4DRKA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphenyl)-1-({[(2s)-1-(3,3-dimethyl-2-oxopentanoyl)piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic acid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drkA00
5HT1A 2XPBA 2KFWA 3IK8A 3IHZA 1B6CA 2FKEA 4TX0A 2N87A 3O5IA 1N1AA 2KE0A 4G2PA 3JYMA 4DZ2A 5I98A 5GPGA 1QPFA 1J4IA 3O5GA 3O5OA 5HKGA 3CGMA 5HWCA 2MPHA 1M5YA 1QPLA 1Q6IA 1FKKA 2RUDA 2ZQUA 2PPNA 2ZQVA 3IKDA 3PRDA 1YATA 2VN1A 3CGNA 3I6CA 3O5PA 3TC5A 4DIPA 5HW6A 2MLXA 1A7XA 2ZQTA 2M2AA 1Y0OA 3O5JA 1ROUA 1FJDA 2KGJA 2XP7A 1HXVA 1NMWA 2MLYA 3LUOA 4JFMA 3PA7A 3KAGA 1J4RA 2ZQSA 4DRIA 1PBKA 3KAHA 4LAYA 3TDBA 2FAPA 1JNSA 1FKHA 4DZ3A 2KO7A 2RUQA 3JXVA 3KAFA 4MGVA 5BXJA 1FKJA 2MNTA 2ITKA 3H9RB 3KABA 4U86A 5DITA 3UI4A 3WH0A 2OFNA 1FKDA 3UI5A 1FKFA 1JNTA 1ZCNA 2F2DA 1FKGA 4TYOA 4FN2A 3NRKA 4LAWA 4MSPA 3ODKA 3UF8A 1FKSA 4J4NA 4TW8A 1YW5A 3VAWA 2MLZA 4G50A 5HWBA 2JZVA 4O2TA 3O5LA 4DT4A 4ODRA 4DRPA 3KACA 5B8IC 5HUAA 2M08A 1Q6HA 5HW8A 2PV2A 2PPPA 4GGQA 3PRBA 2RUCA 2DG4A 5D75A 2XP6A 1NSGA 1R9HA 2LPVA 3FAPA 5HW7A 1FKBA 1FAPA 2PV3A 3O5MA 1FD9A 2XP5A 1FKLA 1J6YA 2ZR6A 2M1IA 4DRNA 2F4EA 2PV1A 2DG9A 1ROTA 4R0XA 1ZK6A 2KR7A 4ODLA 2LJ4A 4LAVA 5DIVA 1D7HA 4DRQA 2Y78A 4DRJA 1C9HA 2RQSA 4FAPA 2AWGA 2ZR4A 2XP8A 4U84A 2VCDA 4LAXA 4ODKA 3RGCA 2KI3A 2XP3A 1W26A 3O5EA 1BKFA 4C02B 1KT0A 2XP4A 2LKNA 2RURA 3B7XA 4TNSA 1EYMA 4TW7A 1D7JA 3UI6A 4QT2A 1PINA 5DIUA 4DH0A 4IQCA 3UQBA 3GPKA 2F21A 4ODMA 4ODPA 2DG3A 1F40A 3UQAA 1Q6UA 2PPOA 3TCZA 2UZ5A 1L1PA 4BF8A 1JVWA 1KT1A 1Q1CA 2LGOA 2RSEA 3O5RA 3UQIA 1FKIA 4DRMA 3KCEA 3O5QA 1F8AB 4DRHA 1TCOC 2K8IA 4W9QA 5HTGA 4GIVA 1T11A 4JFLA 3O5KA 3RFWA 4DRKA 4N19A 4ITZA 1D7IA 2Q5AA 1U79A 2MF9A 4DROA 3O5FA 4W9OA 4J4OA 3EY6A 4ODQA 4JYSA 4U85A 4QIBA 2XPAA 4ODOA 4JFJA 4TW6A 4JFKA 1NMVA 1FKTA 2IF4A 3NI6A 1BL4A 4NNRA 1QZ2A 2ZR5A 3KADA 4JFIA 4W9PA 2PBCA 2L2SA 3MDYB 4IPXA 5J6EA 4QT3A 3OOBA 4ODNA 1J4HA 3O5DA 2XP9A 2D9FA 3KZ7A 3KAIA 1FKRA 3IKGA 3JYJA 1P5QA 3NTPA 4IQ2A 1EQ3A 1D6OA
chains in the Genus database with same CATH superfamily
3AROA 3EIPA 2KFWA 2DSVA 3CHDA 3B9DA 1ZBKA 5GPGA 1HKJA 2MPHA 3PRDA 2ZQVA 2VN1A 2G41A 1A7XA 4WKFA 1JNDA 1TFVA 2XP7A 1NMWA 3PA7A 1E9LA 2ZQSA 1JNEA 4DRIA 2FAPA 4LGXA 2KO7A 3ARVA 1OWQA 2DT3A 1GUVA 1EDQA 1WAWA 1JNTA 2F2DA 2EULA 1H0IA 3AS2A 3VAWA 4AY1A 5HWBA 4G50A 4O2TA 5HW8A 2PV2A 2DSUA 2LPVA 3ARYA 5HW7A 3O5MA 1FD9A 1KFWA 2F4EA 2PV1A 3ALFA 4R0XA 1W1PA 3WKZA 4LAVA 4DRQA 2Y78A 3RM8A 4DRJA 4Z2IA 1LL7A 2DT0A 4FAPA 4ODKA 2KI3A 4C02B 4TW7A 1PINA 5DIUA 3GPKA 1ZBWA 2QF8A 2UZ5A 1LQ0A 4BF8A 1D2KA 1JVWA 1KT1A 3ARPA 5DO2A 3O5RA 2A3CA 4DWSD 1F8AB 3WD0A 4NZCA 1T11A 4JFLA 3O5KA 4ML4A 4L3NA 4N19A 4ITZA 3RFWA 2Q5AA 2MF9A 4R5EA 4ODQA 4QIBA 2ESCA 1HKKA 4JFJA 3AS0A 3QOKA 1GRJA 4TW6A 4JFKA 1NMVA 1H0GA 4HBEA 3KADA 4JFIA 3ARSA 2A3AA 3CHEA 1LL4A 4MNKA 4QT3A 4P8VA 3O5DA 1GPFA 4MNJA 2D9FA 2A3BA 4ZPVR 1GOIA 4IQ2A 4Z2JA 3IK8A 3B8SA 1N1AA 2KE0A 4G2PA 3JYMA 4DZ2A 3O5OA 1JCHB 4L72B 4MTVA 5HWCA 1FKKA 1YATA 3CGNA 3ARRA 3I6CA 2ZQTA 2M2AA 1Y0OA 3O5JA 2O9OA 1WNOA 1ROUA 2KGJA 3KAGA 4WKHA 4LAYA 4WIWA 2IUZA 2WLYA 4U86A 2ITKA 3WH0A 4Z2HA 1E44A 4Z2GA 4J4NA 2JZVA 3KACA 3FAPA 1R9HA 1E6NA 1FFQA 3BXWA 2PV3A 2DPEA 2XP5A 1HJXA 3AS3A 2ZR6A 3WQWA 1ZK6A 4UDMA 2KR7A 5DIVA 3B9EA 1C9HA 2ZR4A 4U84A 2VCDA 3RGCA 4Q22A 3G6MA 1W9PA 1BKFA 1ZBCA 2XP4A 2LKNA 3B7XA 4MNMA 4DH0A 3UQBA 1SYTA 3CHFA 3TCZA 1E6RA 4ZS6A 2OLHA 1NWRA 1XRVA 3UQIA 2RSEA 4DRMA 3B9AA 3O5QA 4WJXA 2K8IA 4PTMA 3AS1A 1D7IA 3CHCA 1U79A 2WK2A 3O5FA 4Q7NA 2DT1A 1LJYA 4JYSA 2G8ZA 2P4VA 4U85A 2XPAA 4DWSC 3GTYX 1NWSA 5HBFA 2YBTA 1EHNA 2IF4A 1WB0A 3NI6A 1QZ2A 2F23A 5J6EA 3CZ8A 4S3KA 3OA5A 4KQZA 4P8UA 1J4HA 2XP9A 5DEZA 3KZ7A 3IKGA 3PRAA 3JYJA 4IT4A 1ITXA 2O92A 1D6OA 3FXYA 5HT1A 4DWSA 2ETNA 1QPFA 5HKGA 3CGMA 3ALGA 3ARWA 1M5YA 1QPLA 1Q6IA 2ZQUA 1NH6A 1UR9A 2DSZA 1W1YA 5HW6A 2YBUA 3ARUA 1W1TA 4Z2LA 1HXVA 1HKMA 4JFMA 3W4RA 1J4RA 2B31A 3KAHA 4HARA 1CTNA 3FY1A 1E15A 2DSWA 3KAFA 2MNTA 3UI4A 3H9RB 5DITA 5JH8A 1LL6A 1ZCNA 2PI6A 1NWUA 2WLZA 4LAWA 4MSPA 4TW8A 1YW5A 1EQ3A 3O5LA 4DT4A 4ODRA 5HUAA 2M08A 1Q6HA 4GGQA 2PPPA 5D75A 1FAPA 1E6ZA 1J6YA 2M1IA 2DG9A 4URIA 3WIJA 4ODLA 1OGBA 1HJVA 1D7HA 3PR9A 2XP8A 3WD3A 4LAXA 1ZU8A 1OGGA 3RM4A 2XP3A 1W26A 4MPKA 1KT0A 5DF0A 1EYMA 1D7JA 4KR0B 4QT2A 4NSBA 1ZBVA 4W5UA 2F21A 4ODMA 4ODPA 2DG3A 3RMEA 1Q6UA 1O6IA 1K9TA 4DRHA 1TCOC 1EIBA 3WQVA 4GIVA 1ZL1A 4DROA 4W9OA 1UR8A 4XAKA 4HBOA 2A3EA 1BL4A 2ZR5A 2PBCA 3MDYB 1IX5A 1LG1A 3OOBA 4ODNA 3WD1A 3KAIA 4DWSB 1FKRA 1P5QA 3NTPA 4P8XA 4MAVA 2XPBA 4ZPTR 2WM0A 3IHZA 1B6CA 1W9VA 2FKEA 4TX0A 2N87A 3O5IA 3WL0A 5I98A 1J4IA 1SR0A 3O5GA 4ZPWR 3BMBA 1W9UA 4MNLA 4WKAA 2RUDA 1FFRA 1VF8A 2PPNA 3IKDA 3TC5A 3O5PA 4DIPA 2MLXA 3AQUA 3ARXA 1FJDA 2MLYA 3LUOA 2PN0A 1JNSA 1PBKA 3TDBA 1FKHA 2B5UB 4DZ3A 2RUQA 3WL1A 3JXVA 4MGVA 5BXJA 2FDMA 1FKJA 3KABA 3ARZA 2OFNA 1FKDA 3UI5A 1FKFA 3CH9A 1FKGA 4TYOA 1X6NA 4FN2A 2AOSA 3NRKA 1E6PA 3ODKA 3UF8A 1FKSA 4Z2KA 2MLZA 4DRPA 5B8IC 1F40A 3PRBA 2RUCA 1ZB5A 2DG4A 2XP6A 1NSGA 4WK9A 1FKBA 1FKLA 5GPRA 4DRNA 1ROTA 4P8WA 3WD2A 3ARQA 2LJ4A 2RQSA 2AWGA 1RD6A 1HKIA 2DT2A 3O5EA 1HJWA 3G6LA 2RURA 4TNSA 3UI6A 3ARTA 4IQCA 1W1VA 3UQAA 2PPOA 3WD4A 1L1PA 1Q1CA 2LGOA 1FKIA 3KCEA 4IT6A 4QZVB 5HTGA 4W9QA 4DRKA 1NWTA 4J4OA 3EY6A 3RM9A 4ODOA 1FKTA 1X6LA 4NNRA 4W9PA 4S3JA 1LG2A 1XHGA 2L2SA 3GU0A 4IPXA 5GQBA
chains in the Genus database with same CATH topology
3AROA 2KFWA 2DSVA 3CHDA 3B9DA 1ZBKA 5GPGA 1HKJA 2MPHA 3PRDA 2ZQVA 2VN1A 2G41A 1A7XA 4WKFA 1JNDA 1TFVA 2XP7A 1NMWA 3PA7A 1E9LA 2ZQSA 1JNEA 4DRIA 2FAPA 4LGXA 2KO7A 3ARVA 1OWQA 2DT3A 1GUVA 1EDQA 1WAWA 1JNTA 2F2DA 1H0IA 3AS2A 3VAWA 4AY1A 5HWBA 4G50A 4O2TA 5HW8A 2PV2A 2DSUA 2LPVA 3ARYA 5HW7A 3O5MA 1FD9A 1KFWA 2F4EA 2PV1A 3ALFA 4R0XA 1W1PA 3WKZA 4LAVA 4DRQA 2Y78A 3RM8A 4DRJA 4Z2IA 1LL7A 2DT0A 4FAPA 4ODKA 2KI3A 4C02B 4TW7A 1PINA 5DIUA 3GPKA 1ZBWA 2QF8A 2UZ5A 1LQ0A 4BF8A 1D2KA 1JVWA 1KT1A 3ARPA 5DO2A 3O5RA 2A3CA 4DWSD 1F8AB 3WD0A 4NZCA 1T11A 4JFLA 3O5KA 4ML4A 4L3NA 4N19A 4ITZA 3RFWA 2Q5AA 2MF9A 4R5EA 4ODQA 4QIBA 2ESCA 1HKKA 4JFJA 3AS0A 3QOKA 4TW6A 4JFKA 1NMVA 1H0GA 4HBEA 3KADA 4JFIA 3ARSA 2A3AA 3CHEA 1LL4A 4MNKA 4QT3A 4P8VA 3O5DA 1GPFA 4MNJA 2D9FA 2A3BA 4ZPVR 1GOIA 4IQ2A 4Z2JA 3IK8A 3B8SA 1N1AA 2KE0A 4G2PA 3JYMA 4DZ2A 3O5OA 4L72B 4MTVA 5HWCA 1FKKA 1YATA 3CGNA 3ARRA 3I6CA 2ZQTA 2M2AA 1Y0OA 3O5JA 2O9OA 1WNOA 1ROUA 2KGJA 3KAGA 4WKHA 4LAYA 4WIWA 2IUZA 2WLYA 4U86A 2ITKA 3WH0A 4Z2HA 4Z2GA 4J4NA 2JZVA 3KACA 3FAPA 1R9HA 1E6NA 1FFQA 3BXWA 2PV3A 2DPEA 2XP5A 1HJXA 3AS3A 2ZR6A 3WQWA 1ZK6A 2KR7A 5DIVA 3B9EA 1C9HA 2ZR4A 4U84A 2VCDA 3RGCA 4Q22A 3G6MA 1W9PA 1BKFA 1ZBCA 2XP4A 2LKNA 3B7XA 4MNMA 4DH0A 3UQBA 1SYTA 3CHFA 3TCZA 1E6RA 4ZS6A 2OLHA 1NWRA 1XRVA 3UQIA 2RSEA 4DRMA 3B9AA 3O5QA 4WJXA 2K8IA 4PTMA 3AS1A 1D7IA 3CHCA 1U79A 2WK2A 3O5FA 4Q7NA 2DT1A 1LJYA 4JYSA 2G8ZA 4U85A 4DWSC 2XPAA 1NWSA 5HBFA 2YBTA 1EHNA 2IF4A 1WB0A 3NI6A 1QZ2A 5J6EA 3CZ8A 4S3KA 3OA5A 4KQZA 4P8UA 1J4HA 2XP9A 5DEZA 3KZ7A 3IKGA 3PRAA 3JYJA 4IT4A 1ITXA 2O92A 1D6OA 3FXYA 5HT1A 4DWSA 1QPFA 5HKGA 3CGMA 3ALGA 3ARWA 1M5YA 1QPLA 1Q6IA 2ZQUA 1NH6A 1UR9A 2DSZA 1W1YA 5HW6A 2YBUA 3ARUA 1W1TA 4Z2LA 1HXVA 1HKMA 4JFMA 3W4RA 1J4RA 2B31A 3KAHA 4HARA 1CTNA 3FY1A 1E15A 2DSWA 3KAFA 2MNTA 3UI4A 3H9RB 5DITA 5JH8A 1LL6A 1ZCNA 2PI6A 1NWUA 2WLZA 4LAWA 4MSPA 4TW8A 1YW5A 1EQ3A 3O5LA 4DT4A 4ODRA 5HUAA 2M08A 1Q6HA 4GGQA 2PPPA 5D75A 1FAPA 1E6ZA 1J6YA 2M1IA 2DG9A 4URIA 3WIJA 4ODLA 1OGBA 1HJVA 1D7HA 3PR9A 2XP8A 3WD3A 4LAXA 1ZU8A 1OGGA 3RM4A 2XP3A 1W26A 4MPKA 1KT0A 5DF0A 1EYMA 1D7JA 4KR0B 4QT2A 4NSBA 1ZBVA 4W5UA 2F21A 4ODMA 4ODPA 2DG3A 3RMEA 1Q6UA 1O6IA 1K9TA 4DRHA 1TCOC 1EIBA 3WQVA 4GIVA 1ZL1A 4DROA 4W9OA 1UR8A 4XAKA 4HBOA 2A3EA 1BL4A 2ZR5A 2PBCA 3MDYB 1IX5A 1LG1A 3OOBA 4ODNA 3WD1A 3KAIA 4DWSB 1FKRA 1P5QA 3NTPA 4P8XA 4MAVA 2XPBA 4ZPTR 2WM0A 3IHZA 1B6CA 1W9VA 2FKEA 4TX0A 2N87A 3O5IA 3WL0A 5I98A 1J4IA 1SR0A 3O5GA 4ZPWR 1W9UA 4MNLA 4WKAA 2RUDA 1FFRA 1VF8A 2PPNA 3IKDA 3TC5A 3O5PA 4DIPA 2MLXA 3AQUA 3ARXA 1FJDA 2MLYA 3LUOA 1JNSA 1PBKA 3TDBA 1FKHA 4DZ3A 2RUQA 3WL1A 3JXVA 4MGVA 5BXJA 2FDMA 1FKJA 3KABA 3ARZA 2OFNA 1FKDA 3UI5A 1FKFA 3CH9A 1FKGA 4TYOA 1X6NA 4FN2A 2AOSA 3NRKA 1E6PA 3ODKA 3UF8A 1FKSA 4Z2KA 2MLZA 4DRPA 5B8IC 1F40A 3PRBA 2RUCA 1ZB5A 2DG4A 2XP6A 1NSGA 4WK9A 1FKBA 1FKLA 5GPRA 4DRNA 1ROTA 4P8WA 3WD2A 3ARQA 2LJ4A 2RQSA 2AWGA 1RD6A 1HKIA 2DT2A 3O5EA 1HJWA 3G6LA 2RURA 4TNSA 3UI6A 3ARTA 4IQCA 1W1VA 3UQAA 2PPOA 3WD4A 1L1PA 1Q1CA 2LGOA 1FKIA 3KCEA 4IT6A 4QZVB 5HTGA 4W9QA 4DRKA 1NWTA 4J4OA 3EY6A 3RM9A 4ODOA 1FKTA 1X6LA 4NNRA 4W9PA 4S3JA 1LG2A 1XHGA 2L2SA 4IPXA 5GQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HT1 A;  2XPB A;  2KFW A;  3IK8 A;  3IHZ A;  1B6C A;  2FKE A;  4TX0 A;  2N87 A;  3O5I A;  1N1A A;  2KE0 A;  4G2P A;  3JYM A;  4DZ2 A;  5I98 A;  5GPG A;  1QPF A;  1J4I A;  3O5G A;  3O5O A;  5HKG A;  3CGM A;  5HWC A;  2MPH A;  1M5Y A;  1QPL A;  1Q6I A;  1FKK A;  2RUD A;  2ZQU A;  2PPN A;  2ZQV A;  3IKD A;  3PRD A;  1YAT A;  2VN1 A;  3CGN A;  3I6C A;  3O5P A;  3TC5 A;  4DIP A;  5HW6 A;  2MLX A;  1A7X A;  2ZQT A;  2M2A A;  1Y0O A;  3O5J A;  1ROU A;  1FJD A;  2KGJ A;  2XP7 A;  1HXV A;  1NMW A;  2MLY A;  3LUO A;  4JFM A;  3PA7 A;  3KAG A;  1J4R A;  2ZQS A;  4DRI A;  1PBK A;  3KAH A;  4LAY A;  3TDB A;  2FAP A;  1JNS A;  1FKH A;  4DZ3 A;  2KO7 A;  2RUQ A;  3JXV A;  3KAF A;  4MGV A;  5BXJ A;  1FKJ A;  2MNT A;  2ITK A;  3H9R B;  3KAB A;  4U86 A;  5DIT A;  3UI4 A;  3WH0 A;  2OFN A;  1FKD A;  3UI5 A;  1FKF A;  1JNT A;  1ZCN A;  2F2D A;  1FKG A;  4TYO A;  4FN2 A;  3NRK A;  4LAW A;  4MSP A;  3ODK A;  3UF8 A;  1FKS A;  4J4N A;  4TW8 A;  1YW5 A;  3VAW A;  2MLZ A;  4G50 A;  5HWB A;  2JZV A;  4O2T A;  3O5L A;  4DT4 A;  4ODR A;  4DRP A;  3KAC A;  5B8I C;  5HUA A;  2M08 A;  1Q6H A;  5HW8 A;  2PV2 A;  2PPP A;  4GGQ A;  3PRB A;  2RUC A;  2DG4 A;  5D75 A;  2XP6 A;  1NSG A;  1R9H A;  2LPV A;  3FAP A;  5HW7 A;  1FKB A;  1FAP A;  2PV3 A;  3O5M A;  1FD9 A;  2XP5 A;  1FKL A;  1J6Y A;  2ZR6 A;  2M1I A;  4DRN A;  2F4E A;  2PV1 A;  2DG9 A;  1ROT A;  4R0X A;  1ZK6 A;  2KR7 A;  4ODL A;  2LJ4 A;  4LAV A;  5DIV A;  1D7H A;  4DRQ A;  2Y78 A;  4DRJ A;  1C9H A;  2RQS A;  4FAP A;  2AWG A;  2ZR4 A;  2XP8 A;  4U84 A;  2VCD A;  4LAX A;  4ODK A;  3RGC A;  2KI3 A;  2XP3 A;  1W26 A;  3O5E A;  1BKF A;  4C02 B;  1KT0 A;  2XP4 A;  2LKN A;  2RUR A;  3B7X A;  4TNS A;  1EYM A;  4TW7 A;  1D7J A;  3UI6 A;  4QT2 A;  1PIN A;  5DIU A;  4DH0 A;  4IQC A;  3UQB A;  3GPK A;  2F21 A;  4ODM A;  4ODP A;  2DG3 A;  1F40 A;  3UQA A;  1Q6U A;  2PPO A;  3TCZ A;  2UZ5 A;  1L1P A;  4BF8 A;  1JVW A;  1KT1 A;  1Q1C A;  2LGO A;  2RSE A;  3O5R A;  3UQI A;  1FKI A;  4DRM A;  3KCE A;  3O5Q A;  1F8A B;  4DRH A;  1TCO C;  2K8I A;  4W9Q A;  5HTG A;  4GIV A;  1T11 A;  4JFL A;  3O5K A;  3RFW A;  4DRK A;  4N19 A;  4ITZ A;  1D7I A;  2Q5A A;  1U79 A;  2MF9 A;  4DRO A;  3O5F A;  4W9O A;  4J4O A;  3EY6 A;  4ODQ A;  4JYS A;  4U85 A;  4QIB A;  2XPA A;  4ODO A;  4JFJ A;  4TW6 A;  4JFK A;  1NMV A;  1FKT A;  2IF4 A;  3NI6 A;  1BL4 A;  4NNR A;  1QZ2 A;  2ZR5 A;  3KAD A;  4JFI A;  4W9P A;  2PBC A;  2L2S A;  3MDY B;  4IPX A;  5J6E A;  4QT3 A;  3OOB A;  4ODN A;  1J4H A;  3O5D A;  2XP9 A;  2D9F A;  3KZ7 A;  3KAI A;  1FKR A;  3IKG A;  3JYJ A;  1P5Q A;  3NTP A;  4IQ2 A;  1EQ3 A;  1D6O A; 
#chains in the Genus database with same CATH topology
 3ARO A;  3EIP A;  2KFW A;  2DSV A;  3CHD A;  3B9D A;  1ZBK A;  5GPG A;  1HKJ A;  2MPH A;  3PRD A;  2ZQV A;  2VN1 A;  2G41 A;  1A7X A;  4WKF A;  1JND A;  1TFV A;  2XP7 A;  1NMW A;  3PA7 A;  1E9L A;  2ZQS A;  1JNE A;  4DRI A;  2FAP A;  4LGX A;  2KO7 A;  3ARV A;  1OWQ A;  2DT3 A;  1GUV A;  1EDQ A;  1WAW A;  1JNT A;  2F2D A;  2EUL A;  1H0I A;  3AS2 A;  3VAW A;  4AY1 A;  5HWB A;  4G50 A;  4O2T A;  5HW8 A;  2PV2 A;  2DSU A;  2LPV A;  3ARY A;  5HW7 A;  3O5M A;  1FD9 A;  1KFW A;  2F4E A;  2PV1 A;  3ALF A;  4R0X A;  1W1P A;  3WKZ A;  4LAV A;  4DRQ A;  2Y78 A;  3RM8 A;  4DRJ A;  4Z2I A;  1LL7 A;  2DT0 A;  4FAP A;  4ODK A;  2KI3 A;  4C02 B;  4TW7 A;  1PIN A;  5DIU A;  3GPK A;  1ZBW A;  2QF8 A;  2UZ5 A;  1LQ0 A;  4BF8 A;  1D2K A;  1JVW A;  1KT1 A;  3ARP A;  5DO2 A;  3O5R A;  2A3C A;  4DWS D;  1F8A B;  3WD0 A;  4NZC A;  1T11 A;  4JFL A;  3O5K A;  4ML4 A;  4L3N A;  4N19 A;  4ITZ A;  3RFW A;  2Q5A A;  2MF9 A;  4R5E A;  4ODQ A;  4QIB A;  2ESC A;  1HKK A;  4JFJ A;  3AS0 A;  3QOK A;  1GRJ A;  4TW6 A;  4JFK A;  1NMV A;  1H0G A;  4HBE A;  3KAD A;  4JFI A;  3ARS A;  2A3A A;  3CHE A;  1LL4 A;  4MNK A;  4QT3 A;  4P8V A;  3O5D A;  1GPF A;  4MNJ A;  2D9F A;  2A3B A;  4ZPV R;  1GOI A;  4IQ2 A;  4Z2J A;  3IK8 A;  3B8S A;  1N1A A;  2KE0 A;  4G2P A;  3JYM A;  4DZ2 A;  3O5O A;  1JCH B;  4L72 B;  4MTV A;  5HWC A;  1FKK A;  1YAT A;  3CGN A;  3ARR A;  3I6C A;  2ZQT A;  2M2A A;  1Y0O A;  3O5J A;  2O9O A;  1WNO A;  1ROU A;  2KGJ A;  3KAG A;  4WKH A;  4LAY A;  4WIW A;  2IUZ A;  2WLY A;  4U86 A;  2ITK A;  3WH0 A;  4Z2H A;  1E44 A;  4Z2G A;  4J4N A;  2JZV A;  3KAC A;  3FAP A;  1R9H A;  1E6N A;  1FFQ A;  3BXW A;  2PV3 A;  2DPE A;  2XP5 A;  1HJX A;  3AS3 A;  2ZR6 A;  3WQW A;  1ZK6 A;  4UDM A;  2KR7 A;  5DIV A;  3B9E A;  1C9H A;  2ZR4 A;  4U84 A;  2VCD A;  3RGC A;  4Q22 A;  3G6M A;  1W9P A;  1BKF A;  1ZBC A;  2XP4 A;  2LKN A;  3B7X A;  4MNM A;  4DH0 A;  3UQB A;  1SYT A;  3CHF A;  3TCZ A;  1E6R A;  4ZS6 A;  2OLH A;  1NWR A;  1XRV A;  3UQI A;  2RSE A;  4DRM A;  3B9A A;  3O5Q A;  4WJX A;  2K8I A;  4PTM A;  3AS1 A;  1D7I A;  3CHC A;  1U79 A;  2WK2 A;  3O5F A;  4Q7N A;  2DT1 A;  1LJY A;  4JYS A;  2G8Z A;  2P4V A;  4U85 A;  2XPA A;  4DWS C;  3GTY X;  1NWS A;  5HBF A;  2YBT A;  1EHN A;  2IF4 A;  1WB0 A;  3NI6 A;  1QZ2 A;  2F23 A;  5J6E A;  3CZ8 A;  4S3K A;  3OA5 A;  4KQZ A;  4P8U A;  1J4H A;  2XP9 A;  5DEZ A;  3KZ7 A;  3IKG A;  3PRA A;  3JYJ A;  4IT4 A;  1ITX A;  2O92 A;  1D6O A;  3FXY A;  5HT1 A;  4DWS A;  2ETN A;  1QPF A;  5HKG A;  3CGM A;  3ALG A;  3ARW A;  1M5Y A;  1QPL A;  1Q6I A;  2ZQU A;  1NH6 A;  1UR9 A;  2DSZ A;  1W1Y A;  5HW6 A;  2YBU A;  3ARU A;  1W1T A;  4Z2L A;  1HXV A;  1HKM A;  4JFM A;  3W4R A;  1J4R A;  2B31 A;  3KAH A;  4HAR A;  1CTN A;  3FY1 A;  1E15 A;  2DSW A;  3KAF A;  2MNT A;  3UI4 A;  3H9R B;  5DIT A;  5JH8 A;  1LL6 A;  1ZCN A;  2PI6 A;  1NWU A;  2WLZ A;  4LAW A;  4MSP A;  4TW8 A;  1YW5 A;  1EQ3 A;  3O5L A;  4DT4 A;  4ODR A;  5HUA A;  2M08 A;  1Q6H A;  4GGQ A;  2PPP A;  5D75 A;  1FAP A;  1E6Z A;  1J6Y A;  2M1I A;  2DG9 A;  4URI A;  3WIJ A;  4ODL A;  1OGB A;  1HJV A;  1D7H A;  3PR9 A;  2XP8 A;  3WD3 A;  4LAX A;  1ZU8 A;  1OGG A;  3RM4 A;  2XP3 A;  1W26 A;  4MPK A;  1KT0 A;  5DF0 A;  1EYM A;  1D7J A;  4KR0 B;  4QT2 A;  4NSB A;  1ZBV A;  4W5U A;  2F21 A;  4ODM A;  4ODP A;  2DG3 A;  3RME A;  1Q6U A;  1O6I A;  1K9T A;  4DRH A;  1TCO C;  1EIB A;  3WQV A;  4GIV A;  1ZL1 A;  4DRO A;  4W9O A;  1UR8 A;  4XAK A;  4HBO A;  2A3E A;  1BL4 A;  2ZR5 A;  2PBC A;  3MDY B;  1IX5 A;  1LG1 A;  3OOB A;  4ODN A;  3WD1 A;  3KAI A;  4DWS B;  1FKR A;  1P5Q A;  3NTP A;  4P8X A;  4MAV A;  2XPB A;  4ZPT R;  2WM0 A;  3IHZ A;  1B6C A;  1W9V A;  2FKE A;  4TX0 A;  2N87 A;  3O5I A;  3WL0 A;  5I98 A;  1J4I A;  1SR0 A;  3O5G A;  4ZPW R;  3BMB A;  1W9U A;  4MNL A;  4WKA A;  2RUD A;  1FFR A;  1VF8 A;  2PPN A;  3IKD A;  3TC5 A;  3O5P A;  4DIP A;  2MLX A;  3AQU A;  3ARX A;  1FJD A;  2MLY A;  3LUO A;  2PN0 A;  1JNS A;  1PBK A;  3TDB A;  1FKH A;  2B5U B;  4DZ3 A;  2RUQ A;  3WL1 A;  3JXV A;  4MGV A;  5BXJ A;  2FDM A;  1FKJ A;  3KAB A;  3ARZ A;  2OFN A;  1FKD A;  3UI5 A;  1FKF A;  3CH9 A;  1FKG A;  4TYO A;  1X6N A;  4FN2 A;  2AOS A;  3NRK A;  1E6P A;  3ODK A;  3UF8 A;  1FKS A;  4Z2K A;  2MLZ A;  4DRP A;  5B8I C;  1F40 A;  3PRB A;  2RUC A;  1ZB5 A;  2DG4 A;  2XP6 A;  1NSG A;  4WK9 A;  1FKB A;  1FKL A;  5GPR A;  4DRN A;  1ROT A;  4P8W A;  3WD2 A;  3ARQ A;  2LJ4 A;  2RQS A;  2AWG A;  1RD6 A;  1HKI A;  2DT2 A;  3O5E A;  1HJW A;  3G6L A;  2RUR A;  4TNS A;  3UI6 A;  3ART A;  4IQC A;  1W1V A;  3UQA A;  2PPO A;  3WD4 A;  1L1P A;  1Q1C A;  2LGO A;  1FKI A;  3KCE A;  4IT6 A;  4QZV B;  5HTG A;  4W9Q A;  4DRK A;  1NWT A;  4J4O A;  3EY6 A;  3RM9 A;  4ODO A;  1FKT A;  1X6L A;  4NNR A;  4W9P A;  4S3J A;  1LG2 A;  1XHG A;  2L2S A;  3GU0 A;  4IPX A;  5GQB A; 
#chains in the Genus database with same CATH homology
 3ARO A;  2KFW A;  2DSV A;  3CHD A;  3B9D A;  1ZBK A;  5GPG A;  1HKJ A;  2MPH A;  3PRD A;  2ZQV A;  2VN1 A;  2G41 A;  1A7X A;  4WKF A;  1JND A;  1TFV A;  2XP7 A;  1NMW A;  3PA7 A;  1E9L A;  2ZQS A;  1JNE A;  4DRI A;  2FAP A;  4LGX A;  2KO7 A;  3ARV A;  1OWQ A;  2DT3 A;  1GUV A;  1EDQ A;  1WAW A;  1JNT A;  2F2D A;  1H0I A;  3AS2 A;  3VAW A;  4AY1 A;  5HWB A;  4G50 A;  4O2T A;  5HW8 A;  2PV2 A;  2DSU A;  2LPV A;  3ARY A;  5HW7 A;  3O5M A;  1FD9 A;  1KFW A;  2F4E A;  2PV1 A;  3ALF A;  4R0X A;  1W1P A;  3WKZ A;  4LAV A;  4DRQ A;  2Y78 A;  3RM8 A;  4DRJ A;  4Z2I A;  1LL7 A;  2DT0 A;  4FAP A;  4ODK A;  2KI3 A;  4C02 B;  4TW7 A;  1PIN A;  5DIU A;  3GPK A;  1ZBW A;  2QF8 A;  2UZ5 A;  1LQ0 A;  4BF8 A;  1D2K A;  1JVW A;  1KT1 A;  3ARP A;  5DO2 A;  3O5R A;  2A3C A;  4DWS D;  1F8A B;  3WD0 A;  4NZC A;  1T11 A;  4JFL A;  3O5K A;  4ML4 A;  4L3N A;  4N19 A;  4ITZ A;  3RFW A;  2Q5A A;  2MF9 A;  4R5E A;  4ODQ A;  4QIB A;  2ESC A;  1HKK A;  4JFJ A;  3AS0 A;  3QOK A;  4TW6 A;  4JFK A;  1NMV A;  1H0G A;  4HBE A;  3KAD A;  4JFI A;  3ARS A;  2A3A A;  3CHE A;  1LL4 A;  4MNK A;  4QT3 A;  4P8V A;  3O5D A;  1GPF A;  4MNJ A;  2D9F A;  2A3B A;  4ZPV R;  1GOI A;  4IQ2 A;  4Z2J A;  3IK8 A;  3B8S A;  1N1A A;  2KE0 A;  4G2P A;  3JYM A;  4DZ2 A;  3O5O A;  4L72 B;  4MTV A;  5HWC A;  1FKK A;  1YAT A;  3CGN A;  3ARR A;  3I6C A;  2ZQT A;  2M2A A;  1Y0O A;  3O5J A;  2O9O A;  1WNO A;  1ROU A;  2KGJ A;  3KAG A;  4WKH A;  4LAY A;  4WIW A;  2IUZ A;  2WLY A;  4U86 A;  2ITK A;  3WH0 A;  4Z2H A;  4Z2G A;  4J4N A;  2JZV A;  3KAC A;  3FAP A;  1R9H A;  1E6N A;  1FFQ A;  3BXW A;  2PV3 A;  2DPE A;  2XP5 A;  1HJX A;  3AS3 A;  2ZR6 A;  3WQW A;  1ZK6 A;  2KR7 A;  5DIV A;  3B9E A;  1C9H A;  2ZR4 A;  4U84 A;  2VCD A;  3RGC A;  4Q22 A;  3G6M A;  1W9P A;  1BKF A;  1ZBC A;  2XP4 A;  2LKN A;  3B7X A;  4MNM A;  4DH0 A;  3UQB A;  1SYT A;  3CHF A;  3TCZ A;  1E6R A;  4ZS6 A;  2OLH A;  1NWR A;  1XRV A;  3UQI A;  2RSE A;  4DRM A;  3B9A A;  3O5Q A;  4WJX A;  2K8I A;  4PTM A;  3AS1 A;  1D7I A;  3CHC A;  1U79 A;  2WK2 A;  3O5F A;  4Q7N A;  2DT1 A;  1LJY A;  4JYS A;  2G8Z A;  4U85 A;  4DWS C;  2XPA A;  1NWS A;  5HBF A;  2YBT A;  1EHN A;  2IF4 A;  1WB0 A;  3NI6 A;  1QZ2 A;  5J6E A;  3CZ8 A;  4S3K A;  3OA5 A;  4KQZ A;  4P8U A;  1J4H A;  2XP9 A;  5DEZ A;  3KZ7 A;  3IKG A;  3PRA A;  3JYJ A;  4IT4 A;  1ITX A;  2O92 A;  1D6O A;  3FXY A;  5HT1 A;  4DWS A;  1QPF A;  5HKG A;  3CGM A;  3ALG A;  3ARW A;  1M5Y A;  1QPL A;  1Q6I A;  2ZQU A;  1NH6 A;  1UR9 A;  2DSZ A;  1W1Y A;  5HW6 A;  2YBU A;  3ARU A;  1W1T A;  4Z2L A;  1HXV A;  1HKM A;  4JFM A;  3W4R A;  1J4R A;  2B31 A;  3KAH A;  4HAR A;  1CTN A;  3FY1 A;  1E15 A;  2DSW A;  3KAF A;  2MNT A;  3UI4 A;  3H9R B;  5DIT A;  5JH8 A;  1LL6 A;  1ZCN A;  2PI6 A;  1NWU A;  2WLZ A;  4LAW A;  4MSP A;  4TW8 A;  1YW5 A;  1EQ3 A;  3O5L A;  4DT4 A;  4ODR A;  5HUA A;  2M08 A;  1Q6H A;  4GGQ A;  2PPP A;  5D75 A;  1FAP A;  1E6Z A;  1J6Y A;  2M1I A;  2DG9 A;  4URI A;  3WIJ A;  4ODL A;  1OGB A;  1HJV A;  1D7H A;  3PR9 A;  2XP8 A;  3WD3 A;  4LAX A;  1ZU8 A;  1OGG A;  3RM4 A;  2XP3 A;  1W26 A;  4MPK A;  1KT0 A;  5DF0 A;  1EYM A;  1D7J A;  4KR0 B;  4QT2 A;  4NSB A;  1ZBV A;  4W5U A;  2F21 A;  4ODM A;  4ODP A;  2DG3 A;  3RME A;  1Q6U A;  1O6I A;  1K9T A;  4DRH A;  1TCO C;  1EIB A;  3WQV A;  4GIV A;  1ZL1 A;  4DRO A;  4W9O A;  1UR8 A;  4XAK A;  4HBO A;  2A3E A;  1BL4 A;  2ZR5 A;  2PBC A;  3MDY B;  1IX5 A;  1LG1 A;  3OOB A;  4ODN A;  3WD1 A;  3KAI A;  4DWS B;  1FKR A;  1P5Q A;  3NTP A;  4P8X A;  4MAV A;  2XPB A;  4ZPT R;  2WM0 A;  3IHZ A;  1B6C A;  1W9V A;  2FKE A;  4TX0 A;  2N87 A;  3O5I A;  3WL0 A;  5I98 A;  1J4I A;  1SR0 A;  3O5G A;  4ZPW R;  1W9U A;  4MNL A;  4WKA A;  2RUD A;  1FFR A;  1VF8 A;  2PPN A;  3IKD A;  3TC5 A;  3O5P A;  4DIP A;  2MLX A;  3AQU A;  3ARX A;  1FJD A;  2MLY A;  3LUO A;  1JNS A;  1PBK A;  3TDB A;  1FKH A;  4DZ3 A;  2RUQ A;  3WL1 A;  3JXV A;  4MGV A;  5BXJ A;  2FDM A;  1FKJ A;  3KAB A;  3ARZ A;  2OFN A;  1FKD A;  3UI5 A;  1FKF A;  3CH9 A;  1FKG A;  4TYO A;  1X6N A;  4FN2 A;  2AOS A;  3NRK A;  1E6P A;  3ODK A;  3UF8 A;  1FKS A;  4Z2K A;  2MLZ A;  4DRP A;  5B8I C;  1F40 A;  3PRB A;  2RUC A;  1ZB5 A;  2DG4 A;  2XP6 A;  1NSG A;  4WK9 A;  1FKB A;  1FKL A;  5GPR A;  4DRN A;  1ROT A;  4P8W A;  3WD2 A;  3ARQ A;  2LJ4 A;  2RQS A;  2AWG A;  1RD6 A;  1HKI A;  2DT2 A;  3O5E A;  1HJW A;  3G6L A;  2RUR A;  4TNS A;  3UI6 A;  3ART A;  4IQC A;  1W1V A;  3UQA A;  2PPO A;  3WD4 A;  1L1P A;  1Q1C A;  2LGO A;  1FKI A;  3KCE A;  4IT6 A;  4QZV B;  5HTG A;  4W9Q A;  4DRK A;  1NWT A;  4J4O A;  3EY6 A;  3RM9 A;  4ODO A;  1FKT A;  1X6L A;  4NNR A;  4W9P A;  4S3J A;  1LG2 A;  1XHG A;  2L2S A;  4IPX A;  5GQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...