4DRPA

Evaluation of synthetic fk506 analogs as ligands for the fk506-binding proteins 51 and 52: complex of fkbp51 with 2-(3-((r)-3-(3,4-dimethoxyphenyl)-1-((s)-1-(2-((1r,2s)-2-ethyl-1-hydroxy-cyclohexyl)-2-oxoacetyl)piperidine-2-carbonyloxy)propyl)phenoxy)acetic acid from cocrystallization
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drpA00
4W9QA 2F2DA 2MLZA 4ODRA 4FN2A 5HWCA 1ROTA 4ODPA 1Y0OA 1JVWA 4DIPA 1FKRA 2KFWA 3CGNA 3O5GA 3O5LA 3CGMA 3KACA 2VCDA 5GPGA 4LAYA 1NMVA 1FKJA 3I6CA 4ITZA 4DH0A 2F4EA 5HKGA 3JYMA 4LAVA 2KR7A 1J4HA 3KCEA 4ODKA 1BKFA 3O5PA 3UI4A 2D9FA 1F40A 1Q6UA 4JFJA 3O5JA 2PPNA 2XP8A 4TX0A 3UI6A 4JYSA 1W26A 3KAFA 2XP4A 4G2PA 3O5EA 2N87A 4TNSA 4TW7A 3UQBA 2DG9A 3KABA 2DG3A 3VAWA 1L1PA 3O5QA 3ODKA 5J6EA 3NTPA 4N19A 5DIUA 3UF8A 3RGCA 1BL4A 3IKDA 4MSPA 4ODOA 5HWBA 3RFWA 1D7HA 2PPPA 3IHZA 3O5IA 5DITA 2XP6A 3PRBA 4C02B 4DRHA 1J4IA 1FKFA 1PBKA 3KAIA 1EYMA 4BF8A 2DG4A 5B8IC 1FKDA 3EY6A 1Q1CA 1J6YA 1B6CA 2PV3A 4DRMA 2M08A 4G50A 5HW6A 2LGOA 2MF9A 1FKIA 1M5YA 2LKNA 3B7XA 3O5MA 2LJ4A 3O5DA 1R9HA 3TC5A 4ODQA 3UI5A 4JFLA 2K8IA 4IPXA 1FAPA 1A7XA 4LAWA 3UQAA 3UQIA 2PV2A 3LUOA 4DRPA 3KZ7A 4GGQA 4JFIA 1N1AA 2F21A 2ITKA 3O5KA 4J4NA 2LPVA 4O2TA 4R0XA 2ZQSA 1QPLA 2MLYA 3IK8A 1PINA 1FKKA 2RQSA 1D7JA 2VN1A 3WH0A 4DZ3A 2M1IA 1FJDA 5HW7A 4DRNA 1KT1A 4W9PA 2XP9A 4U86A 4DZ2A 5BXJA 2RURA 1FKTA 3JYJA 1FD9A 2FAPA 1Q6HA 3IKGA 1FKHA 1ROUA 5HW8A 3TDBA 4ODLA 4DRKA 4QT2A 2ZR4A 2ZQVA 3KAHA 1TCOC 3MDYB 4IQCA 4NNRA 2Q5AA 3H9RB 4MGVA 1FKSA 4ODNA 4ODMA 4U85A 1NMWA 4DRIA 4W9OA 5I98A 1FKBA 1D6OA 4JFKA 2L2SA 3O5OA 1F8AB 2KE0A 2RUCA 2PBCA 2MNTA 4TW8A 3TCZA 1C9HA 4DRJA 2Y78A 1QPFA 4TYOA 5HTGA 1T11A 3O5FA 1P5QA 3KAGA 1ZCNA 1NSGA 1D7IA 4U84A 2ZR5A 1JNSA 2XP5A 3PRDA 3NRKA 4QIBA 4DROA 5HUAA 4QT3A 2KO7A 2XP7A 4LAXA 1FKGA 2KGJA 3KADA 2ZR6A 5D75A 2XPBA 1ZK6A 1QZ2A 1YW5A 1J4RA 1Q6IA 1U79A 1EQ3A 3O5RA 2FKEA 2UZ5A 4TW6A 2OFNA 2RUQA 4DT4A 1FKLA 2MLXA 2KI3A 4FAPA 3GPKA 2MPHA 1KT0A 1YATA 2XPAA 2M2AA 3NI6A 1JNTA 2PV1A 3OOBA 2ZQTA 3JXVA 5DIVA 1HXVA 3FAPA 4J4OA 2RUDA 2RSEA 2IF4A 3PA7A 2XP3A 4GIVA 2JZVA 2ZQUA 5HT1A 4IQ2A 4JFMA 2PPOA 2AWGA 4DRQA
chains in the Genus database with same CATH superfamily
2F2DA 5HWCA 3WQVA 2YBTA 1JVWA 2KFWA 2DT3A 5GQBA 4S3KA 3CHCA 3CH9A 1IX5A 2VCDA 4Z2IA 1SYTA 3I6CA 4DH0A 2F4EA 2O9OA 4LAVA 3KCEA 1F40A 2D9FA 1VF8A 4TX0A 1W26A 2XP4A 4G2PA 4TW7A 3KABA 1L1PA 3VAWA 3ODKA 2F23A 3RGCA 4PTMA 1E6PA 5HWBA 3IHZA 5DITA 4WKHA 4DRHA 3CHDA 3KAIA 1EYMA 1NWTA 2DG4A 3ARTA 3FXYA 2PV3A 4DRMA 1OGBA 4P8XA 1HKKA 2LKNA 3O5MA 1R9HA 1O6IA 2P4VA 3BMBA 4ZPWR 4LGXA 4GGQA 2F21A 4KR0B 4O2TA 4R0XA 5GPRA 2WLZA 1D7JA 1GUVA 2M1IA 4NSBA 4W9PA 4DZ2A 1FKTA 1W1TA 3RMEA 4ML4A 3TDBA 1RD6A 5JH8A 4ZS6A 2ZR4A 4IQCA 1H0IA 4U85A 1NMWA 1FKBA 1D6OA 4JFKA 2L2SA 3TCZA 2KE0A 2PBCA 1FFRA 4XAKA 5HTGA 1C9HA 2Y78A 3WL1A 1NSGA 3ARQA 1D7IA 2XP5A 3PRDA 1W1VA 4QIBA 5HUAA 2KO7A 4LAXA 2A3BA 2ZR6A 5DF0A 1ZK6A 4UDMA 1U79A 3ARUA 1HKMA 3AQUA 3CHFA 2DT1A 2KI3A 3BXWA 2YBUA 5DEZA 1CTNA 2XPAA 3WL0A 1JNTA 2PV1A 1HKJA 1HXVA 3FAPA 4J4OA 2RSEA 3PA7A 5HT1A 4JFMA 2ETNA 3KACA 4LAYA 3CZ8A 5HKGA 3JYMA 2KR7A 4ODKA 1BKFA 3UI4A 1Q6UA 2XP8A 3KAFA 3ALFA 2DG9A 3NTPA 1BL4A 3IKDA 3FY1A 4MSPA 1EHNA 1E9LA 3RFWA 2PPPA 3ARRA 3PRBA 1J4IA 4NZCA 4QZVB 3WD3A 1LG2A 1B6CA 1OWQA 3QOKA 1J6YA 2M08A 4G50A 5HW6A 4IT6A 1FKIA 1EDQA 1FAPA 4LAWA 3UQAA 2OLHA 2B5UB 3LUOA 4DRPA 1X6NA 3AS0A 4JFIA 1ITXA 1UR8A 3RM4A 4AY1A 3G6LA 2ITKA 4Q7NA 3IK8A 3WH0A 2RQSA 4DZ3A 1WNOA 3AROA 4DRNA 1D2KA 2RURA 3JYJA 1FD9A 1Q6HA 1FKHA 5HW8A 2DSWA 4DRKA 2A3EA 4MTVA 1TCOC 4MNJA 4Q22A 4NNRA 2Q5AA 2PN0A 3ARVA 3H9RB 4ODNA 5I98A 1NWRA 2G8ZA 3GTYX 4TW8A 3O5OA 4MNMA 4Z2HA 3WD0A 1LL4A 3NRKA 1NWUA 3EIPA 1ZB5A 2KGJA 3ALGA 1EQ3A 2FKEA 1E6NA 1GRJA 1JNDA 3WD1A 1XHGA 1ZU8A 2RUQA 4DT4A 3GPKA 1KT0A 1W9VA 4WIWA 3JXVA 5DIVA 4MAVA 2IF4A 2PI6A 4WJXA 4GIVA 4IQ2A 2PPOA 1NH6A 1W9UA 1W1YA 4DWSB 4FN2A 4ODPA 1Y0OA 3OA5A 4DIPA 3CGNA 3O5LA 5GPGA 4ITZA 4P8WA 1HKIA 2DT0A 2PPNA 3UI6A 3B9DA 3O5EA 4TNSA 3UQBA 1LL7A 2AOSA 3G6MA 2DG3A 1E6RA 3B9EA 3PR9A 4N19A 3W4RA 3UF8A 3ARPA 1ZBKA 3B8SA 4C02B 4BF8A 1ZL1A 1LG1A 3EY6A 2WM0A 2LGOA 2MF9A 1M5YA 3O5DA 3TC5A 3ARXA 2FDMA 4ZPTR 2K8IA 1JNEA 3UQIA 4W5UA 3KZ7A 4HBEA 1OGGA 1QPLA 2MLYA 1FKKA 2VN1A 1SR0A 1FJDA 3CHEA 5HW7A 2XP9A 5BXJA 3RM9A 2DSVA 2FAPA 4S3JA 1ROUA 4ODLA 4MNLA 3WKZA 2WLYA 2ZQVA 3KAHA 3AS2A 4Z2JA 4R5EA 4ODMA 4MGVA 4DRIA 4W9OA 3ARYA 1F8AB 2RUCA 4Z2GA 4DRJA 3O5FA 1P5QA 3KAGA 4Z2KA 2ZR5A 1JNSA 4WK9A 4QT3A 2XP7A 4MPKA 3KADA 2XPBA 1YW5A 3O5RA 2UZ5A 1UR9A 2B31A 4TW6A 4Z2LA 1FFQA 3ARWA 1ZBCA 1FKLA 2MLXA 4P8VA 1LL6A 2M2AA 4L72B 4WKAA 2ZQTA 2RUDA 2JZVA 2ZQUA 1W1PA 2AWGA 4DRQA 4W9QA 2MLZA 4ODRA 4ZPVR 1GPFA 1ROTA 4DWSA 2IUZA 5DO2A 3PRAA 1FKRA 3O5GA 3CGMA 1NMVA 1FKJA 1J4HA 3GU0A 3ARZA 2DPEA 3O5PA 1LQ0A 1XRVA 4JFJA 3O5JA 4JYSA 2ESCA 3AS3A 2N87A 3O5QA 5J6EA 5DIUA 2EULA 4HBOA 4ODOA 1E44A 1D7HA 3O5IA 3WIJA 2XP6A 1PBKA 1FKFA 4MNKA 4KQZA 4WKFA 5B8IC 1FKDA 1Q1CA 1X6LA 5HBFA 3B7XA 1WAWA 2A3CA 2LJ4A 4ODQA 1HJXA 3UI5A 4JFLA 4IPXA 1A7XA 2PV2A 1N1AA 2DT2A 3O5KA 4J4NA 2LPVA 2ZQSA 1PINA 2WK2A 1KT1A 4HARA 4U86A 1W9PA 3IKGA 4QT2A 1E6ZA 3MDYB 2DSUA 2DSZA 1FKSA 4L3NA 2MNTA 4TYOA 1QPFA 1T11A 1ZCNA 3WQWA 4DWSD 4U84A 1EIBA 1ZBWA 4DROA 1FKGA 3B9AA 1WB0A 1HJWA 3ARSA 1KFWA 5D75A 4IT4A 1QZ2A 1GOIA 1J4RA 1Q6IA 3WD4A 1LJYA 1E15A 3WD2A 2O92A 2OFNA 4P8UA 4URIA 4FAPA 2MPHA 3AS1A 1TFVA 1YATA 3NI6A 1H0GA 2G41A 3OOBA 3RM8A 1NWSA 1HJVA 2XP3A 1ZBVA 4DWSC 1JCHB 2A3AA 2QF8A 1K9TA
chains in the Genus database with same CATH topology
2F2DA 5HWCA 3WQVA 2YBTA 1JVWA 2KFWA 2DT3A 5GQBA 4S3KA 3CHCA 3CH9A 1IX5A 2VCDA 4Z2IA 1SYTA 3I6CA 4DH0A 2F4EA 2O9OA 4LAVA 3KCEA 1F40A 2D9FA 1VF8A 4TX0A 1W26A 2XP4A 4G2PA 4TW7A 3KABA 1L1PA 3VAWA 3ODKA 3RGCA 4PTMA 1E6PA 5HWBA 3IHZA 5DITA 4WKHA 4DRHA 3CHDA 3KAIA 1EYMA 1NWTA 2DG4A 3ARTA 3FXYA 2PV3A 4DRMA 1OGBA 4P8XA 1HKKA 2LKNA 3O5MA 1R9HA 1O6IA 4ZPWR 4LGXA 4GGQA 2F21A 4KR0B 4O2TA 4R0XA 5GPRA 2WLZA 1D7JA 1GUVA 2M1IA 4NSBA 4W9PA 4DZ2A 1FKTA 1W1TA 3RMEA 4ML4A 3TDBA 1RD6A 5JH8A 4ZS6A 2ZR4A 4IQCA 1H0IA 4U85A 1NMWA 1FKBA 1D6OA 4JFKA 2L2SA 3TCZA 2KE0A 2PBCA 1FFRA 4XAKA 5HTGA 1C9HA 2Y78A 3WL1A 1NSGA 3ARQA 1D7IA 2XP5A 3PRDA 1W1VA 4QIBA 5HUAA 2KO7A 4LAXA 2A3BA 2ZR6A 5DF0A 1ZK6A 1U79A 3ARUA 1HKMA 3AQUA 3CHFA 2DT1A 2KI3A 3BXWA 2YBUA 5DEZA 1CTNA 2XPAA 3WL0A 1JNTA 2PV1A 1HKJA 1HXVA 3FAPA 4J4OA 2RSEA 3PA7A 5HT1A 4JFMA 3KACA 4LAYA 3CZ8A 5HKGA 3JYMA 2KR7A 4ODKA 1BKFA 3UI4A 1Q6UA 2XP8A 3KAFA 3ALFA 2DG9A 3NTPA 1BL4A 3IKDA 3FY1A 4MSPA 1EHNA 1E9LA 3RFWA 2PPPA 3ARRA 3PRBA 1J4IA 4NZCA 4QZVB 3WD3A 1LG2A 1B6CA 1OWQA 3QOKA 1J6YA 2M08A 4G50A 5HW6A 4IT6A 1FKIA 1EDQA 1FAPA 4LAWA 3UQAA 2OLHA 3LUOA 4DRPA 1X6NA 3AS0A 4JFIA 1ITXA 1UR8A 3RM4A 4AY1A 3G6LA 2ITKA 4Q7NA 3IK8A 3WH0A 2RQSA 4DZ3A 1WNOA 3AROA 4DRNA 1D2KA 2RURA 3JYJA 1FD9A 1Q6HA 1FKHA 5HW8A 2DSWA 4DRKA 2A3EA 4MTVA 1TCOC 4MNJA 4Q22A 4NNRA 2Q5AA 3ARVA 3H9RB 4ODNA 5I98A 1NWRA 2G8ZA 4TW8A 3O5OA 4MNMA 4Z2HA 3WD0A 1LL4A 3NRKA 1NWUA 1ZB5A 2KGJA 3ALGA 1EQ3A 2FKEA 1E6NA 1JNDA 3WD1A 1XHGA 1ZU8A 2RUQA 4DT4A 3GPKA 1KT0A 1W9VA 4WIWA 3JXVA 5DIVA 4MAVA 2IF4A 2PI6A 4WJXA 4GIVA 4IQ2A 2PPOA 1NH6A 1W9UA 1W1YA 4DWSB 4FN2A 4ODPA 1Y0OA 3OA5A 4DIPA 3CGNA 3O5LA 5GPGA 4ITZA 4P8WA 1HKIA 2DT0A 2PPNA 3UI6A 3B9DA 3O5EA 4TNSA 3UQBA 1LL7A 2AOSA 3G6MA 2DG3A 1E6RA 3B9EA 3PR9A 4N19A 3W4RA 3UF8A 3ARPA 1ZBKA 3B8SA 4C02B 4BF8A 1ZL1A 1LG1A 3EY6A 2WM0A 2LGOA 2MF9A 1M5YA 3O5DA 3TC5A 3ARXA 2FDMA 4ZPTR 2K8IA 1JNEA 3UQIA 4W5UA 3KZ7A 4HBEA 1OGGA 1QPLA 2MLYA 1FKKA 2VN1A 1SR0A 1FJDA 3CHEA 5HW7A 2XP9A 5BXJA 3RM9A 2DSVA 2FAPA 4S3JA 1ROUA 4ODLA 4MNLA 3WKZA 2WLYA 2ZQVA 3KAHA 3AS2A 4Z2JA 4R5EA 4ODMA 4MGVA 4DRIA 4W9OA 3ARYA 1F8AB 2RUCA 4Z2GA 4DRJA 3O5FA 1P5QA 3KAGA 4Z2KA 2ZR5A 1JNSA 4WK9A 4QT3A 2XP7A 4MPKA 3KADA 2XPBA 1YW5A 3O5RA 2UZ5A 1UR9A 2B31A 4TW6A 4Z2LA 1FFQA 3ARWA 1ZBCA 1FKLA 2MLXA 4P8VA 1LL6A 2M2AA 4L72B 4WKAA 2ZQTA 2RUDA 2JZVA 2ZQUA 1W1PA 2AWGA 4DRQA 4W9QA 2MLZA 4ODRA 4ZPVR 1GPFA 1ROTA 4DWSA 2IUZA 5DO2A 3PRAA 1FKRA 3O5GA 3CGMA 1NMVA 1FKJA 1J4HA 3ARZA 2DPEA 3O5PA 1LQ0A 1XRVA 4JFJA 3O5JA 4JYSA 2ESCA 3AS3A 2N87A 3O5QA 5J6EA 5DIUA 4HBOA 4ODOA 1D7HA 3O5IA 3WIJA 2XP6A 1PBKA 1FKFA 4MNKA 4KQZA 4WKFA 5B8IC 1FKDA 1Q1CA 1X6LA 5HBFA 3B7XA 1WAWA 2A3CA 2LJ4A 4ODQA 1HJXA 3UI5A 4JFLA 4IPXA 1A7XA 2PV2A 1N1AA 2DT2A 3O5KA 4J4NA 2LPVA 2ZQSA 1PINA 2WK2A 1KT1A 4HARA 4U86A 1W9PA 3IKGA 4QT2A 1E6ZA 3MDYB 2DSUA 2DSZA 1FKSA 4L3NA 2MNTA 4TYOA 1QPFA 1T11A 1ZCNA 3WQWA 4DWSD 4U84A 1EIBA 1ZBWA 4DROA 1FKGA 3B9AA 1WB0A 1HJWA 3ARSA 1KFWA 5D75A 4IT4A 1QZ2A 1GOIA 1J4RA 1Q6IA 3WD4A 1LJYA 1E15A 3WD2A 2O92A 2OFNA 4P8UA 4URIA 4FAPA 2MPHA 3AS1A 1TFVA 1YATA 3NI6A 1H0GA 2G41A 3OOBA 3RM8A 1NWSA 1HJVA 2XP3A 1ZBVA 4DWSC 2A3AA 2QF8A 1K9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9Q A;  2F2D A;  2MLZ A;  4ODR A;  4FN2 A;  5HWC A;  1ROT A;  4ODP A;  1Y0O A;  1JVW A;  4DIP A;  1FKR A;  2KFW A;  3CGN A;  3O5G A;  3O5L A;  3CGM A;  3KAC A;  2VCD A;  5GPG A;  4LAY A;  1NMV A;  1FKJ A;  3I6C A;  4ITZ A;  4DH0 A;  2F4E A;  5HKG A;  3JYM A;  4LAV A;  2KR7 A;  1J4H A;  3KCE A;  4ODK A;  1BKF A;  3O5P A;  3UI4 A;  2D9F A;  1F40 A;  1Q6U A;  4JFJ A;  3O5J A;  2PPN A;  2XP8 A;  4TX0 A;  3UI6 A;  4JYS A;  1W26 A;  3KAF A;  2XP4 A;  4G2P A;  3O5E A;  2N87 A;  4TNS A;  4TW7 A;  3UQB A;  2DG9 A;  3KAB A;  2DG3 A;  3VAW A;  1L1P A;  3O5Q A;  3ODK A;  5J6E A;  3NTP A;  4N19 A;  5DIU A;  3UF8 A;  3RGC A;  1BL4 A;  3IKD A;  4MSP A;  4ODO A;  5HWB A;  3RFW A;  1D7H A;  2PPP A;  3IHZ A;  3O5I A;  5DIT A;  2XP6 A;  3PRB A;  4C02 B;  4DRH A;  1J4I A;  1FKF A;  1PBK A;  3KAI A;  1EYM A;  4BF8 A;  2DG4 A;  5B8I C;  1FKD A;  3EY6 A;  1Q1C A;  1J6Y A;  1B6C A;  2PV3 A;  4DRM A;  2M08 A;  4G50 A;  5HW6 A;  2LGO A;  2MF9 A;  1FKI A;  1M5Y A;  2LKN A;  3B7X A;  3O5M A;  2LJ4 A;  3O5D A;  1R9H A;  3TC5 A;  4ODQ A;  3UI5 A;  4JFL A;  2K8I A;  4IPX A;  1FAP A;  1A7X A;  4LAW A;  3UQA A;  3UQI A;  2PV2 A;  3LUO A;  4DRP A;  3KZ7 A;  4GGQ A;  4JFI A;  1N1A A;  2F21 A;  2ITK A;  3O5K A;  4J4N A;  2LPV A;  4O2T A;  4R0X A;  2ZQS A;  1QPL A;  2MLY A;  3IK8 A;  1PIN A;  1FKK A;  2RQS A;  1D7J A;  2VN1 A;  3WH0 A;  4DZ3 A;  2M1I A;  1FJD A;  5HW7 A;  4DRN A;  1KT1 A;  4W9P A;  2XP9 A;  4U86 A;  4DZ2 A;  5BXJ A;  2RUR A;  1FKT A;  3JYJ A;  1FD9 A;  2FAP A;  1Q6H A;  3IKG A;  1FKH A;  1ROU A;  5HW8 A;  3TDB A;  4ODL A;  4DRK A;  4QT2 A;  2ZR4 A;  2ZQV A;  3KAH A;  1TCO C;  3MDY B;  4IQC A;  4NNR A;  2Q5A A;  3H9R B;  4MGV A;  1FKS A;  4ODN A;  4ODM A;  4U85 A;  1NMW A;  4DRI A;  4W9O A;  5I98 A;  1FKB A;  1D6O A;  4JFK A;  2L2S A;  3O5O A;  1F8A B;  2KE0 A;  2RUC A;  2PBC A;  2MNT A;  4TW8 A;  3TCZ A;  1C9H A;  4DRJ A;  2Y78 A;  1QPF A;  4TYO A;  5HTG A;  1T11 A;  3O5F A;  1P5Q A;  3KAG A;  1ZCN A;  1NSG A;  1D7I A;  4U84 A;  2ZR5 A;  1JNS A;  2XP5 A;  3PRD A;  3NRK A;  4QIB A;  4DRO A;  5HUA A;  4QT3 A;  2KO7 A;  2XP7 A;  4LAX A;  1FKG A;  2KGJ A;  3KAD A;  2ZR6 A;  5D75 A;  2XPB A;  1ZK6 A;  1QZ2 A;  1YW5 A;  1J4R A;  1Q6I A;  1U79 A;  1EQ3 A;  3O5R A;  2FKE A;  2UZ5 A;  4TW6 A;  2OFN A;  2RUQ A;  4DT4 A;  1FKL A;  2MLX A;  2KI3 A;  4FAP A;  3GPK A;  2MPH A;  1KT0 A;  1YAT A;  2XPA A;  2M2A A;  3NI6 A;  1JNT A;  2PV1 A;  3OOB A;  2ZQT A;  3JXV A;  5DIV A;  1HXV A;  3FAP A;  4J4O A;  2RUD A;  2RSE A;  2IF4 A;  3PA7 A;  2XP3 A;  4GIV A;  2JZV A;  2ZQU A;  5HT1 A;  4IQ2 A;  4JFM A;  2PPO A;  2AWG A;  4DRQ A; 
#chains in the Genus database with same CATH topology
 2F2D A;  5HWC A;  3WQV A;  2YBT A;  1JVW A;  2KFW A;  2DT3 A;  5GQB A;  4S3K A;  3CHC A;  3CH9 A;  1IX5 A;  2VCD A;  4Z2I A;  1SYT A;  3I6C A;  4DH0 A;  2F4E A;  2O9O A;  4LAV A;  3KCE A;  1F40 A;  2D9F A;  1VF8 A;  4TX0 A;  1W26 A;  2XP4 A;  4G2P A;  4TW7 A;  3KAB A;  1L1P A;  3VAW A;  3ODK A;  2F23 A;  3RGC A;  4PTM A;  1E6P A;  5HWB A;  3IHZ A;  5DIT A;  4WKH A;  4DRH A;  3CHD A;  3KAI A;  1EYM A;  1NWT A;  2DG4 A;  3ART A;  3FXY A;  2PV3 A;  4DRM A;  1OGB A;  4P8X A;  1HKK A;  2LKN A;  3O5M A;  1R9H A;  1O6I A;  2P4V A;  3BMB A;  4ZPW R;  4LGX A;  4GGQ A;  2F21 A;  4KR0 B;  4O2T A;  4R0X A;  5GPR A;  2WLZ A;  1D7J A;  1GUV A;  2M1I A;  4NSB A;  4W9P A;  4DZ2 A;  1FKT A;  1W1T A;  3RME A;  4ML4 A;  3TDB A;  1RD6 A;  5JH8 A;  4ZS6 A;  2ZR4 A;  4IQC A;  1H0I A;  4U85 A;  1NMW A;  1FKB A;  1D6O A;  4JFK A;  2L2S A;  3TCZ A;  2KE0 A;  2PBC A;  1FFR A;  4XAK A;  5HTG A;  1C9H A;  2Y78 A;  3WL1 A;  1NSG A;  3ARQ A;  1D7I A;  2XP5 A;  3PRD A;  1W1V A;  4QIB A;  5HUA A;  2KO7 A;  4LAX A;  2A3B A;  2ZR6 A;  5DF0 A;  1ZK6 A;  4UDM A;  1U79 A;  3ARU A;  1HKM A;  3AQU A;  3CHF A;  2DT1 A;  2KI3 A;  3BXW A;  2YBU A;  5DEZ A;  1CTN A;  2XPA A;  3WL0 A;  1JNT A;  2PV1 A;  1HKJ A;  1HXV A;  3FAP A;  4J4O A;  2RSE A;  3PA7 A;  5HT1 A;  4JFM A;  2ETN A;  3KAC A;  4LAY A;  3CZ8 A;  5HKG A;  3JYM A;  2KR7 A;  4ODK A;  1BKF A;  3UI4 A;  1Q6U A;  2XP8 A;  3KAF A;  3ALF A;  2DG9 A;  3NTP A;  1BL4 A;  3IKD A;  3FY1 A;  4MSP A;  1EHN A;  1E9L A;  3RFW A;  2PPP A;  3ARR A;  3PRB A;  1J4I A;  4NZC A;  4QZV B;  3WD3 A;  1LG2 A;  1B6C A;  1OWQ A;  3QOK A;  1J6Y A;  2M08 A;  4G50 A;  5HW6 A;  4IT6 A;  1FKI A;  1EDQ A;  1FAP A;  4LAW A;  3UQA A;  2OLH A;  2B5U B;  3LUO A;  4DRP A;  1X6N A;  3AS0 A;  4JFI A;  1ITX A;  1UR8 A;  3RM4 A;  4AY1 A;  3G6L A;  2ITK A;  4Q7N A;  3IK8 A;  3WH0 A;  2RQS A;  4DZ3 A;  1WNO A;  3ARO A;  4DRN A;  1D2K A;  2RUR A;  3JYJ A;  1FD9 A;  1Q6H A;  1FKH A;  5HW8 A;  2DSW A;  4DRK A;  2A3E A;  4MTV A;  1TCO C;  4MNJ A;  4Q22 A;  4NNR A;  2Q5A A;  2PN0 A;  3ARV A;  3H9R B;  4ODN A;  5I98 A;  1NWR A;  2G8Z A;  3GTY X;  4TW8 A;  3O5O A;  4MNM A;  4Z2H A;  3WD0 A;  1LL4 A;  3NRK A;  1NWU A;  3EIP A;  1ZB5 A;  2KGJ A;  3ALG A;  1EQ3 A;  2FKE A;  1E6N A;  1GRJ A;  1JND A;  3WD1 A;  1XHG A;  1ZU8 A;  2RUQ A;  4DT4 A;  3GPK A;  1KT0 A;  1W9V A;  4WIW A;  3JXV A;  5DIV A;  4MAV A;  2IF4 A;  2PI6 A;  4WJX A;  4GIV A;  4IQ2 A;  2PPO A;  1NH6 A;  1W9U A;  1W1Y A;  4DWS B;  4FN2 A;  4ODP A;  1Y0O A;  3OA5 A;  4DIP A;  3CGN A;  3O5L A;  5GPG A;  4ITZ A;  4P8W A;  1HKI A;  2DT0 A;  2PPN A;  3UI6 A;  3B9D A;  3O5E A;  4TNS A;  3UQB A;  1LL7 A;  2AOS A;  3G6M A;  2DG3 A;  1E6R A;  3B9E A;  3PR9 A;  4N19 A;  3W4R A;  3UF8 A;  3ARP A;  1ZBK A;  3B8S A;  4C02 B;  4BF8 A;  1ZL1 A;  1LG1 A;  3EY6 A;  2WM0 A;  2LGO A;  2MF9 A;  1M5Y A;  3O5D A;  3TC5 A;  3ARX A;  2FDM A;  4ZPT R;  2K8I A;  1JNE A;  3UQI A;  4W5U A;  3KZ7 A;  4HBE A;  1OGG A;  1QPL A;  2MLY A;  1FKK A;  2VN1 A;  1SR0 A;  1FJD A;  3CHE A;  5HW7 A;  2XP9 A;  5BXJ A;  3RM9 A;  2DSV A;  2FAP A;  4S3J A;  1ROU A;  4ODL A;  4MNL A;  3WKZ A;  2WLY A;  2ZQV A;  3KAH A;  3AS2 A;  4Z2J A;  4R5E A;  4ODM A;  4MGV A;  4DRI A;  4W9O A;  3ARY A;  1F8A B;  2RUC A;  4Z2G A;  4DRJ A;  3O5F A;  1P5Q A;  3KAG A;  4Z2K A;  2ZR5 A;  1JNS A;  4WK9 A;  4QT3 A;  2XP7 A;  4MPK A;  3KAD A;  2XPB A;  1YW5 A;  3O5R A;  2UZ5 A;  1UR9 A;  2B31 A;  4TW6 A;  4Z2L A;  1FFQ A;  3ARW A;  1ZBC A;  1FKL A;  2MLX A;  4P8V A;  1LL6 A;  2M2A A;  4L72 B;  4WKA A;  2ZQT A;  2RUD A;  2JZV A;  2ZQU A;  1W1P A;  2AWG A;  4DRQ A;  4W9Q A;  2MLZ A;  4ODR A;  4ZPV R;  1GPF A;  1ROT A;  4DWS A;  2IUZ A;  5DO2 A;  3PRA A;  1FKR A;  3O5G A;  3CGM A;  1NMV A;  1FKJ A;  1J4H A;  3GU0 A;  3ARZ A;  2DPE A;  3O5P A;  1LQ0 A;  1XRV A;  4JFJ A;  3O5J A;  4JYS A;  2ESC A;  3AS3 A;  2N87 A;  3O5Q A;  5J6E A;  5DIU A;  2EUL A;  4HBO A;  4ODO A;  1E44 A;  1D7H A;  3O5I A;  3WIJ A;  2XP6 A;  1PBK A;  1FKF A;  4MNK A;  4KQZ A;  4WKF A;  5B8I C;  1FKD A;  1Q1C A;  1X6L A;  5HBF A;  3B7X A;  1WAW A;  2A3C A;  2LJ4 A;  4ODQ A;  1HJX A;  3UI5 A;  4JFL A;  4IPX A;  1A7X A;  2PV2 A;  1N1A A;  2DT2 A;  3O5K A;  4J4N A;  2LPV A;  2ZQS A;  1PIN A;  2WK2 A;  1KT1 A;  4HAR A;  4U86 A;  1W9P A;  3IKG A;  4QT2 A;  1E6Z A;  3MDY B;  2DSU A;  2DSZ A;  1FKS A;  4L3N A;  2MNT A;  4TYO A;  1QPF A;  1T11 A;  1ZCN A;  3WQW A;  4DWS D;  4U84 A;  1EIB A;  1ZBW A;  4DRO A;  1FKG A;  3B9A A;  1WB0 A;  1HJW A;  3ARS A;  1KFW A;  5D75 A;  4IT4 A;  1QZ2 A;  1GOI A;  1J4R A;  1Q6I A;  3WD4 A;  1LJY A;  1E15 A;  3WD2 A;  2O92 A;  2OFN A;  4P8U A;  4URI A;  4FAP A;  2MPH A;  3AS1 A;  1TFV A;  1YAT A;  3NI6 A;  1H0G A;  2G41 A;  3OOB A;  3RM8 A;  1NWS A;  1HJV A;  2XP3 A;  1ZBV A;  4DWS C;  1JCH B;  2A3A A;  2QF8 A;  1K9T A; 
#chains in the Genus database with same CATH homology
 2F2D A;  5HWC A;  3WQV A;  2YBT A;  1JVW A;  2KFW A;  2DT3 A;  5GQB A;  4S3K A;  3CHC A;  3CH9 A;  1IX5 A;  2VCD A;  4Z2I A;  1SYT A;  3I6C A;  4DH0 A;  2F4E A;  2O9O A;  4LAV A;  3KCE A;  1F40 A;  2D9F A;  1VF8 A;  4TX0 A;  1W26 A;  2XP4 A;  4G2P A;  4TW7 A;  3KAB A;  1L1P A;  3VAW A;  3ODK A;  3RGC A;  4PTM A;  1E6P A;  5HWB A;  3IHZ A;  5DIT A;  4WKH A;  4DRH A;  3CHD A;  3KAI A;  1EYM A;  1NWT A;  2DG4 A;  3ART A;  3FXY A;  2PV3 A;  4DRM A;  1OGB A;  4P8X A;  1HKK A;  2LKN A;  3O5M A;  1R9H A;  1O6I A;  4ZPW R;  4LGX A;  4GGQ A;  2F21 A;  4KR0 B;  4O2T A;  4R0X A;  5GPR A;  2WLZ A;  1D7J A;  1GUV A;  2M1I A;  4NSB A;  4W9P A;  4DZ2 A;  1FKT A;  1W1T A;  3RME A;  4ML4 A;  3TDB A;  1RD6 A;  5JH8 A;  4ZS6 A;  2ZR4 A;  4IQC A;  1H0I A;  4U85 A;  1NMW A;  1FKB A;  1D6O A;  4JFK A;  2L2S A;  3TCZ A;  2KE0 A;  2PBC A;  1FFR A;  4XAK A;  5HTG A;  1C9H A;  2Y78 A;  3WL1 A;  1NSG A;  3ARQ A;  1D7I A;  2XP5 A;  3PRD A;  1W1V A;  4QIB A;  5HUA A;  2KO7 A;  4LAX A;  2A3B A;  2ZR6 A;  5DF0 A;  1ZK6 A;  1U79 A;  3ARU A;  1HKM A;  3AQU A;  3CHF A;  2DT1 A;  2KI3 A;  3BXW A;  2YBU A;  5DEZ A;  1CTN A;  2XPA A;  3WL0 A;  1JNT A;  2PV1 A;  1HKJ A;  1HXV A;  3FAP A;  4J4O A;  2RSE A;  3PA7 A;  5HT1 A;  4JFM A;  3KAC A;  4LAY A;  3CZ8 A;  5HKG A;  3JYM A;  2KR7 A;  4ODK A;  1BKF A;  3UI4 A;  1Q6U A;  2XP8 A;  3KAF A;  3ALF A;  2DG9 A;  3NTP A;  1BL4 A;  3IKD A;  3FY1 A;  4MSP A;  1EHN A;  1E9L A;  3RFW A;  2PPP A;  3ARR A;  3PRB A;  1J4I A;  4NZC A;  4QZV B;  3WD3 A;  1LG2 A;  1B6C A;  1OWQ A;  3QOK A;  1J6Y A;  2M08 A;  4G50 A;  5HW6 A;  4IT6 A;  1FKI A;  1EDQ A;  1FAP A;  4LAW A;  3UQA A;  2OLH A;  3LUO A;  4DRP A;  1X6N A;  3AS0 A;  4JFI A;  1ITX A;  1UR8 A;  3RM4 A;  4AY1 A;  3G6L A;  2ITK A;  4Q7N A;  3IK8 A;  3WH0 A;  2RQS A;  4DZ3 A;  1WNO A;  3ARO A;  4DRN A;  1D2K A;  2RUR A;  3JYJ A;  1FD9 A;  1Q6H A;  1FKH A;  5HW8 A;  2DSW A;  4DRK A;  2A3E A;  4MTV A;  1TCO C;  4MNJ A;  4Q22 A;  4NNR A;  2Q5A A;  3ARV A;  3H9R B;  4ODN A;  5I98 A;  1NWR A;  2G8Z A;  4TW8 A;  3O5O A;  4MNM A;  4Z2H A;  3WD0 A;  1LL4 A;  3NRK A;  1NWU A;  1ZB5 A;  2KGJ A;  3ALG A;  1EQ3 A;  2FKE A;  1E6N A;  1JND A;  3WD1 A;  1XHG A;  1ZU8 A;  2RUQ A;  4DT4 A;  3GPK A;  1KT0 A;  1W9V A;  4WIW A;  3JXV A;  5DIV A;  4MAV A;  2IF4 A;  2PI6 A;  4WJX A;  4GIV A;  4IQ2 A;  2PPO A;  1NH6 A;  1W9U A;  1W1Y A;  4DWS B;  4FN2 A;  4ODP A;  1Y0O A;  3OA5 A;  4DIP A;  3CGN A;  3O5L A;  5GPG A;  4ITZ A;  4P8W A;  1HKI A;  2DT0 A;  2PPN A;  3UI6 A;  3B9D A;  3O5E A;  4TNS A;  3UQB A;  1LL7 A;  2AOS A;  3G6M A;  2DG3 A;  1E6R A;  3B9E A;  3PR9 A;  4N19 A;  3W4R A;  3UF8 A;  3ARP A;  1ZBK A;  3B8S A;  4C02 B;  4BF8 A;  1ZL1 A;  1LG1 A;  3EY6 A;  2WM0 A;  2LGO A;  2MF9 A;  1M5Y A;  3O5D A;  3TC5 A;  3ARX A;  2FDM A;  4ZPT R;  2K8I A;  1JNE A;  3UQI A;  4W5U A;  3KZ7 A;  4HBE A;  1OGG A;  1QPL A;  2MLY A;  1FKK A;  2VN1 A;  1SR0 A;  1FJD A;  3CHE A;  5HW7 A;  2XP9 A;  5BXJ A;  3RM9 A;  2DSV A;  2FAP A;  4S3J A;  1ROU A;  4ODL A;  4MNL A;  3WKZ A;  2WLY A;  2ZQV A;  3KAH A;  3AS2 A;  4Z2J A;  4R5E A;  4ODM A;  4MGV A;  4DRI A;  4W9O A;  3ARY A;  1F8A B;  2RUC A;  4Z2G A;  4DRJ A;  3O5F A;  1P5Q A;  3KAG A;  4Z2K A;  2ZR5 A;  1JNS A;  4WK9 A;  4QT3 A;  2XP7 A;  4MPK A;  3KAD A;  2XPB A;  1YW5 A;  3O5R A;  2UZ5 A;  1UR9 A;  2B31 A;  4TW6 A;  4Z2L A;  1FFQ A;  3ARW A;  1ZBC A;  1FKL A;  2MLX A;  4P8V A;  1LL6 A;  2M2A A;  4L72 B;  4WKA A;  2ZQT A;  2RUD A;  2JZV A;  2ZQU A;  1W1P A;  2AWG A;  4DRQ A;  4W9Q A;  2MLZ A;  4ODR A;  4ZPV R;  1GPF A;  1ROT A;  4DWS A;  2IUZ A;  5DO2 A;  3PRA A;  1FKR A;  3O5G A;  3CGM A;  1NMV A;  1FKJ A;  1J4H A;  3ARZ A;  2DPE A;  3O5P A;  1LQ0 A;  1XRV A;  4JFJ A;  3O5J A;  4JYS A;  2ESC A;  3AS3 A;  2N87 A;  3O5Q A;  5J6E A;  5DIU A;  4HBO A;  4ODO A;  1D7H A;  3O5I A;  3WIJ A;  2XP6 A;  1PBK A;  1FKF A;  4MNK A;  4KQZ A;  4WKF A;  5B8I C;  1FKD A;  1Q1C A;  1X6L A;  5HBF A;  3B7X A;  1WAW A;  2A3C A;  2LJ4 A;  4ODQ A;  1HJX A;  3UI5 A;  4JFL A;  4IPX A;  1A7X A;  2PV2 A;  1N1A A;  2DT2 A;  3O5K A;  4J4N A;  2LPV A;  2ZQS A;  1PIN A;  2WK2 A;  1KT1 A;  4HAR A;  4U86 A;  1W9P A;  3IKG A;  4QT2 A;  1E6Z A;  3MDY B;  2DSU A;  2DSZ A;  1FKS A;  4L3N A;  2MNT A;  4TYO A;  1QPF A;  1T11 A;  1ZCN A;  3WQW A;  4DWS D;  4U84 A;  1EIB A;  1ZBW A;  4DRO A;  1FKG A;  3B9A A;  1WB0 A;  1HJW A;  3ARS A;  1KFW A;  5D75 A;  4IT4 A;  1QZ2 A;  1GOI A;  1J4R A;  1Q6I A;  3WD4 A;  1LJY A;  1E15 A;  3WD2 A;  2O92 A;  2OFN A;  4P8U A;  4URI A;  4FAP A;  2MPH A;  3AS1 A;  1TFV A;  1YAT A;  3NI6 A;  1H0G A;  2G41 A;  3OOB A;  3RM8 A;  1NWS A;  1HJV A;  2XP3 A;  1ZBV A;  4DWS C;  2A3A A;  2QF8 A;  1K9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...