4DRJA

O-crystal structure of the ppiase domain of fkbp52, rapamycin and the frb fragment of mtor
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
PMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 121
sequence length 121
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drjA00
2VN1A 1J4RA 2RQSA 1EQ3A 4LAVA 2FAPA 2MPHA 1YATA 1KT0A 3NRKA 3JYMA 4DRNA 3EY6A 3GPKA 4G50A 3UI4A 3JYJA 2MLZA 3NTPA 2ITKA 4JFIA 3KADA 1D7JA 1FKLA 1ZK6A 4IQ2A 5DITA 4ODLA 1A7XA 5HW6A 4TW8A 1Q1CA 1QPLA 2ZQSA 4NNRA 5HWCA 2MLXA 2ZR4A 1KT1A 2IF4A 4ODMA 5DIUA 5J6EA 1F40A 2MNTA 2KI3A 1TCOC 3I6CA 3CGNA 5GPGA 1J6YA 2ZQTA 1FKRA 3IKDA 4O2TA 4N19A 2KE0A 1M5YA 2F4EA 4DROA 3UI6A 4JFLA 2K8IA 1JNSA 2RURA 3O5EA 2AWGA 4DRPA 3O5PA 3KAGA 3UQBA 1PBKA 2DG3A 3KAFA 4JFKA 1FKGA 4U85A 5B8IC 2LPVA 2ZQVA 4IPXA 2XP5A 4JFMA 5BXJA 2XP7A 3O5LA 4ODPA 3IKGA 4DRJA 4GIVA 4W9PA 2MF9A 4FAPA 1YW5A 2M2AA 1FKKA 3KZ7A 4C02B 1D7HA 2L2SA 1FKSA 4ODOA 2UZ5A 2KGJA 3LUOA 1BL4A 3NI6A 5D75A 1F8AB 1J4HA 2XPBA 4MSPA 2RUDA 1W26A 2KR7A 3KACA 4ITZA 4JFJA 1Q6IA 3UQAA 1FKJA 3O5QA 1U79A 1QZ2A 3O5JA 4DZ2A 2XPAA 4G2PA 1EYMA 4DRKA 1NMVA 3ODKA 3PRBA 1C9HA 3VAWA 4DH0A 1D7IA 4GGQA 4DT4A 1L1PA 4J4OA 1PINA 2ZQUA 4TW7A 4JYSA 5HT1A 1R9HA 3H9RB 2ZR5A 1P5QA 4U86A 2LKNA 4LAYA 4DRHA 3O5OA 2JZVA 1ROTA 2F21A 3O5MA 4W9OA 5DIVA 2PV3A 2Q5AA 2DG9A 1J4IA 4R0XA 1FKDA 2DG4A 1BKFA 3O5FA 3OOBA 3PRDA 3O5GA 4QT3A 2Y78A 4DIPA 3KCEA 1Y0OA 2LJ4A 3IK8A 3CGMA 5HUAA 2N87A 2XP4A 3WH0A 1FKBA 1FKFA 2PBCA 4W9QA 3B7XA 3TCZA 2D9FA 4ODKA 4QIBA 1NMWA 1QPFA 1NSGA 2LGOA 3O5IA 3O5RA 4FN2A 3JXVA 2PPPA 4TX0A 1Q6HA 2PV1A 3TDBA 5HW8A 4TYOA 4TNSA 2FKEA 4MGVA 3RGCA 5HW7A 2PPOA 3O5KA 1FJDA 3PA7A 1JNTA 2MLYA 3KABA 3IHZA 1HXVA 2VCDA 2M1IA 1D6OA 1B6CA 2XP8A 2PV2A 4IQCA 4DRIA 4DZ3A 2M08A 4BF8A 2RUCA 2XP3A 2KO7A 2KFWA 4QT2A 2RUQA 3UF8A 3UI5A 5HTGA 5HWBA 2PPNA 2XP6A 1N1AA 3TC5A 2RSEA 3UQIA 1Q6UA 1JVWA 1ROUA 2OFNA 2ZR6A 4LAWA 3KAHA 1FKIA 4LAXA 4ODQA 3KAIA 3O5DA 4TW6A 4DRMA 1FKHA 1T11A 2F2DA 3FAPA 3MDYB 4ODRA 5I98A 1FAPA 4DRQA 1FD9A 1FKTA 3RFWA 4U84A 1ZCNA 5HKGA 4ODNA 4J4NA 2XP9A
chains in the Genus database with same CATH superfamily
1EQ3A 3EIPA 4LAVA 3B9DA 3JYMA 5DEZA 1ZBVA 1WAWA 2DT3A 1ZK6A 1TFVA 1KFWA 5DITA 4ODLA 2ZQSA 4NNRA 5J6EA 3CHCA 2DT2A 3CH9A 4NSBA 1F40A 3B9AA 4W5UA 4AY1A 4MNKA 4PTMA 5GPGA 2ZQTA 1FKRA 1M5YA 2ESCA 4MNJA 3AS1A 2K8IA 3QOKA 1VF8A 2RURA 2AWGA 3O5EA 3O5PA 3UQBA 3KAFA 4JFKA 1LL4A 1ITXA 2PN0A 2ZQVA 4ODPA 4Z2KA 4WKAA 3TDBA 2UZ5A 1BL4A 1F8AB 2XPBA 4XAKA 4ZS6A 5JH8A 1Q6IA 2XPAA 1GUVA 1LG2A 2F23A 1WNOA 3PRBA 2DSWA 4GGQA 4DT4A 2ZQUA 1R9HA 3H9RB 3AQUA 4LAYA 3WQVA 2G8ZA 3O5MA 2PV3A 1LQ0A 1FKDA 3O5FA 4WIWA 3O5GA 4DWSC 3RMEA 3RM4A 3WH0A 3AS2A 3B7XA 4QIBA 1NMWA 3WL1A 3O5IA 2B5UB 3JXVA 1HJVA 4KR0B 2PPOA 1FFQA 2VCDA 3ARQA 2RUCA 2XP3A 1SR0A 2KFWA 2RUQA 3UQIA 3WD0A 4LAWA 4DRMA 1FKIA 4LAXA 3KAIA 3O5DA 3ALFA 3MDYB 1HJXA 1FAPA 3PR9A 5HKGA 1ZCNA 1W9UA 3BMBA 4J4NA 4MNMA 4URIA 1YATA 3NRKA 3B9EA 1NH6A 4JFIA 1D7JA 1FKLA 1JCHB 2OLHA 5HW6A 4TW8A 1Q1CA 1QPLA 4S3JA 2MLXA 2IF4A 1E6PA 2MNTA 4L3NA 2KI3A 1TCOC 3I6CA 2AOSA 2B31A 5GQBA 4WJXA 2KE0A 4ZPWR 5DO2A 4DRPA 1PBKA 2DG3A 4U85A 1LL7A 4Q22A 5B8IC 4IPXA 1HKJA 2XP7A 4HBEA 2MF9A 1LJYA 1YW5A 4C02B 1GOIA 2L2SA 1ZU8A 3LUOA 3NI6A 1FFRA 3GU0A 1HKIA 1W26A 3KACA 1FKJA 3O5JA 4G2PA 1EYMA 3WD4A 1L1PA 4J4OA 3WD2A 1PINA 4TW7A 3ARWA 3WKZA 1P5QA 2JZVA 1ROTA 2F21A 1K9TA 4ZPVR 1J4IA 3PRDA 1BKFA 2ETNA 3BXWA 3KCEA 1OGBA 1Y0OA 5DF0A 1RD6A 2N87A 1FKBA 2IUZA 1EHNA 2P4VA 3TCZA 2A3AA 4ODKA 3WQWA 1Q6HA 2PV1A 5HW8A 1W1TA 4TNSA 2FKEA 4MGVA 3RGCA 3ARYA 4P8XA 1FJDA 1JNTA 2O9OA 1B6CA 4IQCA 4DRIA 2M08A 1CTNA 2FDMA 3CHDA 2WLZA 3UI5A 5HTGA 2PPNA 4P8UA 1Q6UA 2OFNA 4R5EA 1HKKA 3PRAA 2YBUA 2ZR6A 3KAHA 4IT6A 1T11A 1E9LA 3CHEA 3RFWA 3WL0A 4ODNA 2VN1A 2RQSA 3RM8A 2FAPA 2MPHA 4DRNA 3EY6A 1HKMA 1OGGA 1UR9A 3FXYA 3GPKA 3UI4A 3WD1A 2YBTA 3NTPA 4IQ2A 1A7XA 4WK9A 1NWRA 1ZL1A 5HWCA 1W9PA 2ZR4A 4ODMA 5DIUA 1EDQA 3ARVA 3G6MA 4DWSA 3IKDA 4N19A 2F4EA 2DT1A 4JFLA 1JNSA 2O92A 3KAGA 1FKGA 2LPVA 3CZ8A 4HARA 4DRJA 4GIVA 4W9PA 4FAPA 2M2AA 1FKKA 3KZ7A 1D7HA 2KGJA 1GPFA 1J4HA 4WKFA 3B8SA 2RUDA 1D2KA 1HJWA 3ARSA 4ITZA 4JFJA 3UQAA 3O5QA 4Z2LA 4DZ2A 4DRKA 1E15A 4Z2HA 3ODKA 1C9HA 4DH0A 1JNDA 1D7IA 2A3EA 4JYSA 5HT1A 2PI6A 2ZR5A 1SYTA 3O5OA 4NZCA 5DIVA 2WLYA 1W1YA 4QT3A 3ALGA 1LG1A 3OOBA 2Y78A 4DIPA 3WIJA 1FKFA 2PBCA 4W9QA 2D9FA 1X6LA 4L72B 4TX0A 1NSGA 4FN2A 4LGXA 4TYOA 4DWSB 2DPEA 3KABA 2M1IA 2PV2A 1W1PA 4S3KA 3OA5A 2KO7A 3WD3A 4QT2A 3UF8A 1E6ZA 1H0GA 3AS3A 2XP6A 5HWBA 2RSEA 1IX5A 1UR8A 1W1VA 1E6RA 3G6LA 4DWSD 3ARZA 4ODQA 4TW6A 1E6NA 1FKHA 4ML4A 2G41A 4ODRA 1JNEA 4DRQA 1FKTA 1EIBA 2XP9A 1NWSA 1J4RA 1KT0A 4G50A 1ZBCA 1ZB5A 3JYJA 2MLZA 3CHFA 2ITKA 3KADA 4IT4A 4P8WA 1KT1A 4MTVA 2DSUA 4HBOA 3CGNA 4Z2JA 1J6YA 2DSZA 4O2TA 4KQZA 4DROA 3UI6A 2DSVA 4WKHA 1XHGA 2DT0A 5BXJA 4JFMA 2XP5A 3O5LA 3IKGA 4MPKA 2A3BA 2WM0A 1NWUA 5D75A 4ODOA 1FKSA 3ARPA 5HBFA 4QZVB 4MSPA 2KR7A 3AROA 2A3CA 3GTYX 1U79A 3ARUA 1QZ2A 4Q7NA 1NMVA 1GRJA 3VAWA 2EULA 3ARTA 1W9VA 3AS0A 1O6IA 4U86A 2LKNA 4DRHA 4W9OA 3ARRA 4MNLA 2Q5AA 2DG9A 3W4RA 4R0XA 2DG4A 4P8VA 2LJ4A 3IK8A 1XRVA 3CGMA 4MAVA 2XP4A 5HUAA 1WB0A 1QPFA 2LGOA 3O5RA 2PPPA 1ZBKA 5GPRA 5HW7A 2WK2A 3O5KA 1OWQA 3PA7A 2MLYA 3RM9A 3IHZA 1HXVA 3FY1A 1D6OA 2QF8A 2XP8A 4DZ3A 1ZBWA 4BF8A 3TC5A 1N1AA 1NWTA 3ARXA 1E44A 4Z2IA 1H0IA 1JVWA 1ROUA 4UDMA 1LL6A 4ZPTR 2F2DA 3FAPA 5I98A 1FD9A 4Z2GA 4U84A 1X6NA
chains in the Genus database with same CATH topology
1EQ3A 4LAVA 3B9DA 3JYMA 5DEZA 1ZBVA 1WAWA 2DT3A 1ZK6A 1TFVA 1KFWA 5DITA 4ODLA 2ZQSA 4NNRA 5J6EA 3CHCA 2DT2A 3CH9A 4NSBA 1F40A 3B9AA 4W5UA 4AY1A 4MNKA 4PTMA 5GPGA 2ZQTA 1FKRA 1M5YA 2ESCA 4MNJA 3AS1A 2K8IA 3QOKA 1VF8A 2RURA 2AWGA 3O5EA 3O5PA 3UQBA 3KAFA 4JFKA 1LL4A 1ITXA 2ZQVA 4ODPA 4Z2KA 4WKAA 3TDBA 2UZ5A 1BL4A 1F8AB 2XPBA 4XAKA 4ZS6A 5JH8A 1Q6IA 2XPAA 1GUVA 1LG2A 1WNOA 3PRBA 2DSWA 4GGQA 4DT4A 2ZQUA 1R9HA 3H9RB 3AQUA 4LAYA 3WQVA 2G8ZA 3O5MA 2PV3A 1LQ0A 1FKDA 3O5FA 4WIWA 3O5GA 4DWSC 3RMEA 3RM4A 3WH0A 3AS2A 3B7XA 4QIBA 1NMWA 3WL1A 3O5IA 3JXVA 1HJVA 4KR0B 2PPOA 1FFQA 2VCDA 3ARQA 2RUCA 2XP3A 1SR0A 2KFWA 2RUQA 3UQIA 3WD0A 4LAWA 4DRMA 1FKIA 4LAXA 3KAIA 3O5DA 3ALFA 3MDYB 1HJXA 1FAPA 3PR9A 5HKGA 1ZCNA 1W9UA 4J4NA 4MNMA 4URIA 1YATA 3NRKA 3B9EA 1NH6A 4JFIA 1D7JA 1FKLA 2OLHA 5HW6A 4TW8A 1Q1CA 1QPLA 4S3JA 2MLXA 2IF4A 1E6PA 2MNTA 4L3NA 2KI3A 1TCOC 3I6CA 2AOSA 2B31A 5GQBA 4WJXA 2KE0A 4ZPWR 5DO2A 4DRPA 1PBKA 2DG3A 4U85A 1LL7A 4Q22A 5B8IC 4IPXA 1HKJA 2XP7A 4HBEA 2MF9A 1LJYA 1YW5A 4C02B 1GOIA 2L2SA 1ZU8A 3LUOA 3NI6A 1FFRA 1HKIA 1W26A 3KACA 1FKJA 3O5JA 4G2PA 1EYMA 3WD4A 1L1PA 4J4OA 3WD2A 1PINA 4TW7A 3ARWA 3WKZA 1P5QA 2JZVA 1ROTA 2F21A 1K9TA 4ZPVR 1J4IA 3PRDA 1BKFA 3BXWA 3KCEA 1OGBA 1Y0OA 5DF0A 1RD6A 2N87A 1FKBA 2IUZA 1EHNA 3TCZA 2A3AA 4ODKA 3WQWA 1Q6HA 2PV1A 5HW8A 1W1TA 4TNSA 2FKEA 4MGVA 3RGCA 3ARYA 4P8XA 1FJDA 1JNTA 2O9OA 1B6CA 4IQCA 4DRIA 2M08A 1CTNA 2FDMA 3CHDA 2WLZA 3UI5A 5HTGA 2PPNA 4P8UA 1Q6UA 2OFNA 4R5EA 1HKKA 3PRAA 2YBUA 2ZR6A 3KAHA 4IT6A 1T11A 1E9LA 3CHEA 3RFWA 3WL0A 4ODNA 2VN1A 2RQSA 3RM8A 2FAPA 2MPHA 4DRNA 3EY6A 1HKMA 1OGGA 1UR9A 3FXYA 3GPKA 3UI4A 3WD1A 2YBTA 3NTPA 4IQ2A 1A7XA 4WK9A 1NWRA 1ZL1A 5HWCA 1W9PA 2ZR4A 4ODMA 5DIUA 1EDQA 3ARVA 3G6MA 4DWSA 3IKDA 4N19A 2F4EA 2DT1A 4JFLA 1JNSA 2O92A 3KAGA 1FKGA 2LPVA 3CZ8A 4HARA 4DRJA 4GIVA 4W9PA 4FAPA 2M2AA 1FKKA 3KZ7A 1D7HA 2KGJA 1GPFA 1J4HA 4WKFA 3B8SA 2RUDA 1D2KA 1HJWA 3ARSA 4ITZA 4JFJA 3UQAA 3O5QA 4Z2LA 4DZ2A 4DRKA 1E15A 4Z2HA 3ODKA 1C9HA 4DH0A 1JNDA 1D7IA 2A3EA 4JYSA 5HT1A 2PI6A 2ZR5A 1SYTA 3O5OA 4NZCA 5DIVA 2WLYA 1W1YA 4QT3A 3ALGA 1LG1A 3OOBA 2Y78A 4DIPA 3WIJA 1FKFA 2PBCA 4W9QA 2D9FA 1X6LA 4L72B 4TX0A 1NSGA 4FN2A 4LGXA 4TYOA 4DWSB 2DPEA 3KABA 2M1IA 2PV2A 1W1PA 4S3KA 3OA5A 2KO7A 3WD3A 4QT2A 3UF8A 1E6ZA 1H0GA 3AS3A 2XP6A 5HWBA 2RSEA 1IX5A 1UR8A 1W1VA 1E6RA 3G6LA 4DWSD 3ARZA 4ODQA 4TW6A 1E6NA 1FKHA 4ML4A 2G41A 4ODRA 1JNEA 4DRQA 1FKTA 1EIBA 2XP9A 1NWSA 1J4RA 1KT0A 4G50A 1ZBCA 1ZB5A 3JYJA 2MLZA 3CHFA 2ITKA 3KADA 4IT4A 4P8WA 1KT1A 4MTVA 2DSUA 4HBOA 3CGNA 4Z2JA 1J6YA 2DSZA 4O2TA 4KQZA 4DROA 3UI6A 2DSVA 4WKHA 1XHGA 2DT0A 5BXJA 4JFMA 2XP5A 3O5LA 3IKGA 4MPKA 2A3BA 2WM0A 1NWUA 5D75A 4ODOA 1FKSA 3ARPA 5HBFA 4QZVB 4MSPA 2KR7A 3AROA 2A3CA 1U79A 3ARUA 1QZ2A 4Q7NA 1NMVA 3VAWA 3ARTA 1W9VA 3AS0A 1O6IA 4U86A 2LKNA 4DRHA 4W9OA 3ARRA 4MNLA 2Q5AA 2DG9A 3W4RA 4R0XA 2DG4A 4P8VA 2LJ4A 3IK8A 1XRVA 3CGMA 4MAVA 2XP4A 5HUAA 1WB0A 1QPFA 2LGOA 3O5RA 2PPPA 1ZBKA 5GPRA 5HW7A 2WK2A 3O5KA 1OWQA 3PA7A 2MLYA 3RM9A 3IHZA 1HXVA 3FY1A 1D6OA 2QF8A 2XP8A 4DZ3A 1ZBWA 4BF8A 3TC5A 1N1AA 1NWTA 3ARXA 4Z2IA 1H0IA 1JVWA 1ROUA 1LL6A 4ZPTR 2F2DA 3FAPA 5I98A 1FD9A 4Z2GA 4U84A 1X6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VN1 A;  1J4R A;  2RQS A;  1EQ3 A;  4LAV A;  2FAP A;  2MPH A;  1YAT A;  1KT0 A;  3NRK A;  3JYM A;  4DRN A;  3EY6 A;  3GPK A;  4G50 A;  3UI4 A;  3JYJ A;  2MLZ A;  3NTP A;  2ITK A;  4JFI A;  3KAD A;  1D7J A;  1FKL A;  1ZK6 A;  4IQ2 A;  5DIT A;  4ODL A;  1A7X A;  5HW6 A;  4TW8 A;  1Q1C A;  1QPL A;  2ZQS A;  4NNR A;  5HWC A;  2MLX A;  2ZR4 A;  1KT1 A;  2IF4 A;  4ODM A;  5DIU A;  5J6E A;  1F40 A;  2MNT A;  2KI3 A;  1TCO C;  3I6C A;  3CGN A;  5GPG A;  1J6Y A;  2ZQT A;  1FKR A;  3IKD A;  4O2T A;  4N19 A;  2KE0 A;  1M5Y A;  2F4E A;  4DRO A;  3UI6 A;  4JFL A;  2K8I A;  1JNS A;  2RUR A;  3O5E A;  2AWG A;  4DRP A;  3O5P A;  3KAG A;  3UQB A;  1PBK A;  2DG3 A;  3KAF A;  4JFK A;  1FKG A;  4U85 A;  5B8I C;  2LPV A;  2ZQV A;  4IPX A;  2XP5 A;  4JFM A;  5BXJ A;  2XP7 A;  3O5L A;  4ODP A;  3IKG A;  4DRJ A;  4GIV A;  4W9P A;  2MF9 A;  4FAP A;  1YW5 A;  2M2A A;  1FKK A;  3KZ7 A;  4C02 B;  1D7H A;  2L2S A;  1FKS A;  4ODO A;  2UZ5 A;  2KGJ A;  3LUO A;  1BL4 A;  3NI6 A;  5D75 A;  1F8A B;  1J4H A;  2XPB A;  4MSP A;  2RUD A;  1W26 A;  2KR7 A;  3KAC A;  4ITZ A;  4JFJ A;  1Q6I A;  3UQA A;  1FKJ A;  3O5Q A;  1U79 A;  1QZ2 A;  3O5J A;  4DZ2 A;  2XPA A;  4G2P A;  1EYM A;  4DRK A;  1NMV A;  3ODK A;  3PRB A;  1C9H A;  3VAW A;  4DH0 A;  1D7I A;  4GGQ A;  4DT4 A;  1L1P A;  4J4O A;  1PIN A;  2ZQU A;  4TW7 A;  4JYS A;  5HT1 A;  1R9H A;  3H9R B;  2ZR5 A;  1P5Q A;  4U86 A;  2LKN A;  4LAY A;  4DRH A;  3O5O A;  2JZV A;  1ROT A;  2F21 A;  3O5M A;  4W9O A;  5DIV A;  2PV3 A;  2Q5A A;  2DG9 A;  1J4I A;  4R0X A;  1FKD A;  2DG4 A;  1BKF A;  3O5F A;  3OOB A;  3PRD A;  3O5G A;  4QT3 A;  2Y78 A;  4DIP A;  3KCE A;  1Y0O A;  2LJ4 A;  3IK8 A;  3CGM A;  5HUA A;  2N87 A;  2XP4 A;  3WH0 A;  1FKB A;  1FKF A;  2PBC A;  4W9Q A;  3B7X A;  3TCZ A;  2D9F A;  4ODK A;  4QIB A;  1NMW A;  1QPF A;  1NSG A;  2LGO A;  3O5I A;  3O5R A;  4FN2 A;  3JXV A;  2PPP A;  4TX0 A;  1Q6H A;  2PV1 A;  3TDB A;  5HW8 A;  4TYO A;  4TNS A;  2FKE A;  4MGV A;  3RGC A;  5HW7 A;  2PPO A;  3O5K A;  1FJD A;  3PA7 A;  1JNT A;  2MLY A;  3KAB A;  3IHZ A;  1HXV A;  2VCD A;  2M1I A;  1D6O A;  1B6C A;  2XP8 A;  2PV2 A;  4IQC A;  4DRI A;  4DZ3 A;  2M08 A;  4BF8 A;  2RUC A;  2XP3 A;  2KO7 A;  2KFW A;  4QT2 A;  2RUQ A;  3UF8 A;  3UI5 A;  5HTG A;  5HWB A;  2PPN A;  2XP6 A;  1N1A A;  3TC5 A;  2RSE A;  3UQI A;  1Q6U A;  1JVW A;  1ROU A;  2OFN A;  2ZR6 A;  4LAW A;  3KAH A;  1FKI A;  4LAX A;  4ODQ A;  3KAI A;  3O5D A;  4TW6 A;  4DRM A;  1FKH A;  1T11 A;  2F2D A;  3FAP A;  3MDY B;  4ODR A;  5I98 A;  1FAP A;  4DRQ A;  1FD9 A;  1FKT A;  3RFW A;  4U84 A;  1ZCN A;  5HKG A;  4ODN A;  4J4N A;  2XP9 A; 
#chains in the Genus database with same CATH topology
 1EQ3 A;  3EIP A;  4LAV A;  3B9D A;  3JYM A;  5DEZ A;  1ZBV A;  1WAW A;  2DT3 A;  1ZK6 A;  1TFV A;  1KFW A;  5DIT A;  4ODL A;  2ZQS A;  4NNR A;  5J6E A;  3CHC A;  2DT2 A;  3CH9 A;  4NSB A;  1F40 A;  3B9A A;  4W5U A;  4AY1 A;  4MNK A;  4PTM A;  5GPG A;  2ZQT A;  1FKR A;  1M5Y A;  2ESC A;  4MNJ A;  3AS1 A;  2K8I A;  3QOK A;  1VF8 A;  2RUR A;  2AWG A;  3O5E A;  3O5P A;  3UQB A;  3KAF A;  4JFK A;  1LL4 A;  1ITX A;  2PN0 A;  2ZQV A;  4ODP A;  4Z2K A;  4WKA A;  3TDB A;  2UZ5 A;  1BL4 A;  1F8A B;  2XPB A;  4XAK A;  4ZS6 A;  5JH8 A;  1Q6I A;  2XPA A;  1GUV A;  1LG2 A;  2F23 A;  1WNO A;  3PRB A;  2DSW A;  4GGQ A;  4DT4 A;  2ZQU A;  1R9H A;  3H9R B;  3AQU A;  4LAY A;  3WQV A;  2G8Z A;  3O5M A;  2PV3 A;  1LQ0 A;  1FKD A;  3O5F A;  4WIW A;  3O5G A;  4DWS C;  3RME A;  3RM4 A;  3WH0 A;  3AS2 A;  3B7X A;  4QIB A;  1NMW A;  3WL1 A;  3O5I A;  2B5U B;  3JXV A;  1HJV A;  4KR0 B;  2PPO A;  1FFQ A;  2VCD A;  3ARQ A;  2RUC A;  2XP3 A;  1SR0 A;  2KFW A;  2RUQ A;  3UQI A;  3WD0 A;  4LAW A;  4DRM A;  1FKI A;  4LAX A;  3KAI A;  3O5D A;  3ALF A;  3MDY B;  1HJX A;  1FAP A;  3PR9 A;  5HKG A;  1ZCN A;  1W9U A;  3BMB A;  4J4N A;  4MNM A;  4URI A;  1YAT A;  3NRK A;  3B9E A;  1NH6 A;  4JFI A;  1D7J A;  1FKL A;  1JCH B;  2OLH A;  5HW6 A;  4TW8 A;  1Q1C A;  1QPL A;  4S3J A;  2MLX A;  2IF4 A;  1E6P A;  2MNT A;  4L3N A;  2KI3 A;  1TCO C;  3I6C A;  2AOS A;  2B31 A;  5GQB A;  4WJX A;  2KE0 A;  4ZPW R;  5DO2 A;  4DRP A;  1PBK A;  2DG3 A;  4U85 A;  1LL7 A;  4Q22 A;  5B8I C;  4IPX A;  1HKJ A;  2XP7 A;  4HBE A;  2MF9 A;  1LJY A;  1YW5 A;  4C02 B;  1GOI A;  2L2S A;  1ZU8 A;  3LUO A;  3NI6 A;  1FFR A;  3GU0 A;  1HKI A;  1W26 A;  3KAC A;  1FKJ A;  3O5J A;  4G2P A;  1EYM A;  3WD4 A;  1L1P A;  4J4O A;  3WD2 A;  1PIN A;  4TW7 A;  3ARW A;  3WKZ A;  1P5Q A;  2JZV A;  1ROT A;  2F21 A;  1K9T A;  4ZPV R;  1J4I A;  3PRD A;  1BKF A;  2ETN A;  3BXW A;  3KCE A;  1OGB A;  1Y0O A;  5DF0 A;  1RD6 A;  2N87 A;  1FKB A;  2IUZ A;  1EHN A;  2P4V A;  3TCZ A;  2A3A A;  4ODK A;  3WQW A;  1Q6H A;  2PV1 A;  5HW8 A;  1W1T A;  4TNS A;  2FKE A;  4MGV A;  3RGC A;  3ARY A;  4P8X A;  1FJD A;  1JNT A;  2O9O A;  1B6C A;  4IQC A;  4DRI A;  2M08 A;  1CTN A;  2FDM A;  3CHD A;  2WLZ A;  3UI5 A;  5HTG A;  2PPN A;  4P8U A;  1Q6U A;  2OFN A;  4R5E A;  1HKK A;  3PRA A;  2YBU A;  2ZR6 A;  3KAH A;  4IT6 A;  1T11 A;  1E9L A;  3CHE A;  3RFW A;  3WL0 A;  4ODN A;  2VN1 A;  2RQS A;  3RM8 A;  2FAP A;  2MPH A;  4DRN A;  3EY6 A;  1HKM A;  1OGG A;  1UR9 A;  3FXY A;  3GPK A;  3UI4 A;  3WD1 A;  2YBT A;  3NTP A;  4IQ2 A;  1A7X A;  4WK9 A;  1NWR A;  1ZL1 A;  5HWC A;  1W9P A;  2ZR4 A;  4ODM A;  5DIU A;  1EDQ A;  3ARV A;  3G6M A;  4DWS A;  3IKD A;  4N19 A;  2F4E A;  2DT1 A;  4JFL A;  1JNS A;  2O92 A;  3KAG A;  1FKG A;  2LPV A;  3CZ8 A;  4HAR A;  4DRJ A;  4GIV A;  4W9P A;  4FAP A;  2M2A A;  1FKK A;  3KZ7 A;  1D7H A;  2KGJ A;  1GPF A;  1J4H A;  4WKF A;  3B8S A;  2RUD A;  1D2K A;  1HJW A;  3ARS A;  4ITZ A;  4JFJ A;  3UQA A;  3O5Q A;  4Z2L A;  4DZ2 A;  4DRK A;  1E15 A;  4Z2H A;  3ODK A;  1C9H A;  4DH0 A;  1JND A;  1D7I A;  2A3E A;  4JYS A;  5HT1 A;  2PI6 A;  2ZR5 A;  1SYT A;  3O5O A;  4NZC A;  5DIV A;  2WLY A;  1W1Y A;  4QT3 A;  3ALG A;  1LG1 A;  3OOB A;  2Y78 A;  4DIP A;  3WIJ A;  1FKF A;  2PBC A;  4W9Q A;  2D9F A;  1X6L A;  4L72 B;  4TX0 A;  1NSG A;  4FN2 A;  4LGX A;  4TYO A;  4DWS B;  2DPE A;  3KAB A;  2M1I A;  2PV2 A;  1W1P A;  4S3K A;  3OA5 A;  2KO7 A;  3WD3 A;  4QT2 A;  3UF8 A;  1E6Z A;  1H0G A;  3AS3 A;  2XP6 A;  5HWB A;  2RSE A;  1IX5 A;  1UR8 A;  1W1V A;  1E6R A;  3G6L A;  4DWS D;  3ARZ A;  4ODQ A;  4TW6 A;  1E6N A;  1FKH A;  4ML4 A;  2G41 A;  4ODR A;  1JNE A;  4DRQ A;  1FKT A;  1EIB A;  2XP9 A;  1NWS A;  1J4R A;  1KT0 A;  4G50 A;  1ZBC A;  1ZB5 A;  3JYJ A;  2MLZ A;  3CHF A;  2ITK A;  3KAD A;  4IT4 A;  4P8W A;  1KT1 A;  4MTV A;  2DSU A;  4HBO A;  3CGN A;  4Z2J A;  1J6Y A;  2DSZ A;  4O2T A;  4KQZ A;  4DRO A;  3UI6 A;  2DSV A;  4WKH A;  1XHG A;  2DT0 A;  5BXJ A;  4JFM A;  2XP5 A;  3O5L A;  3IKG A;  4MPK A;  2A3B A;  2WM0 A;  1NWU A;  5D75 A;  4ODO A;  1FKS A;  3ARP A;  5HBF A;  4QZV B;  4MSP A;  2KR7 A;  3ARO A;  2A3C A;  3GTY X;  1U79 A;  3ARU A;  1QZ2 A;  4Q7N A;  1NMV A;  1GRJ A;  3VAW A;  2EUL A;  3ART A;  1W9V A;  3AS0 A;  1O6I A;  4U86 A;  2LKN A;  4DRH A;  4W9O A;  3ARR A;  4MNL A;  2Q5A A;  2DG9 A;  3W4R A;  4R0X A;  2DG4 A;  4P8V A;  2LJ4 A;  3IK8 A;  1XRV A;  3CGM A;  4MAV A;  2XP4 A;  5HUA A;  1WB0 A;  1QPF A;  2LGO A;  3O5R A;  2PPP A;  1ZBK A;  5GPR A;  5HW7 A;  2WK2 A;  3O5K A;  1OWQ A;  3PA7 A;  2MLY A;  3RM9 A;  3IHZ A;  1HXV A;  3FY1 A;  1D6O A;  2QF8 A;  2XP8 A;  4DZ3 A;  1ZBW A;  4BF8 A;  3TC5 A;  1N1A A;  1NWT A;  3ARX A;  1E44 A;  4Z2I A;  1H0I A;  1JVW A;  1ROU A;  4UDM A;  1LL6 A;  4ZPT R;  2F2D A;  3FAP A;  5I98 A;  1FD9 A;  4Z2G A;  4U84 A;  1X6N A; 
#chains in the Genus database with same CATH homology
 1EQ3 A;  4LAV A;  3B9D A;  3JYM A;  5DEZ A;  1ZBV A;  1WAW A;  2DT3 A;  1ZK6 A;  1TFV A;  1KFW A;  5DIT A;  4ODL A;  2ZQS A;  4NNR A;  5J6E A;  3CHC A;  2DT2 A;  3CH9 A;  4NSB A;  1F40 A;  3B9A A;  4W5U A;  4AY1 A;  4MNK A;  4PTM A;  5GPG A;  2ZQT A;  1FKR A;  1M5Y A;  2ESC A;  4MNJ A;  3AS1 A;  2K8I A;  3QOK A;  1VF8 A;  2RUR A;  2AWG A;  3O5E A;  3O5P A;  3UQB A;  3KAF A;  4JFK A;  1LL4 A;  1ITX A;  2ZQV A;  4ODP A;  4Z2K A;  4WKA A;  3TDB A;  2UZ5 A;  1BL4 A;  1F8A B;  2XPB A;  4XAK A;  4ZS6 A;  5JH8 A;  1Q6I A;  2XPA A;  1GUV A;  1LG2 A;  1WNO A;  3PRB A;  2DSW A;  4GGQ A;  4DT4 A;  2ZQU A;  1R9H A;  3H9R B;  3AQU A;  4LAY A;  3WQV A;  2G8Z A;  3O5M A;  2PV3 A;  1LQ0 A;  1FKD A;  3O5F A;  4WIW A;  3O5G A;  4DWS C;  3RME A;  3RM4 A;  3WH0 A;  3AS2 A;  3B7X A;  4QIB A;  1NMW A;  3WL1 A;  3O5I A;  3JXV A;  1HJV A;  4KR0 B;  2PPO A;  1FFQ A;  2VCD A;  3ARQ A;  2RUC A;  2XP3 A;  1SR0 A;  2KFW A;  2RUQ A;  3UQI A;  3WD0 A;  4LAW A;  4DRM A;  1FKI A;  4LAX A;  3KAI A;  3O5D A;  3ALF A;  3MDY B;  1HJX A;  1FAP A;  3PR9 A;  5HKG A;  1ZCN A;  1W9U A;  4J4N A;  4MNM A;  4URI A;  1YAT A;  3NRK A;  3B9E A;  1NH6 A;  4JFI A;  1D7J A;  1FKL A;  2OLH A;  5HW6 A;  4TW8 A;  1Q1C A;  1QPL A;  4S3J A;  2MLX A;  2IF4 A;  1E6P A;  2MNT A;  4L3N A;  2KI3 A;  1TCO C;  3I6C A;  2AOS A;  2B31 A;  5GQB A;  4WJX A;  2KE0 A;  4ZPW R;  5DO2 A;  4DRP A;  1PBK A;  2DG3 A;  4U85 A;  1LL7 A;  4Q22 A;  5B8I C;  4IPX A;  1HKJ A;  2XP7 A;  4HBE A;  2MF9 A;  1LJY A;  1YW5 A;  4C02 B;  1GOI A;  2L2S A;  1ZU8 A;  3LUO A;  3NI6 A;  1FFR A;  1HKI A;  1W26 A;  3KAC A;  1FKJ A;  3O5J A;  4G2P A;  1EYM A;  3WD4 A;  1L1P A;  4J4O A;  3WD2 A;  1PIN A;  4TW7 A;  3ARW A;  3WKZ A;  1P5Q A;  2JZV A;  1ROT A;  2F21 A;  1K9T A;  4ZPV R;  1J4I A;  3PRD A;  1BKF A;  3BXW A;  3KCE A;  1OGB A;  1Y0O A;  5DF0 A;  1RD6 A;  2N87 A;  1FKB A;  2IUZ A;  1EHN A;  3TCZ A;  2A3A A;  4ODK A;  3WQW A;  1Q6H A;  2PV1 A;  5HW8 A;  1W1T A;  4TNS A;  2FKE A;  4MGV A;  3RGC A;  3ARY A;  4P8X A;  1FJD A;  1JNT A;  2O9O A;  1B6C A;  4IQC A;  4DRI A;  2M08 A;  1CTN A;  2FDM A;  3CHD A;  2WLZ A;  3UI5 A;  5HTG A;  2PPN A;  4P8U A;  1Q6U A;  2OFN A;  4R5E A;  1HKK A;  3PRA A;  2YBU A;  2ZR6 A;  3KAH A;  4IT6 A;  1T11 A;  1E9L A;  3CHE A;  3RFW A;  3WL0 A;  4ODN A;  2VN1 A;  2RQS A;  3RM8 A;  2FAP A;  2MPH A;  4DRN A;  3EY6 A;  1HKM A;  1OGG A;  1UR9 A;  3FXY A;  3GPK A;  3UI4 A;  3WD1 A;  2YBT A;  3NTP A;  4IQ2 A;  1A7X A;  4WK9 A;  1NWR A;  1ZL1 A;  5HWC A;  1W9P A;  2ZR4 A;  4ODM A;  5DIU A;  1EDQ A;  3ARV A;  3G6M A;  4DWS A;  3IKD A;  4N19 A;  2F4E A;  2DT1 A;  4JFL A;  1JNS A;  2O92 A;  3KAG A;  1FKG A;  2LPV A;  3CZ8 A;  4HAR A;  4DRJ A;  4GIV A;  4W9P A;  4FAP A;  2M2A A;  1FKK A;  3KZ7 A;  1D7H A;  2KGJ A;  1GPF A;  1J4H A;  4WKF A;  3B8S A;  2RUD A;  1D2K A;  1HJW A;  3ARS A;  4ITZ A;  4JFJ A;  3UQA A;  3O5Q A;  4Z2L A;  4DZ2 A;  4DRK A;  1E15 A;  4Z2H A;  3ODK A;  1C9H A;  4DH0 A;  1JND A;  1D7I A;  2A3E A;  4JYS A;  5HT1 A;  2PI6 A;  2ZR5 A;  1SYT A;  3O5O A;  4NZC A;  5DIV A;  2WLY A;  1W1Y A;  4QT3 A;  3ALG A;  1LG1 A;  3OOB A;  2Y78 A;  4DIP A;  3WIJ A;  1FKF A;  2PBC A;  4W9Q A;  2D9F A;  1X6L A;  4L72 B;  4TX0 A;  1NSG A;  4FN2 A;  4LGX A;  4TYO A;  4DWS B;  2DPE A;  3KAB A;  2M1I A;  2PV2 A;  1W1P A;  4S3K A;  3OA5 A;  2KO7 A;  3WD3 A;  4QT2 A;  3UF8 A;  1E6Z A;  1H0G A;  3AS3 A;  2XP6 A;  5HWB A;  2RSE A;  1IX5 A;  1UR8 A;  1W1V A;  1E6R A;  3G6L A;  4DWS D;  3ARZ A;  4ODQ A;  4TW6 A;  1E6N A;  1FKH A;  4ML4 A;  2G41 A;  4ODR A;  1JNE A;  4DRQ A;  1FKT A;  1EIB A;  2XP9 A;  1NWS A;  1J4R A;  1KT0 A;  4G50 A;  1ZBC A;  1ZB5 A;  3JYJ A;  2MLZ A;  3CHF A;  2ITK A;  3KAD A;  4IT4 A;  4P8W A;  1KT1 A;  4MTV A;  2DSU A;  4HBO A;  3CGN A;  4Z2J A;  1J6Y A;  2DSZ A;  4O2T A;  4KQZ A;  4DRO A;  3UI6 A;  2DSV A;  4WKH A;  1XHG A;  2DT0 A;  5BXJ A;  4JFM A;  2XP5 A;  3O5L A;  3IKG A;  4MPK A;  2A3B A;  2WM0 A;  1NWU A;  5D75 A;  4ODO A;  1FKS A;  3ARP A;  5HBF A;  4QZV B;  4MSP A;  2KR7 A;  3ARO A;  2A3C A;  1U79 A;  3ARU A;  1QZ2 A;  4Q7N A;  1NMV A;  3VAW A;  3ART A;  1W9V A;  3AS0 A;  1O6I A;  4U86 A;  2LKN A;  4DRH A;  4W9O A;  3ARR A;  4MNL A;  2Q5A A;  2DG9 A;  3W4R A;  4R0X A;  2DG4 A;  4P8V A;  2LJ4 A;  3IK8 A;  1XRV A;  3CGM A;  4MAV A;  2XP4 A;  5HUA A;  1WB0 A;  1QPF A;  2LGO A;  3O5R A;  2PPP A;  1ZBK A;  5GPR A;  5HW7 A;  2WK2 A;  3O5K A;  1OWQ A;  3PA7 A;  2MLY A;  3RM9 A;  3IHZ A;  1HXV A;  3FY1 A;  1D6O A;  2QF8 A;  2XP8 A;  4DZ3 A;  1ZBW A;  4BF8 A;  3TC5 A;  1N1A A;  1NWT A;  3ARX A;  4Z2I A;  1H0I A;  1JVW A;  1ROU A;  1LL6 A;  4ZPT R;  2F2D A;  3FAP A;  5I98 A;  1FD9 A;  4Z2G A;  4U84 A;  1X6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...