EA 3PRBA 4ODKA 4TYOA 5DIUA 5I98A 3JYMA 4TW8A 3UI6A 4DT4A 1FJDA 5HUAA 3VAWA 3NRKA 4JFMA 1FKIA 2KO7A 3FAPA 5B8IC 3PRDA 2MPHA 1T11A 3TC5A 2PPOA 4J4NA 3KCEA 1D6OA 1FKBA 4FN2A 4BF8A 1ROTA 3O5MA 1P5QA 1FKKA 3H9RB 2XP5A 2RURA 2JZVA 4DH0A 1D7IA 1R9HA 2XP4A 5HWBA 4JFLA 4ODNA 3RGCA 1FKJA 1JVWA 1QPLA 4R0XA 3IKDA 1HXVA 1QZ2A 2ITKA 4GGQA 3KAHA 2PV1A 3OOBA 2KGJA 5DITA 2ZQUA 1ROUA 4LAWA 3GPKA 3IK8A 2DG3A 2M08A 2XPBA 1FD9A 3JYJA 1EYMA 3UQIA 1ZCNA 2AWGA 4J4OA 2XP3A 2PPNA 2KFWA 2DG4A 3O5PA 4JFJA 4LAXA 4DRHA 1J4HA 2MLZA
chains in the Genus database with same CATH superfamily
4MNKA 1FFRA 2WLZA 3KADA 2F23A 4NZCA 3CGNA 4TW6A 1RD6A 1NWUA 3WD4A 4DZ2A 4NNRA 1QPFA 1XRVA 2G41A 3TDBA 4DRJA 1NWTA 1FKHA 2RUQA 3B8SA 4L72B 4P8VA 1VF8A 2QF8A 3BXWA 1Q6IA 1U79A 1GOIA 3O5KA 2P4VA 4TX0A 2AOSA 2LGOA 5HW6A 1LL6A 2LPVA 2RUCA 4DRQA 4Q7NA 1XHGA 1HKMA 2B31A 3ARYA 2XP9A 2PPPA 1KFWA 4Z2KA 1J6YA 3IKGA 3O5OA 2MLXA 2ZR5A 1FKDA 2PV2A 3RFWA 1E6RA 1JNTA 5DIVA 1YATA 1F40A 1KT1A 1ZBWA 4FAPA 3KZ7A 1TFVA 3PA7A 1ZBKA 1E9LA 1BKFA 4S3JA 4ODQA 2RUDA 5HW8A 5GPRA 3EY6A 2DT3A 4MAVA 1FKSA 4QT2A 3KAGA 1FKFA 3O5EA 4ODKA 5I98A 3JYMA 2PI6A 1EIBA 4TW8A 3VAWA 3CHCA 2ESCA 1JNEA 2PPOA 4P8UA 3KCEA 1FKBA 4FN2A 1ZBVA 3H9RB 3ARZA 1D7IA 2A3EA 4JFLA 1FKJA 1UR9A 3PR9A 1LQ0A 1QPLA 2DPEA 4ZPVR 4GGQA 3KAHA 3B9DA 1ZU8A 3OOBA 2KGJA 4PTMA 4LAWA 3IK8A 2DG3A 2AWGA 3RM8A 2DG4A 4JFJA 5GQBA 3AS2A 2VN1A 2XPAA 3RM9A 4DRNA 3GTYX 2LKNA 1WNOA 1X6NA 4IQCA 3CZ8A 4O2TA 1FKTA 4IT4A 4GIVA 1D2KA 3ARPA 3O5GA 3O5IA 4WK9A 3NTPA 3KABA 4KR0B 3O5DA 1JCHB 2F4EA 3AS1A 1K9TA 2KE0A 3UF8A 4IT6A 5HTGA 1NWSA 1J4RA 2DG9A 4IQ2A 4WIWA 4R5EA 2DSWA 1Q6HA 1Q6UA 3WD3A 3WL1A 1OGBA 5HKGA 1FAPA 2MNTA 3OA5A 5JH8A 2Q5AA 4G50A 1JNDA 2O9OA 1TCOC 4Z2LA 1F8AB 1W1TA 3AROA 1E6ZA 5DITA 1M5YA 2FAPA 2PV3A 2VCDA 1UR8A 2WM0A 3CHEA 2RSEA 4URIA 1FKGA 1NMWA 1ZB5A 2O92A 1NH6A 4G2PA 3EIPA 1PBKA 3O5QA 3CH9A 2EULA 1N1AA 1NMVA 5DIUA 4TYOA 3UI6A 4P8XA 4DT4A 5HUAA 1LL7A 1HKIA 2DT1A 1D6OA 4BF8A 1W9UA 4DWSD 2XP5A 2WK2A 2JZVA 2XP4A 3G6MA 4DWSC 1HXVA 2DSUA 3WD0A 2PV1A 2ZQUA 4Z2GA 3GPKA 1E44A 1LG1A 3B9EA 3JYJA 1EYMA 1ZCNA 2G8ZA 4J4OA 3WKZA 4Z2HA 1A7XA 1W1YA 1HKJA 4DIPA 1GUVA 3MDYB 2DSVA 3UI5A 2FDMA 4DRIA 4WJXA 2UZ5A 2OLHA 1Y0OA 5J6EA 4XAKA 4W5UA 3AS3A 3O5LA 4ODMA 3KAIA 4MGVA 4HBEA 1HJXA 4U86A 4W9PA 3WQWA 4DWSB 4MNJA 1EDQA 4MSPA 1NWRA 1YW5A 4W9OA 4ODRA 4ODOA 2L2SA 3ARTA 3WQVA 4TNSA 2XP8A 2F21A 4TW7A 1O6IA 1Q1CA 1L1PA 2D9FA 1ZK6A 4UDMA 1X6LA 4DRMA 3CGMA 4JYSA 2ZQTA 4ITZA 1HJWA 4MNMA 4ZS6A 4DWSA 2ETNA 4AY1A 3UQBA 2PN0A 2YBUA 4WKHA 1W1VA 5HBFA 4C02B 1E15A 4LGXA 1D7HA 1FFQA 4ODLA 1FKLA 4DH0A 4Q22A 3UQAA 4MNLA 1BL4A 1ITXA 1WAWA 2M1IA 4LAVA 3UI4A 5BXJA 4DZ3A 1NSGA 1SR0A 3RMEA 3B7XA 2IF4A 2KI3A 3ARXA 3TCZA 2ZR6A 3WH0A 4HBOA 3PRBA 1W1PA 5DEZA 2A3BA 3NRKA 1FKIA 2KO7A 3FAPA 5B8IC 4HARA 4MPKA 3TC5A 4J4NA 1LL4A 3O5MA 1P5QA 1HJVA 2RURA 1R9HA 3B9AA 4ZPWR 5HWBA 4ODNA 1H0IA 1LG2A 3ARSA 3AS0A 3RGCA 1WB0A 1JVWA 5DO2A 1H0GA 2ITKA 4WKAA 4MTVA 5DF0A 2XPBA 3RM4A 1W9PA 2XP3A 2PPNA 2KFWA 3O5PA 4DRHA 2A3AA 1D7JA 4U84A 3AQUA 4QT3A 1ZBCA 3IHZA 1W9VA 4U85A 5HW7A 2N87A 2IUZA 4QIBA 4W9QA 4ML4A 1EHNA 4IPXA 1JNSA 1CTNA 2XP7A 3NI6A 1J4IA 1PINA 3CHFA 4ODPA 1LJYA 3G6LA 4ZPTR 2RQSA 2WLYA 1FKRA 1W26A 1C9HA 5HT1A 2MLYA 2ZQVA 1EQ3A 3ALFA 3ARRA 3WIJA 3ODKA 2ZR4A 3O5RA 1E6PA 2DT0A 2ZQSA 2LJ4A 3JXVA 4DRKA 3GU0A 4DRPA 1KT0A 3ARVA 1GPFA 4Z2IA 5D75A 2M2AA 2OFNA 4N19A 4P8WA 1HKKA 4Z2JA 2Y78A 3ARQA 3ALGA 4JFIA 3CHDA 4DROA 4QZVB 3KAFA 2MF9A 5HWCA 2PBCA 3KACA 1GRJA 3ARUA 2XP6A 3I6CA 1IX5A 3FY1A 3LUOA 1SYTA 5GPGA 2B5UB 2KR7A 2F2DA 2DT2A 3FXYA 3WD2A 3O5FA 1B6CA 4S3KA 2K8IA 2FKEA 3WL0A 4JFKA 3QOKA 4LAYA 4KQZA 3O5JA 4WKFA 1FJDA 1ZL1A 1OGGA 4JFMA 3BMBA 3PRDA 2MPHA 1T11A 1ROTA 2YBTA 1FKKA 3PRAA 1E6NA 4R0XA 3IKDA 2DSZA 1QZ2A 4NSBA 2A3CA 1ROUA 3ARWA 2M08A 1FD9A 3W4RA 1OWQA 3UQIA 4LAXA 3WD1A 4L3NA 1J4HA 2MLZA
chains in the Genus database with same CATH topology
4MNKA 1FFRA 2WLZA 3KADA 4NZCA 3CGNA 4TW6A 1RD6A 1NWUA 3WD4A 4DZ2A 4NNRA 1QPFA 1XRVA 2G41A 3TDBA 4DRJA 1NWTA 1FKHA 2RUQA 3B8SA 4L72B 4P8VA 1VF8A 2QF8A 3BXWA 1Q6IA 1U79A 1GOIA 3O5KA 4TX0A 2AOSA 2LGOA 5HW6A 1LL6A 2LPVA 2RUCA 4DRQA 4Q7NA 1XHGA 1HKMA 2B31A 3ARYA 2XP9A 2PPPA 1KFWA 4Z2KA 1J6YA 3IKGA 3O5OA 2MLXA 2ZR5A 1FKDA 2PV2A 3RFWA 1E6RA 1JNTA 5DIVA 1YATA 1F40A 1KT1A 1ZBWA 4FAPA 3KZ7A 1TFVA 3PA7A 1ZBKA 1E9LA 1BKFA 4S3JA 4ODQA 2RUDA 5HW8A 5GPRA 3EY6A 2DT3A 4MAVA 1FKSA 4QT2A 3KAGA 1FKFA 3O5EA 4ODKA 5I98A 3JYMA 2PI6A 1EIBA 4TW8A 3VAWA 3CHCA 2ESCA 1JNEA 2PPOA 4P8UA 3KCEA 1FKBA 4FN2A 1ZBVA 3H9RB 3ARZA 1D7IA 2A3EA 4JFLA 1FKJA 1UR9A 3PR9A 1LQ0A 1QPLA 2DPEA 4ZPVR 4GGQA 3KAHA 3B9DA 1ZU8A 3OOBA 2KGJA 4PTMA 4LAWA 3IK8A 2DG3A 2AWGA 3RM8A 2DG4A 4JFJA 5GQBA 3AS2A 2VN1A 2XPAA 3RM9A 4DRNA 2LKNA 1WNOA 1X6NA 4IQCA 3CZ8A 4O2TA 1FKTA 4IT4A 4GIVA 1D2KA 3ARPA 3O5GA 3O5IA 4WK9A 3NTPA 3KABA 4KR0B 3O5DA 2F4EA 3AS1A 1K9TA 2KE0A 3UF8A 4IT6A 5HTGA 1NWSA 1J4RA 2DG9A 4IQ2A 4WIWA 4R5EA 2DSWA 1Q6HA 1Q6UA 3WD3A 3WL1A 1OGBA 5HKGA 1FAPA 2MNTA 3OA5A 5JH8A 2Q5AA 4G50A 1JNDA 2O9OA 1TCOC 4Z2LA 1F8AB 1W1TA 3AROA 1E6ZA 5DITA 1M5YA 2FAPA 2PV3A 2VCDA 1UR8A 2WM0A 3CHEA 2RSEA 4URIA 1FKGA 1NMWA 1ZB5A 2O92A 1NH6A 4G2PA 1PBKA 3O5QA 3CH9A 1N1AA 1NMVA 5DIUA 4TYOA 3UI6A 4P8XA 4DT4A 5HUAA 1LL7A 1HKIA 2DT1A 1D6OA 4BF8A 1W9UA 4DWSD 2XP5A 2WK2A 2JZVA 2XP4A 3G6MA 4DWSC 1HXVA 2DSUA 3WD0A 2PV1A 2ZQUA 4Z2GA 3GPKA 1LG1A 3B9EA 3JYJA 1EYMA 1ZCNA 2G8ZA 4J4OA 3WKZA 4Z2HA 1A7XA 1W1YA 1HKJA 4DIPA 1GUVA 3MDYB 2DSVA 3UI5A 2FDMA 4DRIA 4WJXA 2UZ5A 2OLHA 1Y0OA 5J6EA 4XAKA 4W5UA 3AS3A 3O5LA 4ODMA 3KAIA 4MGVA 4HBEA 1HJXA 4U86A 4W9PA 3WQWA 4DWSB 4MNJA 1EDQA 4MSPA 1NWRA 1YW5A 4W9OA 4ODRA 4ODOA 2L2SA 3ARTA 3WQVA 4TNSA 2XP8A 2F21A 4TW7A 1O6IA 1Q1CA 1L1PA 2D9FA 1ZK6A 1X6LA 4DRMA 3CGMA 4JYSA 2ZQTA 4ITZA 1HJWA 4MNMA 4ZS6A 4DWSA 4AY1A 3UQBA 2YBUA 4WKHA 1W1VA 5HBFA 4C02B 1E15A 4LGXA 1D7HA 1FFQA 4ODLA 1FKLA 4DH0A 4Q22A 3UQAA 4MNLA 1BL4A 1ITXA 1WAWA 2M1IA 4LAVA 3UI4A 5BXJA 4DZ3A 1NSGA 1SR0A 3RMEA 3B7XA 2IF4A 2KI3A 3ARXA 3TCZA 2ZR6A 3WH0A 4HBOA 3PRBA 1W1PA 5DEZA 2A3BA 3NRKA 1FKIA 2KO7A 3FAPA 5B8IC 4HARA 4MPKA 3TC5A 4J4NA 1LL4A 3O5MA 1P5QA 1HJVA 2RURA 1R9HA 3B9AA 4ZPWR 5HWBA 4ODNA 1H0IA 1LG2A 3ARSA 3AS0A 3RGCA 1WB0A 1JVWA 5DO2A 1H0GA 2ITKA 4WKAA 4MTVA 5DF0A 2XPBA 3RM4A 1W9PA 2XP3A 2PPNA 2KFWA 3O5PA 4DRHA 2A3AA 1D7JA 4U84A 3AQUA 4QT3A 1ZBCA 3IHZA 1W9VA 4U85A 5HW7A 2N87A 2IUZA 4QIBA 4W9QA 4ML4A 1EHNA 4IPXA 1JNSA 1CTNA 2XP7A 3NI6A 1J4IA 1PINA 3CHFA 4ODPA 1LJYA 3G6LA 4ZPTR 2RQSA 2WLYA 1FKRA 1W26A 1C9HA 5HT1A 2MLYA 2ZQVA 1EQ3A 3ALFA 3ARRA 3WIJA 3ODKA 2ZR4A 3O5RA 1E6PA 2DT0A 2ZQSA 2LJ4A 3JXVA 4DRKA 4DRPA 1KT0A 3ARVA 1GPFA 4Z2IA 5D75A 2M2AA 2OFNA 4N19A 4P8WA 1HKKA 4Z2JA 2Y78A 3ARQA 3ALGA 4JFIA 3CHDA 4DROA 4QZVB 3KAFA 2MF9A 5HWCA 2PBCA 3KACA 3ARUA 2XP6A 3I6CA 1IX5A 3FY1A 3LUOA 1SYTA 5GPGA 2KR7A 2F2DA 2DT2A 3FXYA 3WD2A 3O5FA 1B6CA 4S3KA 2K8IA 2FKEA 3WL0A 4JFKA 3QOKA 4LAYA 4KQZA 3O5JA 4WKFA 1FJDA 1ZL1A 1OGGA 4JFMA 3PRDA 2MPHA 1T11A 1ROTA 2YBTA 1FKKA 3PRAA 1E6NA 4R0XA 3IKDA 2DSZA 1QZ2A 4NSBA 2A3CA 1ROUA 3ARWA 2M08A 1FD9A 3W4RA 1OWQA 3UQIA 4LAXA 3WD1A 4L3NA 1J4HA 2MLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7X A;  2VN1 A;  2XPA A;  1D7J A;  4U84 A;  4DIP A;  4DRN A;  3MDY B;  3UI5 A;  4QT3 A;  4DRI A;  3KAD A;  2UZ5 A;  3IHZ A;  1Y0O A;  2LKN A;  4U85 A;  5HW7 A;  3CGN A;  5J6E A;  2N87 A;  4IQC A;  4TW6 A;  3O5L A;  4ODM A;  4QIB A;  4W9Q A;  4O2T A;  1FKT A;  3KAI A;  4GIV A;  4IPX A;  4MGV A;  1JNS A;  4U86 A;  2XP7 A;  4DZ2 A;  3NI6 A;  3O5G A;  4W9P A;  1J4I A;  1PIN A;  3O5I A;  4NNR A;  4ODP A;  1QPF A;  3TDB A;  4DRJ A;  2RQS A;  3NTP A;  1FKH A;  2RUQ A;  1W26 A;  3KAB A;  1C9H A;  3O5D A;  4MSP A;  5HT1 A;  2MLY A;  2F4E A;  2ZQV A;  1YW5 A;  4W9O A;  2KE0 A;  3UF8 A;  1EQ3 A;  1Q6I A;  4ODR A;  5HTG A;  4ODO A;  1U79 A;  2L2S A;  1FKR A;  3ODK A;  2DG9 A;  1J4R A;  4IQ2 A;  5DIV A;  2ZR4 A;  3O5K A;  4TNS A;  4TX0 A;  3O5R A;  2LGO A;  2XP8 A;  2F21 A;  5HW6 A;  4TW7 A;  2LPV A;  2RUC A;  1Q1C A;  1Q6H A;  2ZQS A;  2LJ4 A;  1Q6U A;  3JXV A;  4DRQ A;  1L1P A;  2D9F A;  1ZK6 A;  4DRK A;  2XP9 A;  2PPP A;  4DRP A;  5HKG A;  1FAP A;  1KT0 A;  4DRM A;  3CGM A;  4JYS A;  5D75 A;  2ZQT A;  2MNT A;  2M2A A;  2OFN A;  4N19 A;  1J6Y A;  3IKG A;  2Q5A A;  4ITZ A;  2Y78 A;  3O5O A;  4G50 A;  2MLX A;  2ZR5 A;  1FKD A;  1TCO C;  4JFI A;  3UQB A;  1F8A B;  2PV2 A;  4DRO A;  3KAF A;  2MF9 A;  3RFW A;  4C02 B;  5HWC A;  2PBC A;  1D7H A;  1JNT A;  4ODL A;  1FKL A;  3KAC A;  3I6C A;  1M5Y A;  2FAP A;  1YAT A;  2PV3 A;  1KT1 A;  2VCD A;  2XP6 A;  3UQA A;  1F40 A;  4FAP A;  3KZ7 A;  1BL4 A;  3LUO A;  3PA7 A;  5GPG A;  1BKF A;  2M1I A;  4LAV A;  2KR7 A;  3UI4 A;  2F2D A;  5BXJ A;  3O5F A;  2RUD A;  4ODQ A;  1NSG A;  2RSE A;  1B6C A;  4DZ3 A;  1FKG A;  5HW8 A;  1NMW A;  2K8I A;  2FKE A;  3B7X A;  4JFK A;  3EY6 A;  4G2P A;  2IF4 A;  1PBK A;  2KI3 A;  3O5Q A;  3TCZ A;  1FKS A;  2ZR6 A;  4LAY A;  4QT2 A;  3KAG A;  1FKF A;  1N1A A;  3WH0 A;  1NMV A;  3O5J A;  3O5E A;  3PRB A;  4ODK A;  4TYO A;  5DIU A;  5I98 A;  3JYM A;  4TW8 A;  3UI6 A;  4DT4 A;  1FJD A;  5HUA A;  3VAW A;  3NRK A;  4JFM A;  1FKI A;  2KO7 A;  3FAP A;  5B8I C;  3PRD A;  2MPH A;  1T11 A;  3TC5 A;  2PPO A;  4J4N A;  3KCE A;  1D6O A;  1FKB A;  4FN2 A;  4BF8 A;  1ROT A;  3O5M A;  1P5Q A;  1FKK A;  3H9R B;  2XP5 A;  2RUR A;  2JZV A;  4DH0 A;  1D7I A;  1R9H A;  2XP4 A;  5HWB A;  4JFL A;  4ODN A;  3RGC A;  1FKJ A;  1JVW A;  1QPL A;  4R0X A;  3IKD A;  1HXV A;  1QZ2 A;  2ITK A;  4GGQ A;  3KAH A;  2PV1 A;  3OOB A;  2KGJ A;  5DIT A;  2ZQU A;  1ROU A;  4LAW A;  3GPK A;  3IK8 A;  2DG3 A;  2M08 A;  2XPB A;  1FD9 A;  3JYJ A;  1EYM A;  3UQI A;  1ZCN A;  2AWG A;  4J4O A;  2XP3 A;  2PPN A;  2KFW A;  2DG4 A;  3O5P A;  4JFJ A;  4LAX A;  4DRH A;  1J4H A;  2MLZ A; 
#chains in the Genus database with same CATH topology
 4MNK A;  1FFR A;  2WLZ A;  3KAD A;  2F23 A;  4NZC A;  3CGN A;  4TW6 A;  1RD6 A;  1NWU A;  3WD4 A;  4DZ2 A;  4NNR A;  1QPF A;  1XRV A;  2G41 A;  3TDB A;  4DRJ A;  1NWT A;  1FKH A;  2RUQ A;  3B8S A;  4L72 B;  4P8V A;  1VF8 A;  2QF8 A;  3BXW A;  1Q6I A;  1U79 A;  1GOI A;  3O5K A;  2P4V A;  4TX0 A;  2AOS A;  2LGO A;  5HW6 A;  1LL6 A;  2LPV A;  2RUC A;  4DRQ A;  4Q7N A;  1XHG A;  1HKM A;  2B31 A;  3ARY A;  2XP9 A;  2PPP A;  1KFW A;  4Z2K A;  1J6Y A;  3IKG A;  3O5O A;  2MLX A;  2ZR5 A;  1FKD A;  2PV2 A;  3RFW A;  1E6R A;  1JNT A;  5DIV A;  1YAT A;  1F40 A;  1KT1 A;  1ZBW A;  4FAP A;  3KZ7 A;  1TFV A;  3PA7 A;  1ZBK A;  1E9L A;  1BKF A;  4S3J A;  4ODQ A;  2RUD A;  5HW8 A;  5GPR A;  3EY6 A;  2DT3 A;  4MAV A;  1FKS A;  4QT2 A;  3KAG A;  1FKF A;  3O5E A;  4ODK A;  5I98 A;  3JYM A;  2PI6 A;  1EIB A;  4TW8 A;  3VAW A;  3CHC A;  2ESC A;  1JNE A;  2PPO A;  4P8U A;  3KCE A;  1FKB A;  4FN2 A;  1ZBV A;  3H9R B;  3ARZ A;  1D7I A;  2A3E A;  4JFL A;  1FKJ A;  1UR9 A;  3PR9 A;  1LQ0 A;  1QPL A;  2DPE A;  4ZPV R;  4GGQ A;  3KAH A;  3B9D A;  1ZU8 A;  3OOB A;  2KGJ A;  4PTM A;  4LAW A;  3IK8 A;  2DG3 A;  2AWG A;  3RM8 A;  2DG4 A;  4JFJ A;  5GQB A;  3AS2 A;  2VN1 A;  2XPA A;  3RM9 A;  4DRN A;  3GTY X;  2LKN A;  1WNO A;  1X6N A;  4IQC A;  3CZ8 A;  4O2T A;  1FKT A;  4IT4 A;  4GIV A;  1D2K A;  3ARP A;  3O5G A;  3O5I A;  4WK9 A;  3NTP A;  3KAB A;  4KR0 B;  3O5D A;  1JCH B;  2F4E A;  3AS1 A;  1K9T A;  2KE0 A;  3UF8 A;  4IT6 A;  5HTG A;  1NWS A;  1J4R A;  2DG9 A;  4IQ2 A;  4WIW A;  4R5E A;  2DSW A;  1Q6H A;  1Q6U A;  3WD3 A;  3WL1 A;  1OGB A;  5HKG A;  1FAP A;  2MNT A;  3OA5 A;  5JH8 A;  2Q5A A;  4G50 A;  1JND A;  2O9O A;  1TCO C;  4Z2L A;  1F8A B;  1W1T A;  3ARO A;  1E6Z A;  5DIT A;  1M5Y A;  2FAP A;  2PV3 A;  2VCD A;  1UR8 A;  2WM0 A;  3CHE A;  2RSE A;  4URI A;  1FKG A;  1NMW A;  1ZB5 A;  2O92 A;  1NH6 A;  4G2P A;  3EIP A;  1PBK A;  3O5Q A;  3CH9 A;  2EUL A;  1N1A A;  1NMV A;  5DIU A;  4TYO A;  3UI6 A;  4P8X A;  4DT4 A;  5HUA A;  1LL7 A;  1HKI A;  2DT1 A;  1D6O A;  4BF8 A;  1W9U A;  4DWS D;  2XP5 A;  2WK2 A;  2JZV A;  2XP4 A;  3G6M A;  4DWS C;  1HXV A;  2DSU A;  3WD0 A;  2PV1 A;  2ZQU A;  4Z2G A;  3GPK A;  1E44 A;  1LG1 A;  3B9E A;  3JYJ A;  1EYM A;  1ZCN A;  2G8Z A;  4J4O A;  3WKZ A;  4Z2H A;  1A7X A;  1W1Y A;  1HKJ A;  4DIP A;  1GUV A;  3MDY B;  2DSV A;  3UI5 A;  2FDM A;  4DRI A;  4WJX A;  2UZ5 A;  2OLH A;  1Y0O A;  5J6E A;  4XAK A;  4W5U A;  3AS3 A;  3O5L A;  4ODM A;  3KAI A;  4MGV A;  4HBE A;  1HJX A;  4U86 A;  4W9P A;  3WQW A;  4DWS B;  4MNJ A;  1EDQ A;  4MSP A;  1NWR A;  1YW5 A;  4W9O A;  4ODR A;  4ODO A;  2L2S A;  3ART A;  3WQV A;  4TNS A;  2XP8 A;  2F21 A;  4TW7 A;  1O6I A;  1Q1C A;  1L1P A;  2D9F A;  1ZK6 A;  4UDM A;  1X6L A;  4DRM A;  3CGM A;  4JYS A;  2ZQT A;  4ITZ A;  1HJW A;  4MNM A;  4ZS6 A;  4DWS A;  2ETN A;  4AY1 A;  3UQB A;  2PN0 A;  2YBU A;  4WKH A;  1W1V A;  5HBF A;  4C02 B;  1E15 A;  4LGX A;  1D7H A;  1FFQ A;  4ODL A;  1FKL A;  4DH0 A;  4Q22 A;  3UQA A;  4MNL A;  1BL4 A;  1ITX A;  1WAW A;  2M1I A;  4LAV A;  3UI4 A;  5BXJ A;  4DZ3 A;  1NSG A;  1SR0 A;  3RME A;  3B7X A;  2IF4 A;  2KI3 A;  3ARX A;  3TCZ A;  2ZR6 A;  3WH0 A;  4HBO A;  3PRB A;  1W1P A;  5DEZ A;  2A3B A;  3NRK A;  1FKI A;  2KO7 A;  3FAP A;  5B8I C;  4HAR A;  4MPK A;  3TC5 A;  4J4N A;  1LL4 A;  3O5M A;  1P5Q A;  1HJV A;  2RUR A;  1R9H A;  3B9A A;  4ZPW R;  5HWB A;  4ODN A;  1H0I A;  1LG2 A;  3ARS A;  3AS0 A;  3RGC A;  1WB0 A;  1JVW A;  5DO2 A;  1H0G A;  2ITK A;  4WKA A;  4MTV A;  5DF0 A;  2XPB A;  3RM4 A;  1W9P A;  2XP3 A;  2PPN A;  2KFW A;  3O5P A;  4DRH A;  2A3A A;  1D7J A;  4U84 A;  3AQU A;  4QT3 A;  1ZBC A;  3IHZ A;  1W9V A;  4U85 A;  5HW7 A;  2N87 A;  2IUZ A;  4QIB A;  4W9Q A;  4ML4 A;  1EHN A;  4IPX A;  1JNS A;  1CTN A;  2XP7 A;  3NI6 A;  1J4I A;  1PIN A;  3CHF A;  4ODP A;  1LJY A;  3G6L A;  4ZPT R;  2RQS A;  2WLY A;  1FKR A;  1W26 A;  1C9H A;  5HT1 A;  2MLY A;  2ZQV A;  1EQ3 A;  3ALF A;  3ARR A;  3WIJ A;  3ODK A;  2ZR4 A;  3O5R A;  1E6P A;  2DT0 A;  2ZQS A;  2LJ4 A;  3JXV A;  4DRK A;  3GU0 A;  4DRP A;  1KT0 A;  3ARV A;  1GPF A;  4Z2I A;  5D75 A;  2M2A A;  2OFN A;  4N19 A;  4P8W A;  1HKK A;  4Z2J A;  2Y78 A;  3ARQ A;  3ALG A;  4JFI A;  3CHD A;  4DRO A;  4QZV B;  3KAF A;  2MF9 A;  5HWC A;  2PBC A;  3KAC A;  1GRJ A;  3ARU A;  2XP6 A;  3I6C A;  1IX5 A;  3FY1 A;  3LUO A;  1SYT A;  5GPG A;  2B5U B;  2KR7 A;  2F2D A;  2DT2 A;  3FXY A;  3WD2 A;  3O5F A;  1B6C A;  4S3K A;  2K8I A;  2FKE A;  3WL0 A;  4JFK A;  3QOK A;  4LAY A;  4KQZ A;  3O5J A;  4WKF A;  1FJD A;  1ZL1 A;  1OGG A;  4JFM A;  3BMB A;  3PRD A;  2MPH A;  1T11 A;  1ROT A;  2YBT A;  1FKK A;  3PRA A;  1E6N A;  4R0X A;  3IKD A;  2DSZ A;  1QZ2 A;  4NSB A;  2A3C A;  1ROU A;  3ARW A;  2M08 A;  1FD9 A;  3W4R A;  1OWQ A;  3UQI A;  4LAX A;  3WD1 A;  4L3N A;  1J4H A;  2MLZ A; 
#chains in the Genus database with same CATH homology
 4MNK A;  1FFR A;  2WLZ A;  3KAD A;  4NZC A;  3CGN A;  4TW6 A;  1RD6 A;  1NWU A;  3WD4 A;  4DZ2 A;  4NNR A;  1QPF A;  1XRV A;  2G41 A;  3TDB A;  4DRJ A;  1NWT A;  1FKH A;  2RUQ A;  3B8S A;  4L72 B;  4P8V A;  1VF8 A;  2QF8 A;  3BXW A;  1Q6I A;  1U79 A;  1GOI A;  3O5K A;  4TX0 A;  2AOS A;  2LGO A;  5HW6 A;  1LL6 A;  2LPV A;  2RUC A;  4DRQ A;  4Q7N A;  1XHG A;  1HKM A;  2B31 A;  3ARY A;  2XP9 A;  2PPP A;  1KFW A;  4Z2K A;  1J6Y A;  3IKG A;  3O5O A;  2MLX A;  2ZR5 A;  1FKD A;  2PV2 A;  3RFW A;  1E6R A;  1JNT A;  5DIV A;  1YAT A;  1F40 A;  1KT1 A;  1ZBW A;  4FAP A;  3KZ7 A;  1TFV A;  3PA7 A;  1ZBK A;  1E9L A;  1BKF A;  4S3J A;  4ODQ A;  2RUD A;  5HW8 A;  5GPR A;  3EY6 A;  2DT3 A;  4MAV A;  1FKS A;  4QT2 A;  3KAG A;  1FKF A;  3O5E A;  4ODK A;  5I98 A;  3JYM A;  2PI6 A;  1EIB A;  4TW8 A;  3VAW A;  3CHC A;  2ESC A;  1JNE A;  2PPO A;  4P8U A;  3KCE A;  1FKB A;  4FN2 A;  1ZBV A;  3H9R B;  3ARZ A;  1D7I A;  2A3E A;  4JFL A;  1FKJ A;  1UR9 A;  3PR9 A;  1LQ0 A;  1QPL A;  2DPE A;  4ZPV R;  4GGQ A;  3KAH A;  3B9D A;  1ZU8 A;  3OOB A;  2KGJ A;  4PTM A;  4LAW A;  3IK8 A;  2DG3 A;  2AWG A;  3RM8 A;  2DG4 A;  4JFJ A;  5GQB A;  3AS2 A;  2VN1 A;  2XPA A;  3RM9 A;  4DRN A;  2LKN A;  1WNO A;  1X6N A;  4IQC A;  3CZ8 A;  4O2T A;  1FKT A;  4IT4 A;  4GIV A;  1D2K A;  3ARP A;  3O5G A;  3O5I A;  4WK9 A;  3NTP A;  3KAB A;  4KR0 B;  3O5D A;  2F4E A;  3AS1 A;  1K9T A;  2KE0 A;  3UF8 A;  4IT6 A;  5HTG A;  1NWS A;  1J4R A;  2DG9 A;  4IQ2 A;  4WIW A;  4R5E A;  2DSW A;  1Q6H A;  1Q6U A;  3WD3 A;  3WL1 A;  1OGB A;  5HKG A;  1FAP A;  2MNT A;  3OA5 A;  5JH8 A;  2Q5A A;  4G50 A;  1JND A;  2O9O A;  1TCO C;  4Z2L A;  1F8A B;  1W1T A;  3ARO A;  1E6Z A;  5DIT A;  1M5Y A;  2FAP A;  2PV3 A;  2VCD A;  1UR8 A;  2WM0 A;  3CHE A;  2RSE A;  4URI A;  1FKG A;  1NMW A;  1ZB5 A;  2O92 A;  1NH6 A;  4G2P A;  1PBK A;  3O5Q A;  3CH9 A;  1N1A A;  1NMV A;  5DIU A;  4TYO A;  3UI6 A;  4P8X A;  4DT4 A;  5HUA A;  1LL7 A;  1HKI A;  2DT1 A;  1D6O A;  4BF8 A;  1W9U A;  4DWS D;  2XP5 A;  2WK2 A;  2JZV A;  2XP4 A;  3G6M A;  4DWS C;  1HXV A;  2DSU A;  3WD0 A;  2PV1 A;  2ZQU A;  4Z2G A;  3GPK A;  1LG1 A;  3B9E A;  3JYJ A;  1EYM A;  1ZCN A;  2G8Z A;  4J4O A;  3WKZ A;  4Z2H A;  1A7X A;  1W1Y A;  1HKJ A;  4DIP A;  1GUV A;  3MDY B;  2DSV A;  3UI5 A;  2FDM A;  4DRI A;  4WJX A;  2UZ5 A;  2OLH A;  1Y0O A;  5J6E A;  4XAK A;  4W5U A;  3AS3 A;  3O5L A;  4ODM A;  3KAI A;  4MGV A;  4HBE A;  1HJX A;  4U86 A;  4W9P A;  3WQW A;  4DWS B;  4MNJ A;  1EDQ A;  4MSP A;  1NWR A;  1YW5 A;  4W9O A;  4ODR A;  4ODO A;  2L2S A;  3ART A;  3WQV A;  4TNS A;  2XP8 A;  2F21 A;  4TW7 A;  1O6I A;  1Q1C A;  1L1P A;  2D9F A;  1ZK6 A;  1X6L A;  4DRM A;  3CGM A;  4JYS A;  2ZQT A;  4ITZ A;  1HJW A;  4MNM A;  4ZS6 A;  4DWS A;  4AY1 A;  3UQB A;  2YBU A;  4WKH A;  1W1V A;  5HBF A;  4C02 B;  1E15 A;  4LGX A;  1D7H A;  1FFQ A;  4ODL A;  1FKL A;  4DH0 A;  4Q22 A;  3UQA A;  4MNL A;  1BL4 A;  1ITX A;  1WAW A;  2M1I A;  4LAV A;  3UI4 A;  5BXJ A;  4DZ3 A;  1NSG A;  1SR0 A;  3RME A;  3B7X A;  2IF4 A;  2KI3 A;  3ARX A;  3TCZ A;  2ZR6 A;  3WH0 A;  4HBO A;  3PRB A;  1W1P A;  5DEZ A;  2A3B A;  3NRK A;  1FKI A;  2KO7 A;  3FAP A;  5B8I C;  4HAR A;  4MPK A;  3TC5 A;  4J4N A;  1LL4 A;  3O5M A;  1P5Q A;  1HJV A;  2RUR A;  1R9H A;  3B9A A;  4ZPW R;  5HWB A;  4ODN A;  1H0I A;  1LG2 A;  3ARS A;  3AS0 A;  3RGC A;  1WB0 A;  1JVW A;  5DO2 A;  1H0G A;  2ITK A;  4WKA A;  4MTV A;  5DF0 A;  2XPB A;  3RM4 A;  1W9P A;  2XP3 A;  2PPN A;  2KFW A;  3O5P A;  4DRH A;  2A3A A;  1D7J A;  4U84 A;  3AQU A;  4QT3 A;  1ZBC A;  3IHZ A;  1W9V A;  4U85 A;  5HW7 A;  2N87 A;  2IUZ A;  4QIB A;  4W9Q A;  4ML4 A;  1EHN A;  4IPX A;  1JNS A;  1CTN A;  2XP7 A;  3NI6 A;  1J4I A;  1PIN A;  3CHF A;  4ODP A;  1LJY A;  3G6L A;  4ZPT R;  2RQS A;  2WLY A;  1FKR A;  1W26 A;  1C9H A;  5HT1 A;  2MLY A;  2ZQV A;  1EQ3 A;  3ALF A;  3ARR A;  3WIJ A;  3ODK A;  2ZR4 A;  3O5R A;  1E6P A;  2DT0 A;  2ZQS A;  2LJ4 A;  3JXV A;  4DRK A;  4DRP A;  1KT0 A;  3ARV A;  1GPF A;  4Z2I A;  5D75 A;  2M2A A;  2OFN A;  4N19 A;  4P8W A;  1HKK A;  4Z2J A;  2Y78 A;  3ARQ A;  3ALG A;  4JFI A;  3CHD A;  4DRO A;  4QZV B;  3KAF A;  2MF9 A;  5HWC A;  2PBC A;  3KAC A;  3ARU A;  2XP6 A;  3I6C A;  1IX5 A;  3FY1 A;  3LUO A;  1SYT A;  5GPG A;  2KR7 A;  2F2D A;  2DT2 A;  3FXY A;  3WD2 A;  3O5F A;  1B6C A;  4S3K A;  2K8I A;  2FKE A;  3WL0 A;  4JFK A;  3QOK A;  4LAY A;  4KQZ A;  3O5J A;  4WKF A;  1FJD A;  1ZL1 A;  1OGG A;  4JFM A;  3PRD A;  2MPH A;  1T11 A;  1ROT A;  2YBT A;  1FKK A;  3PRA A;  1E6N A;  4R0X A;  3IKD A;  2DSZ A;  1QZ2 A;  4NSB A;  2A3C A;  1ROU A;  3ARW A;  2M08 A;  1FD9 A;  3W4R A;  1OWQ A;  3UQI A;  4LAX A;  3WD1 A;  4L3N A;  1J4H A;  2MLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...