4DRIA

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
121
structure length
121
Chain Sequence
EQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 121
sequence length 121
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4driA00
3IK8A 5B8IC 4DROA 3PRBA 3CGMA 1D7JA 5HW8A 4C02B 4G50A 4MSPA 2M2AA 3IHZA 1JNSA 1J4HA 1QPLA 1ROUA 2PV2A 5D75A 5GPGA 2IF4A 2LJ4A 3VAWA 4DRJA 1YATA 4ODRA 4ODQA 3O5OA 1B6CA 2DG3A 2ZQTA 1F40A 1FKLA 1FKFA 2XP6A 4IQ2A 3JYMA 4J4OA 3LUOA 4DRMA 5J6EA 4ODPA 2MPHA 2M08A 2ITKA 2MLXA 3O5PA 3O5FA 2PPNA 4DRKA 4TNSA 3NRKA 3JYJA 3H9RB 2PBCA 3UQAA 1FKDA 1FKSA 1JVWA 2M1IA 3EY6A 4TX0A 1ZCNA 2ZQSA 2DG9A 4LAYA 3UI6A 1FAPA 2VN1A 3O5EA 4U84A 3CGNA 3PRDA 4DH0A 3O5LA 3RFWA 2OFNA 3I6CA 1Y0OA 2F2DA 3WH0A 3PA7A 1NSGA 4ITZA 1PBKA 2LKNA 5HW6A 1J6YA 1QZ2A 1YW5A 2VCDA 1W26A 4JFIA 4ODNA 3UI4A 4QT3A 1FKIA 1ZK6A 3NTPA 2XP3A 2Q5AA 4W9PA 3O5IA 4TW6A 1FKGA 4IPXA 2XPBA 5DIVA 2K8IA 1N1AA 4TYOA 2ZR5A 1FJDA 4DIPA 2RUDA 1NMWA 2XP8A 3B7XA 3O5KA 2RUQA 1F8AB 3KAFA 1KT0A 4ODOA 1M5YA 2Y78A 4DRPA 5I98A 3UQBA 4JYSA 3KAIA 4GIVA 1FKKA 2F4EA 1A7XA 4LAXA 1FD9A 2JZVA 3O5JA 4DRQA 4DRIA 4JFKA 5HWCA 2RURA 3O5GA 3TC5A 3KAGA 3O5RA 4IQCA 1L1PA 1TCOC 3O5DA 2XP7A 4BF8A 3UQIA 3TCZA 3UI5A 3IKDA 2UZ5A 2FAPA 3KAHA 1FKJA 4JFJA 4JFMA 5HW7A 1EYMA 1FKHA 2PPOA 2KO7A 4W9OA 2XP9A 4R0XA 1J4IA 2MLYA 2MLZA 2F21A 4QT2A 2LGOA 1QPFA 3JXVA 3ODKA 1C9HA 1J4RA 1D6OA 2LPVA 2MF9A 2PV1A 2ZQVA 5HUAA 2XP4A 3O5QA 1BL4A 4G2PA 2RQSA 4LAWA 4FAPA 1Q6HA 1Q6UA 1U79A 4JFLA 3RGCA 3FAPA 1T11A 5HWBA 3IKGA 4N19A 5DITA 4DZ2A 5HKGA 3KCEA 5HTGA 2D9FA 2PPPA 3UF8A 1FKTA 2ZQUA 4MGVA 5HT1A 3OOBA 2KFWA 3O5MA 3KADA 4J4NA 1BKFA 5DIUA 1FKRA 2KI3A 1D7HA 1KT1A 2PV3A 4TW8A 2KR7A 3KZ7A 2ZR6A 2MNTA 4DZ3A 2L2SA 4ODLA 4DRNA 2XPAA 1P5QA 4ODMA 4LAVA 2AWGA 2RSEA 3KACA 1FKBA 2KE0A 4ODKA 4U86A 4NNRA 4DT4A 1PINA 1HXVA 4QIBA 2ZR4A 4GGQA 3NI6A 1NMVA 2DG4A 4W9QA 1D7IA 1R9HA 5BXJA 1ROTA 4O2TA 3TDBA 1Q6IA 2RUCA 3GPKA 2KGJA 2N87A 4TW7A 1Q1CA 1JNTA 4FN2A 4U85A 1EQ3A 3KABA 3MDYB 2XP5A 4DRHA 2FKEA
chains in the Genus database with same CATH superfamily
5B8IC 1E6NA 3IHZA 5D75A 4P8XA 2IF4A 1GOIA 3VAWA 3FY1A 4ODRA 4ODQA 2DG3A 2ZQTA 4IQ2A 5J6EA 2M08A 2YBTA 2ITKA 2MLXA 4DRKA 3NRKA 3B9EA 3H9RB 2A3BA 3UQAA 4DWSA 4P8VA 3FXYA 4L3NA 4WKHA 3WH0A 1PBKA 1YW5A 2VCDA 1FKIA 3ARPA 1JNDA 4TW6A 5DIVA 2WK2A 2ZR5A 2XP8A 4MPKA 1W1VA 1M5YA 3UQBA 3CH9A 2F4EA 4DWSB 4DRQA 3WD0A 3PR9A 3KAGA 2XP7A 4MNJA 2A3AA 3B9AA 1LQ0A 3CHEA 3UQIA 3UI5A 4ZPTR 1FKJA 4JFJA 2FDMA 2EULA 2MLYA 2F21A 3ODKA 2LPVA 2ZQVA 5HUAA 3O5QA 2RQSA 4LAWA 1ZBVA 4JFLA 5HWBA 4N19A 1E6RA 5DITA 4ML4A 3KCEA 2D9FA 2ZQUA 3WQWA 4NSBA 4S3JA 4WJXA 3G6MA 4DZ3A 4ODLA 2XPAA 3AS2A 1P5QA 3GU0A 1FKBA 1ZL1A 1D2KA 1E9LA 3AQUA 1HJXA 2YBUA 4Q7NA 1W9PA 1ROTA 4U85A 1JNTA 4FN2A 4L72B 4P8UA 4DROA 2AOSA 2WLYA 3ARQA 1J4HA 5GPRA 1UR8A 2LJ4A 4DRJA 2B31A 3RM4A 1F40A 2XP6A 2A3EA 3AS3A 3LUOA 2MPHA 3B8SA 4IT6A 4Z2HA 1FFQA 2DSVA 3G6LA 1FKDA 1HKKA 1JVWA 3EY6A 4Z2IA 2DT3A 3O5LA 3I6CA 1Y0OA 2F2DA 2DSWA 1LG2A 3CHFA 3PA7A 1NSGA 4ITZA 1J6YA 4JFIA 1W26A 2P4VA 4QT3A 3UI4A 3NTPA 1ZBKA 2Q5AA 3O5IA 2XPBA 2DT2A 4TYOA 3CHDA 4DIPA 3O5KA 4DRPA 4GIVA 1FKKA 1A7XA 4LAXA 1FD9A 1GPFA 1LL7A 2RURA 3TC5A 2WM0A 4IQCA 5DO2A 1L1PA 3O5DA 1LJYA 3ARZA 3TCZA 1SR0A 1XHGA 3ARTA 2PPOA 1GRJA 1ZBWA 2XP9A 1WAWA 2MLZA 3JXVA 1QPFA 1C9HA 1CTNA 2PV1A 2XP4A 1Q6HA 1Q6UA 4MNKA 3RGCA 3ALFA 4DZ2A 3ARXA 4MNMA 5HTGA 2PPPA 1HKJA 3O5MA 4WKFA 3W4RA 1BKFA 1FKRA 4IT4A 4DWSD 4Z2GA 1JCHB 2KI3A 2KR7A 3ARRA 2MNTA 2L2SA 4DRNA 2DSZA 2AWGA 4U86A 1E6ZA 4QIBA 1E44A 1EHNA 5GQBA 2ZR4A 3NI6A 1GUVA 1NMVA 3ARWA 2DT1A 1R9HA 3AROA 3TDBA 4TW7A 1X6LA 3BXWA 4KR0B 3MDYB 1LL6A 2XP5A 4U84A 2FKEA 3IK8A 3PRBA 1JNSA 5HW8A 4C02B 4MSPA 4ZPWR 1ROUA 2B5UB 5DF0A 4WKAA 2QF8A 1B6CA 1IX5A 1FKLA 4NZCA 3JYMA 4J4OA 2G8ZA 4DRMA 4ODPA 4QZVB 4AY1A 3O5PA 3O5FA 2PPNA 1OGBA 3JYJA 1FKSA 2M1IA 3PRAA 1FAPA 3O5EA 5JH8A 3CGNA 3PRDA 1ZBCA 3RFWA 2OFNA 3AS0A 4MNLA 2ESCA 4MTVA 3ARVA 5HW6A 4ODNA 3ALGA 4W9PA 1TFVA 3BMBA 4ZS6A 1NWUA 2PI6A 1W9VA 3GTYX 1NMWA 4XAKA 5I98A 1F8AB 1JNEA 1KT0A 3KAFA 3KAIA 1HJWA 4ZPVR 3O5JA 5HWCA 3O5GA 1ZB5A 1TCOC 3WL1A 4BF8A 3QOKA 3WD3A 3IKDA 2UZ5A 3KAHA 5HW7A 1EYMA 1FKHA 3RM8A 1FFRA 4HBEA 4KQZA 4QT2A 2O92A 1J4RA 1D6OA 2MF9A 1BL4A 1LL4A 4FAPA 1OGGA 1H0GA 1T11A 2OLHA 3IKGA 1H0IA 3UF8A 3RMEA 1WB0A 5HT1A 1ITXA 1XRVA 5DIUA 1RD6A 1D7HA 1KT1A 2PV3A 3ARUA 4ODMA 4LAVA 1KFWA 4ODKA 1PINA 3WD4A 4DWSC 3WIJA 4PTMA 2WLZA 4GGQA 2DG4A 5BXJA 1W1TA 4O2TA 2KGJA 1Q1CA 2DPEA 3CGMA 1D7JA 1K9TA 1OWQA 1LG1A 1X6NA 2M2AA 4HARA 1QPLA 2ETNA 2PV2A 5GPGA 1NWSA 4Z2LA 1YATA 3O5OA 1FKFA 3WQVA 5HBFA 4HBOA 4Q22A 4TNSA 2PBCA 3OA5A 4TX0A 1E6PA 4Z2KA 1ZCNA 2ZQSA 2DG9A 4LAYA 4UDMA 3RM9A 3UI6A 1WNOA 2VN1A 4Z2JA 4DH0A 4W5UA 1HJVA 1SYTA 2LKNA 1QZ2A 2IUZA 1ZK6A 2XP3A 1FKGA 1UR9A 1N1AA 2K8IA 1FJDA 4P8WA 1W1YA 3B7XA 2RUDA 4ODOA 1NWTA 2RUQA 4WIWA 1HKMA 2Y78A 4URIA 4JYSA 2JZVA 1NH6A 1ZU8A 4DRIA 4JFKA 3O5RA 2G41A 3ARSA 1E15A 1EIBA 2PN0A 2O9OA 1EDQA 2FAPA 3AS1A 4JFMA 4S3KA 2KO7A 4W9OA 4R0XA 3ARYA 1J4IA 1VF8A 1W1PA 3WL0A 2LGOA 4G50A 4MAVA 4G2PA 1U79A 3EIPA 3B9DA 3CHCA 3FAPA 4LGXA 1HKIA 5DEZA 5HKGA 1FKTA 1NWRA 1W9UA 4MGVA 3OOBA 2KFWA 4WK9A 3KADA 4J4NA 4TW8A 2F23A 3KZ7A 3WKZA 2ZR6A 3WD2A 3KACA 2RSEA 2KE0A 4NNRA 4DT4A 1HXVA 2DSUA 1O6IA 1D7IA 2A3CA 4R5EA 3WD1A 1Q6IA 3CZ8A 2RUCA 3GPKA 2N87A 1EQ3A 3KABA 2DT0A 4W9QA 4DRHA 4IPXA
chains in the Genus database with same CATH topology
5B8IC 1E6NA 3IHZA 5D75A 4P8XA 2IF4A 1GOIA 3VAWA 3FY1A 4ODRA 4ODQA 2DG3A 2ZQTA 4IQ2A 5J6EA 2M08A 2YBTA 2ITKA 2MLXA 4DRKA 3NRKA 3B9EA 3H9RB 2A3BA 3UQAA 4DWSA 4P8VA 3FXYA 4L3NA 4WKHA 3WH0A 1PBKA 1YW5A 2VCDA 1FKIA 3ARPA 1JNDA 4TW6A 5DIVA 2WK2A 2ZR5A 2XP8A 4MPKA 1W1VA 1M5YA 3UQBA 3CH9A 2F4EA 4DWSB 4DRQA 3WD0A 3PR9A 3KAGA 2XP7A 4MNJA 2A3AA 3B9AA 1LQ0A 3CHEA 3UQIA 3UI5A 4ZPTR 1FKJA 4JFJA 2FDMA 2MLYA 2F21A 3ODKA 2LPVA 2ZQVA 5HUAA 3O5QA 2RQSA 4LAWA 1ZBVA 4JFLA 5HWBA 4N19A 1E6RA 5DITA 4ML4A 3KCEA 2D9FA 2ZQUA 3WQWA 4NSBA 4S3JA 4WJXA 3G6MA 4DZ3A 4ODLA 2XPAA 3AS2A 1P5QA 1FKBA 1ZL1A 1D2KA 1E9LA 3AQUA 1HJXA 2YBUA 4Q7NA 1W9PA 1ROTA 4U85A 1JNTA 4FN2A 4L72B 4P8UA 4DROA 2AOSA 2WLYA 3ARQA 1J4HA 5GPRA 1UR8A 2LJ4A 4DRJA 2B31A 3RM4A 1F40A 2XP6A 2A3EA 3AS3A 3LUOA 2MPHA 3B8SA 4IT6A 4Z2HA 1FFQA 2DSVA 3G6LA 1FKDA 1HKKA 1JVWA 3EY6A 4Z2IA 2DT3A 3O5LA 3I6CA 1Y0OA 2F2DA 2DSWA 1LG2A 3CHFA 3PA7A 1NSGA 4ITZA 1J6YA 4JFIA 1W26A 3UI4A 4QT3A 3NTPA 1ZBKA 2Q5AA 3O5IA 2XPBA 2DT2A 4TYOA 3CHDA 4DIPA 3O5KA 4DRPA 4GIVA 1FKKA 1A7XA 4LAXA 1FD9A 1GPFA 1LL7A 2RURA 3TC5A 2WM0A 4IQCA 5DO2A 1L1PA 3O5DA 1LJYA 3ARZA 3TCZA 1SR0A 1XHGA 3ARTA 2PPOA 2XP9A 1ZBWA 1WAWA 2MLZA 3JXVA 1QPFA 1C9HA 1CTNA 2PV1A 2XP4A 1Q6HA 1Q6UA 4MNKA 3RGCA 3ALFA 4DZ2A 3ARXA 4MNMA 5HTGA 2PPPA 1HKJA 3O5MA 4WKFA 3W4RA 1BKFA 1FKRA 4IT4A 4DWSD 4Z2GA 2KI3A 2KR7A 3ARRA 2MNTA 2L2SA 4DRNA 2DSZA 2AWGA 4U86A 1E6ZA 4QIBA 1EHNA 5GQBA 2ZR4A 3NI6A 1GUVA 1NMVA 3ARWA 2DT1A 1R9HA 3AROA 3TDBA 4TW7A 1X6LA 3BXWA 4KR0B 3MDYB 1LL6A 2XP5A 4U84A 2FKEA 3IK8A 3PRBA 1JNSA 5HW8A 4C02B 4MSPA 4ZPWR 1ROUA 5DF0A 4WKAA 2QF8A 1B6CA 1IX5A 1FKLA 4NZCA 3JYMA 4J4OA 2G8ZA 4DRMA 4ODPA 4QZVB 4AY1A 3O5PA 3O5FA 2PPNA 1OGBA 3JYJA 1FKSA 2M1IA 3PRAA 1FAPA 3O5EA 5JH8A 3CGNA 3PRDA 1ZBCA 3RFWA 2OFNA 3AS0A 4MNLA 2ESCA 4MTVA 3ARVA 5HW6A 4ODNA 3ALGA 4W9PA 1TFVA 4ZS6A 1NWUA 2PI6A 1W9VA 1NMWA 4XAKA 5I98A 1F8AB 1JNEA 1KT0A 3KAFA 3KAIA 1HJWA 4ZPVR 3O5JA 5HWCA 3O5GA 1ZB5A 1TCOC 3WL1A 4BF8A 3QOKA 3WD3A 3IKDA 2UZ5A 3KAHA 5HW7A 1EYMA 1FKHA 3RM8A 1FFRA 4HBEA 4KQZA 4QT2A 2O92A 1J4RA 1D6OA 2MF9A 1BL4A 1LL4A 4FAPA 1OGGA 1H0GA 1T11A 2OLHA 3IKGA 1H0IA 3UF8A 3RMEA 1WB0A 5HT1A 1ITXA 1XRVA 5DIUA 1RD6A 1D7HA 1KT1A 2PV3A 3ARUA 4ODMA 4LAVA 1KFWA 4ODKA 1PINA 3WD4A 4DWSC 3WIJA 4PTMA 2WLZA 4GGQA 2DG4A 5BXJA 1W1TA 4O2TA 2KGJA 1Q1CA 2DPEA 3CGMA 1D7JA 1K9TA 1OWQA 1LG1A 1X6NA 2M2AA 4HARA 1QPLA 2PV2A 5GPGA 1NWSA 4Z2LA 1YATA 3O5OA 1FKFA 3WQVA 5HBFA 4HBOA 4Q22A 4TNSA 2PBCA 3OA5A 4TX0A 1E6PA 4Z2KA 1ZCNA 2ZQSA 2DG9A 4LAYA 3RM9A 3UI6A 1WNOA 2VN1A 4Z2JA 4DH0A 4W5UA 1HJVA 1SYTA 2LKNA 1QZ2A 2IUZA 1ZK6A 2XP3A 1FKGA 1UR9A 1N1AA 2K8IA 1FJDA 4P8WA 1W1YA 3B7XA 2RUDA 4ODOA 1NWTA 2RUQA 4WIWA 1HKMA 2Y78A 4URIA 4JYSA 2JZVA 1NH6A 1ZU8A 4DRIA 4JFKA 3O5RA 2G41A 3ARSA 1E15A 1EIBA 2O9OA 1EDQA 2FAPA 3AS1A 4JFMA 4S3KA 2KO7A 4W9OA 4R0XA 3ARYA 1J4IA 1VF8A 1W1PA 3WL0A 2LGOA 4G50A 4MAVA 4G2PA 1U79A 3B9DA 3CHCA 3FAPA 4LGXA 1HKIA 5DEZA 5HKGA 1FKTA 1NWRA 1W9UA 4MGVA 3OOBA 2KFWA 4WK9A 3KADA 4J4NA 4TW8A 3KZ7A 3WKZA 2ZR6A 3WD2A 3KACA 2RSEA 2KE0A 4NNRA 4DT4A 1HXVA 2DSUA 1O6IA 1D7IA 2A3CA 4R5EA 3WD1A 1Q6IA 3CZ8A 2RUCA 3GPKA 2N87A 1EQ3A 3KABA 2DT0A 4W9QA 4DRHA 4IPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IK8 A;  5B8I C;  4DRO A;  3PRB A;  3CGM A;  1D7J A;  5HW8 A;  4C02 B;  4G50 A;  4MSP A;  2M2A A;  3IHZ A;  1JNS A;  1J4H A;  1QPL A;  1ROU A;  2PV2 A;  5D75 A;  5GPG A;  2IF4 A;  2LJ4 A;  3VAW A;  4DRJ A;  1YAT A;  4ODR A;  4ODQ A;  3O5O A;  1B6C A;  2DG3 A;  2ZQT A;  1F40 A;  1FKL A;  1FKF A;  2XP6 A;  4IQ2 A;  3JYM A;  4J4O A;  3LUO A;  4DRM A;  5J6E A;  4ODP A;  2MPH A;  2M08 A;  2ITK A;  2MLX A;  3O5P A;  3O5F A;  2PPN A;  4DRK A;  4TNS A;  3NRK A;  3JYJ A;  3H9R B;  2PBC A;  3UQA A;  1FKD A;  1FKS A;  1JVW A;  2M1I A;  3EY6 A;  4TX0 A;  1ZCN A;  2ZQS A;  2DG9 A;  4LAY A;  3UI6 A;  1FAP A;  2VN1 A;  3O5E A;  4U84 A;  3CGN A;  3PRD A;  4DH0 A;  3O5L A;  3RFW A;  2OFN A;  3I6C A;  1Y0O A;  2F2D A;  3WH0 A;  3PA7 A;  1NSG A;  4ITZ A;  1PBK A;  2LKN A;  5HW6 A;  1J6Y A;  1QZ2 A;  1YW5 A;  2VCD A;  1W26 A;  4JFI A;  4ODN A;  3UI4 A;  4QT3 A;  1FKI A;  1ZK6 A;  3NTP A;  2XP3 A;  2Q5A A;  4W9P A;  3O5I A;  4TW6 A;  1FKG A;  4IPX A;  2XPB A;  5DIV A;  2K8I A;  1N1A A;  4TYO A;  2ZR5 A;  1FJD A;  4DIP A;  2RUD A;  1NMW A;  2XP8 A;  3B7X A;  3O5K A;  2RUQ A;  1F8A B;  3KAF A;  1KT0 A;  4ODO A;  1M5Y A;  2Y78 A;  4DRP A;  5I98 A;  3UQB A;  4JYS A;  3KAI A;  4GIV A;  1FKK A;  2F4E A;  1A7X A;  4LAX A;  1FD9 A;  2JZV A;  3O5J A;  4DRQ A;  4DRI A;  4JFK A;  5HWC A;  2RUR A;  3O5G A;  3TC5 A;  3KAG A;  3O5R A;  4IQC A;  1L1P A;  1TCO C;  3O5D A;  2XP7 A;  4BF8 A;  3UQI A;  3TCZ A;  3UI5 A;  3IKD A;  2UZ5 A;  2FAP A;  3KAH A;  1FKJ A;  4JFJ A;  4JFM A;  5HW7 A;  1EYM A;  1FKH A;  2PPO A;  2KO7 A;  4W9O A;  2XP9 A;  4R0X A;  1J4I A;  2MLY A;  2MLZ A;  2F21 A;  4QT2 A;  2LGO A;  1QPF A;  3JXV A;  3ODK A;  1C9H A;  1J4R A;  1D6O A;  2LPV A;  2MF9 A;  2PV1 A;  2ZQV A;  5HUA A;  2XP4 A;  3O5Q A;  1BL4 A;  4G2P A;  2RQS A;  4LAW A;  4FAP A;  1Q6H A;  1Q6U A;  1U79 A;  4JFL A;  3RGC A;  3FAP A;  1T11 A;  5HWB A;  3IKG A;  4N19 A;  5DIT A;  4DZ2 A;  5HKG A;  3KCE A;  5HTG A;  2D9F A;  2PPP A;  3UF8 A;  1FKT A;  2ZQU A;  4MGV A;  5HT1 A;  3OOB A;  2KFW A;  3O5M A;  3KAD A;  4J4N A;  1BKF A;  5DIU A;  1FKR A;  2KI3 A;  1D7H A;  1KT1 A;  2PV3 A;  4TW8 A;  2KR7 A;  3KZ7 A;  2ZR6 A;  2MNT A;  4DZ3 A;  2L2S A;  4ODL A;  4DRN A;  2XPA A;  1P5Q A;  4ODM A;  4LAV A;  2AWG A;  2RSE A;  3KAC A;  1FKB A;  2KE0 A;  4ODK A;  4U86 A;  4NNR A;  4DT4 A;  1PIN A;  1HXV A;  4QIB A;  2ZR4 A;  4GGQ A;  3NI6 A;  1NMV A;  2DG4 A;  4W9Q A;  1D7I A;  1R9H A;  5BXJ A;  1ROT A;  4O2T A;  3TDB A;  1Q6I A;  2RUC A;  3GPK A;  2KGJ A;  2N87 A;  4TW7 A;  1Q1C A;  1JNT A;  4FN2 A;  4U85 A;  1EQ3 A;  3KAB A;  3MDY B;  2XP5 A;  4DRH A;  2FKE A; 
#chains in the Genus database with same CATH topology
 5B8I C;  1E6N A;  3IHZ A;  5D75 A;  4P8X A;  2IF4 A;  1GOI A;  3VAW A;  3FY1 A;  4ODR A;  4ODQ A;  2DG3 A;  2ZQT A;  4IQ2 A;  5J6E A;  2M08 A;  2YBT A;  2ITK A;  2MLX A;  4DRK A;  3NRK A;  3B9E A;  3H9R B;  2A3B A;  3UQA A;  4DWS A;  4P8V A;  3FXY A;  4L3N A;  4WKH A;  3WH0 A;  1PBK A;  1YW5 A;  2VCD A;  1FKI A;  3ARP A;  1JND A;  4TW6 A;  5DIV A;  2WK2 A;  2ZR5 A;  2XP8 A;  4MPK A;  1W1V A;  1M5Y A;  3UQB A;  3CH9 A;  2F4E A;  4DWS B;  4DRQ A;  3WD0 A;  3PR9 A;  3KAG A;  2XP7 A;  4MNJ A;  2A3A A;  3B9A A;  1LQ0 A;  3CHE A;  3UQI A;  3UI5 A;  4ZPT R;  1FKJ A;  4JFJ A;  2FDM A;  2EUL A;  2MLY A;  2F21 A;  3ODK A;  2LPV A;  2ZQV A;  5HUA A;  3O5Q A;  2RQS A;  4LAW A;  1ZBV A;  4JFL A;  5HWB A;  4N19 A;  1E6R A;  5DIT A;  4ML4 A;  3KCE A;  2D9F A;  2ZQU A;  3WQW A;  4NSB A;  4S3J A;  4WJX A;  3G6M A;  4DZ3 A;  4ODL A;  2XPA A;  3AS2 A;  1P5Q A;  3GU0 A;  1FKB A;  1ZL1 A;  1D2K A;  1E9L A;  3AQU A;  1HJX A;  2YBU A;  4Q7N A;  1W9P A;  1ROT A;  4U85 A;  1JNT A;  4FN2 A;  4L72 B;  4P8U A;  4DRO A;  2AOS A;  2WLY A;  3ARQ A;  1J4H A;  5GPR A;  1UR8 A;  2LJ4 A;  4DRJ A;  2B31 A;  3RM4 A;  1F40 A;  2XP6 A;  2A3E A;  3AS3 A;  3LUO A;  2MPH A;  3B8S A;  4IT6 A;  4Z2H A;  1FFQ A;  2DSV A;  3G6L A;  1FKD A;  1HKK A;  1JVW A;  3EY6 A;  4Z2I A;  2DT3 A;  3O5L A;  3I6C A;  1Y0O A;  2F2D A;  2DSW A;  1LG2 A;  3CHF A;  3PA7 A;  1NSG A;  4ITZ A;  1J6Y A;  4JFI A;  1W26 A;  2P4V A;  4QT3 A;  3UI4 A;  3NTP A;  1ZBK A;  2Q5A A;  3O5I A;  2XPB A;  2DT2 A;  4TYO A;  3CHD A;  4DIP A;  3O5K A;  4DRP A;  4GIV A;  1FKK A;  1A7X A;  4LAX A;  1FD9 A;  1GPF A;  1LL7 A;  2RUR A;  3TC5 A;  2WM0 A;  4IQC A;  5DO2 A;  1L1P A;  3O5D A;  1LJY A;  3ARZ A;  3TCZ A;  1SR0 A;  1XHG A;  3ART A;  2PPO A;  1GRJ A;  1ZBW A;  2XP9 A;  1WAW A;  2MLZ A;  3JXV A;  1QPF A;  1C9H A;  1CTN A;  2PV1 A;  2XP4 A;  1Q6H A;  1Q6U A;  4MNK A;  3RGC A;  3ALF A;  4DZ2 A;  3ARX A;  4MNM A;  5HTG A;  2PPP A;  1HKJ A;  3O5M A;  4WKF A;  3W4R A;  1BKF A;  1FKR A;  4IT4 A;  4DWS D;  4Z2G A;  1JCH B;  2KI3 A;  2KR7 A;  3ARR A;  2MNT A;  2L2S A;  4DRN A;  2DSZ A;  2AWG A;  4U86 A;  1E6Z A;  4QIB A;  1E44 A;  1EHN A;  5GQB A;  2ZR4 A;  3NI6 A;  1GUV A;  1NMV A;  3ARW A;  2DT1 A;  1R9H A;  3ARO A;  3TDB A;  4TW7 A;  1X6L A;  3BXW A;  4KR0 B;  3MDY B;  1LL6 A;  2XP5 A;  4U84 A;  2FKE A;  3IK8 A;  3PRB A;  1JNS A;  5HW8 A;  4C02 B;  4MSP A;  4ZPW R;  1ROU A;  2B5U B;  5DF0 A;  4WKA A;  2QF8 A;  1B6C A;  1IX5 A;  1FKL A;  4NZC A;  3JYM A;  4J4O A;  2G8Z A;  4DRM A;  4ODP A;  4QZV B;  4AY1 A;  3O5P A;  3O5F A;  2PPN A;  1OGB A;  3JYJ A;  1FKS A;  2M1I A;  3PRA A;  1FAP A;  3O5E A;  5JH8 A;  3CGN A;  3PRD A;  1ZBC A;  3RFW A;  2OFN A;  3AS0 A;  4MNL A;  2ESC A;  4MTV A;  3ARV A;  5HW6 A;  4ODN A;  3ALG A;  4W9P A;  1TFV A;  3BMB A;  4ZS6 A;  1NWU A;  2PI6 A;  1W9V A;  3GTY X;  1NMW A;  4XAK A;  5I98 A;  1F8A B;  1JNE A;  1KT0 A;  3KAF A;  3KAI A;  1HJW A;  4ZPV R;  3O5J A;  5HWC A;  3O5G A;  1ZB5 A;  1TCO C;  3WL1 A;  4BF8 A;  3QOK A;  3WD3 A;  3IKD A;  2UZ5 A;  3KAH A;  5HW7 A;  1EYM A;  1FKH A;  3RM8 A;  1FFR A;  4HBE A;  4KQZ A;  4QT2 A;  2O92 A;  1J4R A;  1D6O A;  2MF9 A;  1BL4 A;  1LL4 A;  4FAP A;  1OGG A;  1H0G A;  1T11 A;  2OLH A;  3IKG A;  1H0I A;  3UF8 A;  3RME A;  1WB0 A;  5HT1 A;  1ITX A;  1XRV A;  5DIU A;  1RD6 A;  1D7H A;  1KT1 A;  2PV3 A;  3ARU A;  4ODM A;  4LAV A;  1KFW A;  4ODK A;  1PIN A;  3WD4 A;  4DWS C;  3WIJ A;  4PTM A;  2WLZ A;  4GGQ A;  2DG4 A;  5BXJ A;  1W1T A;  4O2T A;  2KGJ A;  1Q1C A;  2DPE A;  3CGM A;  1D7J A;  1K9T A;  1OWQ A;  1LG1 A;  1X6N A;  2M2A A;  4HAR A;  1QPL A;  2ETN A;  2PV2 A;  5GPG A;  1NWS A;  4Z2L A;  1YAT A;  3O5O A;  1FKF A;  3WQV A;  5HBF A;  4HBO A;  4Q22 A;  4TNS A;  2PBC A;  3OA5 A;  4TX0 A;  1E6P A;  4Z2K A;  1ZCN A;  2ZQS A;  2DG9 A;  4LAY A;  4UDM A;  3RM9 A;  3UI6 A;  1WNO A;  2VN1 A;  4Z2J A;  4DH0 A;  4W5U A;  1HJV A;  1SYT A;  2LKN A;  1QZ2 A;  2IUZ A;  1ZK6 A;  2XP3 A;  1FKG A;  1UR9 A;  1N1A A;  2K8I A;  1FJD A;  4P8W A;  1W1Y A;  3B7X A;  2RUD A;  4ODO A;  1NWT A;  2RUQ A;  4WIW A;  1HKM A;  2Y78 A;  4URI A;  4JYS A;  2JZV A;  1NH6 A;  1ZU8 A;  4DRI A;  4JFK A;  3O5R A;  2G41 A;  3ARS A;  1E15 A;  1EIB A;  2PN0 A;  2O9O A;  1EDQ A;  2FAP A;  3AS1 A;  4JFM A;  4S3K A;  2KO7 A;  4W9O A;  4R0X A;  3ARY A;  1J4I A;  1VF8 A;  1W1P A;  3WL0 A;  2LGO A;  4G50 A;  4MAV A;  4G2P A;  1U79 A;  3EIP A;  3B9D A;  3CHC A;  3FAP A;  4LGX A;  1HKI A;  5DEZ A;  5HKG A;  1FKT A;  1NWR A;  1W9U A;  4MGV A;  3OOB A;  2KFW A;  4WK9 A;  3KAD A;  4J4N A;  4TW8 A;  2F23 A;  3KZ7 A;  3WKZ A;  2ZR6 A;  3WD2 A;  3KAC A;  2RSE A;  2KE0 A;  4NNR A;  4DT4 A;  1HXV A;  2DSU A;  1O6I A;  1D7I A;  2A3C A;  4R5E A;  3WD1 A;  1Q6I A;  3CZ8 A;  2RUC A;  3GPK A;  2N87 A;  1EQ3 A;  3KAB A;  2DT0 A;  4W9Q A;  4DRH A;  4IPX A; 
#chains in the Genus database with same CATH homology
 5B8I C;  1E6N A;  3IHZ A;  5D75 A;  4P8X A;  2IF4 A;  1GOI A;  3VAW A;  3FY1 A;  4ODR A;  4ODQ A;  2DG3 A;  2ZQT A;  4IQ2 A;  5J6E A;  2M08 A;  2YBT A;  2ITK A;  2MLX A;  4DRK A;  3NRK A;  3B9E A;  3H9R B;  2A3B A;  3UQA A;  4DWS A;  4P8V A;  3FXY A;  4L3N A;  4WKH A;  3WH0 A;  1PBK A;  1YW5 A;  2VCD A;  1FKI A;  3ARP A;  1JND A;  4TW6 A;  5DIV A;  2WK2 A;  2ZR5 A;  2XP8 A;  4MPK A;  1W1V A;  1M5Y A;  3UQB A;  3CH9 A;  2F4E A;  4DWS B;  4DRQ A;  3WD0 A;  3PR9 A;  3KAG A;  2XP7 A;  4MNJ A;  2A3A A;  3B9A A;  1LQ0 A;  3CHE A;  3UQI A;  3UI5 A;  4ZPT R;  1FKJ A;  4JFJ A;  2FDM A;  2MLY A;  2F21 A;  3ODK A;  2LPV A;  2ZQV A;  5HUA A;  3O5Q A;  2RQS A;  4LAW A;  1ZBV A;  4JFL A;  5HWB A;  4N19 A;  1E6R A;  5DIT A;  4ML4 A;  3KCE A;  2D9F A;  2ZQU A;  3WQW A;  4NSB A;  4S3J A;  4WJX A;  3G6M A;  4DZ3 A;  4ODL A;  2XPA A;  3AS2 A;  1P5Q A;  1FKB A;  1ZL1 A;  1D2K A;  1E9L A;  3AQU A;  1HJX A;  2YBU A;  4Q7N A;  1W9P A;  1ROT A;  4U85 A;  1JNT A;  4FN2 A;  4L72 B;  4P8U A;  4DRO A;  2AOS A;  2WLY A;  3ARQ A;  1J4H A;  5GPR A;  1UR8 A;  2LJ4 A;  4DRJ A;  2B31 A;  3RM4 A;  1F40 A;  2XP6 A;  2A3E A;  3AS3 A;  3LUO A;  2MPH A;  3B8S A;  4IT6 A;  4Z2H A;  1FFQ A;  2DSV A;  3G6L A;  1FKD A;  1HKK A;  1JVW A;  3EY6 A;  4Z2I A;  2DT3 A;  3O5L A;  3I6C A;  1Y0O A;  2F2D A;  2DSW A;  1LG2 A;  3CHF A;  3PA7 A;  1NSG A;  4ITZ A;  1J6Y A;  4JFI A;  1W26 A;  3UI4 A;  4QT3 A;  3NTP A;  1ZBK A;  2Q5A A;  3O5I A;  2XPB A;  2DT2 A;  4TYO A;  3CHD A;  4DIP A;  3O5K A;  4DRP A;  4GIV A;  1FKK A;  1A7X A;  4LAX A;  1FD9 A;  1GPF A;  1LL7 A;  2RUR A;  3TC5 A;  2WM0 A;  4IQC A;  5DO2 A;  1L1P A;  3O5D A;  1LJY A;  3ARZ A;  3TCZ A;  1SR0 A;  1XHG A;  3ART A;  2PPO A;  2XP9 A;  1ZBW A;  1WAW A;  2MLZ A;  3JXV A;  1QPF A;  1C9H A;  1CTN A;  2PV1 A;  2XP4 A;  1Q6H A;  1Q6U A;  4MNK A;  3RGC A;  3ALF A;  4DZ2 A;  3ARX A;  4MNM A;  5HTG A;  2PPP A;  1HKJ A;  3O5M A;  4WKF A;  3W4R A;  1BKF A;  1FKR A;  4IT4 A;  4DWS D;  4Z2G A;  2KI3 A;  2KR7 A;  3ARR A;  2MNT A;  2L2S A;  4DRN A;  2DSZ A;  2AWG A;  4U86 A;  1E6Z A;  4QIB A;  1EHN A;  5GQB A;  2ZR4 A;  3NI6 A;  1GUV A;  1NMV A;  3ARW A;  2DT1 A;  1R9H A;  3ARO A;  3TDB A;  4TW7 A;  1X6L A;  3BXW A;  4KR0 B;  3MDY B;  1LL6 A;  2XP5 A;  4U84 A;  2FKE A;  3IK8 A;  3PRB A;  1JNS A;  5HW8 A;  4C02 B;  4MSP A;  4ZPW R;  1ROU A;  5DF0 A;  4WKA A;  2QF8 A;  1B6C A;  1IX5 A;  1FKL A;  4NZC A;  3JYM A;  4J4O A;  2G8Z A;  4DRM A;  4ODP A;  4QZV B;  4AY1 A;  3O5P A;  3O5F A;  2PPN A;  1OGB A;  3JYJ A;  1FKS A;  2M1I A;  3PRA A;  1FAP A;  3O5E A;  5JH8 A;  3CGN A;  3PRD A;  1ZBC A;  3RFW A;  2OFN A;  3AS0 A;  4MNL A;  2ESC A;  4MTV A;  3ARV A;  5HW6 A;  4ODN A;  3ALG A;  4W9P A;  1TFV A;  4ZS6 A;  1NWU A;  2PI6 A;  1W9V A;  1NMW A;  4XAK A;  5I98 A;  1F8A B;  1JNE A;  1KT0 A;  3KAF A;  3KAI A;  1HJW A;  4ZPV R;  3O5J A;  5HWC A;  3O5G A;  1ZB5 A;  1TCO C;  3WL1 A;  4BF8 A;  3QOK A;  3WD3 A;  3IKD A;  2UZ5 A;  3KAH A;  5HW7 A;  1EYM A;  1FKH A;  3RM8 A;  1FFR A;  4HBE A;  4KQZ A;  4QT2 A;  2O92 A;  1J4R A;  1D6O A;  2MF9 A;  1BL4 A;  1LL4 A;  4FAP A;  1OGG A;  1H0G A;  1T11 A;  2OLH A;  3IKG A;  1H0I A;  3UF8 A;  3RME A;  1WB0 A;  5HT1 A;  1ITX A;  1XRV A;  5DIU A;  1RD6 A;  1D7H A;  1KT1 A;  2PV3 A;  3ARU A;  4ODM A;  4LAV A;  1KFW A;  4ODK A;  1PIN A;  3WD4 A;  4DWS C;  3WIJ A;  4PTM A;  2WLZ A;  4GGQ A;  2DG4 A;  5BXJ A;  1W1T A;  4O2T A;  2KGJ A;  1Q1C A;  2DPE A;  3CGM A;  1D7J A;  1K9T A;  1OWQ A;  1LG1 A;  1X6N A;  2M2A A;  4HAR A;  1QPL A;  2PV2 A;  5GPG A;  1NWS A;  4Z2L A;  1YAT A;  3O5O A;  1FKF A;  3WQV A;  5HBF A;  4HBO A;  4Q22 A;  4TNS A;  2PBC A;  3OA5 A;  4TX0 A;  1E6P A;  4Z2K A;  1ZCN A;  2ZQS A;  2DG9 A;  4LAY A;  3RM9 A;  3UI6 A;  1WNO A;  2VN1 A;  4Z2J A;  4DH0 A;  4W5U A;  1HJV A;  1SYT A;  2LKN A;  1QZ2 A;  2IUZ A;  1ZK6 A;  2XP3 A;  1FKG A;  1UR9 A;  1N1A A;  2K8I A;  1FJD A;  4P8W A;  1W1Y A;  3B7X A;  2RUD A;  4ODO A;  1NWT A;  2RUQ A;  4WIW A;  1HKM A;  2Y78 A;  4URI A;  4JYS A;  2JZV A;  1NH6 A;  1ZU8 A;  4DRI A;  4JFK A;  3O5R A;  2G41 A;  3ARS A;  1E15 A;  1EIB A;  2O9O A;  1EDQ A;  2FAP A;  3AS1 A;  4JFM A;  4S3K A;  2KO7 A;  4W9O A;  4R0X A;  3ARY A;  1J4I A;  1VF8 A;  1W1P A;  3WL0 A;  2LGO A;  4G50 A;  4MAV A;  4G2P A;  1U79 A;  3B9D A;  3CHC A;  3FAP A;  4LGX A;  1HKI A;  5DEZ A;  5HKG A;  1FKT A;  1NWR A;  1W9U A;  4MGV A;  3OOB A;  2KFW A;  4WK9 A;  3KAD A;  4J4N A;  4TW8 A;  3KZ7 A;  3WKZ A;  2ZR6 A;  3WD2 A;  3KAC A;  2RSE A;  2KE0 A;  4NNR A;  4DT4 A;  1HXV A;  2DSU A;  1O6I A;  1D7I A;  2A3C A;  4R5E A;  3WD1 A;  1Q6I A;  3CZ8 A;  2RUC A;  3GPK A;  2N87 A;  1EQ3 A;  3KAB A;  2DT0 A;  4W9Q A;  4DRH A;  4IPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...