4DRHA

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor at low ph
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
NNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 30
structure length 132
sequence length 132
chains with identical sequence D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drhA00
5HW6A 4DRQA 5J6EA 3O5KA 4J4NA 3RFWA 3TCZA 1FKJA 2KE0A 2XP5A 3UI5A 5BXJA 5HKGA 1Q1CA 2PPNA 3KACA 3I6CA 3JYJA 3O5QA 4LAYA 5HTGA 2DG3A 3PRDA 1M5YA 1PBKA 2PBCA 2MF9A 3UI6A 4MGVA 3MDYB 4DZ2A 3UI4A 1FKGA 3UQIA 2M2AA 3O5DA 3KAFA 3RGCA 3GPKA 1FKHA 1Q6UA 1FKIA 1D7HA 1U79A 4ODMA 4U86A 2ZQTA 3KABA 4ODKA 1ROTA 3FAPA 1KT0A 3EY6A 4IQCA 4JFMA 2F4EA 4BF8A 3H9RB 1QPLA 4IQ2A 1ROUA 4TX0A 2XP9A 2MLXA 4JFKA 3CGNA 4NNRA 1R9HA 1FKBA 1F40A 2OFNA 1FKTA 3O5OA 4QIBA 4FAPA 5HWCA 3TC5A 5HWBA 3IHZA 4DT4A 2ZQVA 3WH0A 1FKLA 2RUQA 2ZQSA 3O5RA 3O5MA 2IF4A 2K8IA 5I98A 1J4RA 2KGJA 1JVWA 2LGOA 4IPXA 4DH0A 4TYOA 5HW7A 2XPBA 2XP4A 3UQAA 3CGMA 3KAGA 4ODLA 3JXVA 1F8AB 4JFJA 3KAIA 3O5IA 1P5QA 4QT3A 1YATA 1JNTA 2RUCA 4ODRA 5D75A 3UF8A 2VCDA 2M08A 2FKEA 2LKNA 3PRBA 1HXVA 2XPAA 5DIUA 4ODPA 1J4HA 1ZCNA 1Y0OA 2F2DA 3PA7A 2L2SA 5B8IC 4ODOA 2PV1A 4GGQA 4W9PA 4DRJA 3O5EA 2RSEA 1FKFA 1C9HA 2MNTA 2N87A 4JFLA 4U84A 1D7JA 1YW5A 2XP3A 4DROA 2XP7A 2ZR4A 1BL4A 4TW6A 3JYMA 4DRKA 2M1IA 4DRHA 2ZR6A 3O5FA 1Q6HA 2Q5AA 1N1AA 2VN1A 3IK8A 2LPVA 4TW8A 1EQ3A 3NRKA 3VAWA 3KZ7A 2MLYA 2DG9A 1Q6IA 2RUDA 3O5PA 1W26A 2PPOA 5DITA 4DZ3A 3IKDA 1J6YA 1NSGA 2D9FA 1QPFA 3LUOA 2PPPA 4DRIA 2KI3A 4FN2A 3UQBA 4ODQA 4LAWA 4TW7A 4G2PA 2LJ4A 3ODKA 4N19A 4DRMA 1ZK6A 5HW8A 1B6CA 1PINA 1KT1A 2Y78A 4DRNA 3IKGA 3KADA 1NMWA 3O5GA 4DRPA 1FKRA 1FAPA 2PV3A 4LAXA 4U85A 4W9QA 2XP8A 3NTPA 1T11A 3KCEA 4JFIA 5DIVA 2MPHA 4QT2A 5HT1A 4ITZA 5HUAA 1QZ2A 1FD9A 2FAPA 2JZVA 2ZR5A 4G50A 2AWGA 1D7IA 2PV2A 4LAVA 1A7XA 1NMVA 2KR7A 4W9OA 1EYMA 4ODNA 3TDBA 3NI6A 1FJDA 1BKFA 4R0XA 4TNSA 2UZ5A 2KO7A 2RURA 4O2TA 1J4IA 3O5JA 1JNSA 3B7XA 2XP6A 1L1PA 2ITKA 2MLZA 1TCOC 2KFWA 4MSPA 2DG4A 4JYSA 3OOBA 5GPGA 1FKKA 4GIVA 2F21A 4C02B 4J4OA 2ZQUA 1FKSA 4DIPA 1FKDA 3O5LA 1D6OA 2RQSA 3KAHA
chains in the Genus database with same CATH superfamily
5J6EA 1EDQA 2YBTA 4DRQA 3O5KA 3GU0A 3ALFA 3TCZA 2KE0A 5HKGA 4Z2LA 1M5YA 2PBCA 4MGVA 3UI4A 1ZL1A 4MNLA 3KAFA 1U79A 3KABA 3WD3A 1KT0A 4IQ2A 1QPLA 1LQ0A 4Z2JA 3WKZA 1FKBA 3O5OA 3GTYX 4Z2GA 5HWCA 3WQWA 1JNDA 2A3AA 4L72B 3OA5A 1FKLA 3O5RA 5I98A 3ARQA 2KGJA 5HW7A 2XPBA 1HKIA 1F8AB 1W9PA 3O5IA 4JFJA 1P5QA 4QT3A 1YATA 1JNTA 2RUCA 4ODRA 1SR0A 2XPAA 2WLZA 1HJXA 4IT6A 2QF8A 3AS2A 1LG1A 4JFLA 1FKFA 3RM8A 2DSUA 4DWSD 1D7JA 2XP3A 4ZPTR 1GOIA 3AS0A 4S3KA 3AQUA 1Q6HA 2Q5AA 2PN0A 3KZ7A 4HARA 5DITA 1J6YA 4MAVA 1RD6A 4MNMA 4LAWA 1HKJA 3ODKA 4G2PA 1B6CA 1GPFA 2A3CA 3KADA 3O5GA 2B31A 3RM4A 4HBEA 1FKRA 4LAXA 4U85A 4ML4A 2XP8A 3ALGA 4QT2A 5HT1A 1QZ2A 3ARWA 2A3EA 1W1YA 1XHGA 4PTMA 1W1TA 4Q7NA 1IX5A 1BKFA 4R0XA 1X6LA 1OGBA 1E9LA 2MLZA 1WB0A 2KFWA 3OOBA 4WKHA 1ZBWA 1FFRA 2PI6A 1FKSA 3O5LA 3BXWA 3KAHA 4WK9A 5HW6A 4MTVA 4J4NA 3RFWA 5BXJA 2OLHA 4LAYA 3JYJA 3PRDA 3G6MA 3UI6A 3MDYB 5DO2A 3UQIA 2DSVA 3RGCA 3GPKA 1FKHA 1Q6UA 1JCHB 4UDMA 1HJWA 2DT0A 4ODMA 2ZQTA 3EY6A 4L3NA 4BF8A 1W1PA 4NZCA 3WQVA 2DSWA 2OFNA 5GQBA 3TC5A 2IUZA 1JNEA 2IF4A 2K8IA 4DH0A 4IPXA 3CHDA 2YBUA 3WD2A 1KFWA 3CGMA 1GUVA 3JXVA 3WD4A 4URIA 3KAIA 5HBFA 1H0IA 3UF8A 3PRBA 4ODPA 1ZCNA 2F2DA 1E6NA 1GRJA 1C9HA 2N87A 3CH9A 4TW6A 3JYMA 4DRKA 2M1IA 2ZR6A 3O5FA 2VN1A 1EQ3A 4DWSA 4Z2IA 2ESCA 2PPOA 3IKDA 1X6NA 2PPPA 3B8SA 4DRIA 3UQBA 4WKAA 1TFVA 1LL6A 4R5EA 1NMWA 3ARRA 4HBOA 4W9QA 3WD0A 1E6ZA 4JFIA 2MPHA 3AROA 2AWGA 3BMBA 1E44A 1A7XA 1ZBVA 2G8ZA 4W9OA 1NWUA 2UZ5A 4MPKA 3G6LA 4KR0B 3B7XA 1ZBCA 1TCOC 2P4VA 2FDMA 4Q22A 1E15A 5GPGA 1FKKA 4GIVA 4C02B 1FKDA 1ZB5A 4P8UA 2WM0A 1D2KA 1SYTA 3UI5A 1E6RA 3AS3A 1Q1CA 3KACA 2DG3A 2MF9A 1FKGA 3B9DA 3O5DA 1FKIA 1D7HA 4U86A 4ODKA 3FAPA 4JFMA 4IQCA 4IT4A 1ROUA 4NNRA 4JFKA 1NWRA 3CGNA 4QZVB 1HKMA 4ZPWR 1FKTA 1LG2A 4QIBA 5HWBA 1H0GA 1E6PA 1WNOA 3WD1A 1JVWA 1NH6A 2LGOA 4TYOA 4ODLA 1LL7A 5D75A 4DRJA 4P8XA 1HXVA 4Z2KA 1J4HA 3PA7A 1UR9A 4GGQA 4W9PA 3ARZA 4U84A 1FFQA 2MNTA 4DROA 3CHEA 2XP7A 2ZR4A 1NWSA 1BL4A 1HJVA 2DPEA 4DRHA 4TW8A 1N1AA 2LPVA 3NRKA 3VAWA 4LGXA 2MLYA 1W26A 4P8VA 1NSGA 2D9FA 3WL1A 4P8WA 4ODQA 2LJ4A 4DRMA 2F23A 2WLYA 1KT1A 4DRNA 3ARSA 3IKGA 4NSBA 4DRPA 4Z2HA 1FAPA 4AY1A 3NTPA 1T11A 3KCEA 5DIVA 3ARYA 3FY1A 3AS1A 4ITZA 4DWSB 1FD9A 4G50A 2ZR5A 4KQZA 1D7IA 3QOKA 1VF8A 2PV2A 1LJYA 1ITXA 3TDBA 4MNKA 5GPRA 1EIBA 4O2TA 1J4IA 3O5JA 1XRVA 1JNSA 2XP6A 2ITKA 4MSPA 2DG4A 4JYSA 5JH8A 3FXYA 2F21A 1K9TA 2EULA 3W4RA 2ETNA 3CHCA 3PR9A 2RQSA 1UR8A 4DWSC 1FKJA 2XP5A 2PPNA 3CHFA 3I6CA 3O5QA 4S3JA 3WL0A 5HTGA 1PBKA 3B9EA 1OGGA 5DF0A 4DZ2A 3RM9A 3B9AA 3ARTA 2M2AA 1W1VA 4MNJA 3WIJA 1ROTA 4XAKA 2DT3A 2O9OA 2F4EA 3H9RB 1ZU8A 4TX0A 2XP9A 2MLXA 1F40A 1R9HA 4FAPA 4WKFA 3IHZA 2DT1A 4DT4A 2ZQVA 3WH0A 1EHNA 2RUQA 2ZQSA 1OWQA 3O5MA 1CTNA 1J4RA 4WJXA 3UQAA 2XP4A 3KAGA 2VCDA 2M08A 2FKEA 2LKNA 5DIUA 1Y0OA 2L2SA 5B8IC 4ODOA 2PV1A 2WK2A 3O5EA 2RSEA 1YW5A 4W5UA 2DSZA 5DEZA 3IK8A 3ARXA 2RUDA 2DG9A 1Q6IA 3O5PA 4DZ3A 1QPFA 3LUOA 3EIPA 2KI3A 4FN2A 4TW7A 2A3BA 5HW8A 4N19A 1ZK6A 1PINA 2Y78A 1NWTA 1W9UA 2PV3A 1HKKA 5HUAA 2JZVA 2FAPA 4ZS6A 4WIWA 2B5UB 4LAVA 2DT2A 2O92A 3ARPA 1NMVA 2KR7A 1ZBKA 1EYMA 4ODNA 3NI6A 1FJDA 4TNSA 2KO7A 3ARVA 2RURA 3CZ8A 3ARUA 4ZPVR 3RMEA 1L1PA 3PRAA 1LL4A 1W9VA 1O6IA 2AOSA 2G41A 4J4OA 2ZQUA 4DIPA 1D6OA 1WAWA
chains in the Genus database with same CATH topology
5J6EA 1EDQA 2YBTA 4DRQA 3O5KA 3ALFA 3TCZA 2KE0A 5HKGA 4Z2LA 1M5YA 2PBCA 4MGVA 3UI4A 1ZL1A 4MNLA 3KAFA 1U79A 3KABA 3WD3A 1KT0A 4IQ2A 1QPLA 1LQ0A 4Z2JA 3WKZA 1FKBA 3O5OA 4Z2GA 5HWCA 3WQWA 1JNDA 2A3AA 4L72B 3OA5A 1FKLA 3O5RA 5I98A 3ARQA 2KGJA 5HW7A 2XPBA 1HKIA 1F8AB 1W9PA 3O5IA 4JFJA 1P5QA 4QT3A 1YATA 1JNTA 2RUCA 4ODRA 1SR0A 2XPAA 2WLZA 1HJXA 4IT6A 2QF8A 3AS2A 1LG1A 4JFLA 1FKFA 3RM8A 2DSUA 4DWSD 1D7JA 2XP3A 4ZPTR 1GOIA 3AS0A 4S3KA 3AQUA 1Q6HA 2Q5AA 3KZ7A 4HARA 5DITA 1J6YA 4MAVA 1RD6A 4MNMA 4LAWA 1HKJA 3ODKA 4G2PA 1B6CA 1GPFA 2A3CA 3KADA 3O5GA 2B31A 3RM4A 4HBEA 1FKRA 4LAXA 4U85A 4ML4A 2XP8A 3ALGA 4QT2A 5HT1A 1QZ2A 3ARWA 2A3EA 1W1YA 1XHGA 4PTMA 1W1TA 4Q7NA 1IX5A 1BKFA 4R0XA 1X6LA 1OGBA 1E9LA 2MLZA 1WB0A 2KFWA 3OOBA 4WKHA 1ZBWA 1FFRA 2PI6A 1FKSA 3O5LA 3BXWA 3KAHA 4WK9A 5HW6A 4MTVA 4J4NA 3RFWA 5BXJA 2OLHA 4LAYA 3JYJA 3PRDA 3G6MA 3UI6A 3MDYB 5DO2A 3UQIA 2DSVA 3RGCA 3GPKA 1FKHA 1Q6UA 1HJWA 2DT0A 4ODMA 2ZQTA 3EY6A 4L3NA 4BF8A 1W1PA 4NZCA 3WQVA 2DSWA 2OFNA 5GQBA 3TC5A 2IUZA 1JNEA 2IF4A 2K8IA 4DH0A 4IPXA 3CHDA 2YBUA 3WD2A 1KFWA 3CGMA 1GUVA 3JXVA 3WD4A 4URIA 3KAIA 5HBFA 1H0IA 3UF8A 3PRBA 4ODPA 1ZCNA 2F2DA 1E6NA 1C9HA 2N87A 3CH9A 4TW6A 3JYMA 4DRKA 2M1IA 2ZR6A 3O5FA 2VN1A 1EQ3A 4DWSA 4Z2IA 2ESCA 2PPOA 3IKDA 1X6NA 2PPPA 3B8SA 4DRIA 3UQBA 4WKAA 1TFVA 1LL6A 4R5EA 1NMWA 3ARRA 4HBOA 4W9QA 3WD0A 4JFIA 1E6ZA 2MPHA 3AROA 2AWGA 1A7XA 1ZBVA 2G8ZA 4W9OA 1NWUA 2UZ5A 4MPKA 3G6LA 4KR0B 3B7XA 1ZBCA 1TCOC 2FDMA 4Q22A 1E15A 5GPGA 1FKKA 4GIVA 4C02B 1FKDA 1ZB5A 4P8UA 2WM0A 1D2KA 1SYTA 3UI5A 1E6RA 3AS3A 1Q1CA 3KACA 2DG3A 2MF9A 1FKGA 3B9DA 3O5DA 1FKIA 1D7HA 4U86A 4ODKA 3FAPA 4JFMA 4IQCA 4IT4A 1ROUA 4NNRA 4JFKA 1NWRA 3CGNA 4QZVB 1HKMA 4ZPWR 1FKTA 1LG2A 4QIBA 5HWBA 1H0GA 1E6PA 1WNOA 3WD1A 1JVWA 1NH6A 2LGOA 4TYOA 4ODLA 1LL7A 5D75A 4DRJA 4P8XA 1HXVA 4Z2KA 1J4HA 3PA7A 1UR9A 4GGQA 4W9PA 3ARZA 4U84A 1FFQA 2MNTA 4DROA 3CHEA 2XP7A 2ZR4A 1NWSA 1BL4A 1HJVA 2DPEA 4DRHA 4TW8A 1N1AA 2LPVA 3NRKA 3VAWA 4LGXA 2MLYA 1W26A 4P8VA 1NSGA 2D9FA 3WL1A 4P8WA 4ODQA 2LJ4A 4DRMA 2WLYA 1KT1A 4DRNA 3ARSA 3IKGA 4NSBA 4DRPA 4Z2HA 1FAPA 4AY1A 3NTPA 1T11A 3KCEA 5DIVA 3ARYA 4ITZA 3FY1A 3AS1A 4DWSB 1FD9A 4KQZA 2ZR5A 4G50A 1D7IA 3QOKA 1VF8A 2PV2A 1LJYA 1ITXA 3TDBA 4MNKA 5GPRA 1EIBA 4O2TA 1J4IA 3O5JA 1XRVA 1JNSA 2XP6A 2ITKA 4MSPA 2DG4A 4JYSA 5JH8A 3FXYA 2F21A 1K9TA 3W4RA 3CHCA 3PR9A 2RQSA 1UR8A 4DWSC 1FKJA 2XP5A 2PPNA 3CHFA 3I6CA 3O5QA 4S3JA 3WL0A 5HTGA 1PBKA 3B9EA 1OGGA 5DF0A 4DZ2A 3RM9A 3B9AA 3ARTA 2M2AA 1W1VA 4MNJA 3WIJA 1ROTA 4XAKA 2DT3A 2O9OA 2F4EA 3H9RB 1ZU8A 4TX0A 2XP9A 2MLXA 1F40A 1R9HA 4FAPA 4WKFA 3IHZA 2DT1A 4DT4A 2ZQVA 3WH0A 1EHNA 2RUQA 2ZQSA 1OWQA 3O5MA 1CTNA 1J4RA 4WJXA 3UQAA 2XP4A 3KAGA 2VCDA 2M08A 2FKEA 2LKNA 5DIUA 1Y0OA 2L2SA 5B8IC 4ODOA 2PV1A 2WK2A 3O5EA 2RSEA 1YW5A 4W5UA 2DSZA 5DEZA 3IK8A 3ARXA 2RUDA 2DG9A 1Q6IA 3O5PA 4DZ3A 1QPFA 3LUOA 2KI3A 4FN2A 4TW7A 2A3BA 5HW8A 4N19A 1ZK6A 1PINA 2Y78A 1NWTA 1W9UA 2PV3A 1HKKA 5HUAA 2JZVA 2FAPA 4ZS6A 4WIWA 4LAVA 2DT2A 2O92A 3ARPA 1NMVA 2KR7A 1ZBKA 1EYMA 4ODNA 3NI6A 1FJDA 4TNSA 2KO7A 3ARVA 2RURA 3CZ8A 3ARUA 4ZPVR 3RMEA 1L1PA 3PRAA 1LL4A 1W9VA 1O6IA 2AOSA 2G41A 4J4OA 2ZQUA 4DIPA 1D6OA 1WAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HW6 A;  4DRQ A;  5J6E A;  3O5K A;  4J4N A;  3RFW A;  3TCZ A;  1FKJ A;  2KE0 A;  2XP5 A;  3UI5 A;  5BXJ A;  5HKG A;  1Q1C A;  2PPN A;  3KAC A;  3I6C A;  3JYJ A;  3O5Q A;  4LAY A;  5HTG A;  2DG3 A;  3PRD A;  1M5Y A;  1PBK A;  2PBC A;  2MF9 A;  3UI6 A;  4MGV A;  3MDY B;  4DZ2 A;  3UI4 A;  1FKG A;  3UQI A;  2M2A A;  3O5D A;  3KAF A;  3RGC A;  3GPK A;  1FKH A;  1Q6U A;  1FKI A;  1D7H A;  1U79 A;  4ODM A;  4U86 A;  2ZQT A;  3KAB A;  4ODK A;  1ROT A;  3FAP A;  1KT0 A;  3EY6 A;  4IQC A;  4JFM A;  2F4E A;  4BF8 A;  3H9R B;  1QPL A;  4IQ2 A;  1ROU A;  4TX0 A;  2XP9 A;  2MLX A;  4JFK A;  3CGN A;  4NNR A;  1R9H A;  1FKB A;  1F40 A;  2OFN A;  1FKT A;  3O5O A;  4QIB A;  4FAP A;  5HWC A;  3TC5 A;  5HWB A;  3IHZ A;  4DT4 A;  2ZQV A;  3WH0 A;  1FKL A;  2RUQ A;  2ZQS A;  3O5R A;  3O5M A;  2IF4 A;  2K8I A;  5I98 A;  1J4R A;  2KGJ A;  1JVW A;  2LGO A;  4IPX A;  4DH0 A;  4TYO A;  5HW7 A;  2XPB A;  2XP4 A;  3UQA A;  3CGM A;  3KAG A;  4ODL A;  3JXV A;  1F8A B;  4JFJ A;  3KAI A;  3O5I A;  1P5Q A;  4QT3 A;  1YAT A;  1JNT A;  2RUC A;  4ODR A;  5D75 A;  3UF8 A;  2VCD A;  2M08 A;  2FKE A;  2LKN A;  3PRB A;  1HXV A;  2XPA A;  5DIU A;  4ODP A;  1J4H A;  1ZCN A;  1Y0O A;  2F2D A;  3PA7 A;  2L2S A;  5B8I C;  4ODO A;  2PV1 A;  4GGQ A;  4W9P A;  4DRJ A;  3O5E A;  2RSE A;  1FKF A;  1C9H A;  2MNT A;  2N87 A;  4JFL A;  4U84 A;  1D7J A;  1YW5 A;  2XP3 A;  4DRO A;  2XP7 A;  2ZR4 A;  1BL4 A;  4TW6 A;  3JYM A;  4DRK A;  2M1I A;  4DRH A;  2ZR6 A;  3O5F A;  1Q6H A;  2Q5A A;  1N1A A;  2VN1 A;  3IK8 A;  2LPV A;  4TW8 A;  1EQ3 A;  3NRK A;  3VAW A;  3KZ7 A;  2MLY A;  2DG9 A;  1Q6I A;  2RUD A;  3O5P A;  1W26 A;  2PPO A;  5DIT A;  4DZ3 A;  3IKD A;  1J6Y A;  1NSG A;  2D9F A;  1QPF A;  3LUO A;  2PPP A;  4DRI A;  2KI3 A;  4FN2 A;  3UQB A;  4ODQ A;  4LAW A;  4TW7 A;  4G2P A;  2LJ4 A;  3ODK A;  4N19 A;  4DRM A;  1ZK6 A;  5HW8 A;  1B6C A;  1PIN A;  1KT1 A;  2Y78 A;  4DRN A;  3IKG A;  3KAD A;  1NMW A;  3O5G A;  4DRP A;  1FKR A;  1FAP A;  2PV3 A;  4LAX A;  4U85 A;  4W9Q A;  2XP8 A;  3NTP A;  1T11 A;  3KCE A;  4JFI A;  5DIV A;  2MPH A;  4QT2 A;  5HT1 A;  4ITZ A;  5HUA A;  1QZ2 A;  1FD9 A;  2FAP A;  2JZV A;  2ZR5 A;  4G50 A;  2AWG A;  1D7I A;  2PV2 A;  4LAV A;  1A7X A;  1NMV A;  2KR7 A;  4W9O A;  1EYM A;  4ODN A;  3TDB A;  3NI6 A;  1FJD A;  1BKF A;  4R0X A;  4TNS A;  2UZ5 A;  2KO7 A;  2RUR A;  4O2T A;  1J4I A;  3O5J A;  1JNS A;  3B7X A;  2XP6 A;  1L1P A;  2ITK A;  2MLZ A;  1TCO C;  2KFW A;  4MSP A;  2DG4 A;  4JYS A;  3OOB A;  5GPG A;  1FKK A;  4GIV A;  2F21 A;  4C02 B;  4J4O A;  2ZQU A;  1FKS A;  4DIP A;  1FKD A;  3O5L A;  1D6O A;  2RQS A;  3KAH A; 
#chains in the Genus database with same CATH topology
 5J6E A;  1EDQ A;  2YBT A;  4DRQ A;  3O5K A;  3GU0 A;  3ALF A;  3TCZ A;  2KE0 A;  5HKG A;  4Z2L A;  1M5Y A;  2PBC A;  4MGV A;  3UI4 A;  1ZL1 A;  4MNL A;  3KAF A;  1U79 A;  3KAB A;  3WD3 A;  1KT0 A;  4IQ2 A;  1QPL A;  1LQ0 A;  4Z2J A;  3WKZ A;  1FKB A;  3O5O A;  3GTY X;  4Z2G A;  5HWC A;  3WQW A;  1JND A;  2A3A A;  4L72 B;  3OA5 A;  1FKL A;  3O5R A;  5I98 A;  3ARQ A;  2KGJ A;  5HW7 A;  2XPB A;  1HKI A;  1F8A B;  1W9P A;  3O5I A;  4JFJ A;  1P5Q A;  4QT3 A;  1YAT A;  1JNT A;  2RUC A;  4ODR A;  1SR0 A;  2XPA A;  2WLZ A;  1HJX A;  4IT6 A;  2QF8 A;  3AS2 A;  1LG1 A;  4JFL A;  1FKF A;  3RM8 A;  2DSU A;  4DWS D;  1D7J A;  2XP3 A;  4ZPT R;  1GOI A;  3AS0 A;  4S3K A;  3AQU A;  1Q6H A;  2Q5A A;  2PN0 A;  3KZ7 A;  4HAR A;  5DIT A;  1J6Y A;  4MAV A;  1RD6 A;  4MNM A;  4LAW A;  1HKJ A;  3ODK A;  4G2P A;  1B6C A;  1GPF A;  2A3C A;  3KAD A;  3O5G A;  2B31 A;  3RM4 A;  4HBE A;  1FKR A;  4LAX A;  4U85 A;  4ML4 A;  2XP8 A;  3ALG A;  4QT2 A;  5HT1 A;  1QZ2 A;  3ARW A;  2A3E A;  1W1Y A;  1XHG A;  4PTM A;  1W1T A;  4Q7N A;  1IX5 A;  1BKF A;  4R0X A;  1X6L A;  1OGB A;  1E9L A;  2MLZ A;  1WB0 A;  2KFW A;  3OOB A;  4WKH A;  1ZBW A;  1FFR A;  2PI6 A;  1FKS A;  3O5L A;  3BXW A;  3KAH A;  4WK9 A;  5HW6 A;  4MTV A;  4J4N A;  3RFW A;  5BXJ A;  2OLH A;  4LAY A;  3JYJ A;  3PRD A;  3G6M A;  3UI6 A;  3MDY B;  5DO2 A;  3UQI A;  2DSV A;  3RGC A;  3GPK A;  1FKH A;  1Q6U A;  1JCH B;  4UDM A;  1HJW A;  2DT0 A;  4ODM A;  2ZQT A;  3EY6 A;  4L3N A;  4BF8 A;  1W1P A;  4NZC A;  3WQV A;  2DSW A;  2OFN A;  5GQB A;  3TC5 A;  2IUZ A;  1JNE A;  2IF4 A;  2K8I A;  4DH0 A;  4IPX A;  3CHD A;  2YBU A;  3WD2 A;  1KFW A;  3CGM A;  1GUV A;  3JXV A;  3WD4 A;  4URI A;  3KAI A;  5HBF A;  1H0I A;  3UF8 A;  3PRB A;  4ODP A;  1ZCN A;  2F2D A;  1E6N A;  1GRJ A;  1C9H A;  2N87 A;  3CH9 A;  4TW6 A;  3JYM A;  4DRK A;  2M1I A;  2ZR6 A;  3O5F A;  2VN1 A;  1EQ3 A;  4DWS A;  4Z2I A;  2ESC A;  2PPO A;  3IKD A;  1X6N A;  2PPP A;  3B8S A;  4DRI A;  3UQB A;  4WKA A;  1TFV A;  1LL6 A;  4R5E A;  1NMW A;  3ARR A;  4HBO A;  4W9Q A;  3WD0 A;  1E6Z A;  4JFI A;  2MPH A;  3ARO A;  2AWG A;  3BMB A;  1E44 A;  1A7X A;  1ZBV A;  2G8Z A;  4W9O A;  1NWU A;  2UZ5 A;  4MPK A;  3G6L A;  4KR0 B;  3B7X A;  1ZBC A;  1TCO C;  2P4V A;  2FDM A;  4Q22 A;  1E15 A;  5GPG A;  1FKK A;  4GIV A;  4C02 B;  1FKD A;  1ZB5 A;  4P8U A;  2WM0 A;  1D2K A;  1SYT A;  3UI5 A;  1E6R A;  3AS3 A;  1Q1C A;  3KAC A;  2DG3 A;  2MF9 A;  1FKG A;  3B9D A;  3O5D A;  1FKI A;  1D7H A;  4U86 A;  4ODK A;  3FAP A;  4JFM A;  4IQC A;  4IT4 A;  1ROU A;  4NNR A;  4JFK A;  1NWR A;  3CGN A;  4QZV B;  1HKM A;  4ZPW R;  1FKT A;  1LG2 A;  4QIB A;  5HWB A;  1H0G A;  1E6P A;  1WNO A;  3WD1 A;  1JVW A;  1NH6 A;  2LGO A;  4TYO A;  4ODL A;  1LL7 A;  5D75 A;  4DRJ A;  4P8X A;  1HXV A;  4Z2K A;  1J4H A;  3PA7 A;  1UR9 A;  4GGQ A;  4W9P A;  3ARZ A;  4U84 A;  1FFQ A;  2MNT A;  4DRO A;  3CHE A;  2XP7 A;  2ZR4 A;  1NWS A;  1BL4 A;  1HJV A;  2DPE A;  4DRH A;  4TW8 A;  1N1A A;  2LPV A;  3NRK A;  3VAW A;  4LGX A;  2MLY A;  1W26 A;  4P8V A;  1NSG A;  2D9F A;  3WL1 A;  4P8W A;  4ODQ A;  2LJ4 A;  4DRM A;  2F23 A;  2WLY A;  1KT1 A;  4DRN A;  3ARS A;  3IKG A;  4NSB A;  4DRP A;  4Z2H A;  1FAP A;  4AY1 A;  3NTP A;  1T11 A;  3KCE A;  5DIV A;  3ARY A;  3FY1 A;  3AS1 A;  4ITZ A;  4DWS B;  1FD9 A;  4G50 A;  2ZR5 A;  4KQZ A;  1D7I A;  3QOK A;  1VF8 A;  2PV2 A;  1LJY A;  1ITX A;  3TDB A;  4MNK A;  5GPR A;  1EIB A;  4O2T A;  1J4I A;  3O5J A;  1XRV A;  1JNS A;  2XP6 A;  2ITK A;  4MSP A;  2DG4 A;  4JYS A;  5JH8 A;  3FXY A;  2F21 A;  1K9T A;  2EUL A;  3W4R A;  2ETN A;  3CHC A;  3PR9 A;  2RQS A;  1UR8 A;  4DWS C;  1FKJ A;  2XP5 A;  2PPN A;  3CHF A;  3I6C A;  3O5Q A;  4S3J A;  3WL0 A;  5HTG A;  1PBK A;  3B9E A;  1OGG A;  5DF0 A;  4DZ2 A;  3RM9 A;  3B9A A;  3ART A;  2M2A A;  1W1V A;  4MNJ A;  3WIJ A;  1ROT A;  4XAK A;  2DT3 A;  2O9O A;  2F4E A;  3H9R B;  1ZU8 A;  4TX0 A;  2XP9 A;  2MLX A;  1F40 A;  1R9H A;  4FAP A;  4WKF A;  3IHZ A;  2DT1 A;  4DT4 A;  2ZQV A;  3WH0 A;  1EHN A;  2RUQ A;  2ZQS A;  1OWQ A;  3O5M A;  1CTN A;  1J4R A;  4WJX A;  3UQA A;  2XP4 A;  3KAG A;  2VCD A;  2M08 A;  2FKE A;  2LKN A;  5DIU A;  1Y0O A;  2L2S A;  5B8I C;  4ODO A;  2PV1 A;  2WK2 A;  3O5E A;  2RSE A;  1YW5 A;  4W5U A;  2DSZ A;  5DEZ A;  3IK8 A;  3ARX A;  2RUD A;  2DG9 A;  1Q6I A;  3O5P A;  4DZ3 A;  1QPF A;  3LUO A;  3EIP A;  2KI3 A;  4FN2 A;  4TW7 A;  2A3B A;  5HW8 A;  4N19 A;  1ZK6 A;  1PIN A;  2Y78 A;  1NWT A;  1W9U A;  2PV3 A;  1HKK A;  5HUA A;  2JZV A;  2FAP A;  4ZS6 A;  4WIW A;  2B5U B;  4LAV A;  2DT2 A;  2O92 A;  3ARP A;  1NMV A;  2KR7 A;  1ZBK A;  1EYM A;  4ODN A;  3NI6 A;  1FJD A;  4TNS A;  2KO7 A;  3ARV A;  2RUR A;  3CZ8 A;  3ARU A;  4ZPV R;  3RME A;  1L1P A;  3PRA A;  1LL4 A;  1W9V A;  1O6I A;  2AOS A;  2G41 A;  4J4O A;  2ZQU A;  4DIP A;  1D6O A;  1WAW A; 
#chains in the Genus database with same CATH homology
 5J6E A;  1EDQ A;  2YBT A;  4DRQ A;  3O5K A;  3ALF A;  3TCZ A;  2KE0 A;  5HKG A;  4Z2L A;  1M5Y A;  2PBC A;  4MGV A;  3UI4 A;  1ZL1 A;  4MNL A;  3KAF A;  1U79 A;  3KAB A;  3WD3 A;  1KT0 A;  4IQ2 A;  1QPL A;  1LQ0 A;  4Z2J A;  3WKZ A;  1FKB A;  3O5O A;  4Z2G A;  5HWC A;  3WQW A;  1JND A;  2A3A A;  4L72 B;  3OA5 A;  1FKL A;  3O5R A;  5I98 A;  3ARQ A;  2KGJ A;  5HW7 A;  2XPB A;  1HKI A;  1F8A B;  1W9P A;  3O5I A;  4JFJ A;  1P5Q A;  4QT3 A;  1YAT A;  1JNT A;  2RUC A;  4ODR A;  1SR0 A;  2XPA A;  2WLZ A;  1HJX A;  4IT6 A;  2QF8 A;  3AS2 A;  1LG1 A;  4JFL A;  1FKF A;  3RM8 A;  2DSU A;  4DWS D;  1D7J A;  2XP3 A;  4ZPT R;  1GOI A;  3AS0 A;  4S3K A;  3AQU A;  1Q6H A;  2Q5A A;  3KZ7 A;  4HAR A;  5DIT A;  1J6Y A;  4MAV A;  1RD6 A;  4MNM A;  4LAW A;  1HKJ A;  3ODK A;  4G2P A;  1B6C A;  1GPF A;  2A3C A;  3KAD A;  3O5G A;  2B31 A;  3RM4 A;  4HBE A;  1FKR A;  4LAX A;  4U85 A;  4ML4 A;  2XP8 A;  3ALG A;  4QT2 A;  5HT1 A;  1QZ2 A;  3ARW A;  2A3E A;  1W1Y A;  1XHG A;  4PTM A;  1W1T A;  4Q7N A;  1IX5 A;  1BKF A;  4R0X A;  1X6L A;  1OGB A;  1E9L A;  2MLZ A;  1WB0 A;  2KFW A;  3OOB A;  4WKH A;  1ZBW A;  1FFR A;  2PI6 A;  1FKS A;  3O5L A;  3BXW A;  3KAH A;  4WK9 A;  5HW6 A;  4MTV A;  4J4N A;  3RFW A;  5BXJ A;  2OLH A;  4LAY A;  3JYJ A;  3PRD A;  3G6M A;  3UI6 A;  3MDY B;  5DO2 A;  3UQI A;  2DSV A;  3RGC A;  3GPK A;  1FKH A;  1Q6U A;  1HJW A;  2DT0 A;  4ODM A;  2ZQT A;  3EY6 A;  4L3N A;  4BF8 A;  1W1P A;  4NZC A;  3WQV A;  2DSW A;  2OFN A;  5GQB A;  3TC5 A;  2IUZ A;  1JNE A;  2IF4 A;  2K8I A;  4DH0 A;  4IPX A;  3CHD A;  2YBU A;  3WD2 A;  1KFW A;  3CGM A;  1GUV A;  3JXV A;  3WD4 A;  4URI A;  3KAI A;  5HBF A;  1H0I A;  3UF8 A;  3PRB A;  4ODP A;  1ZCN A;  2F2D A;  1E6N A;  1C9H A;  2N87 A;  3CH9 A;  4TW6 A;  3JYM A;  4DRK A;  2M1I A;  2ZR6 A;  3O5F A;  2VN1 A;  1EQ3 A;  4DWS A;  4Z2I A;  2ESC A;  2PPO A;  3IKD A;  1X6N A;  2PPP A;  3B8S A;  4DRI A;  3UQB A;  4WKA A;  1TFV A;  1LL6 A;  4R5E A;  1NMW A;  3ARR A;  4HBO A;  4W9Q A;  3WD0 A;  4JFI A;  1E6Z A;  2MPH A;  3ARO A;  2AWG A;  1A7X A;  1ZBV A;  2G8Z A;  4W9O A;  1NWU A;  2UZ5 A;  4MPK A;  3G6L A;  4KR0 B;  3B7X A;  1ZBC A;  1TCO C;  2FDM A;  4Q22 A;  1E15 A;  5GPG A;  1FKK A;  4GIV A;  4C02 B;  1FKD A;  1ZB5 A;  4P8U A;  2WM0 A;  1D2K A;  1SYT A;  3UI5 A;  1E6R A;  3AS3 A;  1Q1C A;  3KAC A;  2DG3 A;  2MF9 A;  1FKG A;  3B9D A;  3O5D A;  1FKI A;  1D7H A;  4U86 A;  4ODK A;  3FAP A;  4JFM A;  4IQC A;  4IT4 A;  1ROU A;  4NNR A;  4JFK A;  1NWR A;  3CGN A;  4QZV B;  1HKM A;  4ZPW R;  1FKT A;  1LG2 A;  4QIB A;  5HWB A;  1H0G A;  1E6P A;  1WNO A;  3WD1 A;  1JVW A;  1NH6 A;  2LGO A;  4TYO A;  4ODL A;  1LL7 A;  5D75 A;  4DRJ A;  4P8X A;  1HXV A;  4Z2K A;  1J4H A;  3PA7 A;  1UR9 A;  4GGQ A;  4W9P A;  3ARZ A;  4U84 A;  1FFQ A;  2MNT A;  4DRO A;  3CHE A;  2XP7 A;  2ZR4 A;  1NWS A;  1BL4 A;  1HJV A;  2DPE A;  4DRH A;  4TW8 A;  1N1A A;  2LPV A;  3NRK A;  3VAW A;  4LGX A;  2MLY A;  1W26 A;  4P8V A;  1NSG A;  2D9F A;  3WL1 A;  4P8W A;  4ODQ A;  2LJ4 A;  4DRM A;  2WLY A;  1KT1 A;  4DRN A;  3ARS A;  3IKG A;  4NSB A;  4DRP A;  4Z2H A;  1FAP A;  4AY1 A;  3NTP A;  1T11 A;  3KCE A;  5DIV A;  3ARY A;  4ITZ A;  3FY1 A;  3AS1 A;  4DWS B;  1FD9 A;  4KQZ A;  2ZR5 A;  4G50 A;  1D7I A;  3QOK A;  1VF8 A;  2PV2 A;  1LJY A;  1ITX A;  3TDB A;  4MNK A;  5GPR A;  1EIB A;  4O2T A;  1J4I A;  3O5J A;  1XRV A;  1JNS A;  2XP6 A;  2ITK A;  4MSP A;  2DG4 A;  4JYS A;  5JH8 A;  3FXY A;  2F21 A;  1K9T A;  3W4R A;  3CHC A;  3PR9 A;  2RQS A;  1UR8 A;  4DWS C;  1FKJ A;  2XP5 A;  2PPN A;  3CHF A;  3I6C A;  3O5Q A;  4S3J A;  3WL0 A;  5HTG A;  1PBK A;  3B9E A;  1OGG A;  5DF0 A;  4DZ2 A;  3RM9 A;  3B9A A;  3ART A;  2M2A A;  1W1V A;  4MNJ A;  3WIJ A;  1ROT A;  4XAK A;  2DT3 A;  2O9O A;  2F4E A;  3H9R B;  1ZU8 A;  4TX0 A;  2XP9 A;  2MLX A;  1F40 A;  1R9H A;  4FAP A;  4WKF A;  3IHZ A;  2DT1 A;  4DT4 A;  2ZQV A;  3WH0 A;  1EHN A;  2RUQ A;  2ZQS A;  1OWQ A;  3O5M A;  1CTN A;  1J4R A;  4WJX A;  3UQA A;  2XP4 A;  3KAG A;  2VCD A;  2M08 A;  2FKE A;  2LKN A;  5DIU A;  1Y0O A;  2L2S A;  5B8I C;  4ODO A;  2PV1 A;  2WK2 A;  3O5E A;  2RSE A;  1YW5 A;  4W5U A;  2DSZ A;  5DEZ A;  3IK8 A;  3ARX A;  2RUD A;  2DG9 A;  1Q6I A;  3O5P A;  4DZ3 A;  1QPF A;  3LUO A;  2KI3 A;  4FN2 A;  4TW7 A;  2A3B A;  5HW8 A;  4N19 A;  1ZK6 A;  1PIN A;  2Y78 A;  1NWT A;  1W9U A;  2PV3 A;  1HKK A;  5HUA A;  2JZV A;  2FAP A;  4ZS6 A;  4WIW A;  4LAV A;  2DT2 A;  2O92 A;  3ARP A;  1NMV A;  2KR7 A;  1ZBK A;  1EYM A;  4ODN A;  3NI6 A;  1FJD A;  4TNS A;  2KO7 A;  3ARV A;  2RUR A;  3CZ8 A;  3ARU A;  4ZPV R;  3RME A;  1L1P A;  3PRA A;  1LL4 A;  1W9V A;  1O6I A;  2AOS A;  2G41 A;  4J4O A;  2ZQU A;  4DIP A;  1D6O A;  1WAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...