4DRHA

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor at low ph
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
NNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 132
sequence length 132
chains with identical sequence D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drhA00
4J4NA 1FKFA 2F2DA 2FAPA 2LKNA 2LGOA 1PBKA 4LAWA 4ODLA 3EY6A 4JFMA 1B6CA 4BF8A 1L1PA 1QZ2A 3FAPA 3KAHA 2Y78A 3CGMA 1F8AB 4DZ2A 3IKDA 2XP4A 4MSPA 3UI6A 2RURA 2MPHA 2M1IA 3O5OA 3TC5A 1NMWA 4ODKA 4QT3A 1JVWA 4DRQA 1FJDA 3IK8A 3TCZA 4DT4A 3CGNA 2IF4A 1QPLA 3GPKA 4TX0A 1ROTA 1FKLA 4DIPA 1Q6IA 2RUDA 2PV2A 1FKIA 2UZ5A 3KAIA 4GGQA 2Q5AA 2M2AA 5HWBA 3IKGA 2DG9A 2L2SA 1KT1A 3B7XA 3KCEA 3O5KA 3TDBA 3UI4A 1Y0OA 1D7JA 2PPOA 2M08A 2XP9A 1TCOC 3KABA 1ZCNA 1J4HA 1R9HA 1J4RA 1FD9A 1EYMA 1P5QA 1ZK6A 2ZQVA 2ZR5A 4QIBA 3WH0A 2PPNA 3PRBA 1YATA 3O5LA 4IQCA 2XP7A 4W9PA 2KO7A 5HW7A 2ZQSA 2PV1A 4IPXA 2RQSA 1M5YA 1U79A 3UQIA 4DRMA 3I6CA 3O5PA 3UQBA 4DRKA 1FKBA 1FKDA 3KZ7A 4U86A 2XP5A 1QPFA 4FN2A 3O5RA 3JYJA 4W9QA 1KT0A 2JZVA 1D6OA 1FAPA 4G50A 1BL4A 2DG3A 2KI3A 2RUCA 4ODMA 4N19A 1FKHA 1JNTA 2F21A 2ZR6A 3LUOA 4O2TA 1D7IA 4ODNA 4C02B 4ITZA 5I98A 1EQ3A 1T11A 3O5FA 3UI5A 4DRPA 2MLZA 3NRKA 2FKEA 4ODOA 1FKJA 3KACA 2MNTA 3H9RB 2PPPA 1BKFA 4G2PA 4JFJA 1FKKA 4JYSA 3JYMA 4DRHA 1FKTA 4W9OA 5HUAA 3KAFA 5B8IC 2RUQA 2PBCA 3O5IA 4R0XA 2N87A 2XPBA 4GIVA 3UQAA 3O5DA 5D75A 2KR7A 1D7HA 3MDYB 1Q1CA 4U84A 5HW6A 4MGVA 4JFIA 4DROA 1HXVA 1FKSA 2RSEA 3O5GA 4ODQA 4TW8A 4J4OA 4LAYA 5DIUA 5HW8A 1JNSA 2LJ4A 2VN1A 3KADA 3VAWA 1F40A 3O5JA 2OFNA 2KGJA 1FKGA 2MLXA 3O5EA 3PRDA 1W26A 2VCDA 5HT1A 2XP6A 3IHZA 3RGCA 4JFKA 3NI6A 2XP3A 3O5MA 4ODPA 4TW6A 3ODKA 4DZ3A 2ZR4A 1N1AA 5HWCA 1Q6HA 4ODRA 5DIVA 2LPVA 4DRNA 1C9HA 2F4EA 3PA7A 4JFLA 2D9FA 2PV3A 4QT2A 2MLYA 4LAVA 3JXVA 3O5QA 2AWGA 4U85A 3UF8A 5HKGA 5J6EA 1A7XA 1NMVA 4NNRA 1J6YA 2ZQTA 3KAGA 5BXJA 2K8IA 2KFWA 1ROUA 4LAXA 1FKRA 1J4IA 2XPAA 2KE0A 4DRIA 1Q6UA 4IQ2A 1PINA 2XP8A 3NTPA 2DG4A 4FAPA 4TNSA 2MF9A 3RFWA 4DH0A 5DITA 2ITKA 2ZQUA 5HTGA 4TYOA 3OOBA 5GPGA 1NSGA 4TW7A 4DRJA 1YW5A
chains in the Genus database with same CATH superfamily
2FAPA 1K9TA 3EY6A 4BF8A 1HKMA 3FAPA 4DZ2A 3IKDA 4MSPA 4P8WA 2RURA 2M1IA 3O5OA 4ODKA 3ARWA 4QT3A 4DRQA 1ZBVA 3TCZA 4DT4A 3CGNA 2IF4A 1W1TA 1WB0A 4XAKA 4DIPA 2DSVA 3KAIA 2L2SA 1KT1A 4Q22A 3ARYA 4MNMA 1GUVA 3KABA 1J4HA 1LG1A 4QIBA 5DO2A 4WKAA 3B9AA 3O5LA 4IQCA 4W9PA 1EIBA 2KO7A 4IT6A 1HJVA 1ZU8A 2PV1A 1WNOA 1W1PA 1FKBA 1FKDA 4L3NA 3JYJA 3B9DA 2DG3A 4ODMA 1JNTA 2F21A 2ZR6A 3RM4A 2WK2A 4HBOA 2O9OA 1EQ3A 1GPFA 3NRKA 4ZPWR 3KACA 3JYMA 1FKTA 5HUAA 2QF8A 3WD1A 5B8IC 1GOIA 2DPEA 2N87A 4R0XA 3UQAA 3O5DA 1D7HA 1EDQA 1Q1CA 1SYTA 3AS0A 4MGVA 4URIA 1H0IA 2RSEA 3O5GA 1OWQA 2LJ4A 3KADA 3WD0A 3O5JA 2B5UB 1E6PA 1UR8A 2VCDA 3G6MA 4P8XA 3IHZA 4WIWA 1KFWA 4ZS6A 4DZ3A 4Z2HA 1N1AA 3PA7A 1WAWA 3PRAA 4QT2A 2MLYA 3O5QA 5J6EA 1A7XA 3RM8A 1E6NA 3WIJA 1E44A 3AS1A 2A3BA 1FKRA 4NSBA 1J4IA 1PINA 2XP8A 2AOSA 3NTPA 2DG4A 2MF9A 2ITKA 3AS3A 3BXWA 1TFVA 4DRPA 3GTYX 4DWSA 4IT4A 2F2DA 4ODLA 2A3EA 2WLYA 3KAHA 2Y78A 3CGMA 4QZVB 2IUZA 1NMWA 3IK8A 1NWTA 2F23A 1FFQA 4TX0A 3WD4A 3CH9A 2RUDA 4WKHA 4HBEA 1FKIA 1HKKA 2WLZA 3UI4A 2DG9A 3WL0A 3KCEA 1LQ0A 1ZCNA 3ARXA 1NWSA 1P5QA 1R9HA 2ZQVA 3OA5A 1YATA 1ITXA 3AROA 4R5EA 1M5YA 1W1YA 2DT0A 4DRKA 2XP5A 4W9QA 2DT1A 4MAVA 5JH8A 1BL4A 3AS2A 4N19A 4S3JA 4ITZA 5I98A 1T11A 1HKIA 4ODOA 2FKEA 2MNTA 2PPPA 3CHDA 1FKKA 1HJWA 4JYSA 1ZBWA 2PI6A 4AY1A 2PBCA 2XPBA 2O92A 1LL6A 3MDYB 4U84A 5HW6A 1XHGA 1E15A 1ZL1A 4JFIA 1FKSA 1NH6A 4ODQA 2OFNA 1D2KA 1W9UA 2B31A 4UDMA 1W26A 5HT1A 2XP6A 2XP3A 3ODKA 4ODRA 2PN0A 1C9HA 2F4EA 4JFLA 2DSUA 1LG2A 4LAVA 3RMEA 1NWRA 5HKGA 3WD3A 4NNRA 2ZQTA 3KAGA 1X6LA 2KFWA 3CHEA 4LAXA 2XPAA 2KE0A 1Q6UA 4DWSD 4MTVA 5DEZA 1NSGA 4WK9A 4HARA 5HBFA 2P4VA 4J4NA 1FKFA 3ARSA 2LGOA 3WL1A 4JFMA 1B6CA 2A3AA 3PR9A 1F8AB 2XP4A 3UI6A 3TC5A 1NWUA 2DT2A 1FJDA 1QPLA 1E6ZA 3GPKA 4P8VA 1ROTA 1FKLA 3ALGA 1Q6IA 1E6RA 4DWSC 2UZ5A 5GQBA 3WKZA 1O6IA 3ARPA 3IKGA 5HWBA 2A3CA 1D7JA 2XP9A 1TCOC 4P8UA 3WQVA 3QOKA 1FD9A 3WH0A 3ARTA 1JNEA 3PRBA 4WKFA 2XP7A 5HW7A 2ZQSA 4MNKA 4IPXA 1W9PA 3ARUA 1U79A 4DRMA 3I6CA 3O5PA 1KT0A 2JZVA 1JCHB 1SR0A 4G50A 4W5UA 1GRJA 4O2TA 1LJYA 1D7IA 4C02B 4WJXA 3ARQA 3RM9A 3H9RB 4ZPVR 4G2PA 4JFJA 1IX5A 2DT3A 4DRHA 4W9OA 2RUQA 4Q7NA 4Z2KA 3O5IA 4GIVA 2G8ZA 3ARVA 5D75A 2ETNA 1OGGA 4Z2GA 1OGBA 4J4OA 4LAYA 1JNSA 3O5EA 3RGCA 4JFKA 2EULA 4ODPA 4TW6A 4Z2IA 3BMBA 5HWCA 1Q6HA 3EIPA 2D9FA 2PV3A 3JXVA 4DWSB 2YBTA 3CHCA 4FAPA 3AQUA 4TNSA 3RFWA 3W4RA 4DH0A 3G6LA 2ZQUA 5HTGA 4TYOA 3OOBA 5GPGA 1ZB5A 3CHFA 4DRJA 1L1PA 2YBUA 5GPRA 2LKNA 1PBKA 4LAWA 4MNJA 1QZ2A 4MPKA 2MPHA 2WM0A 1JVWA 4Z2LA 1VF8A 4LGXA 1UR9A 2PV2A 4GGQA 3WD2A 2Q5AA 2M2AA 3O5KA 3B7XA 3TDBA 1Y0OA 2PPOA 3B9EA 2M08A 4L72B 1J4RA 1EYMA 1XRVA 1ZK6A 2ZR5A 2PPNA 3ALFA 4KR0B 2G41A 2OLHA 3FXYA 2RQSA 3UQIA 1LL7A 2DSWA 3UQBA 3KZ7A 4U86A 4FN2A 1QPFA 3O5RA 4NZCA 3ARRA 1D6OA 1FAPA 1E9LA 2KI3A 2RUCA 3FY1A 1FKHA 1HKJA 1ZBCA 1H0GA 3LUOA 1ZBKA 4ODNA 3ARZA 3O5FA 3UI5A 2MLZA 2FDMA 1FKJA 1BKFA 1W1VA 3KAFA 1JNDA 5DF0A 4ML4A 2DSZA 2KR7A 4S3KA 1EHNA 3B8SA 3CZ8A 4DROA 1HXVA 4TW8A 5DIUA 5HW8A 1F40A 2VN1A 3VAWA 2KGJA 1FKGA 2MLXA 3PRDA 1FFRA 1W9VA 4Z2JA 3NI6A 3O5MA 1X6NA 2ZR4A 5DIVA 1RD6A 2LPVA 4DRNA 1CTNA 4U85A 3UF8A 2AWGA 1LL4A 1NMVA 1J6YA 5BXJA 3GU0A 2K8IA 4KQZA 1ROUA 4ZPTR 4DRIA 4IQ2A 5DITA 1HJXA 2ESCA 3WQWA 4PTMA 4TW7A 1YW5A 4MNLA
chains in the Genus database with same CATH topology
2FAPA 1K9TA 3EY6A 4BF8A 1HKMA 3FAPA 4DZ2A 3IKDA 4MSPA 4P8WA 2RURA 2M1IA 3O5OA 4ODKA 3ARWA 4QT3A 4DRQA 1ZBVA 3TCZA 4DT4A 3CGNA 2IF4A 1W1TA 1WB0A 4XAKA 4DIPA 2DSVA 3KAIA 2L2SA 1KT1A 4Q22A 3ARYA 4MNMA 1GUVA 3KABA 1J4HA 1LG1A 4QIBA 5DO2A 4WKAA 3B9AA 3O5LA 4IQCA 4W9PA 1EIBA 2KO7A 4IT6A 1HJVA 1ZU8A 2PV1A 1WNOA 1W1PA 1FKBA 1FKDA 4L3NA 3JYJA 3B9DA 2DG3A 4ODMA 1JNTA 2F21A 2ZR6A 3RM4A 2WK2A 4HBOA 2O9OA 1EQ3A 1GPFA 3NRKA 4ZPWR 3KACA 3JYMA 1FKTA 5HUAA 2QF8A 3WD1A 5B8IC 1GOIA 2DPEA 2N87A 4R0XA 3UQAA 3O5DA 1D7HA 1EDQA 1Q1CA 1SYTA 3AS0A 4MGVA 4URIA 1H0IA 2RSEA 3O5GA 1OWQA 2LJ4A 3KADA 3WD0A 3O5JA 1E6PA 1UR8A 2VCDA 3G6MA 4P8XA 3IHZA 4WIWA 1KFWA 4ZS6A 4DZ3A 4Z2HA 1N1AA 3PA7A 1WAWA 3PRAA 4QT2A 2MLYA 3O5QA 5J6EA 1A7XA 3RM8A 1E6NA 3WIJA 3AS1A 2A3BA 1FKRA 4NSBA 1J4IA 1PINA 2XP8A 2AOSA 3NTPA 2DG4A 2MF9A 2ITKA 3AS3A 3BXWA 1TFVA 4DRPA 4DWSA 4IT4A 2F2DA 4ODLA 2A3EA 2WLYA 3KAHA 2Y78A 3CGMA 4QZVB 2IUZA 1NMWA 3IK8A 1NWTA 1FFQA 4TX0A 3WD4A 3CH9A 2RUDA 4WKHA 4HBEA 1FKIA 1HKKA 2WLZA 3UI4A 2DG9A 3WL0A 3KCEA 1LQ0A 1ZCNA 3ARXA 1NWSA 1P5QA 1R9HA 2ZQVA 3OA5A 1YATA 1ITXA 3AROA 4R5EA 1M5YA 1W1YA 2DT0A 4DRKA 2XP5A 4W9QA 2DT1A 4MAVA 5JH8A 1BL4A 3AS2A 4N19A 4S3JA 4ITZA 5I98A 1T11A 1HKIA 4ODOA 2FKEA 2MNTA 2PPPA 3CHDA 1FKKA 1HJWA 4JYSA 1ZBWA 2PI6A 4AY1A 2PBCA 2XPBA 2O92A 1LL6A 3MDYB 4U84A 5HW6A 1XHGA 1E15A 1ZL1A 4JFIA 1FKSA 1NH6A 4ODQA 2OFNA 1D2KA 1W9UA 2B31A 1W26A 5HT1A 2XP6A 2XP3A 3ODKA 4ODRA 1C9HA 2F4EA 4JFLA 2DSUA 1LG2A 4LAVA 3RMEA 1NWRA 5HKGA 3WD3A 4NNRA 2ZQTA 3KAGA 1X6LA 2KFWA 3CHEA 4LAXA 2XPAA 2KE0A 1Q6UA 4DWSD 4MTVA 5DEZA 1NSGA 4WK9A 4HARA 5HBFA 4J4NA 1FKFA 3ARSA 2LGOA 3WL1A 4JFMA 1B6CA 2A3AA 3PR9A 1F8AB 2XP4A 3UI6A 3TC5A 1NWUA 2DT2A 1FJDA 1QPLA 1E6ZA 3GPKA 4P8VA 1ROTA 1FKLA 3ALGA 1Q6IA 1E6RA 4DWSC 2UZ5A 5GQBA 3WKZA 1O6IA 3ARPA 3IKGA 5HWBA 2A3CA 1D7JA 2XP9A 1TCOC 4P8UA 3WQVA 3QOKA 1FD9A 3WH0A 3ARTA 1JNEA 3PRBA 4WKFA 2XP7A 5HW7A 2ZQSA 4MNKA 4IPXA 1W9PA 3ARUA 1U79A 4DRMA 3I6CA 3O5PA 1KT0A 2JZVA 1SR0A 4G50A 4W5UA 4O2TA 1LJYA 1D7IA 4C02B 4WJXA 3ARQA 3RM9A 3H9RB 4ZPVR 4G2PA 4JFJA 1IX5A 2DT3A 4DRHA 4W9OA 2RUQA 4Q7NA 4Z2KA 3O5IA 4GIVA 2G8ZA 3ARVA 5D75A 1OGGA 4Z2GA 1OGBA 4J4OA 4LAYA 1JNSA 3O5EA 3RGCA 4JFKA 4ODPA 4TW6A 4Z2IA 5HWCA 1Q6HA 2D9FA 2PV3A 3JXVA 4DWSB 2YBTA 3CHCA 4FAPA 3AQUA 4TNSA 3RFWA 3W4RA 4DH0A 3G6LA 2ZQUA 5HTGA 4TYOA 3OOBA 5GPGA 1ZB5A 3CHFA 4DRJA 1L1PA 2YBUA 5GPRA 2LKNA 1PBKA 4LAWA 4MNJA 1QZ2A 4MPKA 2MPHA 2WM0A 1JVWA 4Z2LA 1VF8A 4LGXA 1UR9A 2PV2A 4GGQA 3WD2A 2Q5AA 2M2AA 3O5KA 3B7XA 3TDBA 1Y0OA 2PPOA 3B9EA 2M08A 4L72B 1J4RA 1EYMA 1XRVA 1ZK6A 2ZR5A 2PPNA 3ALFA 4KR0B 2G41A 2OLHA 3FXYA 2RQSA 3UQIA 1LL7A 2DSWA 3UQBA 3KZ7A 4U86A 4FN2A 1QPFA 3O5RA 4NZCA 3ARRA 1D6OA 1FAPA 1E9LA 2KI3A 2RUCA 3FY1A 1FKHA 1HKJA 1ZBCA 1H0GA 3LUOA 1ZBKA 4ODNA 3ARZA 3O5FA 3UI5A 2MLZA 2FDMA 1FKJA 1BKFA 1W1VA 3KAFA 1JNDA 5DF0A 4ML4A 2DSZA 2KR7A 4S3KA 1EHNA 3B8SA 3CZ8A 4DROA 1HXVA 4TW8A 5DIUA 5HW8A 1F40A 2VN1A 3VAWA 2KGJA 1FKGA 2MLXA 3PRDA 1FFRA 1W9VA 4Z2JA 3NI6A 3O5MA 1X6NA 2ZR4A 5DIVA 1RD6A 2LPVA 4DRNA 1CTNA 4U85A 3UF8A 2AWGA 1LL4A 1NMVA 1J6YA 5BXJA 2K8IA 4KQZA 1ROUA 4ZPTR 4DRIA 4IQ2A 5DITA 1HJXA 2ESCA 3WQWA 4PTMA 4TW7A 1YW5A 4MNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J4N A;  1FKF A;  2F2D A;  2FAP A;  2LKN A;  2LGO A;  1PBK A;  4LAW A;  4ODL A;  3EY6 A;  4JFM A;  1B6C A;  4BF8 A;  1L1P A;  1QZ2 A;  3FAP A;  3KAH A;  2Y78 A;  3CGM A;  1F8A B;  4DZ2 A;  3IKD A;  2XP4 A;  4MSP A;  3UI6 A;  2RUR A;  2MPH A;  2M1I A;  3O5O A;  3TC5 A;  1NMW A;  4ODK A;  4QT3 A;  1JVW A;  4DRQ A;  1FJD A;  3IK8 A;  3TCZ A;  4DT4 A;  3CGN A;  2IF4 A;  1QPL A;  3GPK A;  4TX0 A;  1ROT A;  1FKL A;  4DIP A;  1Q6I A;  2RUD A;  2PV2 A;  1FKI A;  2UZ5 A;  3KAI A;  4GGQ A;  2Q5A A;  2M2A A;  5HWB A;  3IKG A;  2DG9 A;  2L2S A;  1KT1 A;  3B7X A;  3KCE A;  3O5K A;  3TDB A;  3UI4 A;  1Y0O A;  1D7J A;  2PPO A;  2M08 A;  2XP9 A;  1TCO C;  3KAB A;  1ZCN A;  1J4H A;  1R9H A;  1J4R A;  1FD9 A;  1EYM A;  1P5Q A;  1ZK6 A;  2ZQV A;  2ZR5 A;  4QIB A;  3WH0 A;  2PPN A;  3PRB A;  1YAT A;  3O5L A;  4IQC A;  2XP7 A;  4W9P A;  2KO7 A;  5HW7 A;  2ZQS A;  2PV1 A;  4IPX A;  2RQS A;  1M5Y A;  1U79 A;  3UQI A;  4DRM A;  3I6C A;  3O5P A;  3UQB A;  4DRK A;  1FKB A;  1FKD A;  3KZ7 A;  4U86 A;  2XP5 A;  1QPF A;  4FN2 A;  3O5R A;  3JYJ A;  4W9Q A;  1KT0 A;  2JZV A;  1D6O A;  1FAP A;  4G50 A;  1BL4 A;  2DG3 A;  2KI3 A;  2RUC A;  4ODM A;  4N19 A;  1FKH A;  1JNT A;  2F21 A;  2ZR6 A;  3LUO A;  4O2T A;  1D7I A;  4ODN A;  4C02 B;  4ITZ A;  5I98 A;  1EQ3 A;  1T11 A;  3O5F A;  3UI5 A;  4DRP A;  2MLZ A;  3NRK A;  2FKE A;  4ODO A;  1FKJ A;  3KAC A;  2MNT A;  3H9R B;  2PPP A;  1BKF A;  4G2P A;  4JFJ A;  1FKK A;  4JYS A;  3JYM A;  4DRH A;  1FKT A;  4W9O A;  5HUA A;  3KAF A;  5B8I C;  2RUQ A;  2PBC A;  3O5I A;  4R0X A;  2N87 A;  2XPB A;  4GIV A;  3UQA A;  3O5D A;  5D75 A;  2KR7 A;  1D7H A;  3MDY B;  1Q1C A;  4U84 A;  5HW6 A;  4MGV A;  4JFI A;  4DRO A;  1HXV A;  1FKS A;  2RSE A;  3O5G A;  4ODQ A;  4TW8 A;  4J4O A;  4LAY A;  5DIU A;  5HW8 A;  1JNS A;  2LJ4 A;  2VN1 A;  3KAD A;  3VAW A;  1F40 A;  3O5J A;  2OFN A;  2KGJ A;  1FKG A;  2MLX A;  3O5E A;  3PRD A;  1W26 A;  2VCD A;  5HT1 A;  2XP6 A;  3IHZ A;  3RGC A;  4JFK A;  3NI6 A;  2XP3 A;  3O5M A;  4ODP A;  4TW6 A;  3ODK A;  4DZ3 A;  2ZR4 A;  1N1A A;  5HWC A;  1Q6H A;  4ODR A;  5DIV A;  2LPV A;  4DRN A;  1C9H A;  2F4E A;  3PA7 A;  4JFL A;  2D9F A;  2PV3 A;  4QT2 A;  2MLY A;  4LAV A;  3JXV A;  3O5Q A;  2AWG A;  4U85 A;  3UF8 A;  5HKG A;  5J6E A;  1A7X A;  1NMV A;  4NNR A;  1J6Y A;  2ZQT A;  3KAG A;  5BXJ A;  2K8I A;  2KFW A;  1ROU A;  4LAX A;  1FKR A;  1J4I A;  2XPA A;  2KE0 A;  4DRI A;  1Q6U A;  4IQ2 A;  1PIN A;  2XP8 A;  3NTP A;  2DG4 A;  4FAP A;  4TNS A;  2MF9 A;  3RFW A;  4DH0 A;  5DIT A;  2ITK A;  2ZQU A;  5HTG A;  4TYO A;  3OOB A;  5GPG A;  1NSG A;  4TW7 A;  4DRJ A;  1YW5 A; 
#chains in the Genus database with same CATH topology
 2FAP A;  1K9T A;  3EY6 A;  4BF8 A;  1HKM A;  3FAP A;  4DZ2 A;  3IKD A;  4MSP A;  4P8W A;  2RUR A;  2M1I A;  3O5O A;  4ODK A;  3ARW A;  4QT3 A;  4DRQ A;  1ZBV A;  3TCZ A;  4DT4 A;  3CGN A;  2IF4 A;  1W1T A;  1WB0 A;  4XAK A;  4DIP A;  2DSV A;  3KAI A;  2L2S A;  1KT1 A;  4Q22 A;  3ARY A;  4MNM A;  1GUV A;  3KAB A;  1J4H A;  1LG1 A;  4QIB A;  5DO2 A;  4WKA A;  3B9A A;  3O5L A;  4IQC A;  4W9P A;  1EIB A;  2KO7 A;  4IT6 A;  1HJV A;  1ZU8 A;  2PV1 A;  1WNO A;  1W1P A;  1FKB A;  1FKD A;  4L3N A;  3JYJ A;  3B9D A;  2DG3 A;  4ODM A;  1JNT A;  2F21 A;  2ZR6 A;  3RM4 A;  2WK2 A;  4HBO A;  2O9O A;  1EQ3 A;  1GPF A;  3NRK A;  4ZPW R;  3KAC A;  3JYM A;  1FKT A;  5HUA A;  2QF8 A;  3WD1 A;  5B8I C;  1GOI A;  2DPE A;  2N87 A;  4R0X A;  3UQA A;  3O5D A;  1D7H A;  1EDQ A;  1Q1C A;  1SYT A;  3AS0 A;  4MGV A;  4URI A;  1H0I A;  2RSE A;  3O5G A;  1OWQ A;  2LJ4 A;  3KAD A;  3WD0 A;  3O5J A;  2B5U B;  1E6P A;  1UR8 A;  2VCD A;  3G6M A;  4P8X A;  3IHZ A;  4WIW A;  1KFW A;  4ZS6 A;  4DZ3 A;  4Z2H A;  1N1A A;  3PA7 A;  1WAW A;  3PRA A;  4QT2 A;  2MLY A;  3O5Q A;  5J6E A;  1A7X A;  3RM8 A;  1E6N A;  3WIJ A;  1E44 A;  3AS1 A;  2A3B A;  1FKR A;  4NSB A;  1J4I A;  1PIN A;  2XP8 A;  2AOS A;  3NTP A;  2DG4 A;  2MF9 A;  2ITK A;  3AS3 A;  3BXW A;  1TFV A;  4DRP A;  3GTY X;  4DWS A;  4IT4 A;  2F2D A;  4ODL A;  2A3E A;  2WLY A;  3KAH A;  2Y78 A;  3CGM A;  4QZV B;  2IUZ A;  1NMW A;  3IK8 A;  1NWT A;  2F23 A;  1FFQ A;  4TX0 A;  3WD4 A;  3CH9 A;  2RUD A;  4WKH A;  4HBE A;  1FKI A;  1HKK A;  2WLZ A;  3UI4 A;  2DG9 A;  3WL0 A;  3KCE A;  1LQ0 A;  1ZCN A;  3ARX A;  1NWS A;  1P5Q A;  1R9H A;  2ZQV A;  3OA5 A;  1YAT A;  1ITX A;  3ARO A;  4R5E A;  1M5Y A;  1W1Y A;  2DT0 A;  4DRK A;  2XP5 A;  4W9Q A;  2DT1 A;  4MAV A;  5JH8 A;  1BL4 A;  3AS2 A;  4N19 A;  4S3J A;  4ITZ A;  5I98 A;  1T11 A;  1HKI A;  4ODO A;  2FKE A;  2MNT A;  2PPP A;  3CHD A;  1FKK A;  1HJW A;  4JYS A;  1ZBW A;  2PI6 A;  4AY1 A;  2PBC A;  2XPB A;  2O92 A;  1LL6 A;  3MDY B;  4U84 A;  5HW6 A;  1XHG A;  1E15 A;  1ZL1 A;  4JFI A;  1FKS A;  1NH6 A;  4ODQ A;  2OFN A;  1D2K A;  1W9U A;  2B31 A;  4UDM A;  1W26 A;  5HT1 A;  2XP6 A;  2XP3 A;  3ODK A;  4ODR A;  2PN0 A;  1C9H A;  2F4E A;  4JFL A;  2DSU A;  1LG2 A;  4LAV A;  3RME A;  1NWR A;  5HKG A;  3WD3 A;  4NNR A;  2ZQT A;  3KAG A;  1X6L A;  2KFW A;  3CHE A;  4LAX A;  2XPA A;  2KE0 A;  1Q6U A;  4DWS D;  4MTV A;  5DEZ A;  1NSG A;  4WK9 A;  4HAR A;  5HBF A;  2P4V A;  4J4N A;  1FKF A;  3ARS A;  2LGO A;  3WL1 A;  4JFM A;  1B6C A;  2A3A A;  3PR9 A;  1F8A B;  2XP4 A;  3UI6 A;  3TC5 A;  1NWU A;  2DT2 A;  1FJD A;  1QPL A;  1E6Z A;  3GPK A;  4P8V A;  1ROT A;  1FKL A;  3ALG A;  1Q6I A;  1E6R A;  4DWS C;  2UZ5 A;  5GQB A;  3WKZ A;  1O6I A;  3ARP A;  3IKG A;  5HWB A;  2A3C A;  1D7J A;  2XP9 A;  1TCO C;  4P8U A;  3WQV A;  3QOK A;  1FD9 A;  3WH0 A;  3ART A;  1JNE A;  3PRB A;  4WKF A;  2XP7 A;  5HW7 A;  2ZQS A;  4MNK A;  4IPX A;  1W9P A;  3ARU A;  1U79 A;  4DRM A;  3I6C A;  3O5P A;  1KT0 A;  2JZV A;  1JCH B;  1SR0 A;  4G50 A;  4W5U A;  1GRJ A;  4O2T A;  1LJY A;  1D7I A;  4C02 B;  4WJX A;  3ARQ A;  3RM9 A;  3H9R B;  4ZPV R;  4G2P A;  4JFJ A;  1IX5 A;  2DT3 A;  4DRH A;  4W9O A;  2RUQ A;  4Q7N A;  4Z2K A;  3O5I A;  4GIV A;  2G8Z A;  3ARV A;  5D75 A;  2ETN A;  1OGG A;  4Z2G A;  1OGB A;  4J4O A;  4LAY A;  1JNS A;  3O5E A;  3RGC A;  4JFK A;  2EUL A;  4ODP A;  4TW6 A;  4Z2I A;  3BMB A;  5HWC A;  1Q6H A;  3EIP A;  2D9F A;  2PV3 A;  3JXV A;  4DWS B;  2YBT A;  3CHC A;  4FAP A;  3AQU A;  4TNS A;  3RFW A;  3W4R A;  4DH0 A;  3G6L A;  2ZQU A;  5HTG A;  4TYO A;  3OOB A;  5GPG A;  1ZB5 A;  3CHF A;  4DRJ A;  1L1P A;  2YBU A;  5GPR A;  2LKN A;  1PBK A;  4LAW A;  4MNJ A;  1QZ2 A;  4MPK A;  2MPH A;  2WM0 A;  1JVW A;  4Z2L A;  1VF8 A;  4LGX A;  1UR9 A;  2PV2 A;  4GGQ A;  3WD2 A;  2Q5A A;  2M2A A;  3O5K A;  3B7X A;  3TDB A;  1Y0O A;  2PPO A;  3B9E A;  2M08 A;  4L72 B;  1J4R A;  1EYM A;  1XRV A;  1ZK6 A;  2ZR5 A;  2PPN A;  3ALF A;  4KR0 B;  2G41 A;  2OLH A;  3FXY A;  2RQS A;  3UQI A;  1LL7 A;  2DSW A;  3UQB A;  3KZ7 A;  4U86 A;  4FN2 A;  1QPF A;  3O5R A;  4NZC A;  3ARR A;  1D6O A;  1FAP A;  1E9L A;  2KI3 A;  2RUC A;  3FY1 A;  1FKH A;  1HKJ A;  1ZBC A;  1H0G A;  3LUO A;  1ZBK A;  4ODN A;  3ARZ A;  3O5F A;  3UI5 A;  2MLZ A;  2FDM A;  1FKJ A;  1BKF A;  1W1V A;  3KAF A;  1JND A;  5DF0 A;  4ML4 A;  2DSZ A;  2KR7 A;  4S3K A;  1EHN A;  3B8S A;  3CZ8 A;  4DRO A;  1HXV A;  4TW8 A;  5DIU A;  5HW8 A;  1F40 A;  2VN1 A;  3VAW A;  2KGJ A;  1FKG A;  2MLX A;  3PRD A;  1FFR A;  1W9V A;  4Z2J A;  3NI6 A;  3O5M A;  1X6N A;  2ZR4 A;  5DIV A;  1RD6 A;  2LPV A;  4DRN A;  1CTN A;  4U85 A;  3UF8 A;  2AWG A;  1LL4 A;  1NMV A;  1J6Y A;  5BXJ A;  3GU0 A;  2K8I A;  4KQZ A;  1ROU A;  4ZPT R;  4DRI A;  4IQ2 A;  5DIT A;  1HJX A;  2ESC A;  3WQW A;  4PTM A;  4TW7 A;  1YW5 A;  4MNL A; 
#chains in the Genus database with same CATH homology
 2FAP A;  1K9T A;  3EY6 A;  4BF8 A;  1HKM A;  3FAP A;  4DZ2 A;  3IKD A;  4MSP A;  4P8W A;  2RUR A;  2M1I A;  3O5O A;  4ODK A;  3ARW A;  4QT3 A;  4DRQ A;  1ZBV A;  3TCZ A;  4DT4 A;  3CGN A;  2IF4 A;  1W1T A;  1WB0 A;  4XAK A;  4DIP A;  2DSV A;  3KAI A;  2L2S A;  1KT1 A;  4Q22 A;  3ARY A;  4MNM A;  1GUV A;  3KAB A;  1J4H A;  1LG1 A;  4QIB A;  5DO2 A;  4WKA A;  3B9A A;  3O5L A;  4IQC A;  4W9P A;  1EIB A;  2KO7 A;  4IT6 A;  1HJV A;  1ZU8 A;  2PV1 A;  1WNO A;  1W1P A;  1FKB A;  1FKD A;  4L3N A;  3JYJ A;  3B9D A;  2DG3 A;  4ODM A;  1JNT A;  2F21 A;  2ZR6 A;  3RM4 A;  2WK2 A;  4HBO A;  2O9O A;  1EQ3 A;  1GPF A;  3NRK A;  4ZPW R;  3KAC A;  3JYM A;  1FKT A;  5HUA A;  2QF8 A;  3WD1 A;  5B8I C;  1GOI A;  2DPE A;  2N87 A;  4R0X A;  3UQA A;  3O5D A;  1D7H A;  1EDQ A;  1Q1C A;  1SYT A;  3AS0 A;  4MGV A;  4URI A;  1H0I A;  2RSE A;  3O5G A;  1OWQ A;  2LJ4 A;  3KAD A;  3WD0 A;  3O5J A;  1E6P A;  1UR8 A;  2VCD A;  3G6M A;  4P8X A;  3IHZ A;  4WIW A;  1KFW A;  4ZS6 A;  4DZ3 A;  4Z2H A;  1N1A A;  3PA7 A;  1WAW A;  3PRA A;  4QT2 A;  2MLY A;  3O5Q A;  5J6E A;  1A7X A;  3RM8 A;  1E6N A;  3WIJ A;  3AS1 A;  2A3B A;  1FKR A;  4NSB A;  1J4I A;  1PIN A;  2XP8 A;  2AOS A;  3NTP A;  2DG4 A;  2MF9 A;  2ITK A;  3AS3 A;  3BXW A;  1TFV A;  4DRP A;  4DWS A;  4IT4 A;  2F2D A;  4ODL A;  2A3E A;  2WLY A;  3KAH A;  2Y78 A;  3CGM A;  4QZV B;  2IUZ A;  1NMW A;  3IK8 A;  1NWT A;  1FFQ A;  4TX0 A;  3WD4 A;  3CH9 A;  2RUD A;  4WKH A;  4HBE A;  1FKI A;  1HKK A;  2WLZ A;  3UI4 A;  2DG9 A;  3WL0 A;  3KCE A;  1LQ0 A;  1ZCN A;  3ARX A;  1NWS A;  1P5Q A;  1R9H A;  2ZQV A;  3OA5 A;  1YAT A;  1ITX A;  3ARO A;  4R5E A;  1M5Y A;  1W1Y A;  2DT0 A;  4DRK A;  2XP5 A;  4W9Q A;  2DT1 A;  4MAV A;  5JH8 A;  1BL4 A;  3AS2 A;  4N19 A;  4S3J A;  4ITZ A;  5I98 A;  1T11 A;  1HKI A;  4ODO A;  2FKE A;  2MNT A;  2PPP A;  3CHD A;  1FKK A;  1HJW A;  4JYS A;  1ZBW A;  2PI6 A;  4AY1 A;  2PBC A;  2XPB A;  2O92 A;  1LL6 A;  3MDY B;  4U84 A;  5HW6 A;  1XHG A;  1E15 A;  1ZL1 A;  4JFI A;  1FKS A;  1NH6 A;  4ODQ A;  2OFN A;  1D2K A;  1W9U A;  2B31 A;  1W26 A;  5HT1 A;  2XP6 A;  2XP3 A;  3ODK A;  4ODR A;  1C9H A;  2F4E A;  4JFL A;  2DSU A;  1LG2 A;  4LAV A;  3RME A;  1NWR A;  5HKG A;  3WD3 A;  4NNR A;  2ZQT A;  3KAG A;  1X6L A;  2KFW A;  3CHE A;  4LAX A;  2XPA A;  2KE0 A;  1Q6U A;  4DWS D;  4MTV A;  5DEZ A;  1NSG A;  4WK9 A;  4HAR A;  5HBF A;  4J4N A;  1FKF A;  3ARS A;  2LGO A;  3WL1 A;  4JFM A;  1B6C A;  2A3A A;  3PR9 A;  1F8A B;  2XP4 A;  3UI6 A;  3TC5 A;  1NWU A;  2DT2 A;  1FJD A;  1QPL A;  1E6Z A;  3GPK A;  4P8V A;  1ROT A;  1FKL A;  3ALG A;  1Q6I A;  1E6R A;  4DWS C;  2UZ5 A;  5GQB A;  3WKZ A;  1O6I A;  3ARP A;  3IKG A;  5HWB A;  2A3C A;  1D7J A;  2XP9 A;  1TCO C;  4P8U A;  3WQV A;  3QOK A;  1FD9 A;  3WH0 A;  3ART A;  1JNE A;  3PRB A;  4WKF A;  2XP7 A;  5HW7 A;  2ZQS A;  4MNK A;  4IPX A;  1W9P A;  3ARU A;  1U79 A;  4DRM A;  3I6C A;  3O5P A;  1KT0 A;  2JZV A;  1SR0 A;  4G50 A;  4W5U A;  4O2T A;  1LJY A;  1D7I A;  4C02 B;  4WJX A;  3ARQ A;  3RM9 A;  3H9R B;  4ZPV R;  4G2P A;  4JFJ A;  1IX5 A;  2DT3 A;  4DRH A;  4W9O A;  2RUQ A;  4Q7N A;  4Z2K A;  3O5I A;  4GIV A;  2G8Z A;  3ARV A;  5D75 A;  1OGG A;  4Z2G A;  1OGB A;  4J4O A;  4LAY A;  1JNS A;  3O5E A;  3RGC A;  4JFK A;  4ODP A;  4TW6 A;  4Z2I A;  5HWC A;  1Q6H A;  2D9F A;  2PV3 A;  3JXV A;  4DWS B;  2YBT A;  3CHC A;  4FAP A;  3AQU A;  4TNS A;  3RFW A;  3W4R A;  4DH0 A;  3G6L A;  2ZQU A;  5HTG A;  4TYO A;  3OOB A;  5GPG A;  1ZB5 A;  3CHF A;  4DRJ A;  1L1P A;  2YBU A;  5GPR A;  2LKN A;  1PBK A;  4LAW A;  4MNJ A;  1QZ2 A;  4MPK A;  2MPH A;  2WM0 A;  1JVW A;  4Z2L A;  1VF8 A;  4LGX A;  1UR9 A;  2PV2 A;  4GGQ A;  3WD2 A;  2Q5A A;  2M2A A;  3O5K A;  3B7X A;  3TDB A;  1Y0O A;  2PPO A;  3B9E A;  2M08 A;  4L72 B;  1J4R A;  1EYM A;  1XRV A;  1ZK6 A;  2ZR5 A;  2PPN A;  3ALF A;  4KR0 B;  2G41 A;  2OLH A;  3FXY A;  2RQS A;  3UQI A;  1LL7 A;  2DSW A;  3UQB A;  3KZ7 A;  4U86 A;  4FN2 A;  1QPF A;  3O5R A;  4NZC A;  3ARR A;  1D6O A;  1FAP A;  1E9L A;  2KI3 A;  2RUC A;  3FY1 A;  1FKH A;  1HKJ A;  1ZBC A;  1H0G A;  3LUO A;  1ZBK A;  4ODN A;  3ARZ A;  3O5F A;  3UI5 A;  2MLZ A;  2FDM A;  1FKJ A;  1BKF A;  1W1V A;  3KAF A;  1JND A;  5DF0 A;  4ML4 A;  2DSZ A;  2KR7 A;  4S3K A;  1EHN A;  3B8S A;  3CZ8 A;  4DRO A;  1HXV A;  4TW8 A;  5DIU A;  5HW8 A;  1F40 A;  2VN1 A;  3VAW A;  2KGJ A;  1FKG A;  2MLX A;  3PRD A;  1FFR A;  1W9V A;  4Z2J A;  3NI6 A;  3O5M A;  1X6N A;  2ZR4 A;  5DIV A;  1RD6 A;  2LPV A;  4DRN A;  1CTN A;  4U85 A;  3UF8 A;  2AWG A;  1LL4 A;  1NMV A;  1J6Y A;  5BXJ A;  2K8I A;  4KQZ A;  1ROU A;  4ZPT R;  4DRI A;  4IQ2 A;  5DIT A;  1HJX A;  2ESC A;  3WQW A;  4PTM A;  4TW7 A;  1YW5 A;  4MNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...