4DRJA

O-crystal structure of the ppiase domain of fkbp52, rapamycin and the frb fragment of mtor
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
PMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
total genus 27
structure length 121
sequence length 121
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drjA00
4DRNA 1NMWA 1U79A 2PBCA 2ZQUA 4DRMA 1NMVA 3LUOA 5HWCA 4ODRA 1B6CA 2KFWA 1ROUA 3KABA 3KACA 1FKFA 2JZVA 2XP8A 3RGCA 4GIVA 3UI4A 3UI5A 2LKNA 1KT1A 1QPFA 2PV1A 3KAHA 2XP4A 3IHZA 3PRBA 4TW7A 4DRPA 1Q6IA 2LGOA 2XP5A 4TNSA 4C02B 4QT3A 3KAIA 4G50A 3I6CA 2N87A 2XP9A 4W9PA 4JFJA 2ZQTA 1FKJA 2VN1A 1BKFA 1J4HA 4MGVA 1Q1CA 3PRDA 4QIBA 4R0XA 1HXVA 2D9FA 1J4IA 4DT4A 2RUDA 1ZCNA 3CGMA 5GPGA 2RQSA 2XP3A 2XPBA 4JFMA 5B8IC 1A7XA 2XPAA 1JNTA 1Q6HA 1FKBA 2MLYA 2Q5AA 4GGQA 2ZQSA 1FAPA 1FKGA 2FKEA 4JYSA 3RFWA 4DZ2A 1M5YA 2ZR6A 4U84A 2XP7A 2ZR4A 3B7XA 3O5OA 5DIVA 1ROTA 4DRJA 3O5MA 1BL4A 4ODLA 5BXJA 2MPHA 1N1AA 1FKLA 2RUQA 4MSPA 4NNRA 3O5LA 2DG4A 4IPXA 5J6EA 2PPPA 4BF8A 1FKDA 1FKSA 3IK8A 5HWBA 1FKRA 1F8AB 3NTPA 1KT0A 4JFKA 1L1PA 4FN2A 4DRQA 2XP6A 4FAPA 1YATA 3O5EA 2LPVA 4JFIA 4QT2A 3KAFA 1JNSA 4TW8A 3UF8A 4ODMA 4DRKA 2MNTA 4JFLA 3O5FA 4DROA 4G2PA 2PV2A 2KR7A 2VCDA 3O5QA 2IF4A 1NSGA 4DIPA 1D7IA 3NRKA 4N19A 4TW6A 3TCZA 2L2SA 4ODOA 4U85A 4LAYA 4ODPA 4LAXA 5HKGA 3UQBA 2ITKA 2PPOA 4DRHA 5HT1A 3PA7A 1Y0OA 1PBKA 4DH0A 2PPNA 3O5GA 4IQ2A 1TCOC 5I98A 2RUCA 5HW6A 1F40A 1D7JA 4W9QA 3OOBA 5DITA 3UQIA 1C9HA 2PV3A 1YW5A 2FAPA 4ITZA 2KO7A 2KE0A 3UQAA 2MLZA 1R9HA 3VAWA 2ZQVA 4O2TA 3H9RB 4W9OA 4DRIA 5HUAA 2Y78A 3JYMA 3KAGA 3JXVA 5HW8A 4IQCA 1FKKA 2M1IA 4ODNA 5DIUA 1QZ2A 1FD9A 1PINA 3O5DA 3TC5A 3JYJA 3UI6A 4LAWA 1J6YA 3O5PA 1W26A 3O5IA 2OFNA 4ODQA 1Q6UA 3FAPA 3MDYB 3O5JA 2AWGA 3NI6A 4TX0A 5HW7A 1JVWA 2DG9A 1J4RA 3O5RA 1ZK6A 4ODKA 4U86A 3KZ7A 4TYOA 1T11A 4DZ3A 1D6OA 2DG3A 2F2DA 2RSEA 2F4EA 1FKIA 3O5KA 2K8IA 2M08A 3IKGA 2RURA 3EY6A 3GPKA 1FKTA 1D7HA 4LAVA 2F21A 5D75A 1EQ3A 5HTGA 3KCEA 3IKDA 3WH0A 1FKHA 1P5QA 2KI3A 2MF9A 2ZR5A 3KADA 3ODKA 4J4NA 4J4OA 3CGNA 2LJ4A 2KGJA 3TDBA 1FJDA 2MLXA 2UZ5A 2M2AA 1EYMA 1QPLA
chains in the Genus database with same CATH superfamily
4DRNA 1U79A 2PBCA 3B8SA 1E9LA 1HJWA 3KACA 4KQZA 3UI4A 3UI5A 2LKNA 1QPFA 3KAHA 4DRPA 3IHZA 5DF0A 1ZU8A 4QT3A 3KAIA 3I6CA 4S3JA 1XRVA 4JFJA 1E6PA 1J4HA 4QIBA 3PRDA 3WD0A 4AY1A 1NH6A 1W9PA 5HBFA 1GPFA 1FKGA 4JYSA 1WB0A 3ARYA 1E6NA 2DSVA 1E44A 4HBOA 4NNRA 1OGGA 3O5LA 4Q22A 1FKDA 1FKSA 3IK8A 5HWBA 1HJVA 4MNKA 4XAKA 3NTPA 4JFKA 3CHFA 1EIBA 3WQVA 3KAFA 1JNSA 3ARTA 2O9OA 2VCDA 1NWTA 2A3EA 2IF4A 3QOKA 4S3KA 3WL0A 1HJXA 5GPRA 3TCZA 2EULA 2L2SA 4ODPA 1NWUA 3UQBA 2ITKA 4DRHA 1PBKA 4L3NA 1TCOC 4Z2JA 5I98A 1ZBCA 2RUCA 3WD4A 2G8ZA 1C9HA 1YW5A 2FAPA 1ZL1A 2WM0A 4HARA 1FFQA 2OLHA 3OA5A 1E6ZA 4IQCA 2M1IA 2ETNA 2AOSA 4NZCA 1D2KA 1J6YA 1W26A 1GRJA 1NWSA 2AWGA 3ARZA 1JVWA 2DG9A 1J4RA 1SYTA 3AS3A 4U86A 1T11A 2F4EA 3GTYX 2K8IA 2RURA 1EQ3A 2F21A 5HTGA 1KFWA 3BMBA 3WH0A 4J4OA 4J4NA 2A3CA 2KGJA 5DEZA 3BXWA 4ZPVR 3TDBA 3W4RA 4Q7NA 1E6RA 2ZQUA 1NMVA 5HWCA 4ML4A 1ROUA 3KABA 4MNLA 3ARSA 3RGCA 2PV1A 4W5UA 2XP4A 3PRBA 3CHDA 3ALFA 2XP5A 4TNSA 4C02B 3ALGA 5GQBA 2N87A 1UR8A 4PTMA 2VN1A 4MGVA 1X6NA 1HXVA 1JNDA 1J4IA 5JH8A 3CHEA 2XP3A 4WKHA 2DSWA 4P8XA 2Q5AA 2FKEA 2FDMA 2ZR4A 1ZBVA 1ZB5A 5DIVA 4DRJA 2MPHA 4MPKA 2DG4A 2PPPA 4BF8A 1FKRA 1W1YA 1F8AB 1L1PA 4DRQA 2XP6A 4FAPA 4L72B 2O92A 3O5EA 2LPVA 4IT4A 4JFIA 4QT2A 4TW8A 3WD1A 2DT0A 4DRKA 4HBEA 4JFLA 3O5FA 4DROA 3B9EA 3O5QA 3PRAA 1D7IA 3NRKA 4ZS6A 4WK9A 5HKGA 1GUVA 3RMEA 2PPNA 4IQ2A 1D7JA 1LG2A 5DITA 1LL4A 4ITZA 1R9HA 4O2TA 2PN0A 4W9OA 5HUAA 3JYMA 3KAGA 4WKAA 3TC5A 3RM9A 3FXYA 3O5PA 3O5IA 4Z2GA 1WNOA 2OFNA 4TX0A 3O5JA 1UR9A 3KZ7A 4DZ3A 3GPKA 1HKKA 4MNMA 4Z2IA 3KADA 4MAVA 3CGNA 1FJDA 2UZ5A 1QPLA 1O6IA 1JNEA 3LUOA 3CZ8A 1B6CA 3ARXA 4WJXA 1W1TA 1FKFA 4R5EA 3B9DA 4TW7A 1X6LA 2LGOA 4QZVB 2ZQTA 3ARRA 3B9AA 2PI6A 2RUDA 4DT4A 3CGMA 4URIA 2RQSA 2XPBA 4JFMA 1K9TA 2DSZA 1A7XA 4P8UA 2XPAA 1JNTA 3ARUA 1FKBA 4WIWA 3RFWA 1M5YA 4U84A 2XP7A 4ZPTR 3O5OA 1ROTA 2F23A 3O5MA 1BL4A 4ODLA 1N1AA 1LL6A 2RUQA 4MSPA 4IPXA 5J6EA 1W1VA 4FN2A 1E15A 1YATA 3WD3A 3WQWA 3UF8A 3EIPA 2MNTA 1H0GA 3AS0A 2PV2A 4Z2KA 3ARVA 4DIPA 2P4VA 1NWRA 4TW6A 3CHCA 4ODOA 1XHGA 4LAYA 4LAXA 2PPOA 5HT1A 4DH0A 1Y0OA 2IUZA 2DT3A 3G6LA 1LG1A 4UDMA 4W9QA 1IX5A 3AS1A 2PV3A 1WAWA 1HKIA 2KE0A 3WL1A 4MNJA 4DRIA 3JXVA 4MTVA 4P8VA 2A3BA 4ODNA 1FKKA 5DIUA 3O5DA 3WIJA 3JYJA 2WLYA 3UI6A 1RD6A 2B5UB 1Q6UA 3FAPA 3MDYB 1W1PA 3NI6A 1W9VA 3ARQA 1ZBKA 1D6OA 2DG3A 2ESCA 2F2DA 1H0IA 2RSEA 1FKIA 3AROA 3IKGA 3EY6A 2DT1A 1FKTA 1D7HA 4LAVA 5D75A 1ITXA 1FKHA 1P5QA 2KI3A 2MF9A 2ZR5A 3G6MA 3ODKA 4DWSA 2LJ4A 2B31A 2MLXA 2DSUA 1EYMA 4DZ2A 1NMWA 4DRMA 1VF8A 4ODRA 2KFWA 1GOIA 2JZVA 2XP8A 4GIVA 1KT1A 1Q6IA 3ARPA 4DWSB 4G50A 1TFVA 2XP9A 4W9PA 1CTNA 1FKJA 3PR9A 1BKFA 1Q1CA 3RM4A 4R0XA 2D9FA 1HKMA 1ZCNA 3AQUA 1LQ0A 2WK2A 5GPGA 5B8IC 1Q6HA 2MLYA 4GGQA 2ZQSA 4P8WA 1FAPA 2ZR6A 3B7XA 1EHNA 5BXJA 1FKLA 2G41A 1LL7A 1KT0A 1OWQA 4ODMA 1JCHB 3RM8A 4G2PA 3WKZA 2KR7A 1ZBWA 1NSGA 2YBUA 4Z2HA 4N19A 4U85A 4LGXA 3PA7A 3ARWA 3O5GA 5HW6A 1F40A 1LJYA 3GU0A 1FFRA 2DT2A 3OOBA 3UQIA 2WLZA 1HKJA 1W9UA 2KO7A 3UQAA 2MLZA 3VAWA 2ZQVA 3H9RB 3CH9A 1OGBA 2Y78A 5HW8A 1QZ2A 5DO2A 2A3AA 4NSBA 4WKFA 1FD9A 1PINA 3AS2A 1EDQA 4LAWA 4Z2LA 4ODQA 5HW7A 3O5RA 2QF8A 4ODKA 1ZK6A 4KR0B 4TYOA 3O5KA 2M08A 3WD2A 4ZPWR 3KCEA 3IKDA 2YBTA 4DWSC 4IT6A 3FY1A 4DWSD 1SR0A 2DPEA 2M2AA
chains in the Genus database with same CATH topology
4DRNA 1U79A 2PBCA 3B8SA 1E9LA 1HJWA 3KACA 4KQZA 3UI4A 3UI5A 2LKNA 1QPFA 3KAHA 4DRPA 3IHZA 5DF0A 1ZU8A 4QT3A 3KAIA 3I6CA 4S3JA 1XRVA 4JFJA 1E6PA 1J4HA 4QIBA 3PRDA 3WD0A 4AY1A 1NH6A 1W9PA 5HBFA 1GPFA 1FKGA 4JYSA 1WB0A 3ARYA 1E6NA 2DSVA 4HBOA 4NNRA 1OGGA 3O5LA 4Q22A 1FKDA 1FKSA 3IK8A 5HWBA 1HJVA 4MNKA 4XAKA 3NTPA 4JFKA 3CHFA 1EIBA 3WQVA 3KAFA 1JNSA 3ARTA 2O9OA 2VCDA 1NWTA 2A3EA 2IF4A 3QOKA 4S3KA 3WL0A 1HJXA 5GPRA 3TCZA 2L2SA 4ODPA 1NWUA 3UQBA 2ITKA 4DRHA 1PBKA 4L3NA 1TCOC 4Z2JA 5I98A 1ZBCA 2RUCA 3WD4A 2G8ZA 1C9HA 1YW5A 2FAPA 1ZL1A 2WM0A 4HARA 1FFQA 2OLHA 3OA5A 1E6ZA 4IQCA 2M1IA 2AOSA 4NZCA 1D2KA 1J6YA 1W26A 1NWSA 2AWGA 3ARZA 1JVWA 2DG9A 1J4RA 1SYTA 3AS3A 4U86A 1T11A 2F4EA 2K8IA 2RURA 1EQ3A 2F21A 5HTGA 1KFWA 3WH0A 4J4OA 4J4NA 2A3CA 2KGJA 5DEZA 3BXWA 4ZPVR 3TDBA 3W4RA 4Q7NA 1E6RA 2ZQUA 1NMVA 5HWCA 4ML4A 1ROUA 3KABA 4MNLA 3ARSA 3RGCA 2PV1A 4W5UA 2XP4A 3PRBA 3CHDA 3ALFA 2XP5A 4TNSA 4C02B 3ALGA 5GQBA 2N87A 1UR8A 4PTMA 2VN1A 4MGVA 1X6NA 1HXVA 1JNDA 1J4IA 5JH8A 3CHEA 2XP3A 4WKHA 2DSWA 4P8XA 2Q5AA 2FKEA 2FDMA 2ZR4A 1ZBVA 1ZB5A 5DIVA 4DRJA 2MPHA 4MPKA 2DG4A 2PPPA 4BF8A 1FKRA 1W1YA 1F8AB 1L1PA 4DRQA 2XP6A 4FAPA 4L72B 2O92A 3O5EA 2LPVA 4IT4A 4JFIA 4QT2A 4TW8A 3WD1A 2DT0A 4DRKA 4HBEA 4JFLA 3O5FA 4DROA 3B9EA 3O5QA 3PRAA 1D7IA 3NRKA 4ZS6A 4WK9A 5HKGA 1GUVA 3RMEA 2PPNA 4IQ2A 1D7JA 1LG2A 5DITA 1LL4A 4ITZA 1R9HA 4O2TA 4W9OA 5HUAA 3JYMA 3KAGA 4WKAA 3TC5A 3RM9A 3FXYA 3O5PA 3O5IA 4Z2GA 1WNOA 2OFNA 4TX0A 3O5JA 1UR9A 3KZ7A 4DZ3A 3GPKA 1HKKA 4MNMA 4Z2IA 3KADA 4MAVA 3CGNA 1FJDA 2UZ5A 1QPLA 1O6IA 1JNEA 3LUOA 3CZ8A 1B6CA 3ARXA 4WJXA 1W1TA 1FKFA 4R5EA 3B9DA 4TW7A 1X6LA 2LGOA 4QZVB 2ZQTA 3ARRA 3B9AA 2PI6A 2RUDA 4DT4A 3CGMA 4URIA 2RQSA 2XPBA 4JFMA 1K9TA 2DSZA 1A7XA 4P8UA 2XPAA 1JNTA 3ARUA 1FKBA 4WIWA 3RFWA 1M5YA 4U84A 2XP7A 4ZPTR 3O5OA 1ROTA 3O5MA 1BL4A 4ODLA 1N1AA 1LL6A 2RUQA 4MSPA 4IPXA 5J6EA 1W1VA 4FN2A 1E15A 1YATA 3WD3A 3WQWA 3UF8A 2MNTA 1H0GA 3AS0A 2PV2A 4Z2KA 3ARVA 4DIPA 1NWRA 4TW6A 3CHCA 4ODOA 1XHGA 4LAYA 4LAXA 2PPOA 5HT1A 4DH0A 1Y0OA 2IUZA 2DT3A 3G6LA 1LG1A 4W9QA 1IX5A 3AS1A 2PV3A 1WAWA 1HKIA 2KE0A 3WL1A 4MNJA 4DRIA 3JXVA 4MTVA 4P8VA 2A3BA 4ODNA 1FKKA 5DIUA 3O5DA 3WIJA 3JYJA 2WLYA 3UI6A 1RD6A 1Q6UA 3FAPA 3MDYB 1W1PA 3NI6A 1W9VA 3ARQA 1ZBKA 1D6OA 2DG3A 2ESCA 2F2DA 1H0IA 2RSEA 1FKIA 3AROA 3IKGA 3EY6A 2DT1A 1FKTA 1D7HA 4LAVA 5D75A 1ITXA 1FKHA 1P5QA 2KI3A 2MF9A 2ZR5A 3G6MA 3ODKA 4DWSA 2LJ4A 2B31A 2MLXA 2DSUA 1EYMA 4DZ2A 1NMWA 4DRMA 1VF8A 4ODRA 2KFWA 1GOIA 2JZVA 2XP8A 4GIVA 1KT1A 1Q6IA 3ARPA 4DWSB 4G50A 1TFVA 2XP9A 4W9PA 1CTNA 1FKJA 3PR9A 1BKFA 1Q1CA 3RM4A 4R0XA 2D9FA 1HKMA 1ZCNA 3AQUA 1LQ0A 2WK2A 5GPGA 5B8IC 1Q6HA 2MLYA 4GGQA 2ZQSA 4P8WA 1FAPA 2ZR6A 3B7XA 1EHNA 5BXJA 1FKLA 2G41A 1LL7A 1KT0A 1OWQA 4ODMA 3RM8A 4G2PA 3WKZA 2KR7A 1ZBWA 1NSGA 2YBUA 4Z2HA 4N19A 4U85A 4LGXA 3PA7A 3ARWA 3O5GA 5HW6A 1F40A 1LJYA 1FFRA 2DT2A 3OOBA 3UQIA 2WLZA 1HKJA 1W9UA 2KO7A 3UQAA 2MLZA 3VAWA 2ZQVA 3H9RB 3CH9A 1OGBA 2Y78A 5HW8A 1QZ2A 5DO2A 2A3AA 4NSBA 4WKFA 1FD9A 1PINA 3AS2A 1EDQA 4LAWA 4Z2LA 4ODQA 5HW7A 3O5RA 2QF8A 4ODKA 1ZK6A 4KR0B 4TYOA 3O5KA 2M08A 3WD2A 4ZPWR 3KCEA 3IKDA 2YBTA 4DWSC 4IT6A 3FY1A 4DWSD 1SR0A 2DPEA 2M2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRN A;  1NMW A;  1U79 A;  2PBC A;  2ZQU A;  4DRM A;  1NMV A;  3LUO A;  5HWC A;  4ODR A;  1B6C A;  2KFW A;  1ROU A;  3KAB A;  3KAC A;  1FKF A;  2JZV A;  2XP8 A;  3RGC A;  4GIV A;  3UI4 A;  3UI5 A;  2LKN A;  1KT1 A;  1QPF A;  2PV1 A;  3KAH A;  2XP4 A;  3IHZ A;  3PRB A;  4TW7 A;  4DRP A;  1Q6I A;  2LGO A;  2XP5 A;  4TNS A;  4C02 B;  4QT3 A;  3KAI A;  4G50 A;  3I6C A;  2N87 A;  2XP9 A;  4W9P A;  4JFJ A;  2ZQT A;  1FKJ A;  2VN1 A;  1BKF A;  1J4H A;  4MGV A;  1Q1C A;  3PRD A;  4QIB A;  4R0X A;  1HXV A;  2D9F A;  1J4I A;  4DT4 A;  2RUD A;  1ZCN A;  3CGM A;  5GPG A;  2RQS A;  2XP3 A;  2XPB A;  4JFM A;  5B8I C;  1A7X A;  2XPA A;  1JNT A;  1Q6H A;  1FKB A;  2MLY A;  2Q5A A;  4GGQ A;  2ZQS A;  1FAP A;  1FKG A;  2FKE A;  4JYS A;  3RFW A;  4DZ2 A;  1M5Y A;  2ZR6 A;  4U84 A;  2XP7 A;  2ZR4 A;  3B7X A;  3O5O A;  5DIV A;  1ROT A;  4DRJ A;  3O5M A;  1BL4 A;  4ODL A;  5BXJ A;  2MPH A;  1N1A A;  1FKL A;  2RUQ A;  4MSP A;  4NNR A;  3O5L A;  2DG4 A;  4IPX A;  5J6E A;  2PPP A;  4BF8 A;  1FKD A;  1FKS A;  3IK8 A;  5HWB A;  1FKR A;  1F8A B;  3NTP A;  1KT0 A;  4JFK A;  1L1P A;  4FN2 A;  4DRQ A;  2XP6 A;  4FAP A;  1YAT A;  3O5E A;  2LPV A;  4JFI A;  4QT2 A;  3KAF A;  1JNS A;  4TW8 A;  3UF8 A;  4ODM A;  4DRK A;  2MNT A;  4JFL A;  3O5F A;  4DRO A;  4G2P A;  2PV2 A;  2KR7 A;  2VCD A;  3O5Q A;  2IF4 A;  1NSG A;  4DIP A;  1D7I A;  3NRK A;  4N19 A;  4TW6 A;  3TCZ A;  2L2S A;  4ODO A;  4U85 A;  4LAY A;  4ODP A;  4LAX A;  5HKG A;  3UQB A;  2ITK A;  2PPO A;  4DRH A;  5HT1 A;  3PA7 A;  1Y0O A;  1PBK A;  4DH0 A;  2PPN A;  3O5G A;  4IQ2 A;  1TCO C;  5I98 A;  2RUC A;  5HW6 A;  1F40 A;  1D7J A;  4W9Q A;  3OOB A;  5DIT A;  3UQI A;  1C9H A;  2PV3 A;  1YW5 A;  2FAP A;  4ITZ A;  2KO7 A;  2KE0 A;  3UQA A;  2MLZ A;  1R9H A;  3VAW A;  2ZQV A;  4O2T A;  3H9R B;  4W9O A;  4DRI A;  5HUA A;  2Y78 A;  3JYM A;  3KAG A;  3JXV A;  5HW8 A;  4IQC A;  1FKK A;  2M1I A;  4ODN A;  5DIU A;  1QZ2 A;  1FD9 A;  1PIN A;  3O5D A;  3TC5 A;  3JYJ A;  3UI6 A;  4LAW A;  1J6Y A;  3O5P A;  1W26 A;  3O5I A;  2OFN A;  4ODQ A;  1Q6U A;  3FAP A;  3MDY B;  3O5J A;  2AWG A;  3NI6 A;  4TX0 A;  5HW7 A;  1JVW A;  2DG9 A;  1J4R A;  3O5R A;  1ZK6 A;  4ODK A;  4U86 A;  3KZ7 A;  4TYO A;  1T11 A;  4DZ3 A;  1D6O A;  2DG3 A;  2F2D A;  2RSE A;  2F4E A;  1FKI A;  3O5K A;  2K8I A;  2M08 A;  3IKG A;  2RUR A;  3EY6 A;  3GPK A;  1FKT A;  1D7H A;  4LAV A;  2F21 A;  5D75 A;  1EQ3 A;  5HTG A;  3KCE A;  3IKD A;  3WH0 A;  1FKH A;  1P5Q A;  2KI3 A;  2MF9 A;  2ZR5 A;  3KAD A;  3ODK A;  4J4N A;  4J4O A;  3CGN A;  2LJ4 A;  2KGJ A;  3TDB A;  1FJD A;  2MLX A;  2UZ5 A;  2M2A A;  1EYM A;  1QPL A; 
#chains in the Genus database with same CATH topology
 4DRN A;  1U79 A;  2PBC A;  3B8S A;  1E9L A;  1HJW A;  3KAC A;  4KQZ A;  3UI4 A;  3UI5 A;  2LKN A;  1QPF A;  3KAH A;  4DRP A;  3IHZ A;  5DF0 A;  1ZU8 A;  4QT3 A;  3KAI A;  3I6C A;  4S3J A;  1XRV A;  4JFJ A;  1E6P A;  1J4H A;  4QIB A;  3PRD A;  3WD0 A;  4AY1 A;  1NH6 A;  1W9P A;  5HBF A;  1GPF A;  1FKG A;  4JYS A;  1WB0 A;  3ARY A;  1E6N A;  2DSV A;  1E44 A;  4HBO A;  4NNR A;  1OGG A;  3O5L A;  4Q22 A;  1FKD A;  1FKS A;  3IK8 A;  5HWB A;  1HJV A;  4MNK A;  4XAK A;  3NTP A;  4JFK A;  3CHF A;  1EIB A;  3WQV A;  3KAF A;  1JNS A;  3ART A;  2O9O A;  2VCD A;  1NWT A;  2A3E A;  2IF4 A;  3QOK A;  4S3K A;  3WL0 A;  1HJX A;  5GPR A;  3TCZ A;  2EUL A;  2L2S A;  4ODP A;  1NWU A;  3UQB A;  2ITK A;  4DRH A;  1PBK A;  4L3N A;  1TCO C;  4Z2J A;  5I98 A;  1ZBC A;  2RUC A;  3WD4 A;  2G8Z A;  1C9H A;  1YW5 A;  2FAP A;  1ZL1 A;  2WM0 A;  4HAR A;  1FFQ A;  2OLH A;  3OA5 A;  1E6Z A;  4IQC A;  2M1I A;  2ETN A;  2AOS A;  4NZC A;  1D2K A;  1J6Y A;  1W26 A;  1GRJ A;  1NWS A;  2AWG A;  3ARZ A;  1JVW A;  2DG9 A;  1J4R A;  1SYT A;  3AS3 A;  4U86 A;  1T11 A;  2F4E A;  3GTY X;  2K8I A;  2RUR A;  1EQ3 A;  2F21 A;  5HTG A;  1KFW A;  3BMB A;  3WH0 A;  4J4O A;  4J4N A;  2A3C A;  2KGJ A;  5DEZ A;  3BXW A;  4ZPV R;  3TDB A;  3W4R A;  4Q7N A;  1E6R A;  2ZQU A;  1NMV A;  5HWC A;  4ML4 A;  1ROU A;  3KAB A;  4MNL A;  3ARS A;  3RGC A;  2PV1 A;  4W5U A;  2XP4 A;  3PRB A;  3CHD A;  3ALF A;  2XP5 A;  4TNS A;  4C02 B;  3ALG A;  5GQB A;  2N87 A;  1UR8 A;  4PTM A;  2VN1 A;  4MGV A;  1X6N A;  1HXV A;  1JND A;  1J4I A;  5JH8 A;  3CHE A;  2XP3 A;  4WKH A;  2DSW A;  4P8X A;  2Q5A A;  2FKE A;  2FDM A;  2ZR4 A;  1ZBV A;  1ZB5 A;  5DIV A;  4DRJ A;  2MPH A;  4MPK A;  2DG4 A;  2PPP A;  4BF8 A;  1FKR A;  1W1Y A;  1F8A B;  1L1P A;  4DRQ A;  2XP6 A;  4FAP A;  4L72 B;  2O92 A;  3O5E A;  2LPV A;  4IT4 A;  4JFI A;  4QT2 A;  4TW8 A;  3WD1 A;  2DT0 A;  4DRK A;  4HBE A;  4JFL A;  3O5F A;  4DRO A;  3B9E A;  3O5Q A;  3PRA A;  1D7I A;  3NRK A;  4ZS6 A;  4WK9 A;  5HKG A;  1GUV A;  3RME A;  2PPN A;  4IQ2 A;  1D7J A;  1LG2 A;  5DIT A;  1LL4 A;  4ITZ A;  1R9H A;  4O2T A;  2PN0 A;  4W9O A;  5HUA A;  3JYM A;  3KAG A;  4WKA A;  3TC5 A;  3RM9 A;  3FXY A;  3O5P A;  3O5I A;  4Z2G A;  1WNO A;  2OFN A;  4TX0 A;  3O5J A;  1UR9 A;  3KZ7 A;  4DZ3 A;  3GPK A;  1HKK A;  4MNM A;  4Z2I A;  3KAD A;  4MAV A;  3CGN A;  1FJD A;  2UZ5 A;  1QPL A;  1O6I A;  1JNE A;  3LUO A;  3CZ8 A;  1B6C A;  3ARX A;  4WJX A;  1W1T A;  1FKF A;  4R5E A;  3B9D A;  4TW7 A;  1X6L A;  2LGO A;  4QZV B;  2ZQT A;  3ARR A;  3B9A A;  2PI6 A;  2RUD A;  4DT4 A;  3CGM A;  4URI A;  2RQS A;  2XPB A;  4JFM A;  1K9T A;  2DSZ A;  1A7X A;  4P8U A;  2XPA A;  1JNT A;  3ARU A;  1FKB A;  4WIW A;  3RFW A;  1M5Y A;  4U84 A;  2XP7 A;  4ZPT R;  3O5O A;  1ROT A;  2F23 A;  3O5M A;  1BL4 A;  4ODL A;  1N1A A;  1LL6 A;  2RUQ A;  4MSP A;  4IPX A;  5J6E A;  1W1V A;  4FN2 A;  1E15 A;  1YAT A;  3WD3 A;  3WQW A;  3UF8 A;  3EIP A;  2MNT A;  1H0G A;  3AS0 A;  2PV2 A;  4Z2K A;  3ARV A;  4DIP A;  2P4V A;  1NWR A;  4TW6 A;  3CHC A;  4ODO A;  1XHG A;  4LAY A;  4LAX A;  2PPO A;  5HT1 A;  4DH0 A;  1Y0O A;  2IUZ A;  2DT3 A;  3G6L A;  1LG1 A;  4UDM A;  4W9Q A;  1IX5 A;  3AS1 A;  2PV3 A;  1WAW A;  1HKI A;  2KE0 A;  3WL1 A;  4MNJ A;  4DRI A;  3JXV A;  4MTV A;  4P8V A;  2A3B A;  4ODN A;  1FKK A;  5DIU A;  3O5D A;  3WIJ A;  3JYJ A;  2WLY A;  3UI6 A;  1RD6 A;  2B5U B;  1Q6U A;  3FAP A;  3MDY B;  1W1P A;  3NI6 A;  1W9V A;  3ARQ A;  1ZBK A;  1D6O A;  2DG3 A;  2ESC A;  2F2D A;  1H0I A;  2RSE A;  1FKI A;  3ARO A;  3IKG A;  3EY6 A;  2DT1 A;  1FKT A;  1D7H A;  4LAV A;  5D75 A;  1ITX A;  1FKH A;  1P5Q A;  2KI3 A;  2MF9 A;  2ZR5 A;  3G6M A;  3ODK A;  4DWS A;  2LJ4 A;  2B31 A;  2MLX A;  2DSU A;  1EYM A;  4DZ2 A;  1NMW A;  4DRM A;  1VF8 A;  4ODR A;  2KFW A;  1GOI A;  2JZV A;  2XP8 A;  4GIV A;  1KT1 A;  1Q6I A;  3ARP A;  4DWS B;  4G50 A;  1TFV A;  2XP9 A;  4W9P A;  1CTN A;  1FKJ A;  3PR9 A;  1BKF A;  1Q1C A;  3RM4 A;  4R0X A;  2D9F A;  1HKM A;  1ZCN A;  3AQU A;  1LQ0 A;  2WK2 A;  5GPG A;  5B8I C;  1Q6H A;  2MLY A;  4GGQ A;  2ZQS A;  4P8W A;  1FAP A;  2ZR6 A;  3B7X A;  1EHN A;  5BXJ A;  1FKL A;  2G41 A;  1LL7 A;  1KT0 A;  1OWQ A;  4ODM A;  1JCH B;  3RM8 A;  4G2P A;  3WKZ A;  2KR7 A;  1ZBW A;  1NSG A;  2YBU A;  4Z2H A;  4N19 A;  4U85 A;  4LGX A;  3PA7 A;  3ARW A;  3O5G A;  5HW6 A;  1F40 A;  1LJY A;  3GU0 A;  1FFR A;  2DT2 A;  3OOB A;  3UQI A;  2WLZ A;  1HKJ A;  1W9U A;  2KO7 A;  3UQA A;  2MLZ A;  3VAW A;  2ZQV A;  3H9R B;  3CH9 A;  1OGB A;  2Y78 A;  5HW8 A;  1QZ2 A;  5DO2 A;  2A3A A;  4NSB A;  4WKF A;  1FD9 A;  1PIN A;  3AS2 A;  1EDQ A;  4LAW A;  4Z2L A;  4ODQ A;  5HW7 A;  3O5R A;  2QF8 A;  4ODK A;  1ZK6 A;  4KR0 B;  4TYO A;  3O5K A;  2M08 A;  3WD2 A;  4ZPW R;  3KCE A;  3IKD A;  2YBT A;  4DWS C;  4IT6 A;  3FY1 A;  4DWS D;  1SR0 A;  2DPE A;  2M2A A; 
#chains in the Genus database with same CATH homology
 4DRN A;  1U79 A;  2PBC A;  3B8S A;  1E9L A;  1HJW A;  3KAC A;  4KQZ A;  3UI4 A;  3UI5 A;  2LKN A;  1QPF A;  3KAH A;  4DRP A;  3IHZ A;  5DF0 A;  1ZU8 A;  4QT3 A;  3KAI A;  3I6C A;  4S3J A;  1XRV A;  4JFJ A;  1E6P A;  1J4H A;  4QIB A;  3PRD A;  3WD0 A;  4AY1 A;  1NH6 A;  1W9P A;  5HBF A;  1GPF A;  1FKG A;  4JYS A;  1WB0 A;  3ARY A;  1E6N A;  2DSV A;  4HBO A;  4NNR A;  1OGG A;  3O5L A;  4Q22 A;  1FKD A;  1FKS A;  3IK8 A;  5HWB A;  1HJV A;  4MNK A;  4XAK A;  3NTP A;  4JFK A;  3CHF A;  1EIB A;  3WQV A;  3KAF A;  1JNS A;  3ART A;  2O9O A;  2VCD A;  1NWT A;  2A3E A;  2IF4 A;  3QOK A;  4S3K A;  3WL0 A;  1HJX A;  5GPR A;  3TCZ A;  2L2S A;  4ODP A;  1NWU A;  3UQB A;  2ITK A;  4DRH A;  1PBK A;  4L3N A;  1TCO C;  4Z2J A;  5I98 A;  1ZBC A;  2RUC A;  3WD4 A;  2G8Z A;  1C9H A;  1YW5 A;  2FAP A;  1ZL1 A;  2WM0 A;  4HAR A;  1FFQ A;  2OLH A;  3OA5 A;  1E6Z A;  4IQC A;  2M1I A;  2AOS A;  4NZC A;  1D2K A;  1J6Y A;  1W26 A;  1NWS A;  2AWG A;  3ARZ A;  1JVW A;  2DG9 A;  1J4R A;  1SYT A;  3AS3 A;  4U86 A;  1T11 A;  2F4E A;  2K8I A;  2RUR A;  1EQ3 A;  2F21 A;  5HTG A;  1KFW A;  3WH0 A;  4J4O A;  4J4N A;  2A3C A;  2KGJ A;  5DEZ A;  3BXW A;  4ZPV R;  3TDB A;  3W4R A;  4Q7N A;  1E6R A;  2ZQU A;  1NMV A;  5HWC A;  4ML4 A;  1ROU A;  3KAB A;  4MNL A;  3ARS A;  3RGC A;  2PV1 A;  4W5U A;  2XP4 A;  3PRB A;  3CHD A;  3ALF A;  2XP5 A;  4TNS A;  4C02 B;  3ALG A;  5GQB A;  2N87 A;  1UR8 A;  4PTM A;  2VN1 A;  4MGV A;  1X6N A;  1HXV A;  1JND A;  1J4I A;  5JH8 A;  3CHE A;  2XP3 A;  4WKH A;  2DSW A;  4P8X A;  2Q5A A;  2FKE A;  2FDM A;  2ZR4 A;  1ZBV A;  1ZB5 A;  5DIV A;  4DRJ A;  2MPH A;  4MPK A;  2DG4 A;  2PPP A;  4BF8 A;  1FKR A;  1W1Y A;  1F8A B;  1L1P A;  4DRQ A;  2XP6 A;  4FAP A;  4L72 B;  2O92 A;  3O5E A;  2LPV A;  4IT4 A;  4JFI A;  4QT2 A;  4TW8 A;  3WD1 A;  2DT0 A;  4DRK A;  4HBE A;  4JFL A;  3O5F A;  4DRO A;  3B9E A;  3O5Q A;  3PRA A;  1D7I A;  3NRK A;  4ZS6 A;  4WK9 A;  5HKG A;  1GUV A;  3RME A;  2PPN A;  4IQ2 A;  1D7J A;  1LG2 A;  5DIT A;  1LL4 A;  4ITZ A;  1R9H A;  4O2T A;  4W9O A;  5HUA A;  3JYM A;  3KAG A;  4WKA A;  3TC5 A;  3RM9 A;  3FXY A;  3O5P A;  3O5I A;  4Z2G A;  1WNO A;  2OFN A;  4TX0 A;  3O5J A;  1UR9 A;  3KZ7 A;  4DZ3 A;  3GPK A;  1HKK A;  4MNM A;  4Z2I A;  3KAD A;  4MAV A;  3CGN A;  1FJD A;  2UZ5 A;  1QPL A;  1O6I A;  1JNE A;  3LUO A;  3CZ8 A;  1B6C A;  3ARX A;  4WJX A;  1W1T A;  1FKF A;  4R5E A;  3B9D A;  4TW7 A;  1X6L A;  2LGO A;  4QZV B;  2ZQT A;  3ARR A;  3B9A A;  2PI6 A;  2RUD A;  4DT4 A;  3CGM A;  4URI A;  2RQS A;  2XPB A;  4JFM A;  1K9T A;  2DSZ A;  1A7X A;  4P8U A;  2XPA A;  1JNT A;  3ARU A;  1FKB A;  4WIW A;  3RFW A;  1M5Y A;  4U84 A;  2XP7 A;  4ZPT R;  3O5O A;  1ROT A;  3O5M A;  1BL4 A;  4ODL A;  1N1A A;  1LL6 A;  2RUQ A;  4MSP A;  4IPX A;  5J6E A;  1W1V A;  4FN2 A;  1E15 A;  1YAT A;  3WD3 A;  3WQW A;  3UF8 A;  2MNT A;  1H0G A;  3AS0 A;  2PV2 A;  4Z2K A;  3ARV A;  4DIP A;  1NWR A;  4TW6 A;  3CHC A;  4ODO A;  1XHG A;  4LAY A;  4LAX A;  2PPO A;  5HT1 A;  4DH0 A;  1Y0O A;  2IUZ A;  2DT3 A;  3G6L A;  1LG1 A;  4W9Q A;  1IX5 A;  3AS1 A;  2PV3 A;  1WAW A;  1HKI A;  2KE0 A;  3WL1 A;  4MNJ A;  4DRI A;  3JXV A;  4MTV A;  4P8V A;  2A3B A;  4ODN A;  1FKK A;  5DIU A;  3O5D A;  3WIJ A;  3JYJ A;  2WLY A;  3UI6 A;  1RD6 A;  1Q6U A;  3FAP A;  3MDY B;  1W1P A;  3NI6 A;  1W9V A;  3ARQ A;  1ZBK A;  1D6O A;  2DG3 A;  2ESC A;  2F2D A;  1H0I A;  2RSE A;  1FKI A;  3ARO A;  3IKG A;  3EY6 A;  2DT1 A;  1FKT A;  1D7H A;  4LAV A;  5D75 A;  1ITX A;  1FKH A;  1P5Q A;  2KI3 A;  2MF9 A;  2ZR5 A;  3G6M A;  3ODK A;  4DWS A;  2LJ4 A;  2B31 A;  2MLX A;  2DSU A;  1EYM A;  4DZ2 A;  1NMW A;  4DRM A;  1VF8 A;  4ODR A;  2KFW A;  1GOI A;  2JZV A;  2XP8 A;  4GIV A;  1KT1 A;  1Q6I A;  3ARP A;  4DWS B;  4G50 A;  1TFV A;  2XP9 A;  4W9P A;  1CTN A;  1FKJ A;  3PR9 A;  1BKF A;  1Q1C A;  3RM4 A;  4R0X A;  2D9F A;  1HKM A;  1ZCN A;  3AQU A;  1LQ0 A;  2WK2 A;  5GPG A;  5B8I C;  1Q6H A;  2MLY A;  4GGQ A;  2ZQS A;  4P8W A;  1FAP A;  2ZR6 A;  3B7X A;  1EHN A;  5BXJ A;  1FKL A;  2G41 A;  1LL7 A;  1KT0 A;  1OWQ A;  4ODM A;  3RM8 A;  4G2P A;  3WKZ A;  2KR7 A;  1ZBW A;  1NSG A;  2YBU A;  4Z2H A;  4N19 A;  4U85 A;  4LGX A;  3PA7 A;  3ARW A;  3O5G A;  5HW6 A;  1F40 A;  1LJY A;  1FFR A;  2DT2 A;  3OOB A;  3UQI A;  2WLZ A;  1HKJ A;  1W9U A;  2KO7 A;  3UQA A;  2MLZ A;  3VAW A;  2ZQV A;  3H9R B;  3CH9 A;  1OGB A;  2Y78 A;  5HW8 A;  1QZ2 A;  5DO2 A;  2A3A A;  4NSB A;  4WKF A;  1FD9 A;  1PIN A;  3AS2 A;  1EDQ A;  4LAW A;  4Z2L A;  4ODQ A;  5HW7 A;  3O5R A;  2QF8 A;  4ODK A;  1ZK6 A;  4KR0 B;  4TYO A;  3O5K A;  2M08 A;  3WD2 A;  4ZPW R;  3KCE A;  3IKD A;  2YBT A;  4DWS C;  4IT6 A;  3FY1 A;  4DWS D;  1SR0 A;  2DPE A;  2M2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...