4DRKA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphenyl)-1-({[(2s)-1-(3,3-dimethyl-2-oxopentanoyl)piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic acid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drkA00
4G2PA 3UI4A 2RURA 4IQCA 4J4OA 4NNRA 4DIPA 4DZ3A 1KT1A 2XP5A 2XP4A 4IQ2A 4LAWA 1ZCNA 2M08A 3B7XA 2XP8A 2VN1A 2RUDA 2Y78A 3NI6A 4O2TA 2RUQA 4IPXA 5HW7A 3KZ7A 4TW6A 4QT2A 1R9HA 4GGQA 4W9PA 5HUAA 2PV2A 2F2DA 1L1PA 1Q6IA 2RQSA 4W9OA 1FAPA 2Q5AA 4DT4A 2FKEA 3JXVA 1YW5A 2LJ4A 2PV3A 5I98A 1D7JA 2KGJA 1FKBA 1FKTA 4DH0A 1NMVA 2MF9A 4DRKA 5HTGA 4TW8A 4ODOA 3UF8A 4ODLA 1Q1CA 1M5YA 4DRNA 2ZR4A 4U85A 4MSPA 2L2SA 1ROUA 2XP9A 4JFJA 4ODKA 3O5GA 5HWCA 4FN2A 5D75A 2ZQSA 3NTPA 1YATA 4DRPA 1EQ3A 2UZ5A 4DZ2A 3LUOA 3GPKA 3I6CA 3ODKA 3WH0A 3UQAA 1FKJA 3H9RB 4QT3A 2PBCA 2M2AA 4BF8A 1NSGA 2RUCA 3NRKA 2RSEA 4DRIA 3KABA 1ZK6A 1U79A 2F4EA 3IK8A 3O5KA 1J4IA 1N1AA 1QPFA 2JZVA 2PPPA 2KI3A 4JYSA 4ODQA 4DRHA 3CGMA 5HW8A 4ITZA 5GPGA 1J6YA 1JNSA 1J4HA 1NMWA 1F40A 1FD9A 2MLYA 2IF4A 4LAXA 4R0XA 1P5QA 1Q6HA 3PA7A 5HKGA 3O5QA 3EY6A 3RGCA 1F8AB 3KACA 4QIBA 3KAGA 4ODRA 4U86A 3PRDA 1FKRA 3KADA 3RFWA 5DIUA 3TDBA 1JVWA 1QZ2A 3O5DA 2K8IA 1FKGA 4JFMA 3IHZA 5HWBA 1JNTA 1B6CA 3JYJA 2AWGA 1Q6UA 2PPOA 1D7HA 2MNTA 3CGNA 5DIVA 1D6OA 4TW7A 3KAHA 4JFKA 3MDYB 2D9FA 4W9QA 2MPHA 2PPNA 5BXJA 2KR7A 1A7XA 1T11A 3O5OA 3KAIA 1ROTA 4ODPA 3JYMA 3O5LA 2XP3A 2VCDA 5J6EA 3PRBA 1Y0OA 1BL4A 2KFWA 2MLXA 4JFIA 3OOBA 4DRQA 2ZQUA 1TCOC 4N19A 3UI6A 2KO7A 4J4NA 4LAVA 2PV1A 4TYOA 1FKHA 1FKFA 4U84A 2MLZA 1FKIA 4TX0A 3UQBA 2ZR5A 4MGVA 5DITA 4FAPA 1BKFA 1PINA 2LKNA 1PBKA 3IKGA 2XPBA 3O5JA 4LAYA 1FKDA 3IKDA 4ODMA 3KCEA 4TNSA 2LGOA 1FKSA 2M1IA 2OFNA 4ODNA 3UQIA 4DROA 4DRMA 1FKKA 3TCZA 5HT1A 1D7IA 2XP6A 3O5IA 4G50A 4C02B 2ZQVA 1FJDA 2N87A 4GIVA 4JFLA 2DG9A 3VAWA 2FAPA 2LPVA 3O5EA 1W26A 3UI5A 3FAPA 2ZR6A 1QPLA 2KE0A 3O5MA 2ITKA 1FKLA 3O5FA 1HXVA 2XP7A 1KT0A 2XPAA 3O5RA 2ZQTA 3O5PA 3TC5A 3KAFA 1C9HA 1EYMA 2DG4A 1J4RA 2DG3A 5B8IC 4DRJA 2F21A 5HW6A
chains in the Genus database with same CATH superfamily
4G2PA 2RURA 4DZ3A 1KT1A 2XP5A 3FY1A 4ZPWR 3VAWA 1ZCNA 4Z2IA 2Y78A 5HW7A 4TW6A 1R9HA 1L1PA 2F2DA 1Q6IA 5DF0A 2Q5AA 4MNKA 2LJ4A 1FFRA 4UDMA 1LG2A 1NMVA 1M5YA 1D2KA 4MNMA 3GTYX 3B8SA 5HWCA 5D75A 3G6MA 2OLHA 1EQ3A 3AROA 1FKJA 1RD6A 3H9RB 4BF8A 1HKJA 1NSGA 1E6RA 3WD2A 1XRVA 1SYTA 1ZK6A 1N1AA 2PPPA 1W1VA 2G8ZA 3PR9A 4WK9A 2IF4A 3GU0A 4R0XA 3WD4A 3O5QA 1F8AB 4QIBA 4U86A 4S3JA 4P8VA 4XAKA 1FKRA 5JH8A 1UR8A 1ITXA 3IHZA 2DT3A 1D6OA 3MDYB 1OWQA 1A7XA 1ZBKA 3KAIA 4ODPA 2B31A 3WL1A 3O5LA 2XP3A 2VCDA 3ARQA 1BL4A 4JFIA 1NWUA 3CHDA 3EIPA 2PV1A 3B9EA 4HARA 2MLZA 1FKIA 2A3EA 3CH9A 5DITA 3OA5A 1BKFA 1PINA 1PBKA 1UR9A 1WAWA 3UQIA 4HBOA 2XP6A 1K9TA 2FAPA 4S3KA 3FAPA 1XHGA 4URIA 4MAVA 2B5UB 2QF8A 1KT0A 2ZQTA 3CZ8A 1GPFA 3KAFA 1HJVA 3W4RA 2DG3A 2YBUA 2DSUA 4DRJA 1NWRA 3AS3A 4NNRA 4DIPA 4LAWA 3AS0A 2VN1A 1IX5A 3ARVA 2PV2A 2FKEA 5I98A 4ZPTR 1FKBA 4DH0A 1FKTA 4DRKA 5DEZA 5HTGA 4ODOA 3UF8A 1E6NA 1Q1CA 1X6NA 4R5EA 2ZR4A 3ARUA 4JFJA 4MTVA 2DSVA 3PRAA 4KQZA 1LL6A 1WNOA 3WH0A 1EIBA 3UQAA 2PBCA 3KABA 1NWSA 1U79A 1E9LA 3UI5A 1J4IA 1HJWA 1GUVA 5HW8A 3WD0A 2WM0A 1HKIA 4ODRA 4DWSA 3RMEA 4HBEA 3O5DA 3WKZA 3CHFA 1HKKA 4Z2JA 4JFMA 1JNTA 1B6CA 5GPRA 2MNTA 5DIVA 3ARWA 4TW7A 2PPNA 3WD3A 3ARRA 2A3BA 1ROTA 1Y0OA 2KFWA 2MLXA 4LAVA 4TYOA 4TX0A 4WKAA 4MGVA 3ARPA 3IKGA 2XPBA 4ODMA 4TNSA 1FKSA 2OFNA 2DSZA 3TCZA 4DRMA 3AQUA 3O5IA 4G50A 4KR0B 4Q7NA 2ZQVA 1H0IA 4WJXA 2ZR6A 2KE0A 3CHCA 1GOIA 3O5RA 1E6ZA 3RM8A 5B8IC 2DG4A 1EYMA 1J4RA 1W9PA 2F21A 1HKMA 3G6LA 4J4OA 4IQ2A 4O2TA 2M08A 3NI6A 4Z2KA 2RUDA 2RUQA 4IPXA 5HUAA 1OGBA 1FAPA 1E44A 2WK2A 4ZS6A 4DT4A 3JXVA 1X6LA 1D7JA 4LGXA 1ZL1A 1W1TA 4U85A 1W1YA 1ROUA 4ODKA 3O5GA 4P8WA 3NTPA 1E15A 1YATA 2UZ5A 3LUOA 3I6CA 1W1PA 3FXYA 4QT3A 2M2AA 1EDQA 2RUCA 2WLYA 3IK8A 4ODQA 3AS1A 4JYSA 4IT4A 1J6YA 1JNSA 3ARTA 4ITZA 5GPGA 5GQBA 2DT1A 1J4HA 1NMWA 4DWSC 1ZBCA 1FD9A 1VF8A 2MLYA 4IT6A 4ZPVR 1P5QA 5HKGA 3EY6A 3RGCA 3ARYA 3KACA 4DWSD 3RFWA 5DIUA 4Z2LA 1JVWA 1ZBWA 1WB0A 3B9AA 1ZB5A 5HWBA 3JYJA 2AWGA 3CGNA 3KAHA 3ARXA 2AOSA 4JFKA 3O5OA 4MNJA 3RM4A 1E6PA 5J6EA 4P8UA 3PRBA 2EULA 1LL7A 4N19A 3BMBA 1FKHA 2ETNA 1FKFA 4U84A 2DT2A 3UQBA 2ZR5A 4FAPA 1JNEA 3O5JA 1FKDA 5HBFA 3KCEA 2LGOA 4ODNA 2M1IA 2WLZA 1GRJA 1FKKA 5HT1A 1W9VA 1D7IA 1FJDA 3WQVA 4JFLA 2IUZA 2LPVA 3O5EA 2DSWA 1QPLA 3O5MA 1FKLA 4Z2HA 4Z2GA 1HXVA 2A3CA 2FDMA 1HJXA 3AS2A 5HW6A 2G41A 1LJYA 3UI4A 4IQCA 2O92A 2XP4A 1FFQA 3BXWA 3B7XA 2P4VA 1H0GA 2XP8A 1JNDA 3KZ7A 4QT2A 4W9PA 4GGQA 1NH6A 2RQSA 4W9OA 1KFWA 4MPKA 1JCHB 1YW5A 2PV3A 4ML4A 1LQ0A 1SR0A 2KGJA 2MF9A 4TW8A 4ODLA 3ALGA 4WIWA 4DRNA 4NSBA 4MSPA 2L2SA 2XP9A 4WKFA 4FN2A 2ZQSA 4DRPA 4DZ2A 3GPKA 3ODKA 5DO2A 4P8XA 3NRKA 3WIJA 4MNLA 4DRIA 2A3AA 2F4EA 3UI6A 3O5KA 1QPFA 1LL4A 2JZVA 4DRHA 1ZU8A 2KI3A 2O9OA 1NWTA 3CGMA 1F40A 4LAXA 4W5UA 1W9UA 1Q6HA 3PA7A 1OGGA 3KAGA 4DWSB 3PRDA 3B9DA 4L72B 3RM9A 3KADA 3TDBA 1QZ2A 2K8IA 1FKGA 1O6IA 2DPEA 1CTNA 1Q6UA 1D7HA 2PPOA 2D9FA 4W9QA 2MPHA 5BXJA 1T11A 2KR7A 2YBTA 3CHEA 3JYMA 2PI6A 3WD1A 3ALFA 2DT0A 4DRQA 1EHNA 3OOBA 2ZQUA 1TCOC 2KO7A 2PN0A 4J4NA 4Q22A 3ARSA 3QOKA 1LG1A 1ZBVA 2LKNA 4LAYA 3IKDA 4L3NA 2ESCA 4DROA 1TFVA 4C02B 2N87A 4GIVA 4QZVB 2DG9A 4AY1A 1W26A 3ARZA 4NZCA 2ITKA 3O5FA 4WKHA 2XP7A 2XPAA 2F23A 3O5PA 3TC5A 3WQWA 1C9HA 3WL0A 2RSEA 4PTMA
chains in the Genus database with same CATH topology
4G2PA 2RURA 4DZ3A 1KT1A 2XP5A 3FY1A 4ZPWR 3VAWA 1ZCNA 4Z2IA 2Y78A 5HW7A 4TW6A 1R9HA 1L1PA 2F2DA 1Q6IA 5DF0A 2Q5AA 4MNKA 2LJ4A 1FFRA 1LG2A 1NMVA 1M5YA 1D2KA 4MNMA 3B8SA 5HWCA 5D75A 3G6MA 2OLHA 1EQ3A 3AROA 1FKJA 1RD6A 3H9RB 4BF8A 1HKJA 1NSGA 1E6RA 3WD2A 1XRVA 1SYTA 1ZK6A 1N1AA 2PPPA 1W1VA 2G8ZA 3PR9A 4WK9A 2IF4A 4R0XA 3WD4A 3O5QA 1F8AB 4QIBA 4U86A 4S3JA 4P8VA 4XAKA 1FKRA 5JH8A 1UR8A 1ITXA 3IHZA 2DT3A 1D6OA 3MDYB 1OWQA 1A7XA 1ZBKA 3KAIA 4ODPA 2B31A 3WL1A 3O5LA 2XP3A 2VCDA 3ARQA 1BL4A 4JFIA 1NWUA 3CHDA 2PV1A 3B9EA 4HARA 2MLZA 1FKIA 2A3EA 3CH9A 5DITA 3OA5A 1BKFA 1PINA 1PBKA 1UR9A 1WAWA 3UQIA 4HBOA 2XP6A 1K9TA 2FAPA 4S3KA 3FAPA 1XHGA 4URIA 4MAVA 2QF8A 1KT0A 2ZQTA 3CZ8A 1GPFA 3KAFA 1HJVA 3W4RA 2DG3A 2YBUA 2DSUA 4DRJA 1NWRA 3AS3A 4NNRA 4DIPA 4LAWA 3AS0A 2VN1A 1IX5A 3ARVA 2PV2A 2FKEA 5I98A 4ZPTR 1FKBA 4DH0A 1FKTA 4DRKA 5DEZA 5HTGA 4ODOA 3UF8A 1E6NA 1Q1CA 1X6NA 4R5EA 2ZR4A 3ARUA 4JFJA 4MTVA 2DSVA 3PRAA 4KQZA 1LL6A 1WNOA 3WH0A 1EIBA 3UQAA 2PBCA 3KABA 1NWSA 1U79A 1E9LA 3UI5A 1J4IA 1HJWA 1GUVA 5HW8A 3WD0A 2WM0A 1HKIA 4ODRA 4DWSA 3RMEA 4HBEA 3O5DA 3WKZA 3CHFA 1HKKA 4Z2JA 4JFMA 1JNTA 1B6CA 5GPRA 2MNTA 5DIVA 3ARWA 4TW7A 2PPNA 3WD3A 3ARRA 2A3BA 1ROTA 1Y0OA 2KFWA 2MLXA 4LAVA 4TYOA 4TX0A 4WKAA 4MGVA 3ARPA 3IKGA 2XPBA 4ODMA 4TNSA 1FKSA 2OFNA 2DSZA 3TCZA 4DRMA 3AQUA 3O5IA 4G50A 4KR0B 4Q7NA 2ZQVA 1H0IA 4WJXA 2ZR6A 2KE0A 3CHCA 1GOIA 3O5RA 1E6ZA 3RM8A 5B8IC 2DG4A 1EYMA 1J4RA 1W9PA 2F21A 1HKMA 3G6LA 4J4OA 4IQ2A 4O2TA 2M08A 3NI6A 4Z2KA 2RUDA 2RUQA 4IPXA 5HUAA 1OGBA 1FAPA 2WK2A 4ZS6A 4DT4A 3JXVA 1X6LA 1D7JA 4LGXA 1ZL1A 1W1TA 4U85A 1W1YA 1ROUA 4ODKA 3O5GA 4P8WA 3NTPA 1E15A 1YATA 2UZ5A 3LUOA 3I6CA 1W1PA 3FXYA 4QT3A 2M2AA 1EDQA 2RUCA 2WLYA 3IK8A 4ODQA 3AS1A 4JYSA 4IT4A 1J6YA 1JNSA 3ARTA 4ITZA 5GPGA 5GQBA 2DT1A 1J4HA 1NMWA 4DWSC 1ZBCA 1FD9A 1VF8A 2MLYA 4IT6A 4ZPVR 1P5QA 5HKGA 3EY6A 3RGCA 3ARYA 3KACA 4DWSD 3RFWA 5DIUA 4Z2LA 1JVWA 1ZBWA 1WB0A 3B9AA 1ZB5A 5HWBA 3JYJA 2AWGA 3CGNA 3KAHA 3ARXA 2AOSA 4JFKA 3O5OA 4MNJA 3RM4A 1E6PA 5J6EA 4P8UA 3PRBA 1LL7A 4N19A 1FKHA 1FKFA 4U84A 2DT2A 3UQBA 2ZR5A 4FAPA 1JNEA 3O5JA 1FKDA 5HBFA 3KCEA 2LGOA 4ODNA 2M1IA 2WLZA 1FKKA 5HT1A 1W9VA 1D7IA 1FJDA 3WQVA 4JFLA 2IUZA 2LPVA 3O5EA 2DSWA 1QPLA 3O5MA 1FKLA 4Z2HA 4Z2GA 1HXVA 2A3CA 2FDMA 1HJXA 3AS2A 5HW6A 2G41A 1LJYA 3UI4A 4IQCA 2O92A 2XP4A 1FFQA 3B7XA 3BXWA 2XP8A 1H0GA 1JNDA 3KZ7A 4QT2A 4W9PA 4GGQA 1NH6A 2RQSA 4W9OA 1KFWA 4MPKA 1YW5A 2PV3A 4ML4A 1LQ0A 1SR0A 2KGJA 2MF9A 4TW8A 4ODLA 3ALGA 4WIWA 4DRNA 4NSBA 4MSPA 2L2SA 2XP9A 4WKFA 4FN2A 2ZQSA 4DRPA 4DZ2A 3GPKA 3ODKA 5DO2A 4P8XA 3NRKA 3WIJA 4MNLA 4DRIA 2A3AA 2F4EA 3UI6A 3O5KA 1QPFA 1LL4A 2JZVA 4DRHA 1ZU8A 2KI3A 2O9OA 1NWTA 3CGMA 1F40A 4LAXA 4W5UA 1W9UA 1Q6HA 3PA7A 1OGGA 3KAGA 4DWSB 3PRDA 3B9DA 4L72B 3RM9A 3KADA 3TDBA 1QZ2A 2K8IA 1FKGA 1O6IA 2DPEA 1CTNA 1Q6UA 1D7HA 2PPOA 2D9FA 4W9QA 2MPHA 5BXJA 1T11A 2KR7A 2YBTA 3CHEA 3JYMA 2PI6A 3WD1A 3ALFA 2DT0A 4DRQA 1EHNA 3OOBA 2ZQUA 1TCOC 2KO7A 4J4NA 4Q22A 3ARSA 3QOKA 1LG1A 1ZBVA 2LKNA 4LAYA 3IKDA 4L3NA 2ESCA 4DROA 1TFVA 4C02B 2N87A 4GIVA 4QZVB 2DG9A 4AY1A 1W26A 3ARZA 4NZCA 2ITKA 3O5FA 4WKHA 2XP7A 2XPAA 3O5PA 3TC5A 3WQWA 1C9HA 3WL0A 2RSEA 4PTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G2P A;  3UI4 A;  2RUR A;  4IQC A;  4J4O A;  4NNR A;  4DIP A;  4DZ3 A;  1KT1 A;  2XP5 A;  2XP4 A;  4IQ2 A;  4LAW A;  1ZCN A;  2M08 A;  3B7X A;  2XP8 A;  2VN1 A;  2RUD A;  2Y78 A;  3NI6 A;  4O2T A;  2RUQ A;  4IPX A;  5HW7 A;  3KZ7 A;  4TW6 A;  4QT2 A;  1R9H A;  4GGQ A;  4W9P A;  5HUA A;  2PV2 A;  2F2D A;  1L1P A;  1Q6I A;  2RQS A;  4W9O A;  1FAP A;  2Q5A A;  4DT4 A;  2FKE A;  3JXV A;  1YW5 A;  2LJ4 A;  2PV3 A;  5I98 A;  1D7J A;  2KGJ A;  1FKB A;  1FKT A;  4DH0 A;  1NMV A;  2MF9 A;  4DRK A;  5HTG A;  4TW8 A;  4ODO A;  3UF8 A;  4ODL A;  1Q1C A;  1M5Y A;  4DRN A;  2ZR4 A;  4U85 A;  4MSP A;  2L2S A;  1ROU A;  2XP9 A;  4JFJ A;  4ODK A;  3O5G A;  5HWC A;  4FN2 A;  5D75 A;  2ZQS A;  3NTP A;  1YAT A;  4DRP A;  1EQ3 A;  2UZ5 A;  4DZ2 A;  3LUO A;  3GPK A;  3I6C A;  3ODK A;  3WH0 A;  3UQA A;  1FKJ A;  3H9R B;  4QT3 A;  2PBC A;  2M2A A;  4BF8 A;  1NSG A;  2RUC A;  3NRK A;  2RSE A;  4DRI A;  3KAB A;  1ZK6 A;  1U79 A;  2F4E A;  3IK8 A;  3O5K A;  1J4I A;  1N1A A;  1QPF A;  2JZV A;  2PPP A;  2KI3 A;  4JYS A;  4ODQ A;  4DRH A;  3CGM A;  5HW8 A;  4ITZ A;  5GPG A;  1J6Y A;  1JNS A;  1J4H A;  1NMW A;  1F40 A;  1FD9 A;  2MLY A;  2IF4 A;  4LAX A;  4R0X A;  1P5Q A;  1Q6H A;  3PA7 A;  5HKG A;  3O5Q A;  3EY6 A;  3RGC A;  1F8A B;  3KAC A;  4QIB A;  3KAG A;  4ODR A;  4U86 A;  3PRD A;  1FKR A;  3KAD A;  3RFW A;  5DIU A;  3TDB A;  1JVW A;  1QZ2 A;  3O5D A;  2K8I A;  1FKG A;  4JFM A;  3IHZ A;  5HWB A;  1JNT A;  1B6C A;  3JYJ A;  2AWG A;  1Q6U A;  2PPO A;  1D7H A;  2MNT A;  3CGN A;  5DIV A;  1D6O A;  4TW7 A;  3KAH A;  4JFK A;  3MDY B;  2D9F A;  4W9Q A;  2MPH A;  2PPN A;  5BXJ A;  2KR7 A;  1A7X A;  1T11 A;  3O5O A;  3KAI A;  1ROT A;  4ODP A;  3JYM A;  3O5L A;  2XP3 A;  2VCD A;  5J6E A;  3PRB A;  1Y0O A;  1BL4 A;  2KFW A;  2MLX A;  4JFI A;  3OOB A;  4DRQ A;  2ZQU A;  1TCO C;  4N19 A;  3UI6 A;  2KO7 A;  4J4N A;  4LAV A;  2PV1 A;  4TYO A;  1FKH A;  1FKF A;  4U84 A;  2MLZ A;  1FKI A;  4TX0 A;  3UQB A;  2ZR5 A;  4MGV A;  5DIT A;  4FAP A;  1BKF A;  1PIN A;  2LKN A;  1PBK A;  3IKG A;  2XPB A;  3O5J A;  4LAY A;  1FKD A;  3IKD A;  4ODM A;  3KCE A;  4TNS A;  2LGO A;  1FKS A;  2M1I A;  2OFN A;  4ODN A;  3UQI A;  4DRO A;  4DRM A;  1FKK A;  3TCZ A;  5HT1 A;  1D7I A;  2XP6 A;  3O5I A;  4G50 A;  4C02 B;  2ZQV A;  1FJD A;  2N87 A;  4GIV A;  4JFL A;  2DG9 A;  3VAW A;  2FAP A;  2LPV A;  3O5E A;  1W26 A;  3UI5 A;  3FAP A;  2ZR6 A;  1QPL A;  2KE0 A;  3O5M A;  2ITK A;  1FKL A;  3O5F A;  1HXV A;  2XP7 A;  1KT0 A;  2XPA A;  3O5R A;  2ZQT A;  3O5P A;  3TC5 A;  3KAF A;  1C9H A;  1EYM A;  2DG4 A;  1J4R A;  2DG3 A;  5B8I C;  4DRJ A;  2F21 A;  5HW6 A; 
#chains in the Genus database with same CATH topology
 4G2P A;  2RUR A;  4DZ3 A;  1KT1 A;  2XP5 A;  3FY1 A;  4ZPW R;  3VAW A;  1ZCN A;  4Z2I A;  2Y78 A;  5HW7 A;  4TW6 A;  1R9H A;  1L1P A;  2F2D A;  1Q6I A;  5DF0 A;  2Q5A A;  4MNK A;  2LJ4 A;  1FFR A;  4UDM A;  1LG2 A;  1NMV A;  1M5Y A;  1D2K A;  4MNM A;  3GTY X;  3B8S A;  5HWC A;  5D75 A;  3G6M A;  2OLH A;  1EQ3 A;  3ARO A;  1FKJ A;  1RD6 A;  3H9R B;  4BF8 A;  1HKJ A;  1NSG A;  1E6R A;  3WD2 A;  1XRV A;  1SYT A;  1ZK6 A;  1N1A A;  2PPP A;  1W1V A;  2G8Z A;  3PR9 A;  4WK9 A;  2IF4 A;  3GU0 A;  4R0X A;  3WD4 A;  3O5Q A;  1F8A B;  4QIB A;  4U86 A;  4S3J A;  4P8V A;  4XAK A;  1FKR A;  5JH8 A;  1UR8 A;  1ITX A;  3IHZ A;  2DT3 A;  1D6O A;  3MDY B;  1OWQ A;  1A7X A;  1ZBK A;  3KAI A;  4ODP A;  2B31 A;  3WL1 A;  3O5L A;  2XP3 A;  2VCD A;  3ARQ A;  1BL4 A;  4JFI A;  1NWU A;  3CHD A;  3EIP A;  2PV1 A;  3B9E A;  4HAR A;  2MLZ A;  1FKI A;  2A3E A;  3CH9 A;  5DIT A;  3OA5 A;  1BKF A;  1PIN A;  1PBK A;  1UR9 A;  1WAW A;  3UQI A;  4HBO A;  2XP6 A;  1K9T A;  2FAP A;  4S3K A;  3FAP A;  1XHG A;  4URI A;  4MAV A;  2B5U B;  2QF8 A;  1KT0 A;  2ZQT A;  3CZ8 A;  1GPF A;  3KAF A;  1HJV A;  3W4R A;  2DG3 A;  2YBU A;  2DSU A;  4DRJ A;  1NWR A;  3AS3 A;  4NNR A;  4DIP A;  4LAW A;  3AS0 A;  2VN1 A;  1IX5 A;  3ARV A;  2PV2 A;  2FKE A;  5I98 A;  4ZPT R;  1FKB A;  4DH0 A;  1FKT A;  4DRK A;  5DEZ A;  5HTG A;  4ODO A;  3UF8 A;  1E6N A;  1Q1C A;  1X6N A;  4R5E A;  2ZR4 A;  3ARU A;  4JFJ A;  4MTV A;  2DSV A;  3PRA A;  4KQZ A;  1LL6 A;  1WNO A;  3WH0 A;  1EIB A;  3UQA A;  2PBC A;  3KAB A;  1NWS A;  1U79 A;  1E9L A;  3UI5 A;  1J4I A;  1HJW A;  1GUV A;  5HW8 A;  3WD0 A;  2WM0 A;  1HKI A;  4ODR A;  4DWS A;  3RME A;  4HBE A;  3O5D A;  3WKZ A;  3CHF A;  1HKK A;  4Z2J A;  4JFM A;  1JNT A;  1B6C A;  5GPR A;  2MNT A;  5DIV A;  3ARW A;  4TW7 A;  2PPN A;  3WD3 A;  3ARR A;  2A3B A;  1ROT A;  1Y0O A;  2KFW A;  2MLX A;  4LAV A;  4TYO A;  4TX0 A;  4WKA A;  4MGV A;  3ARP A;  3IKG A;  2XPB A;  4ODM A;  4TNS A;  1FKS A;  2OFN A;  2DSZ A;  3TCZ A;  4DRM A;  3AQU A;  3O5I A;  4G50 A;  4KR0 B;  4Q7N A;  2ZQV A;  1H0I A;  4WJX A;  2ZR6 A;  2KE0 A;  3CHC A;  1GOI A;  3O5R A;  1E6Z A;  3RM8 A;  5B8I C;  2DG4 A;  1EYM A;  1J4R A;  1W9P A;  2F21 A;  1HKM A;  3G6L A;  4J4O A;  4IQ2 A;  4O2T A;  2M08 A;  3NI6 A;  4Z2K A;  2RUD A;  2RUQ A;  4IPX A;  5HUA A;  1OGB A;  1FAP A;  1E44 A;  2WK2 A;  4ZS6 A;  4DT4 A;  3JXV A;  1X6L A;  1D7J A;  4LGX A;  1ZL1 A;  1W1T A;  4U85 A;  1W1Y A;  1ROU A;  4ODK A;  3O5G A;  4P8W A;  3NTP A;  1E15 A;  1YAT A;  2UZ5 A;  3LUO A;  3I6C A;  1W1P A;  3FXY A;  4QT3 A;  2M2A A;  1EDQ A;  2RUC A;  2WLY A;  3IK8 A;  4ODQ A;  3AS1 A;  4JYS A;  4IT4 A;  1J6Y A;  1JNS A;  3ART A;  4ITZ A;  5GPG A;  5GQB A;  2DT1 A;  1J4H A;  1NMW A;  4DWS C;  1ZBC A;  1FD9 A;  1VF8 A;  2MLY A;  4IT6 A;  4ZPV R;  1P5Q A;  5HKG A;  3EY6 A;  3RGC A;  3ARY A;  3KAC A;  4DWS D;  3RFW A;  5DIU A;  4Z2L A;  1JVW A;  1ZBW A;  1WB0 A;  3B9A A;  1ZB5 A;  5HWB A;  3JYJ A;  2AWG A;  3CGN A;  3KAH A;  3ARX A;  2AOS A;  4JFK A;  3O5O A;  4MNJ A;  3RM4 A;  1E6P A;  5J6E A;  4P8U A;  3PRB A;  2EUL A;  1LL7 A;  4N19 A;  3BMB A;  1FKH A;  2ETN A;  1FKF A;  4U84 A;  2DT2 A;  3UQB A;  2ZR5 A;  4FAP A;  1JNE A;  3O5J A;  1FKD A;  5HBF A;  3KCE A;  2LGO A;  4ODN A;  2M1I A;  2WLZ A;  1GRJ A;  1FKK A;  5HT1 A;  1W9V A;  1D7I A;  1FJD A;  3WQV A;  4JFL A;  2IUZ A;  2LPV A;  3O5E A;  2DSW A;  1QPL A;  3O5M A;  1FKL A;  4Z2H A;  4Z2G A;  1HXV A;  2A3C A;  2FDM A;  1HJX A;  3AS2 A;  5HW6 A;  2G41 A;  1LJY A;  3UI4 A;  4IQC A;  2O92 A;  2XP4 A;  1FFQ A;  3BXW A;  3B7X A;  2P4V A;  1H0G A;  2XP8 A;  1JND A;  3KZ7 A;  4QT2 A;  4W9P A;  4GGQ A;  1NH6 A;  2RQS A;  4W9O A;  1KFW A;  4MPK A;  1JCH B;  1YW5 A;  2PV3 A;  4ML4 A;  1LQ0 A;  1SR0 A;  2KGJ A;  2MF9 A;  4TW8 A;  4ODL A;  3ALG A;  4WIW A;  4DRN A;  4NSB A;  4MSP A;  2L2S A;  2XP9 A;  4WKF A;  4FN2 A;  2ZQS A;  4DRP A;  4DZ2 A;  3GPK A;  3ODK A;  5DO2 A;  4P8X A;  3NRK A;  3WIJ A;  4MNL A;  4DRI A;  2A3A A;  2F4E A;  3UI6 A;  3O5K A;  1QPF A;  1LL4 A;  2JZV A;  4DRH A;  1ZU8 A;  2KI3 A;  2O9O A;  1NWT A;  3CGM A;  1F40 A;  4LAX A;  4W5U A;  1W9U A;  1Q6H A;  3PA7 A;  1OGG A;  3KAG A;  4DWS B;  3PRD A;  3B9D A;  4L72 B;  3RM9 A;  3KAD A;  3TDB A;  1QZ2 A;  2K8I A;  1FKG A;  1O6I A;  2DPE A;  1CTN A;  1Q6U A;  1D7H A;  2PPO A;  2D9F A;  4W9Q A;  2MPH A;  5BXJ A;  1T11 A;  2KR7 A;  2YBT A;  3CHE A;  3JYM A;  2PI6 A;  3WD1 A;  3ALF A;  2DT0 A;  4DRQ A;  1EHN A;  3OOB A;  2ZQU A;  1TCO C;  2KO7 A;  2PN0 A;  4J4N A;  4Q22 A;  3ARS A;  3QOK A;  1LG1 A;  1ZBV A;  2LKN A;  4LAY A;  3IKD A;  4L3N A;  2ESC A;  4DRO A;  1TFV A;  4C02 B;  2N87 A;  4GIV A;  4QZV B;  2DG9 A;  4AY1 A;  1W26 A;  3ARZ A;  4NZC A;  2ITK A;  3O5F A;  4WKH A;  2XP7 A;  2XPA A;  2F23 A;  3O5P A;  3TC5 A;  3WQW A;  1C9H A;  3WL0 A;  2RSE A;  4PTM A; 
#chains in the Genus database with same CATH homology
 4G2P A;  2RUR A;  4DZ3 A;  1KT1 A;  2XP5 A;  3FY1 A;  4ZPW R;  3VAW A;  1ZCN A;  4Z2I A;  2Y78 A;  5HW7 A;  4TW6 A;  1R9H A;  1L1P A;  2F2D A;  1Q6I A;  5DF0 A;  2Q5A A;  4MNK A;  2LJ4 A;  1FFR A;  1LG2 A;  1NMV A;  1M5Y A;  1D2K A;  4MNM A;  3B8S A;  5HWC A;  5D75 A;  3G6M A;  2OLH A;  1EQ3 A;  3ARO A;  1FKJ A;  1RD6 A;  3H9R B;  4BF8 A;  1HKJ A;  1NSG A;  1E6R A;  3WD2 A;  1XRV A;  1SYT A;  1ZK6 A;  1N1A A;  2PPP A;  1W1V A;  2G8Z A;  3PR9 A;  4WK9 A;  2IF4 A;  4R0X A;  3WD4 A;  3O5Q A;  1F8A B;  4QIB A;  4U86 A;  4S3J A;  4P8V A;  4XAK A;  1FKR A;  5JH8 A;  1UR8 A;  1ITX A;  3IHZ A;  2DT3 A;  1D6O A;  3MDY B;  1OWQ A;  1A7X A;  1ZBK A;  3KAI A;  4ODP A;  2B31 A;  3WL1 A;  3O5L A;  2XP3 A;  2VCD A;  3ARQ A;  1BL4 A;  4JFI A;  1NWU A;  3CHD A;  2PV1 A;  3B9E A;  4HAR A;  2MLZ A;  1FKI A;  2A3E A;  3CH9 A;  5DIT A;  3OA5 A;  1BKF A;  1PIN A;  1PBK A;  1UR9 A;  1WAW A;  3UQI A;  4HBO A;  2XP6 A;  1K9T A;  2FAP A;  4S3K A;  3FAP A;  1XHG A;  4URI A;  4MAV A;  2QF8 A;  1KT0 A;  2ZQT A;  3CZ8 A;  1GPF A;  3KAF A;  1HJV A;  3W4R A;  2DG3 A;  2YBU A;  2DSU A;  4DRJ A;  1NWR A;  3AS3 A;  4NNR A;  4DIP A;  4LAW A;  3AS0 A;  2VN1 A;  1IX5 A;  3ARV A;  2PV2 A;  2FKE A;  5I98 A;  4ZPT R;  1FKB A;  4DH0 A;  1FKT A;  4DRK A;  5DEZ A;  5HTG A;  4ODO A;  3UF8 A;  1E6N A;  1Q1C A;  1X6N A;  4R5E A;  2ZR4 A;  3ARU A;  4JFJ A;  4MTV A;  2DSV A;  3PRA A;  4KQZ A;  1LL6 A;  1WNO A;  3WH0 A;  1EIB A;  3UQA A;  2PBC A;  3KAB A;  1NWS A;  1U79 A;  1E9L A;  3UI5 A;  1J4I A;  1HJW A;  1GUV A;  5HW8 A;  3WD0 A;  2WM0 A;  1HKI A;  4ODR A;  4DWS A;  3RME A;  4HBE A;  3O5D A;  3WKZ A;  3CHF A;  1HKK A;  4Z2J A;  4JFM A;  1JNT A;  1B6C A;  5GPR A;  2MNT A;  5DIV A;  3ARW A;  4TW7 A;  2PPN A;  3WD3 A;  3ARR A;  2A3B A;  1ROT A;  1Y0O A;  2KFW A;  2MLX A;  4LAV A;  4TYO A;  4TX0 A;  4WKA A;  4MGV A;  3ARP A;  3IKG A;  2XPB A;  4ODM A;  4TNS A;  1FKS A;  2OFN A;  2DSZ A;  3TCZ A;  4DRM A;  3AQU A;  3O5I A;  4G50 A;  4KR0 B;  4Q7N A;  2ZQV A;  1H0I A;  4WJX A;  2ZR6 A;  2KE0 A;  3CHC A;  1GOI A;  3O5R A;  1E6Z A;  3RM8 A;  5B8I C;  2DG4 A;  1EYM A;  1J4R A;  1W9P A;  2F21 A;  1HKM A;  3G6L A;  4J4O A;  4IQ2 A;  4O2T A;  2M08 A;  3NI6 A;  4Z2K A;  2RUD A;  2RUQ A;  4IPX A;  5HUA A;  1OGB A;  1FAP A;  2WK2 A;  4ZS6 A;  4DT4 A;  3JXV A;  1X6L A;  1D7J A;  4LGX A;  1ZL1 A;  1W1T A;  4U85 A;  1W1Y A;  1ROU A;  4ODK A;  3O5G A;  4P8W A;  3NTP A;  1E15 A;  1YAT A;  2UZ5 A;  3LUO A;  3I6C A;  1W1P A;  3FXY A;  4QT3 A;  2M2A A;  1EDQ A;  2RUC A;  2WLY A;  3IK8 A;  4ODQ A;  3AS1 A;  4JYS A;  4IT4 A;  1J6Y A;  1JNS A;  3ART A;  4ITZ A;  5GPG A;  5GQB A;  2DT1 A;  1J4H A;  1NMW A;  4DWS C;  1ZBC A;  1FD9 A;  1VF8 A;  2MLY A;  4IT6 A;  4ZPV R;  1P5Q A;  5HKG A;  3EY6 A;  3RGC A;  3ARY A;  3KAC A;  4DWS D;  3RFW A;  5DIU A;  4Z2L A;  1JVW A;  1ZBW A;  1WB0 A;  3B9A A;  1ZB5 A;  5HWB A;  3JYJ A;  2AWG A;  3CGN A;  3KAH A;  3ARX A;  2AOS A;  4JFK A;  3O5O A;  4MNJ A;  3RM4 A;  1E6P A;  5J6E A;  4P8U A;  3PRB A;  1LL7 A;  4N19 A;  1FKH A;  1FKF A;  4U84 A;  2DT2 A;  3UQB A;  2ZR5 A;  4FAP A;  1JNE A;  3O5J A;  1FKD A;  5HBF A;  3KCE A;  2LGO A;  4ODN A;  2M1I A;  2WLZ A;  1FKK A;  5HT1 A;  1W9V A;  1D7I A;  1FJD A;  3WQV A;  4JFL A;  2IUZ A;  2LPV A;  3O5E A;  2DSW A;  1QPL A;  3O5M A;  1FKL A;  4Z2H A;  4Z2G A;  1HXV A;  2A3C A;  2FDM A;  1HJX A;  3AS2 A;  5HW6 A;  2G41 A;  1LJY A;  3UI4 A;  4IQC A;  2O92 A;  2XP4 A;  1FFQ A;  3B7X A;  3BXW A;  2XP8 A;  1H0G A;  1JND A;  3KZ7 A;  4QT2 A;  4W9P A;  4GGQ A;  1NH6 A;  2RQS A;  4W9O A;  1KFW A;  4MPK A;  1YW5 A;  2PV3 A;  4ML4 A;  1LQ0 A;  1SR0 A;  2KGJ A;  2MF9 A;  4TW8 A;  4ODL A;  3ALG A;  4WIW A;  4DRN A;  4NSB A;  4MSP A;  2L2S A;  2XP9 A;  4WKF A;  4FN2 A;  2ZQS A;  4DRP A;  4DZ2 A;  3GPK A;  3ODK A;  5DO2 A;  4P8X A;  3NRK A;  3WIJ A;  4MNL A;  4DRI A;  2A3A A;  2F4E A;  3UI6 A;  3O5K A;  1QPF A;  1LL4 A;  2JZV A;  4DRH A;  1ZU8 A;  2KI3 A;  2O9O A;  1NWT A;  3CGM A;  1F40 A;  4LAX A;  4W5U A;  1W9U A;  1Q6H A;  3PA7 A;  1OGG A;  3KAG A;  4DWS B;  3PRD A;  3B9D A;  4L72 B;  3RM9 A;  3KAD A;  3TDB A;  1QZ2 A;  2K8I A;  1FKG A;  1O6I A;  2DPE A;  1CTN A;  1Q6U A;  1D7H A;  2PPO A;  2D9F A;  4W9Q A;  2MPH A;  5BXJ A;  1T11 A;  2KR7 A;  2YBT A;  3CHE A;  3JYM A;  2PI6 A;  3WD1 A;  3ALF A;  2DT0 A;  4DRQ A;  1EHN A;  3OOB A;  2ZQU A;  1TCO C;  2KO7 A;  4J4N A;  4Q22 A;  3ARS A;  3QOK A;  1LG1 A;  1ZBV A;  2LKN A;  4LAY A;  3IKD A;  4L3N A;  2ESC A;  4DRO A;  1TFV A;  4C02 B;  2N87 A;  4GIV A;  4QZV B;  2DG9 A;  4AY1 A;  1W26 A;  3ARZ A;  4NZC A;  2ITK A;  3O5F A;  4WKH A;  2XP7 A;  2XPA A;  3O5P A;  3TC5 A;  3WQW A;  1C9H A;  3WL0 A;  2RSE A;  4PTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...