4DROA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with (1r)-3-(3,4-dimethoxyphenyl)-1-phenylpropyl (2s)-1-{[(1r,2s)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidine-2-carboxylate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4droA00
5DIVA 5HT1A 3O5PA 2XP5A 4DZ2A 2F2DA 2PPNA 3PRBA 4LAWA 3UQAA 4JFIA 1KT1A 2KR7A 2LJ4A 2KFWA 2PV3A 3JYMA 3OOBA 4DRNA 4DZ3A 1D7IA 3NI6A 2M2AA 3KCEA 1BKFA 2ZQTA 4DH0A 1FJDA 1FKRA 2UZ5A 2XP4A 2XP8A 4LAYA 1FKFA 2M08A 4TW6A 4J4OA 4DRPA 1Q1CA 1ZK6A 3JXVA 5HTGA 4MGVA 3UI6A 1NSGA 2RURA 2AWGA 2LKNA 1M5YA 3RGCA 3PA7A 3VAWA 4JYSA 3KACA 1FKGA 2XP7A 5DIUA 2F4EA 4U84A 1HXVA 2IF4A 1FKLA 1FKDA 5DITA 1QZ2A 1FKTA 1Q6HA 2ZQVA 4FN2A 3I6CA 5HW7A 4IQCA 4DT4A 1QPFA 2LPVA 4G50A 3KAIA 2MLYA 3O5QA 3TC5A 1J6YA 1PINA 2K8IA 4IQ2A 3IKDA 2PV1A 2XPBA 4ODKA 2ZQUA 1FKIA 4JFLA 3TDBA 2RSEA 1L1PA 1R9HA 4JFMA 2ZR6A 1ROTA 2N87A 4GGQA 1FAPA 1FKBA 1PBKA 2Q5AA 3KAHA 3O5MA 3O5DA 2KGJA 3UI4A 4DRQA 4W9OA 2L2SA 4IPXA 4U85A 5GPGA 4QIBA 4LAXA 4J4NA 1FD9A 3O5KA 2OFNA 1D7HA 4N19A 1Q6IA 2MNTA 1T11A 3FAPA 2D9FA 2PPOA 1YW5A 1FKJA 3O5LA 1Y0OA 3GPKA 4TNSA 3RFWA 3CGNA 2LGOA 2F21A 2RUCA 3H9RB 3O5JA 3WH0A 1NMVA 4DRHA 3KABA 1EYMA 2VN1A 2MF9A 3CGMA 4ODOA 4ODPA 2DG3A 3MDYB 2MLXA 4ITZA 2PPPA 2XP6A 4O2TA 5HW8A 2MLZA 1J4IA 4BF8A 1JNSA 2Y78A 2XP9A 3B7XA 5HW6A 4DRKA 4W9PA 5HWCA 3O5FA 3O5RA 1Q6UA 1EQ3A 5J6EA 4DRIA 2JZVA 5B8IC 3TCZA 2DG4A 1YATA 3O5OA 3KADA 1P5QA 4ODRA 5D75A 1FKKA 1ZCNA 2KI3A 4TX0A 4DRMA 5I98A 3UQBA 4FAPA 2DG9A 1FKHA 3IKGA 1W26A 3UQIA 2FAPA 3ODKA 5HKGA 4ODLA 4U86A 1QPLA 2ZR4A 4JFKA 2RUQA 3IK8A 3UI5A 5HWBA 3NRKA 4ODNA 1J4RA 1A7XA 4W9QA 1F40A 4DRJA 1F8AB 4ODQA 4QT3A 2XP3A 3EY6A 5BXJA 1JVWA 1ROUA 1FKSA 1U79A 2XPAA 2PBCA 3O5GA 4GIVA 3LUOA 2PV2A 4MSPA 4C02B 2ITKA 2VCDA 1J4HA 2ZR5A 4TW7A 4QT2A 4JFJA 4NNRA 4R0XA 4DROA 1JNTA 5HUAA 2KE0A 3KAGA 2M1IA 3O5IA 3JYJA 3PRDA 2RUDA 1D6OA 1BL4A 1D7JA 2ZQSA 3O5EA 1B6CA 4G2PA 1KT0A 4LAVA 4ODMA 4TW8A 1N1AA 2RQSA 4TYOA 3KZ7A 3UF8A 3NTPA 4DIPA 2KO7A 1C9HA 1TCOC 2MPHA 3IHZA 3KAFA 2FKEA 1NMWA
chains in the Genus database with same CATH superfamily
5DIVA 4LAWA 3ALGA 3UQAA 2DPEA 4DZ3A 3NI6A 4DH0A 4LAYA 2XP8A 1FKFA 4DRPA 3RM9A 3CHEA 5HTGA 1NSGA 4HBEA 3OA5A 2IUZA 3PA7A 1FKGA 4DWSA 3CHCA 2IF4A 1FKDA 1FKTA 2ZQVA 4DWSC 3I6CA 5GPRA 4IQCA 2LPVA 4ZPWR 3O5QA 3WQVA 4Z2IA 1OGGA 1PINA 4W5UA 3AS1A 3IKDA 1EHNA 1L1PA 2ZQUA 3AQUA 1W9VA 2ZR6A 3B9EA 3WKZA 4KR0B 2Q5AA 3WL1A 2KGJA 3ARPA 4DRQA 4W9OA 2L2SA 5HBFA 3ARRA 4QIBA 4J4NA 3O5KA 2DSUA 2OFNA 3BMBA 3FAPA 1NWTA 2D9FA 2PPOA 3O5LA 3GPKA 4TNSA 3O5JA 3WH0A 2F23A 4P8WA 4WJXA 3CGMA 4KQZA 4LGXA 4ODOA 2DG3A 3MDYB 4ITZA 4O2TA 2XP6A 2G8ZA 2MLZA 1K9TA 2WLYA 2XP9A 3B7XA 1X6NA 1LL7A 3O5FA 3O5RA 1EQ3A 5B8IC 1ZB5A 1E6RA 3ALFA 4Z2KA 4Q7NA 4TX0A 4DWSD 1NH6A 3ARTA 3B9AA 4UDMA 2P4VA 2DT2A 3UQIA 2FAPA 4ZPVR 4JFKA 4Z2LA 3NRKA 3WL0A 2DSZA 4WKHA 1E6ZA 4W9QA 4QT3A 1HKIA 1JVWA 1U79A 2XPAA 4WIWA 1WNOA 3O5GA 2B5UB 2PV2A 1J4HA 1W1PA 1B6CA 1KT0A 4TW8A 3UF8A 5DF0A 3KZ7A 3NTPA 2FKEA 1FKJA 5HT1A 4DZ2A 2XP5A 1W1VA 2KR7A 2LJ4A 4NSBA 2YBTA 2PN0A 4Q22A 4DRNA 1D7IA 3KCEA 4P8XA 2ZQTA 3AS3A 1FJDA 2XP4A 4TW6A 1JCHB 3W4RA 1Q1CA 4QZVB 4Z2GA 1NWRA 4MGVA 2G41A 4MNKA 4JYSA 4PTMA 4U84A 1HXVA 1QZ2A 5HW7A 4ZPTR 1FFQA 3KAIA 2MLYA 3TC5A 4IQ2A 2A3AA 1FKIA 4S3JA 4MNLA 3WIJA 1ROTA 3QOKA 4XAKA 4L72B 3FY1A 5GQBA 4IPXA 4U85A 5GPGA 1FD9A 4N19A 2MNTA 1D2KA 1ZU8A 4P8VA 2O9OA 1YW5A 1GPFA 3CGNA 2F21A 3H9RB 3G6LA 1HJWA 1ZBWA 1EYMA 2VN1A 4IT6A 1W9PA 1WAWA 5JH8A 1NWSA 4BF8A 2EULA 2Y78A 3ARUA 5HWCA 1Q6UA 2OLHA 1W1YA 2DG4A 3KADA 1P5QA 4NZCA 5D75A 4Z2JA 1LL6A 4DRMA 3AS2A 3ARWA 3UQBA 3FXYA 2DG9A 1W1TA 4MNMA 2RUQA 1LL4A 1J4RA 1ZL1A 1UR8A 3WD0A 3EY6A 1LJYA 2O92A 1FKSA 1ITXA 3LUOA 3CHFA 3WD2A 2VCDA 4TW7A 4QT2A 4JFJA 4Z2HA 3PRDA 4HARA 4WKFA 4G2PA 1UR9A 4ODMA 1N1AA 3KAFA 1C9HA 2MPHA 3AS0A 4DWSB 1NMWA 1E9LA 1SR0A 3ARYA 1EIBA 4JFIA 1OGBA 3JYMA 2KFWA 2PV3A 4MNJA 2M2AA 2ETNA 3ARQA 3PRAA 1FFRA 4J4OA 2B31A 1H0GA 1ZK6A 3JXVA 3UI6A 2DT1A 2A3BA 2LKNA 4ZS6A 5DO2A 2F4EA 3WD1A 2QF8A 5DITA 4FN2A 1Q6HA 3RM8A 1GRJA 1J6YA 2K8IA 4HBOA 4JFLA 2DT0A 2RSEA 1LG1A 1JNDA 2N87A 4GGQA 1FAPA 3KAHA 1HKJA 3O5DA 4LAXA 1T11A 2DSWA 3WD4A 2A3EA 2LGOA 2RUCA 4L3NA 3G6MA 1NMVA 1XRVA 4DRHA 3KABA 1CTNA 1HKKA 5HW8A 1J4IA 1E6NA 1W9UA 4W9PA 2A3CA 5J6EA 4URIA 1YATA 4ODRA 1LG2A 1VF8A 3EIPA 1FKHA 3ARZA 3IKGA 5HKGA 4ODLA 4U86A 2ZR4A 1LQ0A 4ODNA 1OWQA 1XHGA 4P8UA 3WD3A 4DRJA 1F8AB 2XP3A 3CZ8A 1ROUA 1O6IA 4MSPA 4WKAA 2ITKA 1EDQA 1E44A 4R0XA 2WK2A 1JNTA 5HUAA 1E15A 2KE0A 3KAGA 3O5IA 2RUDA 3CHDA 1BL4A 1D7JA 2DSVA 2ZQSA 3O5EA 4S3KA 4MPKA 4LAVA 3B9DA 4TYOA 4DIPA 1H0IA 1TCOC 1SYTA 2WM0A 3RM4A 1HJXA 1WB0A 3O5PA 1ZBVA 3GU0A 2F2DA 2PPNA 3PRBA 1KT1A 3OOBA 1BKFA 1FKRA 2UZ5A 4ML4A 2M08A 3BXWA 1HKMA 2RURA 2AWGA 2FDMA 2YBUA 1M5YA 1JNEA 3RGCA 3VAWA 3KACA 5DIUA 2XP7A 1HJVA 1FKLA 4IT4A 4AY1A 2DT3A 4DT4A 1QPFA 3AROA 4G50A 1E6PA 2PV1A 2XPBA 4ODKA 4R5EA 3TDBA 1X6LA 1R9HA 4JFMA 3GTYX 1FKBA 1PBKA 3O5MA 1IX5A 3UI4A 1D7HA 1Q6IA 3ARXA 3RFWA 1Y0OA 1NWUA 3ARSA 2MF9A 4ODPA 1GOIA 2MLXA 2PPPA 1JNSA 3CH9A 5HW6A 4DRKA 4MAVA 4DRIA 2JZVA 3TCZA 3O5OA 1ZBKA 2ESCA 1KFWA 1FKKA 1ZCNA 2KI3A 5I98A 4FAPA 1W26A 3ODKA 2WLZA 1QPLA 3B8SA 5HWBA 3IK8A 3UI5A 3ARVA 2AOSA 1A7XA 1F40A 4ODQA 5BXJA 1TFVA 2PBCA 4GIVA 5DEZA 1GUVA 4WK9A 4C02B 2ZR5A 4MTVA 4NNRA 3WQWA 4DROA 2PI6A 3RMEA 2M1IA 3JYJA 3PR9A 1D6OA 1RD6A 2RQSA 2KO7A 3IHZA 1ZBCA
chains in the Genus database with same CATH topology
5DIVA 4LAWA 3ALGA 3UQAA 2DPEA 4DZ3A 3NI6A 4DH0A 4LAYA 2XP8A 1FKFA 4DRPA 3RM9A 3CHEA 5HTGA 1NSGA 4HBEA 3OA5A 2IUZA 3PA7A 1FKGA 4DWSA 3CHCA 2IF4A 1FKDA 1FKTA 2ZQVA 4DWSC 3I6CA 5GPRA 4IQCA 2LPVA 4ZPWR 3O5QA 3WQVA 4Z2IA 1OGGA 1PINA 4W5UA 3AS1A 3IKDA 1EHNA 1L1PA 2ZQUA 3AQUA 1W9VA 2ZR6A 3B9EA 3WKZA 4KR0B 2Q5AA 3WL1A 2KGJA 3ARPA 4DRQA 4W9OA 2L2SA 5HBFA 3ARRA 4QIBA 4J4NA 3O5KA 2DSUA 2OFNA 3FAPA 1NWTA 2D9FA 2PPOA 3O5LA 3GPKA 4TNSA 3O5JA 3WH0A 4P8WA 4WJXA 3CGMA 4KQZA 4LGXA 4ODOA 2DG3A 3MDYB 4ITZA 4O2TA 2XP6A 2G8ZA 2MLZA 1K9TA 2WLYA 2XP9A 3B7XA 1X6NA 1LL7A 3O5FA 3O5RA 1EQ3A 5B8IC 1ZB5A 1E6RA 3ALFA 4Z2KA 4Q7NA 4TX0A 4DWSD 1NH6A 3ARTA 3B9AA 2DT2A 3UQIA 2FAPA 4ZPVR 4JFKA 4Z2LA 3NRKA 3WL0A 2DSZA 4WKHA 1E6ZA 4W9QA 4QT3A 1HKIA 1JVWA 1U79A 2XPAA 4WIWA 1WNOA 3O5GA 2PV2A 1J4HA 1W1PA 1B6CA 1KT0A 4TW8A 3UF8A 5DF0A 3KZ7A 3NTPA 2FKEA 1FKJA 5HT1A 4DZ2A 2XP5A 1W1VA 2KR7A 2LJ4A 4NSBA 2YBTA 4Q22A 4DRNA 1D7IA 3KCEA 4P8XA 2ZQTA 3AS3A 1FJDA 2XP4A 4TW6A 3W4RA 1Q1CA 4QZVB 4Z2GA 1NWRA 4MGVA 2G41A 4MNKA 4JYSA 4PTMA 4U84A 1HXVA 1QZ2A 5HW7A 4ZPTR 1FFQA 3KAIA 2MLYA 3TC5A 4IQ2A 2A3AA 1FKIA 4S3JA 4MNLA 3WIJA 1ROTA 3QOKA 4XAKA 4L72B 3FY1A 5GQBA 4IPXA 4U85A 5GPGA 1FD9A 4N19A 2MNTA 1D2KA 1ZU8A 4P8VA 2O9OA 1YW5A 1GPFA 3CGNA 2F21A 3H9RB 3G6LA 1HJWA 1ZBWA 1EYMA 2VN1A 4IT6A 1W9PA 1WAWA 5JH8A 1NWSA 4BF8A 2Y78A 3ARUA 5HWCA 1Q6UA 2OLHA 1W1YA 2DG4A 3KADA 1P5QA 4NZCA 5D75A 4Z2JA 1LL6A 4DRMA 3AS2A 3ARWA 3UQBA 3FXYA 2DG9A 1W1TA 4MNMA 2RUQA 1LL4A 1J4RA 1ZL1A 1UR8A 3WD0A 3EY6A 1LJYA 2O92A 1FKSA 1ITXA 3LUOA 3CHFA 3WD2A 2VCDA 4TW7A 4QT2A 4JFJA 4Z2HA 3PRDA 4HARA 4WKFA 4G2PA 1UR9A 4ODMA 1N1AA 3KAFA 1C9HA 2MPHA 3AS0A 4DWSB 1NMWA 1E9LA 1SR0A 3ARYA 1EIBA 4JFIA 1OGBA 3JYMA 2KFWA 2PV3A 4MNJA 2M2AA 3ARQA 3PRAA 1FFRA 4J4OA 2B31A 1H0GA 1ZK6A 3JXVA 3UI6A 2DT1A 2A3BA 2LKNA 4ZS6A 5DO2A 2F4EA 3WD1A 2QF8A 5DITA 4FN2A 1Q6HA 3RM8A 1J6YA 2K8IA 4HBOA 4JFLA 2DT0A 2RSEA 1LG1A 1JNDA 2N87A 4GGQA 1FAPA 3KAHA 1HKJA 3O5DA 4LAXA 1T11A 2DSWA 3WD4A 2A3EA 2LGOA 2RUCA 4L3NA 3G6MA 1NMVA 1XRVA 4DRHA 3KABA 1CTNA 1HKKA 5HW8A 1J4IA 1E6NA 1W9UA 4W9PA 2A3CA 5J6EA 4URIA 1YATA 4ODRA 1LG2A 1VF8A 1FKHA 3ARZA 3IKGA 5HKGA 4ODLA 4U86A 2ZR4A 1LQ0A 4ODNA 1OWQA 1XHGA 4P8UA 3WD3A 4DRJA 1F8AB 2XP3A 3CZ8A 1ROUA 1O6IA 4MSPA 4WKAA 2ITKA 1EDQA 4R0XA 2WK2A 1JNTA 5HUAA 1E15A 2KE0A 3KAGA 3O5IA 2RUDA 3CHDA 1BL4A 1D7JA 2DSVA 2ZQSA 3O5EA 4S3KA 4MPKA 4LAVA 3B9DA 4TYOA 4DIPA 1H0IA 1TCOC 1SYTA 2WM0A 3RM4A 1HJXA 1WB0A 3O5PA 1ZBVA 2F2DA 2PPNA 3PRBA 1KT1A 3OOBA 1BKFA 1FKRA 2UZ5A 4ML4A 2M08A 3BXWA 1HKMA 2RURA 2AWGA 2FDMA 2YBUA 1M5YA 1JNEA 3RGCA 3VAWA 3KACA 5DIUA 2XP7A 1HJVA 1FKLA 4IT4A 4AY1A 2DT3A 4DT4A 1QPFA 3AROA 4G50A 1E6PA 2PV1A 2XPBA 4ODKA 4R5EA 3TDBA 1X6LA 1R9HA 4JFMA 1FKBA 1PBKA 3O5MA 1IX5A 3UI4A 1D7HA 1Q6IA 3ARXA 3RFWA 1Y0OA 1NWUA 3ARSA 2MF9A 4ODPA 1GOIA 2MLXA 2PPPA 1JNSA 3CH9A 5HW6A 4DRKA 4MAVA 4DRIA 2JZVA 3TCZA 3O5OA 1ZBKA 2ESCA 1KFWA 1FKKA 1ZCNA 2KI3A 5I98A 4FAPA 1W26A 3ODKA 2WLZA 1QPLA 3B8SA 5HWBA 3IK8A 3UI5A 3ARVA 2AOSA 1A7XA 1F40A 4ODQA 5BXJA 1TFVA 2PBCA 4GIVA 5DEZA 1GUVA 4WK9A 4C02B 2ZR5A 4MTVA 4NNRA 3WQWA 4DROA 2PI6A 3RMEA 2M1IA 3JYJA 3PR9A 1D6OA 1RD6A 2RQSA 2KO7A 3IHZA 1ZBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIV A;  5HT1 A;  3O5P A;  2XP5 A;  4DZ2 A;  2F2D A;  2PPN A;  3PRB A;  4LAW A;  3UQA A;  4JFI A;  1KT1 A;  2KR7 A;  2LJ4 A;  2KFW A;  2PV3 A;  3JYM A;  3OOB A;  4DRN A;  4DZ3 A;  1D7I A;  3NI6 A;  2M2A A;  3KCE A;  1BKF A;  2ZQT A;  4DH0 A;  1FJD A;  1FKR A;  2UZ5 A;  2XP4 A;  2XP8 A;  4LAY A;  1FKF A;  2M08 A;  4TW6 A;  4J4O A;  4DRP A;  1Q1C A;  1ZK6 A;  3JXV A;  5HTG A;  4MGV A;  3UI6 A;  1NSG A;  2RUR A;  2AWG A;  2LKN A;  1M5Y A;  3RGC A;  3PA7 A;  3VAW A;  4JYS A;  3KAC A;  1FKG A;  2XP7 A;  5DIU A;  2F4E A;  4U84 A;  1HXV A;  2IF4 A;  1FKL A;  1FKD A;  5DIT A;  1QZ2 A;  1FKT A;  1Q6H A;  2ZQV A;  4FN2 A;  3I6C A;  5HW7 A;  4IQC A;  4DT4 A;  1QPF A;  2LPV A;  4G50 A;  3KAI A;  2MLY A;  3O5Q A;  3TC5 A;  1J6Y A;  1PIN A;  2K8I A;  4IQ2 A;  3IKD A;  2PV1 A;  2XPB A;  4ODK A;  2ZQU A;  1FKI A;  4JFL A;  3TDB A;  2RSE A;  1L1P A;  1R9H A;  4JFM A;  2ZR6 A;  1ROT A;  2N87 A;  4GGQ A;  1FAP A;  1FKB A;  1PBK A;  2Q5A A;  3KAH A;  3O5M A;  3O5D A;  2KGJ A;  3UI4 A;  4DRQ A;  4W9O A;  2L2S A;  4IPX A;  4U85 A;  5GPG A;  4QIB A;  4LAX A;  4J4N A;  1FD9 A;  3O5K A;  2OFN A;  1D7H A;  4N19 A;  1Q6I A;  2MNT A;  1T11 A;  3FAP A;  2D9F A;  2PPO A;  1YW5 A;  1FKJ A;  3O5L A;  1Y0O A;  3GPK A;  4TNS A;  3RFW A;  3CGN A;  2LGO A;  2F21 A;  2RUC A;  3H9R B;  3O5J A;  3WH0 A;  1NMV A;  4DRH A;  3KAB A;  1EYM A;  2VN1 A;  2MF9 A;  3CGM A;  4ODO A;  4ODP A;  2DG3 A;  3MDY B;  2MLX A;  4ITZ A;  2PPP A;  2XP6 A;  4O2T A;  5HW8 A;  2MLZ A;  1J4I A;  4BF8 A;  1JNS A;  2Y78 A;  2XP9 A;  3B7X A;  5HW6 A;  4DRK A;  4W9P A;  5HWC A;  3O5F A;  3O5R A;  1Q6U A;  1EQ3 A;  5J6E A;  4DRI A;  2JZV A;  5B8I C;  3TCZ A;  2DG4 A;  1YAT A;  3O5O A;  3KAD A;  1P5Q A;  4ODR A;  5D75 A;  1FKK A;  1ZCN A;  2KI3 A;  4TX0 A;  4DRM A;  5I98 A;  3UQB A;  4FAP A;  2DG9 A;  1FKH A;  3IKG A;  1W26 A;  3UQI A;  2FAP A;  3ODK A;  5HKG A;  4ODL A;  4U86 A;  1QPL A;  2ZR4 A;  4JFK A;  2RUQ A;  3IK8 A;  3UI5 A;  5HWB A;  3NRK A;  4ODN A;  1J4R A;  1A7X A;  4W9Q A;  1F40 A;  4DRJ A;  1F8A B;  4ODQ A;  4QT3 A;  2XP3 A;  3EY6 A;  5BXJ A;  1JVW A;  1ROU A;  1FKS A;  1U79 A;  2XPA A;  2PBC A;  3O5G A;  4GIV A;  3LUO A;  2PV2 A;  4MSP A;  4C02 B;  2ITK A;  2VCD A;  1J4H A;  2ZR5 A;  4TW7 A;  4QT2 A;  4JFJ A;  4NNR A;  4R0X A;  4DRO A;  1JNT A;  5HUA A;  2KE0 A;  3KAG A;  2M1I A;  3O5I A;  3JYJ A;  3PRD A;  2RUD A;  1D6O A;  1BL4 A;  1D7J A;  2ZQS A;  3O5E A;  1B6C A;  4G2P A;  1KT0 A;  4LAV A;  4ODM A;  4TW8 A;  1N1A A;  2RQS A;  4TYO A;  3KZ7 A;  3UF8 A;  3NTP A;  4DIP A;  2KO7 A;  1C9H A;  1TCO C;  2MPH A;  3IHZ A;  3KAF A;  2FKE A;  1NMW A; 
#chains in the Genus database with same CATH topology
 5DIV A;  4LAW A;  3ALG A;  3UQA A;  2DPE A;  4DZ3 A;  3NI6 A;  4DH0 A;  4LAY A;  2XP8 A;  1FKF A;  4DRP A;  3RM9 A;  3CHE A;  5HTG A;  1NSG A;  4HBE A;  3OA5 A;  2IUZ A;  3PA7 A;  1FKG A;  4DWS A;  3CHC A;  2IF4 A;  1FKD A;  1FKT A;  2ZQV A;  4DWS C;  3I6C A;  5GPR A;  4IQC A;  2LPV A;  4ZPW R;  3O5Q A;  3WQV A;  4Z2I A;  1OGG A;  1PIN A;  4W5U A;  3AS1 A;  3IKD A;  1EHN A;  1L1P A;  2ZQU A;  3AQU A;  1W9V A;  2ZR6 A;  3B9E A;  3WKZ A;  4KR0 B;  2Q5A A;  3WL1 A;  2KGJ A;  3ARP A;  4DRQ A;  4W9O A;  2L2S A;  5HBF A;  3ARR A;  4QIB A;  4J4N A;  3O5K A;  2DSU A;  2OFN A;  3BMB A;  3FAP A;  1NWT A;  2D9F A;  2PPO A;  3O5L A;  3GPK A;  4TNS A;  3O5J A;  3WH0 A;  2F23 A;  4P8W A;  4WJX A;  3CGM A;  4KQZ A;  4LGX A;  4ODO A;  2DG3 A;  3MDY B;  4ITZ A;  4O2T A;  2XP6 A;  2G8Z A;  2MLZ A;  1K9T A;  2WLY A;  2XP9 A;  3B7X A;  1X6N A;  1LL7 A;  3O5F A;  3O5R A;  1EQ3 A;  5B8I C;  1ZB5 A;  1E6R A;  3ALF A;  4Z2K A;  4Q7N A;  4TX0 A;  4DWS D;  1NH6 A;  3ART A;  3B9A A;  4UDM A;  2P4V A;  2DT2 A;  3UQI A;  2FAP A;  4ZPV R;  4JFK A;  4Z2L A;  3NRK A;  3WL0 A;  2DSZ A;  4WKH A;  1E6Z A;  4W9Q A;  4QT3 A;  1HKI A;  1JVW A;  1U79 A;  2XPA A;  4WIW A;  1WNO A;  3O5G A;  2B5U B;  2PV2 A;  1J4H A;  1W1P A;  1B6C A;  1KT0 A;  4TW8 A;  3UF8 A;  5DF0 A;  3KZ7 A;  3NTP A;  2FKE A;  1FKJ A;  5HT1 A;  4DZ2 A;  2XP5 A;  1W1V A;  2KR7 A;  2LJ4 A;  4NSB A;  2YBT A;  2PN0 A;  4Q22 A;  4DRN A;  1D7I A;  3KCE A;  4P8X A;  2ZQT A;  3AS3 A;  1FJD A;  2XP4 A;  4TW6 A;  1JCH B;  3W4R A;  1Q1C A;  4QZV B;  4Z2G A;  1NWR A;  4MGV A;  2G41 A;  4MNK A;  4JYS A;  4PTM A;  4U84 A;  1HXV A;  1QZ2 A;  5HW7 A;  4ZPT R;  1FFQ A;  3KAI A;  2MLY A;  3TC5 A;  4IQ2 A;  2A3A A;  1FKI A;  4S3J A;  4MNL A;  3WIJ A;  1ROT A;  3QOK A;  4XAK A;  4L72 B;  3FY1 A;  5GQB A;  4IPX A;  4U85 A;  5GPG A;  1FD9 A;  4N19 A;  2MNT A;  1D2K A;  1ZU8 A;  4P8V A;  2O9O A;  1YW5 A;  1GPF A;  3CGN A;  2F21 A;  3H9R B;  3G6L A;  1HJW A;  1ZBW A;  1EYM A;  2VN1 A;  4IT6 A;  1W9P A;  1WAW A;  5JH8 A;  1NWS A;  4BF8 A;  2EUL A;  2Y78 A;  3ARU A;  5HWC A;  1Q6U A;  2OLH A;  1W1Y A;  2DG4 A;  3KAD A;  1P5Q A;  4NZC A;  5D75 A;  4Z2J A;  1LL6 A;  4DRM A;  3AS2 A;  3ARW A;  3UQB A;  3FXY A;  2DG9 A;  1W1T A;  4MNM A;  2RUQ A;  1LL4 A;  1J4R A;  1ZL1 A;  1UR8 A;  3WD0 A;  3EY6 A;  1LJY A;  2O92 A;  1FKS A;  1ITX A;  3LUO A;  3CHF A;  3WD2 A;  2VCD A;  4TW7 A;  4QT2 A;  4JFJ A;  4Z2H A;  3PRD A;  4HAR A;  4WKF A;  4G2P A;  1UR9 A;  4ODM A;  1N1A A;  3KAF A;  1C9H A;  2MPH A;  3AS0 A;  4DWS B;  1NMW A;  1E9L A;  1SR0 A;  3ARY A;  1EIB A;  4JFI A;  1OGB A;  3JYM A;  2KFW A;  2PV3 A;  4MNJ A;  2M2A A;  2ETN A;  3ARQ A;  3PRA A;  1FFR A;  4J4O A;  2B31 A;  1H0G A;  1ZK6 A;  3JXV A;  3UI6 A;  2DT1 A;  2A3B A;  2LKN A;  4ZS6 A;  5DO2 A;  2F4E A;  3WD1 A;  2QF8 A;  5DIT A;  4FN2 A;  1Q6H A;  3RM8 A;  1GRJ A;  1J6Y A;  2K8I A;  4HBO A;  4JFL A;  2DT0 A;  2RSE A;  1LG1 A;  1JND A;  2N87 A;  4GGQ A;  1FAP A;  3KAH A;  1HKJ A;  3O5D A;  4LAX A;  1T11 A;  2DSW A;  3WD4 A;  2A3E A;  2LGO A;  2RUC A;  4L3N A;  3G6M A;  1NMV A;  1XRV A;  4DRH A;  3KAB A;  1CTN A;  1HKK A;  5HW8 A;  1J4I A;  1E6N A;  1W9U A;  4W9P A;  2A3C A;  5J6E A;  4URI A;  1YAT A;  4ODR A;  1LG2 A;  1VF8 A;  3EIP A;  1FKH A;  3ARZ A;  3IKG A;  5HKG A;  4ODL A;  4U86 A;  2ZR4 A;  1LQ0 A;  4ODN A;  1OWQ A;  1XHG A;  4P8U A;  3WD3 A;  4DRJ A;  1F8A B;  2XP3 A;  3CZ8 A;  1ROU A;  1O6I A;  4MSP A;  4WKA A;  2ITK A;  1EDQ A;  1E44 A;  4R0X A;  2WK2 A;  1JNT A;  5HUA A;  1E15 A;  2KE0 A;  3KAG A;  3O5I A;  2RUD A;  3CHD A;  1BL4 A;  1D7J A;  2DSV A;  2ZQS A;  3O5E A;  4S3K A;  4MPK A;  4LAV A;  3B9D A;  4TYO A;  4DIP A;  1H0I A;  1TCO C;  1SYT A;  2WM0 A;  3RM4 A;  1HJX A;  1WB0 A;  3O5P A;  1ZBV A;  3GU0 A;  2F2D A;  2PPN A;  3PRB A;  1KT1 A;  3OOB A;  1BKF A;  1FKR A;  2UZ5 A;  4ML4 A;  2M08 A;  3BXW A;  1HKM A;  2RUR A;  2AWG A;  2FDM A;  2YBU A;  1M5Y A;  1JNE A;  3RGC A;  3VAW A;  3KAC A;  5DIU A;  2XP7 A;  1HJV A;  1FKL A;  4IT4 A;  4AY1 A;  2DT3 A;  4DT4 A;  1QPF A;  3ARO A;  4G50 A;  1E6P A;  2PV1 A;  2XPB A;  4ODK A;  4R5E A;  3TDB A;  1X6L A;  1R9H A;  4JFM A;  3GTY X;  1FKB A;  1PBK A;  3O5M A;  1IX5 A;  3UI4 A;  1D7H A;  1Q6I A;  3ARX A;  3RFW A;  1Y0O A;  1NWU A;  3ARS A;  2MF9 A;  4ODP A;  1GOI A;  2MLX A;  2PPP A;  1JNS A;  3CH9 A;  5HW6 A;  4DRK A;  4MAV A;  4DRI A;  2JZV A;  3TCZ A;  3O5O A;  1ZBK A;  2ESC A;  1KFW A;  1FKK A;  1ZCN A;  2KI3 A;  5I98 A;  4FAP A;  1W26 A;  3ODK A;  2WLZ A;  1QPL A;  3B8S A;  5HWB A;  3IK8 A;  3UI5 A;  3ARV A;  2AOS A;  1A7X A;  1F40 A;  4ODQ A;  5BXJ A;  1TFV A;  2PBC A;  4GIV A;  5DEZ A;  1GUV A;  4WK9 A;  4C02 B;  2ZR5 A;  4MTV A;  4NNR A;  3WQW A;  4DRO A;  2PI6 A;  3RME A;  2M1I A;  3JYJ A;  3PR9 A;  1D6O A;  1RD6 A;  2RQS A;  2KO7 A;  3IHZ A;  1ZBC A; 
#chains in the Genus database with same CATH homology
 5DIV A;  4LAW A;  3ALG A;  3UQA A;  2DPE A;  4DZ3 A;  3NI6 A;  4DH0 A;  4LAY A;  2XP8 A;  1FKF A;  4DRP A;  3RM9 A;  3CHE A;  5HTG A;  1NSG A;  4HBE A;  3OA5 A;  2IUZ A;  3PA7 A;  1FKG A;  4DWS A;  3CHC A;  2IF4 A;  1FKD A;  1FKT A;  2ZQV A;  4DWS C;  3I6C A;  5GPR A;  4IQC A;  2LPV A;  4ZPW R;  3O5Q A;  3WQV A;  4Z2I A;  1OGG A;  1PIN A;  4W5U A;  3AS1 A;  3IKD A;  1EHN A;  1L1P A;  2ZQU A;  3AQU A;  1W9V A;  2ZR6 A;  3B9E A;  3WKZ A;  4KR0 B;  2Q5A A;  3WL1 A;  2KGJ A;  3ARP A;  4DRQ A;  4W9O A;  2L2S A;  5HBF A;  3ARR A;  4QIB A;  4J4N A;  3O5K A;  2DSU A;  2OFN A;  3FAP A;  1NWT A;  2D9F A;  2PPO A;  3O5L A;  3GPK A;  4TNS A;  3O5J A;  3WH0 A;  4P8W A;  4WJX A;  3CGM A;  4KQZ A;  4LGX A;  4ODO A;  2DG3 A;  3MDY B;  4ITZ A;  4O2T A;  2XP6 A;  2G8Z A;  2MLZ A;  1K9T A;  2WLY A;  2XP9 A;  3B7X A;  1X6N A;  1LL7 A;  3O5F A;  3O5R A;  1EQ3 A;  5B8I C;  1ZB5 A;  1E6R A;  3ALF A;  4Z2K A;  4Q7N A;  4TX0 A;  4DWS D;  1NH6 A;  3ART A;  3B9A A;  2DT2 A;  3UQI A;  2FAP A;  4ZPV R;  4JFK A;  4Z2L A;  3NRK A;  3WL0 A;  2DSZ A;  4WKH A;  1E6Z A;  4W9Q A;  4QT3 A;  1HKI A;  1JVW A;  1U79 A;  2XPA A;  4WIW A;  1WNO A;  3O5G A;  2PV2 A;  1J4H A;  1W1P A;  1B6C A;  1KT0 A;  4TW8 A;  3UF8 A;  5DF0 A;  3KZ7 A;  3NTP A;  2FKE A;  1FKJ A;  5HT1 A;  4DZ2 A;  2XP5 A;  1W1V A;  2KR7 A;  2LJ4 A;  4NSB A;  2YBT A;  4Q22 A;  4DRN A;  1D7I A;  3KCE A;  4P8X A;  2ZQT A;  3AS3 A;  1FJD A;  2XP4 A;  4TW6 A;  3W4R A;  1Q1C A;  4QZV B;  4Z2G A;  1NWR A;  4MGV A;  2G41 A;  4MNK A;  4JYS A;  4PTM A;  4U84 A;  1HXV A;  1QZ2 A;  5HW7 A;  4ZPT R;  1FFQ A;  3KAI A;  2MLY A;  3TC5 A;  4IQ2 A;  2A3A A;  1FKI A;  4S3J A;  4MNL A;  3WIJ A;  1ROT A;  3QOK A;  4XAK A;  4L72 B;  3FY1 A;  5GQB A;  4IPX A;  4U85 A;  5GPG A;  1FD9 A;  4N19 A;  2MNT A;  1D2K A;  1ZU8 A;  4P8V A;  2O9O A;  1YW5 A;  1GPF A;  3CGN A;  2F21 A;  3H9R B;  3G6L A;  1HJW A;  1ZBW A;  1EYM A;  2VN1 A;  4IT6 A;  1W9P A;  1WAW A;  5JH8 A;  1NWS A;  4BF8 A;  2Y78 A;  3ARU A;  5HWC A;  1Q6U A;  2OLH A;  1W1Y A;  2DG4 A;  3KAD A;  1P5Q A;  4NZC A;  5D75 A;  4Z2J A;  1LL6 A;  4DRM A;  3AS2 A;  3ARW A;  3UQB A;  3FXY A;  2DG9 A;  1W1T A;  4MNM A;  2RUQ A;  1LL4 A;  1J4R A;  1ZL1 A;  1UR8 A;  3WD0 A;  3EY6 A;  1LJY A;  2O92 A;  1FKS A;  1ITX A;  3LUO A;  3CHF A;  3WD2 A;  2VCD A;  4TW7 A;  4QT2 A;  4JFJ A;  4Z2H A;  3PRD A;  4HAR A;  4WKF A;  4G2P A;  1UR9 A;  4ODM A;  1N1A A;  3KAF A;  1C9H A;  2MPH A;  3AS0 A;  4DWS B;  1NMW A;  1E9L A;  1SR0 A;  3ARY A;  1EIB A;  4JFI A;  1OGB A;  3JYM A;  2KFW A;  2PV3 A;  4MNJ A;  2M2A A;  3ARQ A;  3PRA A;  1FFR A;  4J4O A;  2B31 A;  1H0G A;  1ZK6 A;  3JXV A;  3UI6 A;  2DT1 A;  2A3B A;  2LKN A;  4ZS6 A;  5DO2 A;  2F4E A;  3WD1 A;  2QF8 A;  5DIT A;  4FN2 A;  1Q6H A;  3RM8 A;  1J6Y A;  2K8I A;  4HBO A;  4JFL A;  2DT0 A;  2RSE A;  1LG1 A;  1JND A;  2N87 A;  4GGQ A;  1FAP A;  3KAH A;  1HKJ A;  3O5D A;  4LAX A;  1T11 A;  2DSW A;  3WD4 A;  2A3E A;  2LGO A;  2RUC A;  4L3N A;  3G6M A;  1NMV A;  1XRV A;  4DRH A;  3KAB A;  1CTN A;  1HKK A;  5HW8 A;  1J4I A;  1E6N A;  1W9U A;  4W9P A;  2A3C A;  5J6E A;  4URI A;  1YAT A;  4ODR A;  1LG2 A;  1VF8 A;  1FKH A;  3ARZ A;  3IKG A;  5HKG A;  4ODL A;  4U86 A;  2ZR4 A;  1LQ0 A;  4ODN A;  1OWQ A;  1XHG A;  4P8U A;  3WD3 A;  4DRJ A;  1F8A B;  2XP3 A;  3CZ8 A;  1ROU A;  1O6I A;  4MSP A;  4WKA A;  2ITK A;  1EDQ A;  4R0X A;  2WK2 A;  1JNT A;  5HUA A;  1E15 A;  2KE0 A;  3KAG A;  3O5I A;  2RUD A;  3CHD A;  1BL4 A;  1D7J A;  2DSV A;  2ZQS A;  3O5E A;  4S3K A;  4MPK A;  4LAV A;  3B9D A;  4TYO A;  4DIP A;  1H0I A;  1TCO C;  1SYT A;  2WM0 A;  3RM4 A;  1HJX A;  1WB0 A;  3O5P A;  1ZBV A;  2F2D A;  2PPN A;  3PRB A;  1KT1 A;  3OOB A;  1BKF A;  1FKR A;  2UZ5 A;  4ML4 A;  2M08 A;  3BXW A;  1HKM A;  2RUR A;  2AWG A;  2FDM A;  2YBU A;  1M5Y A;  1JNE A;  3RGC A;  3VAW A;  3KAC A;  5DIU A;  2XP7 A;  1HJV A;  1FKL A;  4IT4 A;  4AY1 A;  2DT3 A;  4DT4 A;  1QPF A;  3ARO A;  4G50 A;  1E6P A;  2PV1 A;  2XPB A;  4ODK A;  4R5E A;  3TDB A;  1X6L A;  1R9H A;  4JFM A;  1FKB A;  1PBK A;  3O5M A;  1IX5 A;  3UI4 A;  1D7H A;  1Q6I A;  3ARX A;  3RFW A;  1Y0O A;  1NWU A;  3ARS A;  2MF9 A;  4ODP A;  1GOI A;  2MLX A;  2PPP A;  1JNS A;  3CH9 A;  5HW6 A;  4DRK A;  4MAV A;  4DRI A;  2JZV A;  3TCZ A;  3O5O A;  1ZBK A;  2ESC A;  1KFW A;  1FKK A;  1ZCN A;  2KI3 A;  5I98 A;  4FAP A;  1W26 A;  3ODK A;  2WLZ A;  1QPL A;  3B8S A;  5HWB A;  3IK8 A;  3UI5 A;  3ARV A;  2AOS A;  1A7X A;  1F40 A;  4ODQ A;  5BXJ A;  1TFV A;  2PBC A;  4GIV A;  5DEZ A;  1GUV A;  4WK9 A;  4C02 B;  2ZR5 A;  4MTV A;  4NNR A;  3WQW A;  4DRO A;  2PI6 A;  3RME A;  2M1I A;  3JYJ A;  3PR9 A;  1D6O A;  1RD6 A;  2RQS A;  2KO7 A;  3IHZ A;  1ZBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...