4DROA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with (1r)-3-(3,4-dimethoxyphenyl)-1-phenylpropyl (2s)-1-{[(1r,2s)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidine-2-carboxylate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4droA00
4U84A 1J4IA 2FAPA 4JFKA 4MSPA 4BF8A 3EY6A 2RSEA 2VCDA 4N19A 3UI6A 2KI3A 1Y0OA 2M08A 2OFNA 4LAXA 4DZ2A 2PPNA 2MPHA 2XPAA 3O5OA 5J6EA 4ODOA 5HT1A 4G50A 2M1IA 3JYMA 5HTGA 3KAHA 2ZQUA 2ZR5A 1U79A 2XP9A 2DG4A 3KAIA 1NMVA 3H9RB 3O5RA 2RURA 1ZK6A 2UZ5A 3MDYB 3RFWA 4DRKA 4GGQA 5HWCA 1JNTA 4MGVA 4ODRA 2IF4A 4DH0A 5HWBA 1BL4A 4C02B 1T11A 3CGMA 1Q6HA 3PA7A 1JNSA 2ZQSA 4O2TA 2FKEA 3RGCA 1PINA 1FD9A 3IKDA 4DRMA 3O5MA 5HKGA 4U85A 1FKIA 4DRHA 4ITZA 1J6YA 3PRDA 4R0XA 3GPKA 1FAPA 2N87A 2XPBA 4LAVA 2PPOA 4FAPA 1J4RA 1FJDA 3O5DA 2PPPA 1D7IA 2K8IA 2KR7A 3OOBA 4JFLA 3NI6A 3UQIA 1D7HA 1Q6UA 4IPXA 4W9PA 4ODKA 2PBCA 4DRIA 1ZCNA 3UQAA 1QPLA 2LJ4A 1JVWA 5HW6A 2RUQA 1L1PA 1ROUA 2XP7A 5BXJA 3UI5A 4JFJA 3KABA 2MF9A 3KZ7A 4TW6A 1FKLA 4J4NA 1F40A 1J4HA 4ODPA 5DIUA 2MLZA 3NRKA 1FKFA 2LKNA 3WH0A 2VN1A 3TC5A 2LPVA 1QPFA 2XP8A 2D9FA 4DRNA 2PV2A 3UI4A 4TNSA 1D7JA 4ODNA 4NNRA 1FKDA 3KAFA 5HUAA 4ODQA 4TW7A 3O5QA 2KE0A 2MNTA 3LUOA 3O5JA 2F4EA 1FKTA 3I6CA 2Q5AA 2XP5A 3O5IA 4JYSA 1FKGA 1TCOC 2KO7A 3UF8A 4DRQA 1FKKA 2XP4A 1EQ3A 2KFWA 4ODLA 4LAWA 2KGJA 2MLYA 3KCEA 4DT4A 5DITA 3IKGA 1D6OA 1Q6IA 3KACA 3O5KA 1ROTA 2Y78A 2M2AA 2ITKA 2XP6A 2ZQTA 4DZ3A 2ZQVA 3JYJA 1B6CA 4QIBA 1F8AB 3O5GA 3KADA 1YW5A 2LGOA 4IQCA 3NTPA 2ZR6A 4GIVA 2JZVA 4QT2A 4TYOA 3ODKA 4TX0A 4W9OA 1C9HA 1BKFA 4LAYA 4DRPA 5HW8A 3UQBA 4IQ2A 1HXVA 4JFMA 3IHZA 1QZ2A 2AWGA 3B7XA 4TW8A 1FKRA 2F2DA 3O5LA 1FKHA 2PV1A 5DIVA 3TCZA 5HW7A 2XP3A 3VAWA 1R9HA 3O5EA 3PRBA 2PV3A 3CGNA 4J4OA 4W9QA 4QT3A 1PBKA 1YATA 1M5YA 2L2SA 4U86A 5GPGA 5B8IC 1EYMA 1NSGA 3TDBA 4DIPA 3O5PA 3FAPA 1Q1CA 5I98A 1FKSA 1FKBA 1FKJA 4G2PA 1N1AA 1KT0A 2DG3A 4JFIA 4DRJA 2RUDA 1P5QA 2F21A 2ZR4A 3O5FA 1A7XA 4FN2A 5D75A 3IK8A 2MLXA 4DROA 2RQSA 1KT1A 3KAGA 1W26A 2DG9A 1NMWA 2RUCA 4ODMA 3JXVA
chains in the Genus database with same CATH superfamily
1IX5A 3ARRA 4JFKA 3W4RA 3UI6A 1W9PA 2M08A 2O9OA 4DZ2A 2PPNA 5J6EA 4P8WA 1W1VA 3CHEA 5HT1A 4G50A 3FY1A 4AY1A 1NMVA 3RFWA 4DRKA 1E6PA 4KR0B 4DH0A 1TFVA 3WL0A 4IT4A 3ALGA 1JNSA 3PA7A 2ZQSA 1PINA 3IKDA 1KFWA 3CZ8A 3PRDA 4R0XA 2PPOA 1JNEA 1D7HA 1HKIA 1Q6UA 4ODKA 4DRIA 3UQAA 1QPLA 2LJ4A 2DPEA 2RUQA 3UI5A 3KABA 3KZ7A 4TW6A 1ITXA 1J4HA 4ODPA 1LL7A 1FKFA 2LPVA 3B9DA 4MNMA 3G6MA 4W5UA 2A3EA 4ODQA 4TW7A 3LUOA 3O5JA 4L72B 3RMEA 3BXWA 4MPKA 2O92A 4ZPWR 3I6CA 2XP5A 1E15A 2KO7A 3UF8A 4Z2JA 4Z2IA 1EQ3A 2KFWA 5DITA 4L3NA 4WIWA 1ROTA 1LL4A 2Y78A 5GPRA 2M2AA 2ITKA 4DZ3A 1W9UA 3JYJA 1W1YA 1HJXA 1D2KA 2DSWA 5HW8A 4LAYA 3AQUA 1HXVA 3IHZA 2AWGA 2B31A 4Z2HA 3AROA 1FKHA 3O5LA 2XP3A 3VAWA 1R9HA 3CGNA 3ARSA 1YATA 3CH9A 2L2SA 1NSGA 4DIPA 1GPFA 4IT6A 2WK2A 1FKBA 1FKJA 3WQWA 1KT0A 1ZBCA 3EIPA 2ZR4A 3O5FA 4LGXA 1A7XA 3ARQA 3IK8A 4NZCA 3KAGA 4HBOA 1W26A 1NMWA 3PR9A 4R5EA 1J4IA 4MSPA 4BF8A 3EY6A 4N19A 1NWTA 2A3BA 2KI3A 1Y0OA 4LAXA 4DWSA 1XHGA 5DF0A 4KQZA 3RM8A 3ARZA 2ZR5A 2XP9A 3WD1A 3O5RA 2RURA 4Q22A 1LL6A 3ARXA 4O2TA 2FKEA 3RGCA 1FD9A 3WQVA 2QF8A 4XAKA 4U85A 1FKIA 1NWSA 1FAPA 1GUVA 3GPKA 2XPBA 1FJDA 1W1TA 1E6ZA 2PPPA 1D7IA 4JFLA 3NI6A 4WK9A 1ZCNA 4MNLA 5HW6A 3B9AA 1L1PA 2AOSA 2XP7A 3CHCA 2WLZA 2G8ZA 2MF9A 1W1PA 1FKLA 1F40A 3ALFA 1LQ0A 2MLZA 2LKNA 2YBUA 1QPFA 4DRNA 1HKKA 1H0GA 5HUAA 3O5QA 4S3KA 2MNTA 2ETNA 4Q7NA 1ZB5A 3WD2A 1FFRA 2Q5AA 1TCOC 4DRQA 4ODLA 2MLYA 3IKGA 1Q6IA 1ZBKA 1HJWA 1EDQA 3AS1A 1E6NA 1B6CA 1E44A 1YW5A 2ZR6A 2JZVA 4DWSB 1JCHB 1EHNA 4TX0A 4DRPA 2OLHA 3QOKA 4DWSD 1QZ2A 2F2DA 4QZVB 5HW7A 3O5EA 3PRBA 4W9QA 2EULA 1PBKA 1M5YA 3B8SA 4U86A 5B8IC 4MAVA 1ZU8A 1RD6A 3TDBA 3FXYA 1CTNA 4MNKA 5I98A 4G2PA 5HBFA 2RUDA 1P5QA 2F21A 4FN2A 3BMBA 4P8VA 3JXVA 4U84A 2B5UB 3WD3A 2OFNA 4WJXA 2XPAA 4ODOA 2F23A 2M1IA 3JYMA 5HTGA 3KAHA 1U79A 1NWRA 2WLYA 3WL1A 4GGQA 1JNTA 4PTMA 2IF4A 5HWBA 1BL4A 4DWSC 1LG1A 5HKGA 3ARPA 3O5MA 1O6IA 1JNDA 4UDMA 4WKFA 3OOBA 4IPXA 2PBCA 2ESCA 2A3CA 2G41A 1GRJA 4ML4A 3OA5A 1JVWA 2DT3A 5DO2A 1ROUA 2PN0A 3G6LA 4JFJA 3ARUA 2DSZA 4J4NA 3GTYX 3TC5A 4HARA 2D9FA 2PV2A 4TNSA 1E6RA 4NNRA 3KAFA 1GOIA 2KE0A 1OGGA 1FKTA 1UR9A 2P4VA 1FKGA 3O5IA 4JYSA 1FKKA 3ARYA 5DEZA 2KGJA 3PRAA 3KCEA 4DT4A 3KACA 3O5KA 1K9TA 2ZQTA 2XP6A 1NWUA 2DSVA 2ZQVA 4QIBA 3O5GA 4ZPVR 2LGOA 4IQCA 3NTPA 1E9LA 4QT2A 4TYOA 5JH8A 4IQ2A 1WNOA 3B7XA 3WD4A 3CHFA 4WKAA 2PV1A 5DIVA 1HKJA 4J4OA 4P8XA 4QT3A 4WKHA 5GPGA 4ZS6A 1EYMA 3CHDA 4Z2GA 1Q1CA 3ARWA 1FKSA 4JFIA 5D75A 1UR8A 2RUCA 4ODMA 1LG2A 4Z2LA 2FAPA 1H0IA 3AS2A 2RSEA 2VCDA 3AS3A 3AS0A 1NH6A 3O5OA 2MPHA 2DT1A 2FDMA 2ZQUA 3KAIA 2DG4A 3H9RB 3WIJA 1ZK6A 1ZL1A 2UZ5A 3MDYB 1W9VA 5HWCA 4ODRA 4MGVA 3RM9A 3WKZA 4C02B 1T11A 3CGMA 1Q6HA 1FFQA 2IUZA 4DRMA 1OWQA 4DRHA 4ITZA 1J6YA 1X6NA 2DSUA 2N87A 3RM4A 1EIBA 4LAVA 4FAPA 1J4RA 3O5DA 2DT2A 2K8IA 2KR7A 2A3AA 3UQIA 4W9PA 1VF8A 1LJYA 1HJVA 3ARVA 5BXJA 4URIA 5DIUA 3NRKA 2WM0A 3WH0A 1HKMA 2VN1A 2XP8A 1SYTA 3UI4A 1D7JA 4ODNA 1FKDA 1WB0A 2F4EA 5GQBA 2XP4A 1X6LA 4LAWA 1ZBVA 2YBTA 4S3JA 1D6OA 1F8AB 3KADA 1ZBWA 4P8UA 4GIVA 4ZPTR 4HBEA 3ODKA 4W9OA 1BKFA 1C9HA 3UQBA 4JFMA 2PI6A 1FKRA 4TW8A 1OGBA 1WAWA 3TCZA 2PV3A 4Z2KA 2DT0A 3ARTA 1SR0A 3O5PA 4MTVA 3FAPA 1XRVA 1N1AA 2DG3A 4DRJA 3WD0A 2MLXA 4DROA 2RQSA 4MNJA 1KT1A 2DG9A 4NSBA 3GU0A 3B9EA
chains in the Genus database with same CATH topology
1IX5A 3ARRA 4JFKA 3W4RA 3UI6A 1W9PA 2M08A 2O9OA 4DZ2A 2PPNA 5J6EA 4P8WA 1W1VA 3CHEA 5HT1A 4G50A 3FY1A 4AY1A 1NMVA 3RFWA 4DRKA 1E6PA 4KR0B 4DH0A 1TFVA 3WL0A 4IT4A 3ALGA 1JNSA 3PA7A 2ZQSA 1PINA 3IKDA 1KFWA 3CZ8A 3PRDA 4R0XA 2PPOA 1JNEA 1D7HA 1HKIA 1Q6UA 4ODKA 4DRIA 3UQAA 1QPLA 2LJ4A 2DPEA 2RUQA 3UI5A 3KABA 3KZ7A 4TW6A 1ITXA 1J4HA 4ODPA 1LL7A 1FKFA 2LPVA 3B9DA 4MNMA 3G6MA 4W5UA 2A3EA 4ODQA 4TW7A 3LUOA 3O5JA 4L72B 3RMEA 3BXWA 4MPKA 2O92A 4ZPWR 3I6CA 2XP5A 1E15A 2KO7A 3UF8A 4Z2JA 4Z2IA 1EQ3A 2KFWA 5DITA 4L3NA 4WIWA 1ROTA 1LL4A 2Y78A 5GPRA 2M2AA 2ITKA 4DZ3A 1W9UA 3JYJA 1W1YA 1HJXA 1D2KA 2DSWA 5HW8A 4LAYA 3AQUA 1HXVA 3IHZA 2AWGA 2B31A 4Z2HA 3AROA 1FKHA 3O5LA 2XP3A 3VAWA 1R9HA 3CGNA 3ARSA 1YATA 3CH9A 2L2SA 1NSGA 4DIPA 1GPFA 4IT6A 2WK2A 1FKBA 1FKJA 3WQWA 1KT0A 1ZBCA 2ZR4A 3O5FA 4LGXA 1A7XA 3ARQA 3IK8A 4NZCA 3KAGA 4HBOA 1W26A 1NMWA 3PR9A 4R5EA 1J4IA 4MSPA 4BF8A 3EY6A 4N19A 1NWTA 2A3BA 2KI3A 1Y0OA 4LAXA 4DWSA 1XHGA 5DF0A 4KQZA 3RM8A 3ARZA 2ZR5A 2XP9A 3WD1A 3O5RA 2RURA 4Q22A 1LL6A 3ARXA 4O2TA 2FKEA 3RGCA 1FD9A 3WQVA 2QF8A 4XAKA 4U85A 1FKIA 1NWSA 1FAPA 1GUVA 3GPKA 2XPBA 1FJDA 1W1TA 1E6ZA 2PPPA 1D7IA 4JFLA 3NI6A 4WK9A 1ZCNA 4MNLA 5HW6A 3B9AA 1L1PA 2AOSA 2XP7A 3CHCA 2WLZA 2G8ZA 2MF9A 1W1PA 1FKLA 1F40A 3ALFA 1LQ0A 2MLZA 2LKNA 2YBUA 1QPFA 4DRNA 1HKKA 1H0GA 5HUAA 3O5QA 4S3KA 2MNTA 4Q7NA 1ZB5A 3WD2A 1FFRA 2Q5AA 1TCOC 4DRQA 4ODLA 2MLYA 3IKGA 1Q6IA 1ZBKA 1HJWA 1EDQA 3AS1A 1E6NA 1B6CA 1YW5A 2ZR6A 2JZVA 4DWSB 1EHNA 4TX0A 4DRPA 2OLHA 3QOKA 4DWSD 1QZ2A 2F2DA 4QZVB 5HW7A 3O5EA 3PRBA 4W9QA 1PBKA 1M5YA 3B8SA 4U86A 5B8IC 4MAVA 1ZU8A 1RD6A 3TDBA 3FXYA 1CTNA 4MNKA 5I98A 4G2PA 5HBFA 2RUDA 1P5QA 2F21A 4FN2A 4P8VA 3JXVA 4U84A 3WD3A 2OFNA 4WJXA 2XPAA 4ODOA 2M1IA 3JYMA 5HTGA 3KAHA 1U79A 1NWRA 2WLYA 3WL1A 4GGQA 1JNTA 4PTMA 2IF4A 5HWBA 1BL4A 4DWSC 1LG1A 5HKGA 3ARPA 3O5MA 1O6IA 1JNDA 4WKFA 3OOBA 4IPXA 2PBCA 2ESCA 2A3CA 2G41A 4ML4A 3OA5A 1JVWA 2DT3A 5DO2A 1ROUA 3G6LA 4JFJA 3ARUA 2DSZA 4J4NA 3TC5A 4HARA 2D9FA 2PV2A 4TNSA 1E6RA 4NNRA 3KAFA 1GOIA 2KE0A 1OGGA 1FKTA 1UR9A 3O5IA 1FKGA 4JYSA 1FKKA 3ARYA 5DEZA 2KGJA 3PRAA 3KCEA 4DT4A 3KACA 3O5KA 1K9TA 2ZQTA 2XP6A 1NWUA 2DSVA 2ZQVA 4QIBA 3O5GA 4ZPVR 2LGOA 4IQCA 3NTPA 1E9LA 4QT2A 4TYOA 5JH8A 4IQ2A 1WNOA 3B7XA 3WD4A 3CHFA 4WKAA 2PV1A 5DIVA 1HKJA 4J4OA 4P8XA 4QT3A 4WKHA 5GPGA 4ZS6A 1EYMA 3CHDA 4Z2GA 1Q1CA 3ARWA 1FKSA 4JFIA 5D75A 1UR8A 2RUCA 4ODMA 1LG2A 4Z2LA 2FAPA 1H0IA 3AS2A 2RSEA 2VCDA 3AS3A 3AS0A 1NH6A 3O5OA 2MPHA 2DT1A 2FDMA 2ZQUA 3KAIA 2DG4A 3H9RB 3WIJA 1ZK6A 1ZL1A 2UZ5A 3MDYB 1W9VA 5HWCA 4ODRA 4MGVA 3RM9A 3WKZA 4C02B 1T11A 3CGMA 1Q6HA 1FFQA 2IUZA 4DRMA 1OWQA 4DRHA 4ITZA 1J6YA 1X6NA 2DSUA 2N87A 3RM4A 1EIBA 4LAVA 4FAPA 1J4RA 3O5DA 2DT2A 2K8IA 2KR7A 2A3AA 3UQIA 4W9PA 1VF8A 1LJYA 1HJVA 3ARVA 5BXJA 4URIA 5DIUA 3NRKA 2WM0A 3WH0A 1HKMA 2VN1A 2XP8A 1SYTA 3UI4A 1D7JA 4ODNA 1FKDA 1WB0A 2F4EA 5GQBA 2XP4A 1X6LA 4LAWA 1ZBVA 2YBTA 4S3JA 1D6OA 1F8AB 3KADA 1ZBWA 4P8UA 4GIVA 4ZPTR 4HBEA 3ODKA 4W9OA 1BKFA 1C9HA 3UQBA 4JFMA 2PI6A 1FKRA 4TW8A 1OGBA 1WAWA 3TCZA 2PV3A 4Z2KA 2DT0A 3ARTA 1SR0A 3O5PA 4MTVA 3FAPA 1XRVA 1N1AA 2DG3A 4DRJA 3WD0A 2MLXA 4DROA 2RQSA 4MNJA 1KT1A 2DG9A 4NSBA 3B9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U84 A;  1J4I A;  2FAP A;  4JFK A;  4MSP A;  4BF8 A;  3EY6 A;  2RSE A;  2VCD A;  4N19 A;  3UI6 A;  2KI3 A;  1Y0O A;  2M08 A;  2OFN A;  4LAX A;  4DZ2 A;  2PPN A;  2MPH A;  2XPA A;  3O5O A;  5J6E A;  4ODO A;  5HT1 A;  4G50 A;  2M1I A;  3JYM A;  5HTG A;  3KAH A;  2ZQU A;  2ZR5 A;  1U79 A;  2XP9 A;  2DG4 A;  3KAI A;  1NMV A;  3H9R B;  3O5R A;  2RUR A;  1ZK6 A;  2UZ5 A;  3MDY B;  3RFW A;  4DRK A;  4GGQ A;  5HWC A;  1JNT A;  4MGV A;  4ODR A;  2IF4 A;  4DH0 A;  5HWB A;  1BL4 A;  4C02 B;  1T11 A;  3CGM A;  1Q6H A;  3PA7 A;  1JNS A;  2ZQS A;  4O2T A;  2FKE A;  3RGC A;  1PIN A;  1FD9 A;  3IKD A;  4DRM A;  3O5M A;  5HKG A;  4U85 A;  1FKI A;  4DRH A;  4ITZ A;  1J6Y A;  3PRD A;  4R0X A;  3GPK A;  1FAP A;  2N87 A;  2XPB A;  4LAV A;  2PPO A;  4FAP A;  1J4R A;  1FJD A;  3O5D A;  2PPP A;  1D7I A;  2K8I A;  2KR7 A;  3OOB A;  4JFL A;  3NI6 A;  3UQI A;  1D7H A;  1Q6U A;  4IPX A;  4W9P A;  4ODK A;  2PBC A;  4DRI A;  1ZCN A;  3UQA A;  1QPL A;  2LJ4 A;  1JVW A;  5HW6 A;  2RUQ A;  1L1P A;  1ROU A;  2XP7 A;  5BXJ A;  3UI5 A;  4JFJ A;  3KAB A;  2MF9 A;  3KZ7 A;  4TW6 A;  1FKL A;  4J4N A;  1F40 A;  1J4H A;  4ODP A;  5DIU A;  2MLZ A;  3NRK A;  1FKF A;  2LKN A;  3WH0 A;  2VN1 A;  3TC5 A;  2LPV A;  1QPF A;  2XP8 A;  2D9F A;  4DRN A;  2PV2 A;  3UI4 A;  4TNS A;  1D7J A;  4ODN A;  4NNR A;  1FKD A;  3KAF A;  5HUA A;  4ODQ A;  4TW7 A;  3O5Q A;  2KE0 A;  2MNT A;  3LUO A;  3O5J A;  2F4E A;  1FKT A;  3I6C A;  2Q5A A;  2XP5 A;  3O5I A;  4JYS A;  1FKG A;  1TCO C;  2KO7 A;  3UF8 A;  4DRQ A;  1FKK A;  2XP4 A;  1EQ3 A;  2KFW A;  4ODL A;  4LAW A;  2KGJ A;  2MLY A;  3KCE A;  4DT4 A;  5DIT A;  3IKG A;  1D6O A;  1Q6I A;  3KAC A;  3O5K A;  1ROT A;  2Y78 A;  2M2A A;  2ITK A;  2XP6 A;  2ZQT A;  4DZ3 A;  2ZQV A;  3JYJ A;  1B6C A;  4QIB A;  1F8A B;  3O5G A;  3KAD A;  1YW5 A;  2LGO A;  4IQC A;  3NTP A;  2ZR6 A;  4GIV A;  2JZV A;  4QT2 A;  4TYO A;  3ODK A;  4TX0 A;  4W9O A;  1C9H A;  1BKF A;  4LAY A;  4DRP A;  5HW8 A;  3UQB A;  4IQ2 A;  1HXV A;  4JFM A;  3IHZ A;  1QZ2 A;  2AWG A;  3B7X A;  4TW8 A;  1FKR A;  2F2D A;  3O5L A;  1FKH A;  2PV1 A;  5DIV A;  3TCZ A;  5HW7 A;  2XP3 A;  3VAW A;  1R9H A;  3O5E A;  3PRB A;  2PV3 A;  3CGN A;  4J4O A;  4W9Q A;  4QT3 A;  1PBK A;  1YAT A;  1M5Y A;  2L2S A;  4U86 A;  5GPG A;  5B8I C;  1EYM A;  1NSG A;  3TDB A;  4DIP A;  3O5P A;  3FAP A;  1Q1C A;  5I98 A;  1FKS A;  1FKB A;  1FKJ A;  4G2P A;  1N1A A;  1KT0 A;  2DG3 A;  4JFI A;  4DRJ A;  2RUD A;  1P5Q A;  2F21 A;  2ZR4 A;  3O5F A;  1A7X A;  4FN2 A;  5D75 A;  3IK8 A;  2MLX A;  4DRO A;  2RQS A;  1KT1 A;  3KAG A;  1W26 A;  2DG9 A;  1NMW A;  2RUC A;  4ODM A;  3JXV A; 
#chains in the Genus database with same CATH topology
 1IX5 A;  3ARR A;  4JFK A;  3W4R A;  3UI6 A;  1W9P A;  2M08 A;  2O9O A;  4DZ2 A;  2PPN A;  5J6E A;  4P8W A;  1W1V A;  3CHE A;  5HT1 A;  4G50 A;  3FY1 A;  4AY1 A;  1NMV A;  3RFW A;  4DRK A;  1E6P A;  4KR0 B;  4DH0 A;  1TFV A;  3WL0 A;  4IT4 A;  3ALG A;  1JNS A;  3PA7 A;  2ZQS A;  1PIN A;  3IKD A;  1KFW A;  3CZ8 A;  3PRD A;  4R0X A;  2PPO A;  1JNE A;  1D7H A;  1HKI A;  1Q6U A;  4ODK A;  4DRI A;  3UQA A;  1QPL A;  2LJ4 A;  2DPE A;  2RUQ A;  3UI5 A;  3KAB A;  3KZ7 A;  4TW6 A;  1ITX A;  1J4H A;  4ODP A;  1LL7 A;  1FKF A;  2LPV A;  3B9D A;  4MNM A;  3G6M A;  4W5U A;  2A3E A;  4ODQ A;  4TW7 A;  3LUO A;  3O5J A;  4L72 B;  3RME A;  3BXW A;  4MPK A;  2O92 A;  4ZPW R;  3I6C A;  2XP5 A;  1E15 A;  2KO7 A;  3UF8 A;  4Z2J A;  4Z2I A;  1EQ3 A;  2KFW A;  5DIT A;  4L3N A;  4WIW A;  1ROT A;  1LL4 A;  2Y78 A;  5GPR A;  2M2A A;  2ITK A;  4DZ3 A;  1W9U A;  3JYJ A;  1W1Y A;  1HJX A;  1D2K A;  2DSW A;  5HW8 A;  4LAY A;  3AQU A;  1HXV A;  3IHZ A;  2AWG A;  2B31 A;  4Z2H A;  3ARO A;  1FKH A;  3O5L A;  2XP3 A;  3VAW A;  1R9H A;  3CGN A;  3ARS A;  1YAT A;  3CH9 A;  2L2S A;  1NSG A;  4DIP A;  1GPF A;  4IT6 A;  2WK2 A;  1FKB A;  1FKJ A;  3WQW A;  1KT0 A;  1ZBC A;  3EIP A;  2ZR4 A;  3O5F A;  4LGX A;  1A7X A;  3ARQ A;  3IK8 A;  4NZC A;  3KAG A;  4HBO A;  1W26 A;  1NMW A;  3PR9 A;  4R5E A;  1J4I A;  4MSP A;  4BF8 A;  3EY6 A;  4N19 A;  1NWT A;  2A3B A;  2KI3 A;  1Y0O A;  4LAX A;  4DWS A;  1XHG A;  5DF0 A;  4KQZ A;  3RM8 A;  3ARZ A;  2ZR5 A;  2XP9 A;  3WD1 A;  3O5R A;  2RUR A;  4Q22 A;  1LL6 A;  3ARX A;  4O2T A;  2FKE A;  3RGC A;  1FD9 A;  3WQV A;  2QF8 A;  4XAK A;  4U85 A;  1FKI A;  1NWS A;  1FAP A;  1GUV A;  3GPK A;  2XPB A;  1FJD A;  1W1T A;  1E6Z A;  2PPP A;  1D7I A;  4JFL A;  3NI6 A;  4WK9 A;  1ZCN A;  4MNL A;  5HW6 A;  3B9A A;  1L1P A;  2AOS A;  2XP7 A;  3CHC A;  2WLZ A;  2G8Z A;  2MF9 A;  1W1P A;  1FKL A;  1F40 A;  3ALF A;  1LQ0 A;  2MLZ A;  2LKN A;  2YBU A;  1QPF A;  4DRN A;  1HKK A;  1H0G A;  5HUA A;  3O5Q A;  4S3K A;  2MNT A;  2ETN A;  4Q7N A;  1ZB5 A;  3WD2 A;  1FFR A;  2Q5A A;  1TCO C;  4DRQ A;  4ODL A;  2MLY A;  3IKG A;  1Q6I A;  1ZBK A;  1HJW A;  1EDQ A;  3AS1 A;  1E6N A;  1B6C A;  1E44 A;  1YW5 A;  2ZR6 A;  2JZV A;  4DWS B;  1JCH B;  1EHN A;  4TX0 A;  4DRP A;  2OLH A;  3QOK A;  4DWS D;  1QZ2 A;  2F2D A;  4QZV B;  5HW7 A;  3O5E A;  3PRB A;  4W9Q A;  2EUL A;  1PBK A;  1M5Y A;  3B8S A;  4U86 A;  5B8I C;  4MAV A;  1ZU8 A;  1RD6 A;  3TDB A;  3FXY A;  1CTN A;  4MNK A;  5I98 A;  4G2P A;  5HBF A;  2RUD A;  1P5Q A;  2F21 A;  4FN2 A;  3BMB A;  4P8V A;  3JXV A;  4U84 A;  2B5U B;  3WD3 A;  2OFN A;  4WJX A;  2XPA A;  4ODO A;  2F23 A;  2M1I A;  3JYM A;  5HTG A;  3KAH A;  1U79 A;  1NWR A;  2WLY A;  3WL1 A;  4GGQ A;  1JNT A;  4PTM A;  2IF4 A;  5HWB A;  1BL4 A;  4DWS C;  1LG1 A;  5HKG A;  3ARP A;  3O5M A;  1O6I A;  1JND A;  4UDM A;  4WKF A;  3OOB A;  4IPX A;  2PBC A;  2ESC A;  2A3C A;  2G41 A;  1GRJ A;  4ML4 A;  3OA5 A;  1JVW A;  2DT3 A;  5DO2 A;  1ROU A;  2PN0 A;  3G6L A;  4JFJ A;  3ARU A;  2DSZ A;  4J4N A;  3GTY X;  3TC5 A;  4HAR A;  2D9F A;  2PV2 A;  4TNS A;  1E6R A;  4NNR A;  3KAF A;  1GOI A;  2KE0 A;  1OGG A;  1FKT A;  1UR9 A;  2P4V A;  1FKG A;  3O5I A;  4JYS A;  1FKK A;  3ARY A;  5DEZ A;  2KGJ A;  3PRA A;  3KCE A;  4DT4 A;  3KAC A;  3O5K A;  1K9T A;  2ZQT A;  2XP6 A;  1NWU A;  2DSV A;  2ZQV A;  4QIB A;  3O5G A;  4ZPV R;  2LGO A;  4IQC A;  3NTP A;  1E9L A;  4QT2 A;  4TYO A;  5JH8 A;  4IQ2 A;  1WNO A;  3B7X A;  3WD4 A;  3CHF A;  4WKA A;  2PV1 A;  5DIV A;  1HKJ A;  4J4O A;  4P8X A;  4QT3 A;  4WKH A;  5GPG A;  4ZS6 A;  1EYM A;  3CHD A;  4Z2G A;  1Q1C A;  3ARW A;  1FKS A;  4JFI A;  5D75 A;  1UR8 A;  2RUC A;  4ODM A;  1LG2 A;  4Z2L A;  2FAP A;  1H0I A;  3AS2 A;  2RSE A;  2VCD A;  3AS3 A;  3AS0 A;  1NH6 A;  3O5O A;  2MPH A;  2DT1 A;  2FDM A;  2ZQU A;  3KAI A;  2DG4 A;  3H9R B;  3WIJ A;  1ZK6 A;  1ZL1 A;  2UZ5 A;  3MDY B;  1W9V A;  5HWC A;  4ODR A;  4MGV A;  3RM9 A;  3WKZ A;  4C02 B;  1T11 A;  3CGM A;  1Q6H A;  1FFQ A;  2IUZ A;  4DRM A;  1OWQ A;  4DRH A;  4ITZ A;  1J6Y A;  1X6N A;  2DSU A;  2N87 A;  3RM4 A;  1EIB A;  4LAV A;  4FAP A;  1J4R A;  3O5D A;  2DT2 A;  2K8I A;  2KR7 A;  2A3A A;  3UQI A;  4W9P A;  1VF8 A;  1LJY A;  1HJV A;  3ARV A;  5BXJ A;  4URI A;  5DIU A;  3NRK A;  2WM0 A;  3WH0 A;  1HKM A;  2VN1 A;  2XP8 A;  1SYT A;  3UI4 A;  1D7J A;  4ODN A;  1FKD A;  1WB0 A;  2F4E A;  5GQB A;  2XP4 A;  1X6L A;  4LAW A;  1ZBV A;  2YBT A;  4S3J A;  1D6O A;  1F8A B;  3KAD A;  1ZBW A;  4P8U A;  4GIV A;  4ZPT R;  4HBE A;  3ODK A;  4W9O A;  1BKF A;  1C9H A;  3UQB A;  4JFM A;  2PI6 A;  1FKR A;  4TW8 A;  1OGB A;  1WAW A;  3TCZ A;  2PV3 A;  4Z2K A;  2DT0 A;  3ART A;  1SR0 A;  3O5P A;  4MTV A;  3FAP A;  1XRV A;  1N1A A;  2DG3 A;  4DRJ A;  3WD0 A;  2MLX A;  4DRO A;  2RQS A;  4MNJ A;  1KT1 A;  2DG9 A;  4NSB A;  3GU0 A;  3B9E A; 
#chains in the Genus database with same CATH homology
 1IX5 A;  3ARR A;  4JFK A;  3W4R A;  3UI6 A;  1W9P A;  2M08 A;  2O9O A;  4DZ2 A;  2PPN A;  5J6E A;  4P8W A;  1W1V A;  3CHE A;  5HT1 A;  4G50 A;  3FY1 A;  4AY1 A;  1NMV A;  3RFW A;  4DRK A;  1E6P A;  4KR0 B;  4DH0 A;  1TFV A;  3WL0 A;  4IT4 A;  3ALG A;  1JNS A;  3PA7 A;  2ZQS A;  1PIN A;  3IKD A;  1KFW A;  3CZ8 A;  3PRD A;  4R0X A;  2PPO A;  1JNE A;  1D7H A;  1HKI A;  1Q6U A;  4ODK A;  4DRI A;  3UQA A;  1QPL A;  2LJ4 A;  2DPE A;  2RUQ A;  3UI5 A;  3KAB A;  3KZ7 A;  4TW6 A;  1ITX A;  1J4H A;  4ODP A;  1LL7 A;  1FKF A;  2LPV A;  3B9D A;  4MNM A;  3G6M A;  4W5U A;  2A3E A;  4ODQ A;  4TW7 A;  3LUO A;  3O5J A;  4L72 B;  3RME A;  3BXW A;  4MPK A;  2O92 A;  4ZPW R;  3I6C A;  2XP5 A;  1E15 A;  2KO7 A;  3UF8 A;  4Z2J A;  4Z2I A;  1EQ3 A;  2KFW A;  5DIT A;  4L3N A;  4WIW A;  1ROT A;  1LL4 A;  2Y78 A;  5GPR A;  2M2A A;  2ITK A;  4DZ3 A;  1W9U A;  3JYJ A;  1W1Y A;  1HJX A;  1D2K A;  2DSW A;  5HW8 A;  4LAY A;  3AQU A;  1HXV A;  3IHZ A;  2AWG A;  2B31 A;  4Z2H A;  3ARO A;  1FKH A;  3O5L A;  2XP3 A;  3VAW A;  1R9H A;  3CGN A;  3ARS A;  1YAT A;  3CH9 A;  2L2S A;  1NSG A;  4DIP A;  1GPF A;  4IT6 A;  2WK2 A;  1FKB A;  1FKJ A;  3WQW A;  1KT0 A;  1ZBC A;  2ZR4 A;  3O5F A;  4LGX A;  1A7X A;  3ARQ A;  3IK8 A;  4NZC A;  3KAG A;  4HBO A;  1W26 A;  1NMW A;  3PR9 A;  4R5E A;  1J4I A;  4MSP A;  4BF8 A;  3EY6 A;  4N19 A;  1NWT A;  2A3B A;  2KI3 A;  1Y0O A;  4LAX A;  4DWS A;  1XHG A;  5DF0 A;  4KQZ A;  3RM8 A;  3ARZ A;  2ZR5 A;  2XP9 A;  3WD1 A;  3O5R A;  2RUR A;  4Q22 A;  1LL6 A;  3ARX A;  4O2T A;  2FKE A;  3RGC A;  1FD9 A;  3WQV A;  2QF8 A;  4XAK A;  4U85 A;  1FKI A;  1NWS A;  1FAP A;  1GUV A;  3GPK A;  2XPB A;  1FJD A;  1W1T A;  1E6Z A;  2PPP A;  1D7I A;  4JFL A;  3NI6 A;  4WK9 A;  1ZCN A;  4MNL A;  5HW6 A;  3B9A A;  1L1P A;  2AOS A;  2XP7 A;  3CHC A;  2WLZ A;  2G8Z A;  2MF9 A;  1W1P A;  1FKL A;  1F40 A;  3ALF A;  1LQ0 A;  2MLZ A;  2LKN A;  2YBU A;  1QPF A;  4DRN A;  1HKK A;  1H0G A;  5HUA A;  3O5Q A;  4S3K A;  2MNT A;  4Q7N A;  1ZB5 A;  3WD2 A;  1FFR A;  2Q5A A;  1TCO C;  4DRQ A;  4ODL A;  2MLY A;  3IKG A;  1Q6I A;  1ZBK A;  1HJW A;  1EDQ A;  3AS1 A;  1E6N A;  1B6C A;  1YW5 A;  2ZR6 A;  2JZV A;  4DWS B;  1EHN A;  4TX0 A;  4DRP A;  2OLH A;  3QOK A;  4DWS D;  1QZ2 A;  2F2D A;  4QZV B;  5HW7 A;  3O5E A;  3PRB A;  4W9Q A;  1PBK A;  1M5Y A;  3B8S A;  4U86 A;  5B8I C;  4MAV A;  1ZU8 A;  1RD6 A;  3TDB A;  3FXY A;  1CTN A;  4MNK A;  5I98 A;  4G2P A;  5HBF A;  2RUD A;  1P5Q A;  2F21 A;  4FN2 A;  4P8V A;  3JXV A;  4U84 A;  3WD3 A;  2OFN A;  4WJX A;  2XPA A;  4ODO A;  2M1I A;  3JYM A;  5HTG A;  3KAH A;  1U79 A;  1NWR A;  2WLY A;  3WL1 A;  4GGQ A;  1JNT A;  4PTM A;  2IF4 A;  5HWB A;  1BL4 A;  4DWS C;  1LG1 A;  5HKG A;  3ARP A;  3O5M A;  1O6I A;  1JND A;  4WKF A;  3OOB A;  4IPX A;  2PBC A;  2ESC A;  2A3C A;  2G41 A;  4ML4 A;  3OA5 A;  1JVW A;  2DT3 A;  5DO2 A;  1ROU A;  3G6L A;  4JFJ A;  3ARU A;  2DSZ A;  4J4N A;  3TC5 A;  4HAR A;  2D9F A;  2PV2 A;  4TNS A;  1E6R A;  4NNR A;  3KAF A;  1GOI A;  2KE0 A;  1OGG A;  1FKT A;  1UR9 A;  3O5I A;  1FKG A;  4JYS A;  1FKK A;  3ARY A;  5DEZ A;  2KGJ A;  3PRA A;  3KCE A;  4DT4 A;  3KAC A;  3O5K A;  1K9T A;  2ZQT A;  2XP6 A;  1NWU A;  2DSV A;  2ZQV A;  4QIB A;  3O5G A;  4ZPV R;  2LGO A;  4IQC A;  3NTP A;  1E9L A;  4QT2 A;  4TYO A;  5JH8 A;  4IQ2 A;  1WNO A;  3B7X A;  3WD4 A;  3CHF A;  4WKA A;  2PV1 A;  5DIV A;  1HKJ A;  4J4O A;  4P8X A;  4QT3 A;  4WKH A;  5GPG A;  4ZS6 A;  1EYM A;  3CHD A;  4Z2G A;  1Q1C A;  3ARW A;  1FKS A;  4JFI A;  5D75 A;  1UR8 A;  2RUC A;  4ODM A;  1LG2 A;  4Z2L A;  2FAP A;  1H0I A;  3AS2 A;  2RSE A;  2VCD A;  3AS3 A;  3AS0 A;  1NH6 A;  3O5O A;  2MPH A;  2DT1 A;  2FDM A;  2ZQU A;  3KAI A;  2DG4 A;  3H9R B;  3WIJ A;  1ZK6 A;  1ZL1 A;  2UZ5 A;  3MDY B;  1W9V A;  5HWC A;  4ODR A;  4MGV A;  3RM9 A;  3WKZ A;  4C02 B;  1T11 A;  3CGM A;  1Q6H A;  1FFQ A;  2IUZ A;  4DRM A;  1OWQ A;  4DRH A;  4ITZ A;  1J6Y A;  1X6N A;  2DSU A;  2N87 A;  3RM4 A;  1EIB A;  4LAV A;  4FAP A;  1J4R A;  3O5D A;  2DT2 A;  2K8I A;  2KR7 A;  2A3A A;  3UQI A;  4W9P A;  1VF8 A;  1LJY A;  1HJV A;  3ARV A;  5BXJ A;  4URI A;  5DIU A;  3NRK A;  2WM0 A;  3WH0 A;  1HKM A;  2VN1 A;  2XP8 A;  1SYT A;  3UI4 A;  1D7J A;  4ODN A;  1FKD A;  1WB0 A;  2F4E A;  5GQB A;  2XP4 A;  1X6L A;  4LAW A;  1ZBV A;  2YBT A;  4S3J A;  1D6O A;  1F8A B;  3KAD A;  1ZBW A;  4P8U A;  4GIV A;  4ZPT R;  4HBE A;  3ODK A;  4W9O A;  1BKF A;  1C9H A;  3UQB A;  4JFM A;  2PI6 A;  1FKR A;  4TW8 A;  1OGB A;  1WAW A;  3TCZ A;  2PV3 A;  4Z2K A;  2DT0 A;  3ART A;  1SR0 A;  3O5P A;  4MTV A;  3FAP A;  1XRV A;  1N1A A;  2DG3 A;  4DRJ A;  3WD0 A;  2MLX A;  4DRO A;  2RQS A;  4MNJ A;  1KT1 A;  2DG9 A;  4NSB A;  3B9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...