4DRMA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphenyl)-1-({[(2s)-1-{[(1s,2r)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic acid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drmA00
1FKGA 2KE0A 2FAPA 2LKNA 2ZQUA 3KABA 1BKFA 4IPXA 4MGVA 3UI4A 4NNRA 4DH0A 2XP3A 1YW5A 4DRMA 4JFKA 3O5QA 4IQCA 1NMVA 4TYOA 2RUQA 3OOBA 1T11A 2KGJA 3UQAA 4ODKA 1JNSA 1M5YA 1HXVA 2PV1A 3KAHA 2PPOA 1B6CA 2KO7A 4QT2A 3I6CA 3KAGA 1BL4A 3JYMA 1A7XA 1KT0A 2LGOA 1ZCNA 2RQSA 2ZQTA 4ITZA 2OFNA 5D75A 3PRBA 2DG4A 2PPPA 5HWBA 3O5OA 3O5RA 1ROUA 1NSGA 2LPVA 2XP9A 3NI6A 1FKBA 1D6OA 1J4HA 3KADA 4DIPA 1Q6UA 4TNSA 2Y78A 1TCOC 1Y0OA 2AWGA 3O5MA 3ODKA 4DT4A 3RGCA 2F2DA 2KR7A 1Q6HA 1F8AB 2L2SA 3UI6A 4DRPA 3NTPA 4W9OA 3KAFA 3O5DA 4R0XA 3UQIA 3WH0A 1W26A 2DG3A 4TW7A 4JYSA 3O5JA 4ODLA 4DZ2A 4U85A 1QPLA 1QPFA 4JFLA 5B8IC 4G50A 1JNTA 3KCEA 4U84A 2FKEA 3GPKA 3TCZA 3O5KA 3O5LA 4JFJA 2DG9A 2ZR4A 4J4NA 5DIVA 5HW8A 1Q6IA 4ODOA 1D7HA 2Q5AA 5J6EA 3LUOA 4W9PA 2MLYA 3B7XA 4DRJA 5BXJA 3VAWA 4LAYA 1JVWA 1FKKA 1FJDA 2PV3A 3O5EA 3UF8A 4BF8A 1FD9A 1D7JA 3FAPA 4ODQA 4ODMA 2XP4A 3EY6A 4G2PA 5HTGA 2JZVA 5HUAA 1R9HA 1FKIA 2KFWA 4ODRA 2F4EA 4FN2A 3PA7A 2IF4A 1U79A 1ZK6A 2D9FA 2N87A 3KZ7A 1EQ3A 1C9HA 2PBCA 1D7IA 4LAVA 4DROA 4N19A 3NRKA 2XP6A 1YATA 2MF9A 4QT3A 2XPBA 4C02B 3IHZA 2MLZA 2M2AA 4MSPA 3H9RB 3CGNA 3TC5A 1F40A 4DRHA 2M08A 1J6YA 2F21A 3JYJA 4JFIA 4IQ2A 1J4RA 2XP5A 5GPGA 1FKFA 1ROTA 4W9QA 2M1IA 2VCDA 3CGMA 4JFMA 4TX0A 3IKDA 3KAIA 4LAWA 4FAPA 3IKGA 4GGQA 1FKHA 2XP7A 4J4OA 3O5IA 3JXVA 4ODNA 3TDBA 3UI5A 5HW6A 1L1PA 2LJ4A 1EYMA 4DRQA 2UZ5A 1KT1A 5HW7A 4DRNA 5HT1A 2KI3A 3UQBA 1N1AA 1PBKA 2XPAA 1FKJA 2ZQSA 4GIVA 4TW6A 5I98A 2ZR5A 4U86A 4QIBA 1NMWA 3PRDA 4ODPA 1QZ2A 1FAPA 3O5GA 2XP8A 1FKSA 3RFWA 1J4IA 3KACA 4DRKA 2VN1A 4TW8A 1FKDA 2RUDA 2RURA 4DZ3A 4LAXA 2ITKA 2MNTA 2RSEA 2ZQVA 4O2TA 2ZR6A 1Q1CA 1FKTA 3MDYB 5HWCA 5HKGA 4DRIA 5DIUA 1P5QA 2PPNA 2MLXA 3IK8A 3O5FA 1FKRA 2PV2A 1PINA 1FKLA 5DITA 3O5PA 2K8IA 2RUCA 2MPHA
chains in the Genus database with same CATH superfamily
1FKGA 2KE0A 3QOKA 4DRMA 1YW5A 4JFKA 4TYOA 1T11A 3WD1A 1JNEA 1JNSA 4WJXA 3ARZA 2PV1A 1EHNA 3RM8A 3ARYA 3CHDA 3I6CA 3KAGA 3AQUA 3ARPA 5D75A 3O5RA 4HBEA 1D6OA 1HKKA 5HBFA 2AWGA 4DT4A 3FY1A 2DSZA 3UI6A 4WKAA 4MPKA 4JYSA 4Z2LA 4ODLA 5DO2A 1NWRA 5B8IC 4G50A 3KCEA 2FKEA 4Q7NA 3O5LA 2ZR4A 5DIVA 3VAWA 4LAYA 1FJDA 4BF8A 2YBTA 3UF8A 1FD9A 3FAPA 2G41A 4ODQA 3CHCA 3GTYX 5HTGA 5HUAA 1FKIA 2KFWA 2P4VA 4FN2A 3PA7A 2D9FA 4WKFA 3CH9A 4LAVA 4N19A 3NRKA 2XP6A 1O6IA 1YATA 2MF9A 1W1TA 4DWSC 3TC5A 4DWSB 4DWSA 1J6YA 3AS1A 3B9EA 3CGMA 4L3NA 3KAIA 2QF8A 1X6NA 2O92A 4NZCA 4ODNA 3TDBA 2LJ4A 1E6PA 5HT1A 1VF8A 1SR0A 3PRAA 1FKJA 3G6MA 1WNOA 1QZ2A 2XP8A 4Z2HA 3ALFA 2RUDA 2ZQVA 1D2KA 1UR9A 4P8XA 4S3JA 1OGBA 4MTVA 5DIUA 1ZBCA 1FKLA 2EULA 2MPHA 4IPXA 4P8VA 4NNRA 3O5QA 2RUQA 2KGJA 1HKJA 3WQWA 1GPFA 1M5YA 1HXVA 2WLZA 1LJYA 4QT2A 1BL4A 2LGOA 3ARRA 4ITZA 2OFNA 3PRBA 1ROUA 1NSGA 2LPVA 2XP9A 4HBOA 1FKBA 1J4HA 1GUVA 2WM0A 4TNSA 1IX5A 2Y78A 1LL4A 3RGCA 1LL7A 2DSUA 3NTPA 2A3EA 4W9OA 1KFWA 2DG3A 2B5UB 4U85A 1QPFA 4KQZA 4JFLA 1W1VA 3TCZA 4JFJA 2DG9A 4ML4A 3WIJA 2MLYA 3B7XA 4DRJA 2OLHA 3ARSA 3O5EA 4ODMA 3WL1A 1GRJA 1RD6A 4G2PA 4P8WA 4ODRA 3ARVA 1NWUA 2AOSA 2IF4A 2N87A 3ARTA 3KZ7A 2DT3A 1UR8A 2DSVA 1C9HA 1JCHB 1D7IA 4DROA 2WK2A 4MNJA 2DT1A 3IHZA 2MLZA 2M2AA 4MSPA 1K9TA 1FFQA 2M08A 3BXWA 3JYJA 4Z2JA 4JFIA 1FKFA 4W9QA 1ZL1A 4MNMA 4LAWA 4FAPA 3IKGA 1CTNA 4GGQA 1FKHA 4J4OA 3O5IA 3JXVA 1KT1A 3UQBA 1EDQA 3WKZA 4W5UA 1E6ZA 5DEZA 4TW6A 1SYTA 4URIA 4IT4A 4QIBA 1NMWA 4ODPA 1FAPA 2DPEA 3O5GA 1GOIA 3ALGA 3KACA 4TW8A 3G6LA 1FKDA 2RURA 3GU0A 4DZ3A 1ZBWA 3WD3A 1ZU8A 1FKTA 3MDYB 1ITXA 1P5QA 4XAKA 2ETNA 1PINA 3CHFA 4NSBA 3ARQA 2RUCA 2ZQUA 2FAPA 4R5EA 3KABA 4WK9A 4DH0A 1E6NA 1HJVA 2WLYA 2XP3A 4IQCA 3UQAA 1NMVA 4UDMA 3OOBA 4AY1A 3KAHA 1B6CA 4P8UA 4ZS6A 4ZPWR 1A7XA 1KT0A 2ZQTA 5JH8A 3WL0A 2PPPA 1JNDA 4WKHA 1Q6UA 3AS3A 3ODKA 3CHEA 4Q22A 2F2DA 2KR7A 1Q6HA 3PR9A 5GQBA 1FFRA 4R0XA 1W26A 4TW7A 4U84A 2YBUA 3O5KA 1Q6IA 4ODOA 1D7HA 2G8ZA 5BXJA 1JVWA 1FKKA 1NWTA 1OGGA 2A3CA 2XP4A 4WIWA 2JZVA 3WD2A 1U79A 1ZK6A 2A3AA 2PBCA 4L72B 1LG2A 4C02B 3WD0A 3H9RB 3CGNA 4ZPTR 2IUZA 3OA5A 1HKMA 2F21A 4IQ2A 2XP5A 5GPGA 4KR0B 4Z2KA 4JFMA 4TX0A 3RMEA 1WB0A 1L1PA 5HW6A 4Z2IA 2DT0A 1EYMA 1E15A 5DF0A 2KI3A 2DT2A 1W1YA 1E6RA 2DSWA 2XPAA 4PTMA 5I98A 4U86A 3RFWA 1OWQA 3AS2A 4LAXA 4QZVB 2ITKA 2MNTA 2RSEA 2ZR6A 1Q1CA 1ZBKA 1LG1A 5HWCA 4IT6A 1E9LA 2PPNA 3B9DA 3O5FA 1FKRA 1HJXA 2K8IA 2LKNA 5J6EA 3ARXA 1BKFA 4MGVA 3UI4A 5HW8A 4ODKA 3B9AA 1WAWA 2F23A 2A3BA 2PPOA 2KO7A 1E44A 1XRVA 1ZBVA 3JYMA 2RQSA 1ZCNA 2DG4A 4ZPVR 5HWBA 3O5OA 3NI6A 3W4RA 3RM4A 1HKIA 2PI6A 3WD4A 3KADA 4DIPA 1TCOC 1Y0OA 3O5MA 2O9OA 1EIBA 1F8AB 2L2SA 3ARUA 4DRPA 3WQVA 3AROA 3KAFA 3O5DA 3UQIA 3WH0A 3O5JA 4DZ2A 1LL6A 1TFVA 1QPLA 1JNTA 3GPKA 4J4NA 1W9UA 2Q5AA 1HJWA 3LUOA 4W9PA 2PV3A 1W9VA 1D7JA 3BMBA 3EY6A 1R9HA 2F4EA 1H0GA 1EQ3A 3ARWA 3EIPA 3AS0A 4Z2GA 1XHGA 4QT3A 2XPBA 1ZB5A 4HARA 1F40A 4DRHA 1W1PA 1J4RA 1ROTA 2ESCA 2M1IA 2VCDA 3IKDA 1X6LA 2XP7A 4DWSD 3UI5A 2FDMA 4DRQA 2UZ5A 5HW7A 4DRNA 4MNKA 1N1AA 4LGXA 1W9PA 3CZ8A 1PBKA 3FXYA 4MNLA 2ZQSA 4GIVA 1LQ0A 2ZR5A 1NH6A 3PRDA 1FKSA 1J4IA 4DRKA 4MAVA 2VN1A 4O2TA 3B8SA 5HKGA 4DRIA 5GPRA 1H0IA 1NWSA 2MLXA 3IK8A 3RM9A 2PV2A 4S3KA 2B31A 5DITA 3O5PA 2PN0A
chains in the Genus database with same CATH topology
1FKGA 2KE0A 3QOKA 4DRMA 1YW5A 4JFKA 4TYOA 1T11A 3WD1A 1JNEA 1JNSA 4WJXA 3ARZA 2PV1A 1EHNA 3RM8A 3ARYA 3CHDA 3I6CA 3KAGA 3AQUA 3ARPA 5D75A 3O5RA 4HBEA 1D6OA 1HKKA 5HBFA 2AWGA 4DT4A 3FY1A 2DSZA 3UI6A 4WKAA 4MPKA 4JYSA 4Z2LA 4ODLA 5DO2A 1NWRA 5B8IC 4G50A 3KCEA 2FKEA 4Q7NA 3O5LA 2ZR4A 5DIVA 3VAWA 4LAYA 1FJDA 4BF8A 2YBTA 3UF8A 1FD9A 3FAPA 2G41A 4ODQA 3CHCA 5HTGA 5HUAA 1FKIA 2KFWA 4FN2A 3PA7A 2D9FA 4WKFA 3CH9A 4LAVA 4N19A 3NRKA 2XP6A 1O6IA 1YATA 2MF9A 1W1TA 4DWSC 3TC5A 4DWSB 4DWSA 1J6YA 3AS1A 3B9EA 3CGMA 4L3NA 3KAIA 2QF8A 1X6NA 2O92A 4NZCA 4ODNA 3TDBA 2LJ4A 1E6PA 5HT1A 1VF8A 1SR0A 3PRAA 1FKJA 3G6MA 1WNOA 1QZ2A 2XP8A 4Z2HA 3ALFA 2RUDA 2ZQVA 1D2KA 1UR9A 4P8XA 4S3JA 1OGBA 4MTVA 5DIUA 1ZBCA 1FKLA 2MPHA 4IPXA 4P8VA 4NNRA 3O5QA 2RUQA 2KGJA 1HKJA 3WQWA 1GPFA 1M5YA 1HXVA 2WLZA 1LJYA 4QT2A 1BL4A 2LGOA 3ARRA 4ITZA 2OFNA 3PRBA 1ROUA 1NSGA 2LPVA 2XP9A 4HBOA 1FKBA 1J4HA 1GUVA 2WM0A 4TNSA 1IX5A 2Y78A 1LL4A 3RGCA 1LL7A 2DSUA 3NTPA 2A3EA 4W9OA 1KFWA 2DG3A 4U85A 1QPFA 4KQZA 4JFLA 1W1VA 3TCZA 4JFJA 2DG9A 4ML4A 3WIJA 2MLYA 3B7XA 4DRJA 2OLHA 3ARSA 3O5EA 4ODMA 3WL1A 1RD6A 4G2PA 4P8WA 4ODRA 3ARVA 1NWUA 2AOSA 2IF4A 2N87A 3ARTA 3KZ7A 2DT3A 1UR8A 2DSVA 1C9HA 1D7IA 4DROA 2WK2A 4MNJA 2DT1A 3IHZA 2MLZA 2M2AA 4MSPA 1K9TA 1FFQA 2M08A 3BXWA 3JYJA 4Z2JA 4JFIA 1FKFA 4W9QA 1ZL1A 4MNMA 4LAWA 4FAPA 3IKGA 1CTNA 4GGQA 1FKHA 4J4OA 3O5IA 3JXVA 1KT1A 3UQBA 1EDQA 3WKZA 4W5UA 1E6ZA 5DEZA 4TW6A 1SYTA 4URIA 4IT4A 4QIBA 1NMWA 4ODPA 1FAPA 2DPEA 3O5GA 1GOIA 3ALGA 3KACA 4TW8A 3G6LA 1FKDA 2RURA 4DZ3A 1ZBWA 3WD3A 1ZU8A 1FKTA 3MDYB 1ITXA 1P5QA 4XAKA 1PINA 3CHFA 4NSBA 3ARQA 2RUCA 2ZQUA 2FAPA 4R5EA 3KABA 4WK9A 4DH0A 1E6NA 1HJVA 2WLYA 2XP3A 4IQCA 3UQAA 1NMVA 3OOBA 4AY1A 3KAHA 1B6CA 4P8UA 4ZS6A 4ZPWR 1A7XA 1KT0A 2ZQTA 5JH8A 3WL0A 2PPPA 1JNDA 4WKHA 1Q6UA 3AS3A 3ODKA 3CHEA 4Q22A 2F2DA 2KR7A 1Q6HA 3PR9A 5GQBA 1FFRA 4R0XA 1W26A 4TW7A 4U84A 2YBUA 3O5KA 1Q6IA 4ODOA 1D7HA 2G8ZA 5BXJA 1JVWA 1FKKA 1NWTA 1OGGA 2A3CA 2XP4A 4WIWA 2JZVA 3WD2A 1U79A 1ZK6A 2A3AA 2PBCA 4L72B 1LG2A 4C02B 3WD0A 3H9RB 3CGNA 4ZPTR 2IUZA 3OA5A 1HKMA 2F21A 4IQ2A 2XP5A 5GPGA 4KR0B 4Z2KA 4JFMA 4TX0A 3RMEA 1WB0A 1L1PA 5HW6A 4Z2IA 2DT0A 1EYMA 1E15A 5DF0A 2KI3A 2DT2A 1W1YA 1E6RA 2DSWA 2XPAA 4PTMA 5I98A 4U86A 3RFWA 1OWQA 3AS2A 4LAXA 4QZVB 2ITKA 2MNTA 2RSEA 2ZR6A 1Q1CA 1ZBKA 1LG1A 5HWCA 4IT6A 1E9LA 2PPNA 3B9DA 3O5FA 1FKRA 1HJXA 2K8IA 2LKNA 5J6EA 3ARXA 1BKFA 4MGVA 3UI4A 5HW8A 4ODKA 3B9AA 1WAWA 2A3BA 2PPOA 2KO7A 1XRVA 1ZBVA 3JYMA 2RQSA 1ZCNA 2DG4A 4ZPVR 5HWBA 3O5OA 3NI6A 3W4RA 3RM4A 1HKIA 2PI6A 3WD4A 3KADA 4DIPA 1TCOC 1Y0OA 3O5MA 2O9OA 1EIBA 1F8AB 2L2SA 3ARUA 4DRPA 3WQVA 3AROA 3KAFA 3O5DA 3UQIA 3WH0A 3O5JA 4DZ2A 1LL6A 1TFVA 1QPLA 1JNTA 3GPKA 4J4NA 1W9UA 2Q5AA 1HJWA 3LUOA 4W9PA 2PV3A 1W9VA 1D7JA 3EY6A 1R9HA 2F4EA 1H0GA 1EQ3A 3ARWA 3AS0A 4Z2GA 1XHGA 4QT3A 2XPBA 1ZB5A 4HARA 1F40A 4DRHA 1W1PA 1J4RA 1ROTA 2ESCA 2M1IA 2VCDA 3IKDA 1X6LA 2XP7A 4DWSD 3UI5A 2FDMA 4DRQA 2UZ5A 5HW7A 4DRNA 4MNKA 1N1AA 4LGXA 1W9PA 3CZ8A 1PBKA 3FXYA 4MNLA 2ZQSA 4GIVA 1LQ0A 2ZR5A 1NH6A 3PRDA 1FKSA 1J4IA 4DRKA 4MAVA 2VN1A 4O2TA 3B8SA 5HKGA 4DRIA 5GPRA 1H0IA 1NWSA 2MLXA 3IK8A 3RM9A 2PV2A 4S3KA 2B31A 5DITA 3O5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKG A;  2KE0 A;  2FAP A;  2LKN A;  2ZQU A;  3KAB A;  1BKF A;  4IPX A;  4MGV A;  3UI4 A;  4NNR A;  4DH0 A;  2XP3 A;  1YW5 A;  4DRM A;  4JFK A;  3O5Q A;  4IQC A;  1NMV A;  4TYO A;  2RUQ A;  3OOB A;  1T11 A;  2KGJ A;  3UQA A;  4ODK A;  1JNS A;  1M5Y A;  1HXV A;  2PV1 A;  3KAH A;  2PPO A;  1B6C A;  2KO7 A;  4QT2 A;  3I6C A;  3KAG A;  1BL4 A;  3JYM A;  1A7X A;  1KT0 A;  2LGO A;  1ZCN A;  2RQS A;  2ZQT A;  4ITZ A;  2OFN A;  5D75 A;  3PRB A;  2DG4 A;  2PPP A;  5HWB A;  3O5O A;  3O5R A;  1ROU A;  1NSG A;  2LPV A;  2XP9 A;  3NI6 A;  1FKB A;  1D6O A;  1J4H A;  3KAD A;  4DIP A;  1Q6U A;  4TNS A;  2Y78 A;  1TCO C;  1Y0O A;  2AWG A;  3O5M A;  3ODK A;  4DT4 A;  3RGC A;  2F2D A;  2KR7 A;  1Q6H A;  1F8A B;  2L2S A;  3UI6 A;  4DRP A;  3NTP A;  4W9O A;  3KAF A;  3O5D A;  4R0X A;  3UQI A;  3WH0 A;  1W26 A;  2DG3 A;  4TW7 A;  4JYS A;  3O5J A;  4ODL A;  4DZ2 A;  4U85 A;  1QPL A;  1QPF A;  4JFL A;  5B8I C;  4G50 A;  1JNT A;  3KCE A;  4U84 A;  2FKE A;  3GPK A;  3TCZ A;  3O5K A;  3O5L A;  4JFJ A;  2DG9 A;  2ZR4 A;  4J4N A;  5DIV A;  5HW8 A;  1Q6I A;  4ODO A;  1D7H A;  2Q5A A;  5J6E A;  3LUO A;  4W9P A;  2MLY A;  3B7X A;  4DRJ A;  5BXJ A;  3VAW A;  4LAY A;  1JVW A;  1FKK A;  1FJD A;  2PV3 A;  3O5E A;  3UF8 A;  4BF8 A;  1FD9 A;  1D7J A;  3FAP A;  4ODQ A;  4ODM A;  2XP4 A;  3EY6 A;  4G2P A;  5HTG A;  2JZV A;  5HUA A;  1R9H A;  1FKI A;  2KFW A;  4ODR A;  2F4E A;  4FN2 A;  3PA7 A;  2IF4 A;  1U79 A;  1ZK6 A;  2D9F A;  2N87 A;  3KZ7 A;  1EQ3 A;  1C9H A;  2PBC A;  1D7I A;  4LAV A;  4DRO A;  4N19 A;  3NRK A;  2XP6 A;  1YAT A;  2MF9 A;  4QT3 A;  2XPB A;  4C02 B;  3IHZ A;  2MLZ A;  2M2A A;  4MSP A;  3H9R B;  3CGN A;  3TC5 A;  1F40 A;  4DRH A;  2M08 A;  1J6Y A;  2F21 A;  3JYJ A;  4JFI A;  4IQ2 A;  1J4R A;  2XP5 A;  5GPG A;  1FKF A;  1ROT A;  4W9Q A;  2M1I A;  2VCD A;  3CGM A;  4JFM A;  4TX0 A;  3IKD A;  3KAI A;  4LAW A;  4FAP A;  3IKG A;  4GGQ A;  1FKH A;  2XP7 A;  4J4O A;  3O5I A;  3JXV A;  4ODN A;  3TDB A;  3UI5 A;  5HW6 A;  1L1P A;  2LJ4 A;  1EYM A;  4DRQ A;  2UZ5 A;  1KT1 A;  5HW7 A;  4DRN A;  5HT1 A;  2KI3 A;  3UQB A;  1N1A A;  1PBK A;  2XPA A;  1FKJ A;  2ZQS A;  4GIV A;  4TW6 A;  5I98 A;  2ZR5 A;  4U86 A;  4QIB A;  1NMW A;  3PRD A;  4ODP A;  1QZ2 A;  1FAP A;  3O5G A;  2XP8 A;  1FKS A;  3RFW A;  1J4I A;  3KAC A;  4DRK A;  2VN1 A;  4TW8 A;  1FKD A;  2RUD A;  2RUR A;  4DZ3 A;  4LAX A;  2ITK A;  2MNT A;  2RSE A;  2ZQV A;  4O2T A;  2ZR6 A;  1Q1C A;  1FKT A;  3MDY B;  5HWC A;  5HKG A;  4DRI A;  5DIU A;  1P5Q A;  2PPN A;  2MLX A;  3IK8 A;  3O5F A;  1FKR A;  2PV2 A;  1PIN A;  1FKL A;  5DIT A;  3O5P A;  2K8I A;  2RUC A;  2MPH A; 
#chains in the Genus database with same CATH topology
 1FKG A;  2KE0 A;  3QOK A;  4DRM A;  1YW5 A;  4JFK A;  4TYO A;  1T11 A;  3WD1 A;  1JNE A;  1JNS A;  4WJX A;  3ARZ A;  2PV1 A;  1EHN A;  3RM8 A;  3ARY A;  3CHD A;  3I6C A;  3KAG A;  3AQU A;  3ARP A;  5D75 A;  3O5R A;  4HBE A;  1D6O A;  1HKK A;  5HBF A;  2AWG A;  4DT4 A;  3FY1 A;  2DSZ A;  3UI6 A;  4WKA A;  4MPK A;  4JYS A;  4Z2L A;  4ODL A;  5DO2 A;  1NWR A;  5B8I C;  4G50 A;  3KCE A;  2FKE A;  4Q7N A;  3O5L A;  2ZR4 A;  5DIV A;  3VAW A;  4LAY A;  1FJD A;  4BF8 A;  2YBT A;  3UF8 A;  1FD9 A;  3FAP A;  2G41 A;  4ODQ A;  3CHC A;  3GTY X;  5HTG A;  5HUA A;  1FKI A;  2KFW A;  2P4V A;  4FN2 A;  3PA7 A;  2D9F A;  4WKF A;  3CH9 A;  4LAV A;  4N19 A;  3NRK A;  2XP6 A;  1O6I A;  1YAT A;  2MF9 A;  1W1T A;  4DWS C;  3TC5 A;  4DWS B;  4DWS A;  1J6Y A;  3AS1 A;  3B9E A;  3CGM A;  4L3N A;  3KAI A;  2QF8 A;  1X6N A;  2O92 A;  4NZC A;  4ODN A;  3TDB A;  2LJ4 A;  1E6P A;  5HT1 A;  1VF8 A;  1SR0 A;  3PRA A;  1FKJ A;  3G6M A;  1WNO A;  1QZ2 A;  2XP8 A;  4Z2H A;  3ALF A;  2RUD A;  2ZQV A;  1D2K A;  1UR9 A;  4P8X A;  4S3J A;  1OGB A;  4MTV A;  5DIU A;  1ZBC A;  1FKL A;  2EUL A;  2MPH A;  4IPX A;  4P8V A;  4NNR A;  3O5Q A;  2RUQ A;  2KGJ A;  1HKJ A;  3WQW A;  1GPF A;  1M5Y A;  1HXV A;  2WLZ A;  1LJY A;  4QT2 A;  1BL4 A;  2LGO A;  3ARR A;  4ITZ A;  2OFN A;  3PRB A;  1ROU A;  1NSG A;  2LPV A;  2XP9 A;  4HBO A;  1FKB A;  1J4H A;  1GUV A;  2WM0 A;  4TNS A;  1IX5 A;  2Y78 A;  1LL4 A;  3RGC A;  1LL7 A;  2DSU A;  3NTP A;  2A3E A;  4W9O A;  1KFW A;  2DG3 A;  2B5U B;  4U85 A;  1QPF A;  4KQZ A;  4JFL A;  1W1V A;  3TCZ A;  4JFJ A;  2DG9 A;  4ML4 A;  3WIJ A;  2MLY A;  3B7X A;  4DRJ A;  2OLH A;  3ARS A;  3O5E A;  4ODM A;  3WL1 A;  1GRJ A;  1RD6 A;  4G2P A;  4P8W A;  4ODR A;  3ARV A;  1NWU A;  2AOS A;  2IF4 A;  2N87 A;  3ART A;  3KZ7 A;  2DT3 A;  1UR8 A;  2DSV A;  1C9H A;  1JCH B;  1D7I A;  4DRO A;  2WK2 A;  4MNJ A;  2DT1 A;  3IHZ A;  2MLZ A;  2M2A A;  4MSP A;  1K9T A;  1FFQ A;  2M08 A;  3BXW A;  3JYJ A;  4Z2J A;  4JFI A;  1FKF A;  4W9Q A;  1ZL1 A;  4MNM A;  4LAW A;  4FAP A;  3IKG A;  1CTN A;  4GGQ A;  1FKH A;  4J4O A;  3O5I A;  3JXV A;  1KT1 A;  3UQB A;  1EDQ A;  3WKZ A;  4W5U A;  1E6Z A;  5DEZ A;  4TW6 A;  1SYT A;  4URI A;  4IT4 A;  4QIB A;  1NMW A;  4ODP A;  1FAP A;  2DPE A;  3O5G A;  1GOI A;  3ALG A;  3KAC A;  4TW8 A;  3G6L A;  1FKD A;  2RUR A;  3GU0 A;  4DZ3 A;  1ZBW A;  3WD3 A;  1ZU8 A;  1FKT A;  3MDY B;  1ITX A;  1P5Q A;  4XAK A;  2ETN A;  1PIN A;  3CHF A;  4NSB A;  3ARQ A;  2RUC A;  2ZQU A;  2FAP A;  4R5E A;  3KAB A;  4WK9 A;  4DH0 A;  1E6N A;  1HJV A;  2WLY A;  2XP3 A;  4IQC A;  3UQA A;  1NMV A;  4UDM A;  3OOB A;  4AY1 A;  3KAH A;  1B6C A;  4P8U A;  4ZS6 A;  4ZPW R;  1A7X A;  1KT0 A;  2ZQT A;  5JH8 A;  3WL0 A;  2PPP A;  1JND A;  4WKH A;  1Q6U A;  3AS3 A;  3ODK A;  3CHE A;  4Q22 A;  2F2D A;  2KR7 A;  1Q6H A;  3PR9 A;  5GQB A;  1FFR A;  4R0X A;  1W26 A;  4TW7 A;  4U84 A;  2YBU A;  3O5K A;  1Q6I A;  4ODO A;  1D7H A;  2G8Z A;  5BXJ A;  1JVW A;  1FKK A;  1NWT A;  1OGG A;  2A3C A;  2XP4 A;  4WIW A;  2JZV A;  3WD2 A;  1U79 A;  1ZK6 A;  2A3A A;  2PBC A;  4L72 B;  1LG2 A;  4C02 B;  3WD0 A;  3H9R B;  3CGN A;  4ZPT R;  2IUZ A;  3OA5 A;  1HKM A;  2F21 A;  4IQ2 A;  2XP5 A;  5GPG A;  4KR0 B;  4Z2K A;  4JFM A;  4TX0 A;  3RME A;  1WB0 A;  1L1P A;  5HW6 A;  4Z2I A;  2DT0 A;  1EYM A;  1E15 A;  5DF0 A;  2KI3 A;  2DT2 A;  1W1Y A;  1E6R A;  2DSW A;  2XPA A;  4PTM A;  5I98 A;  4U86 A;  3RFW A;  1OWQ A;  3AS2 A;  4LAX A;  4QZV B;  2ITK A;  2MNT A;  2RSE A;  2ZR6 A;  1Q1C A;  1ZBK A;  1LG1 A;  5HWC A;  4IT6 A;  1E9L A;  2PPN A;  3B9D A;  3O5F A;  1FKR A;  1HJX A;  2K8I A;  2LKN A;  5J6E A;  3ARX A;  1BKF A;  4MGV A;  3UI4 A;  5HW8 A;  4ODK A;  3B9A A;  1WAW A;  2F23 A;  2A3B A;  2PPO A;  2KO7 A;  1E44 A;  1XRV A;  1ZBV A;  3JYM A;  2RQS A;  1ZCN A;  2DG4 A;  4ZPV R;  5HWB A;  3O5O A;  3NI6 A;  3W4R A;  3RM4 A;  1HKI A;  2PI6 A;  3WD4 A;  3KAD A;  4DIP A;  1TCO C;  1Y0O A;  3O5M A;  2O9O A;  1EIB A;  1F8A B;  2L2S A;  3ARU A;  4DRP A;  3WQV A;  3ARO A;  3KAF A;  3O5D A;  3UQI A;  3WH0 A;  3O5J A;  4DZ2 A;  1LL6 A;  1TFV A;  1QPL A;  1JNT A;  3GPK A;  4J4N A;  1W9U A;  2Q5A A;  1HJW A;  3LUO A;  4W9P A;  2PV3 A;  1W9V A;  1D7J A;  3BMB A;  3EY6 A;  1R9H A;  2F4E A;  1H0G A;  1EQ3 A;  3ARW A;  3EIP A;  3AS0 A;  4Z2G A;  1XHG A;  4QT3 A;  2XPB A;  1ZB5 A;  4HAR A;  1F40 A;  4DRH A;  1W1P A;  1J4R A;  1ROT A;  2ESC A;  2M1I A;  2VCD A;  3IKD A;  1X6L A;  2XP7 A;  4DWS D;  3UI5 A;  2FDM A;  4DRQ A;  2UZ5 A;  5HW7 A;  4DRN A;  4MNK A;  1N1A A;  4LGX A;  1W9P A;  3CZ8 A;  1PBK A;  3FXY A;  4MNL A;  2ZQS A;  4GIV A;  1LQ0 A;  2ZR5 A;  1NH6 A;  3PRD A;  1FKS A;  1J4I A;  4DRK A;  4MAV A;  2VN1 A;  4O2T A;  3B8S A;  5HKG A;  4DRI A;  5GPR A;  1H0I A;  1NWS A;  2MLX A;  3IK8 A;  3RM9 A;  2PV2 A;  4S3K A;  2B31 A;  5DIT A;  3O5P A;  2PN0 A; 
#chains in the Genus database with same CATH homology
 1FKG A;  2KE0 A;  3QOK A;  4DRM A;  1YW5 A;  4JFK A;  4TYO A;  1T11 A;  3WD1 A;  1JNE A;  1JNS A;  4WJX A;  3ARZ A;  2PV1 A;  1EHN A;  3RM8 A;  3ARY A;  3CHD A;  3I6C A;  3KAG A;  3AQU A;  3ARP A;  5D75 A;  3O5R A;  4HBE A;  1D6O A;  1HKK A;  5HBF A;  2AWG A;  4DT4 A;  3FY1 A;  2DSZ A;  3UI6 A;  4WKA A;  4MPK A;  4JYS A;  4Z2L A;  4ODL A;  5DO2 A;  1NWR A;  5B8I C;  4G50 A;  3KCE A;  2FKE A;  4Q7N A;  3O5L A;  2ZR4 A;  5DIV A;  3VAW A;  4LAY A;  1FJD A;  4BF8 A;  2YBT A;  3UF8 A;  1FD9 A;  3FAP A;  2G41 A;  4ODQ A;  3CHC A;  5HTG A;  5HUA A;  1FKI A;  2KFW A;  4FN2 A;  3PA7 A;  2D9F A;  4WKF A;  3CH9 A;  4LAV A;  4N19 A;  3NRK A;  2XP6 A;  1O6I A;  1YAT A;  2MF9 A;  1W1T A;  4DWS C;  3TC5 A;  4DWS B;  4DWS A;  1J6Y A;  3AS1 A;  3B9E A;  3CGM A;  4L3N A;  3KAI A;  2QF8 A;  1X6N A;  2O92 A;  4NZC A;  4ODN A;  3TDB A;  2LJ4 A;  1E6P A;  5HT1 A;  1VF8 A;  1SR0 A;  3PRA A;  1FKJ A;  3G6M A;  1WNO A;  1QZ2 A;  2XP8 A;  4Z2H A;  3ALF A;  2RUD A;  2ZQV A;  1D2K A;  1UR9 A;  4P8X A;  4S3J A;  1OGB A;  4MTV A;  5DIU A;  1ZBC A;  1FKL A;  2MPH A;  4IPX A;  4P8V A;  4NNR A;  3O5Q A;  2RUQ A;  2KGJ A;  1HKJ A;  3WQW A;  1GPF A;  1M5Y A;  1HXV A;  2WLZ A;  1LJY A;  4QT2 A;  1BL4 A;  2LGO A;  3ARR A;  4ITZ A;  2OFN A;  3PRB A;  1ROU A;  1NSG A;  2LPV A;  2XP9 A;  4HBO A;  1FKB A;  1J4H A;  1GUV A;  2WM0 A;  4TNS A;  1IX5 A;  2Y78 A;  1LL4 A;  3RGC A;  1LL7 A;  2DSU A;  3NTP A;  2A3E A;  4W9O A;  1KFW A;  2DG3 A;  4U85 A;  1QPF A;  4KQZ A;  4JFL A;  1W1V A;  3TCZ A;  4JFJ A;  2DG9 A;  4ML4 A;  3WIJ A;  2MLY A;  3B7X A;  4DRJ A;  2OLH A;  3ARS A;  3O5E A;  4ODM A;  3WL1 A;  1RD6 A;  4G2P A;  4P8W A;  4ODR A;  3ARV A;  1NWU A;  2AOS A;  2IF4 A;  2N87 A;  3ART A;  3KZ7 A;  2DT3 A;  1UR8 A;  2DSV A;  1C9H A;  1D7I A;  4DRO A;  2WK2 A;  4MNJ A;  2DT1 A;  3IHZ A;  2MLZ A;  2M2A A;  4MSP A;  1K9T A;  1FFQ A;  2M08 A;  3BXW A;  3JYJ A;  4Z2J A;  4JFI A;  1FKF A;  4W9Q A;  1ZL1 A;  4MNM A;  4LAW A;  4FAP A;  3IKG A;  1CTN A;  4GGQ A;  1FKH A;  4J4O A;  3O5I A;  3JXV A;  1KT1 A;  3UQB A;  1EDQ A;  3WKZ A;  4W5U A;  1E6Z A;  5DEZ A;  4TW6 A;  1SYT A;  4URI A;  4IT4 A;  4QIB A;  1NMW A;  4ODP A;  1FAP A;  2DPE A;  3O5G A;  1GOI A;  3ALG A;  3KAC A;  4TW8 A;  3G6L A;  1FKD A;  2RUR A;  4DZ3 A;  1ZBW A;  3WD3 A;  1ZU8 A;  1FKT A;  3MDY B;  1ITX A;  1P5Q A;  4XAK A;  1PIN A;  3CHF A;  4NSB A;  3ARQ A;  2RUC A;  2ZQU A;  2FAP A;  4R5E A;  3KAB A;  4WK9 A;  4DH0 A;  1E6N A;  1HJV A;  2WLY A;  2XP3 A;  4IQC A;  3UQA A;  1NMV A;  3OOB A;  4AY1 A;  3KAH A;  1B6C A;  4P8U A;  4ZS6 A;  4ZPW R;  1A7X A;  1KT0 A;  2ZQT A;  5JH8 A;  3WL0 A;  2PPP A;  1JND A;  4WKH A;  1Q6U A;  3AS3 A;  3ODK A;  3CHE A;  4Q22 A;  2F2D A;  2KR7 A;  1Q6H A;  3PR9 A;  5GQB A;  1FFR A;  4R0X A;  1W26 A;  4TW7 A;  4U84 A;  2YBU A;  3O5K A;  1Q6I A;  4ODO A;  1D7H A;  2G8Z A;  5BXJ A;  1JVW A;  1FKK A;  1NWT A;  1OGG A;  2A3C A;  2XP4 A;  4WIW A;  2JZV A;  3WD2 A;  1U79 A;  1ZK6 A;  2A3A A;  2PBC A;  4L72 B;  1LG2 A;  4C02 B;  3WD0 A;  3H9R B;  3CGN A;  4ZPT R;  2IUZ A;  3OA5 A;  1HKM A;  2F21 A;  4IQ2 A;  2XP5 A;  5GPG A;  4KR0 B;  4Z2K A;  4JFM A;  4TX0 A;  3RME A;  1WB0 A;  1L1P A;  5HW6 A;  4Z2I A;  2DT0 A;  1EYM A;  1E15 A;  5DF0 A;  2KI3 A;  2DT2 A;  1W1Y A;  1E6R A;  2DSW A;  2XPA A;  4PTM A;  5I98 A;  4U86 A;  3RFW A;  1OWQ A;  3AS2 A;  4LAX A;  4QZV B;  2ITK A;  2MNT A;  2RSE A;  2ZR6 A;  1Q1C A;  1ZBK A;  1LG1 A;  5HWC A;  4IT6 A;  1E9L A;  2PPN A;  3B9D A;  3O5F A;  1FKR A;  1HJX A;  2K8I A;  2LKN A;  5J6E A;  3ARX A;  1BKF A;  4MGV A;  3UI4 A;  5HW8 A;  4ODK A;  3B9A A;  1WAW A;  2A3B A;  2PPO A;  2KO7 A;  1XRV A;  1ZBV A;  3JYM A;  2RQS A;  1ZCN A;  2DG4 A;  4ZPV R;  5HWB A;  3O5O A;  3NI6 A;  3W4R A;  3RM4 A;  1HKI A;  2PI6 A;  3WD4 A;  3KAD A;  4DIP A;  1TCO C;  1Y0O A;  3O5M A;  2O9O A;  1EIB A;  1F8A B;  2L2S A;  3ARU A;  4DRP A;  3WQV A;  3ARO A;  3KAF A;  3O5D A;  3UQI A;  3WH0 A;  3O5J A;  4DZ2 A;  1LL6 A;  1TFV A;  1QPL A;  1JNT A;  3GPK A;  4J4N A;  1W9U A;  2Q5A A;  1HJW A;  3LUO A;  4W9P A;  2PV3 A;  1W9V A;  1D7J A;  3EY6 A;  1R9H A;  2F4E A;  1H0G A;  1EQ3 A;  3ARW A;  3AS0 A;  4Z2G A;  1XHG A;  4QT3 A;  2XPB A;  1ZB5 A;  4HAR A;  1F40 A;  4DRH A;  1W1P A;  1J4R A;  1ROT A;  2ESC A;  2M1I A;  2VCD A;  3IKD A;  1X6L A;  2XP7 A;  4DWS D;  3UI5 A;  2FDM A;  4DRQ A;  2UZ5 A;  5HW7 A;  4DRN A;  4MNK A;  1N1A A;  4LGX A;  1W9P A;  3CZ8 A;  1PBK A;  3FXY A;  4MNL A;  2ZQS A;  4GIV A;  1LQ0 A;  2ZR5 A;  1NH6 A;  3PRD A;  1FKS A;  1J4I A;  4DRK A;  4MAV A;  2VN1 A;  4O2T A;  3B8S A;  5HKG A;  4DRI A;  5GPR A;  1H0I A;  1NWS A;  2MLX A;  3IK8 A;  3RM9 A;  2PV2 A;  4S3K A;  2B31 A;  5DIT A;  3O5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...