4DRPA

Evaluation of synthetic fk506 analogs as ligands for the fk506-binding proteins 51 and 52: complex of fkbp51 with 2-(3-((r)-3-(3,4-dimethoxyphenyl)-1-((s)-1-(2-((1r,2s)-2-ethyl-1-hydroxy-cyclohexyl)-2-oxoacetyl)piperidine-2-carbonyloxy)propyl)phenoxy)acetic acid from cocrystallization
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drpA00
4NNRA 2XP7A 3JYJA 3O5GA 1FKDA 2LGOA 4JFJA 4DIPA 4TW8A 3O5OA 3KADA 3PA7A 1J6YA 3O5IA 2DG4A 1J4HA 2XPBA 1ZCNA 1FKJA 1QPLA 4DRMA 4TW6A 3TDBA 3MDYB 4ODOA 1C9HA 1ZK6A 4LAXA 3UI6A 4DRNA 2KFWA 3B7XA 4JFMA 4C02B 1FKTA 1PBKA 2F4EA 2OFNA 3O5JA 1ROTA 1W26A 4IQ2A 5GPGA 3TC5A 3VAWA 3KCEA 4W9QA 1FD9A 3O5RA 3KAIA 4QIBA 1JNSA 3KZ7A 4U84A 2XPAA 1J4IA 5HWCA 4J4NA 2RSEA 4QT3A 4BF8A 4DT4A 4DZ3A 2KI3A 4LAWA 2Y78A 2DG9A 4MSPA 2MNTA 1JNTA 2XP3A 2MLXA 4ODQA 2LKNA 2XP4A 3JXVA 1N1AA 3OOBA 4ODKA 5BXJA 3JYMA 1J4RA 1QZ2A 1P5QA 1F8AB 2ZQUA 3O5DA 4TW7A 4G2PA 4DRPA 3UQBA 1EQ3A 1FJDA 1D7JA 2MPHA 4TNSA 5HWBA 2MF9A 2XP8A 3I6CA 4G50A 1Q6HA 4GGQA 3O5QA 3O5MA 3O5EA 3O5LA 3WH0A 4JYSA 2ITKA 2PV1A 2IF4A 2VCDA 4TYOA 3PRBA 2PPOA 2PPPA 1KT1A 1BL4A 2PV3A 3KACA 3NI6A 5HT1A 1T11A 4GIVA 4DZ2A 3KABA 2K8IA 5HW8A 2KR7A 4ODPA 3GPKA 4ODRA 4FAPA 1NMWA 2KE0A 5I98A 2AWGA 1FKGA 2L2SA 2FAPA 4DRJA 5HW6A 1M5YA 2M2AA 1Q1CA 1FKLA 2MLZA 4R0XA 2DG3A 4N19A 2MLYA 2ZQVA 4ITZA 5HTGA 1YATA 4DRQA 5B8IC 2UZ5A 3KAGA 5D75A 2VN1A 2RUDA 2ZQTA 4TX0A 4W9OA 4MGVA 1U79A 3FAPA 5DIUA 5DIVA 2FKEA 3RGCA 4O2TA 2PV2A 3UI5A 2LPVA 3CGMA 1D7IA 4DRHA 3H9RB 4JFIA 2JZVA 4W9PA 3UF8A 5HKGA 3O5PA 3O5KA 3O5FA 1Q6UA 1NMVA 4JFLA 1FKRA 2RUQA 5HUAA 4DRKA 4LAYA 4J4OA 4DROA 1FKFA 1TCOC 5DITA 1Q6IA 3ODKA 1R9HA 3CGNA 3UQIA 4IQCA 2ZR6A 3NRKA 2RQSA 2RUCA 3PRDA 4FN2A 3IKGA 1KT0A 2PPNA 1Y0OA 4ODMA 3IHZA 1JVWA 1D7HA 1ROUA 2XP5A 1FKKA 2XP9A 2D9FA 2KGJA 3EY6A 4JFKA 3UI4A 5J6EA 1L1PA 2XP6A 1FKHA 4LAVA 4DH0A 1FAPA 4ODLA 1D6OA 2M08A 2ZR5A 2KO7A 3KAFA 4DRIA 1F40A 3IKDA 1HXVA 4U86A 2F21A 3UQAA 3NTPA 3TCZA 5HW7A 2ZR4A 1A7XA 1FKBA 1PINA 1EYMA 2F2DA 1FKSA 2RURA 1BKFA 4ODNA 4U85A 3IK8A 3RFWA 1B6CA 1FKIA 2M1IA 2N87A 3LUOA 4IPXA 2Q5AA 2LJ4A 2ZQSA 2PBCA 1YW5A 3KAHA 1QPFA 1NSGA 4QT2A
chains in the Genus database with same CATH superfamily
4NNRA 3O5GA 1W1VA 2DSUA 2LGOA 3O5OA 4Z2JA 3PA7A 4HARA 1LG2A 2ETNA 3MDYB 4ODOA 4WK9A 4JFMA 4C02B 1D2KA 1LJYA 2OLHA 2F4EA 3TC5A 4KQZA 3KCEA 3O5RA 3KZ7A 4U84A 3WQWA 2XPAA 1ZBWA 2DT1A 5DO2A 4QT3A 2KI3A 4LAWA 2LKNA 3JXVA 3O5DA 4DRPA 4WJXA 4G2PA 4TNSA 4DWSC 4G50A 3O5QA 1H0GA 2IUZA 3WH0A 4UDMA 1TFVA 2PPPA 3KACA 4L3NA 2B5UB 1T11A 4DZ2A 1OWQA 3OA5A 1W1PA 4PTMA 4ODPA 3ARXA 4URIA 4MNJA 4FAPA 1NMWA 2KE0A 5I98A 1FKGA 3RMEA 2L2SA 2FDMA 1Q1CA 2A3AA 4ZS6A 3RM9A 1KFWA 5GQBA 3AS2A 4DRQA 5B8IC 1UR9A 3GU0A 3KAGA 2ZQTA 1RD6A 3BMBA 4Q22A 4WKAA 1WAWA 5DIUA 2PV2A 4NZCA 3QOKA 3ARPA 2P4VA 1NMVA 4JFLA 4WKFA 1JNEA 1W9UA 4J4OA 4DROA 3UQIA 3CGNA 2DSWA 2ZR6A 2WLZA 4FN2A 3IKGA 1KT0A 1Y0OA 4ODMA 1JVWA 1D7HA 1ROUA 3CHCA 1SYTA 2WM0A 4P8XA 2XP6A 1WNOA 3B9DA 1FAPA 1WB0A 3WD2A 3G6MA 2KO7A 4MPKA 3UQAA 3NTPA 1A7XA 2F2DA 1LL4A 1NWRA 4U85A 3CZ8A 1B6CA 2M1IA 3LUOA 1YW5A 3KAHA 1FFRA 1NSGA 3WD1A 2XP7A 1J6YA 4ML4A 3KADA 1ZL1A 1GOIA 3UI6A 4DRNA 1PBKA 2OFNA 5GPGA 1W26A 2G41A 3VAWA 4W9QA 1FD9A 1X6LA 1JNSA 4J4NA 1HKJA 2RSEA 3FXYA 3ARQA 4DT4A 2PI6A 4DZ3A 1JNTA 2XP3A 4ODQA 1HJVA 1FKRA 3FY1A 1E6ZA 4LGXA 1IX5A 1FJDA 1D7JA 5HWBA 2DSZA 2MF9A 1FFQA 1Q6HA 4JYSA 2ITKA 2IF4A 2VCDA 3ARRA 4TYOA 5HT1A 2KR7A 1LG1A 2DT3A 1ZB5A 2AWGA 2WK2A 5HW6A 1HKMA 3AS0A 4N19A 2UZ5A 4Q7NA 2VN1A 1OGBA 4W9OA 4ZPVR 1U79A 1D7IA 4DRHA 1E6NA 3H9RB 3UF8A 3O5PA 1EHNA 3PR9A 1NWTA 5HUAA 1HJWA 3WIJA 1JNDA 1R9HA 4IQCA 3PRDA 2RQSA 1GUVA 2RUCA 3AROA 4MAVA 3IHZA 2XP5A 1FKKA 4KR0B 5J6EA 1UR8A 5JH8A 1SR0A 4LAVA 4DH0A 3CHEA 3B9AA 1E15A 2M08A 3KAFA 3IKDA 1ZBKA 1HXVA 1K9TA 5HW7A 2ZR4A 5DEZA 2A3CA 1FKSA 3IK8A 3RFWA 4IPXA 2Q5AA 3WD3A 2LJ4A 2ESCA 4QT2A 3AS1A 3ARYA 1FKDA 4DIPA 4TW8A 2DG4A 2XPBA 1ZCNA 1FKJA 3TDBA 1ZK6A 4LAXA 2F23A 1GRJA 3ALGA 3CHFA 1E9LA 3KAIA 4QIBA 4Z2HA 1J4IA 5HWCA 1HJXA 3AQUA 4BF8A 1ZBCA 1E6PA 4MSPA 2DG9A 3ARTA 2MNTA 4ODKA 5BXJA 2YBTA 3JYMA 4TW7A 4XAKA 1NWSA 3B8SA 2MPHA 2YBUA 2B31A 2XP8A 3I6CA 1W9VA 3O5EA 4Z2LA 3PRBA 1LL6A 2PV3A 1BL4A 3NI6A 2G8ZA 4DWSB 1OGGA 2O9OA 5HW8A 3GPKA 4AY1A 4ODRA 2A3BA 1NH6A 2DSVA 2FAPA 1M5YA 2M2AA 1FKLA 2A3EA 4R0XA 2DG3A 2MLYA 4ITZA 1YATA 4TX0A 4L72B 4MGVA 1NWUA 5DIVA 2FKEA 3RGCA 1LL7A 3WKZA 4HBOA 1ZBVA 1E6RA 2JZVA 4JFIA 3O5FA 2RUQA 4ZPWR 4Z2IA 4LAYA 1FKFA 4S3KA 1TCOC 5DITA 1Q6IA 3PRAA 2PPNA 4MTVA 1EIBA 2XP9A 2D9FA 3EY6A 4JFKA 3UI4A 1L1PA 3ALFA 1ZU8A 1FKHA 4DWSD 1LQ0A 3GTYX 4MNKA 2PN0A 3CH9A 1F40A 2F21A 1E44A 1FKBA 1PINA 2RURA 3ARZA 1BKFA 4WKHA 1FKIA 2ZQSA 4DWSA 1QPFA 1W1TA 1EDQA 3JYJA 4JFJA 3EIPA 3O5IA 3CHDA 1J4HA 1QPLA 4DRMA 3WD4A 4TW6A 1C9HA 2KFWA 3B7XA 4IT6A 1FKTA 3WL0A 3O5JA 1ROTA 4IQ2A 1GPFA 1O6IA 3G6LA 4P8WA 4Z2KA 2DT2A 3ARSA 2Y78A 4P8VA 4MNLA 2MLXA 2XP4A 2EULA 3OOBA 1N1AA 3RM4A 3WL1A 1J4RA 1QZ2A 1P5QA 1F8AB 2ZQUA 1EQ3A 3UQBA 1VF8A 4HBEA 3AS3A 2O92A 2DPEA 4GGQA 3O5MA 3O5LA 2PV1A 1HKIA 4ZPTR 2PPOA 1KT1A 3B9EA 4WIWA 4GIVA 1ITXA 3ARWA 3KABA 3WQVA 3WD0A 4DRJA 3ARUA 2MLZA 5HTGA 2ZQVA 2WLYA 5D75A 2RUDA 5HBFA 3FAPA 1X6NA 4O2TA 3UI5A 2LPVA 3CGMA 4W9PA 2QF8A 5HKGA 3ARVA 3O5KA 1Q6UA 4S3JA 1JCHB 4W5UA 4DRKA 1CTNA 3ODKA 3NRKA 4P8UA 5GPRA 2AOSA 1W1YA 2KGJA 4NSBA 1W9PA 4MNMA 4ODLA 1D6OA 2ZR5A 3BXWA 4QZVB 5DF0A 1XHGA 4DRIA 4IT4A 4U86A 3TCZA 3W4RA 1HKKA 1EYMA 4ODNA 2DT0A 4R5EA 3RM8A 2N87A 4Z2GA 2PBCA 2K8IA 1H0IA 1XRVA
chains in the Genus database with same CATH topology
4NNRA 3O5GA 1W1VA 2DSUA 2LGOA 3O5OA 4Z2JA 3PA7A 4HARA 1LG2A 3MDYB 4ODOA 4WK9A 4JFMA 4C02B 1D2KA 1LJYA 2OLHA 2F4EA 3TC5A 4KQZA 3KCEA 3O5RA 3KZ7A 4U84A 3WQWA 2XPAA 1ZBWA 2DT1A 5DO2A 4QT3A 2KI3A 4LAWA 2LKNA 3JXVA 3O5DA 4DRPA 4WJXA 4G2PA 4TNSA 4DWSC 4G50A 3O5QA 1H0GA 2IUZA 3WH0A 1TFVA 2PPPA 3KACA 4L3NA 1T11A 4DZ2A 1OWQA 3OA5A 1W1PA 4PTMA 4ODPA 3ARXA 4URIA 4MNJA 4FAPA 1NMWA 2KE0A 5I98A 1FKGA 3RMEA 2L2SA 2FDMA 1Q1CA 2A3AA 4ZS6A 3RM9A 1KFWA 5GQBA 3AS2A 4DRQA 5B8IC 1UR9A 3KAGA 2ZQTA 1RD6A 4WKAA 4Q22A 5DIUA 1WAWA 2PV2A 4NZCA 3QOKA 3ARPA 1NMVA 4JFLA 4WKFA 1JNEA 1W9UA 4J4OA 4DROA 3UQIA 3CGNA 2DSWA 2ZR6A 2WLZA 4FN2A 3IKGA 1KT0A 1Y0OA 4ODMA 1JVWA 1D7HA 1ROUA 3CHCA 1SYTA 2WM0A 4P8XA 2XP6A 1WNOA 3B9DA 1FAPA 1WB0A 3WD2A 3G6MA 2KO7A 4MPKA 3UQAA 3NTPA 1A7XA 2F2DA 1LL4A 1NWRA 4U85A 3CZ8A 1B6CA 2M1IA 3LUOA 1YW5A 3KAHA 1FFRA 1NSGA 3WD1A 2XP7A 1J6YA 4ML4A 3KADA 1ZL1A 1GOIA 3UI6A 4DRNA 1PBKA 2OFNA 5GPGA 1W26A 2G41A 3VAWA 4W9QA 1FD9A 1X6LA 1JNSA 4J4NA 1HKJA 2RSEA 3FXYA 3ARQA 4DT4A 2PI6A 4DZ3A 1JNTA 2XP3A 4ODQA 1HJVA 1FKRA 3FY1A 1E6ZA 4LGXA 1IX5A 1FJDA 1D7JA 5HWBA 2DSZA 2MF9A 1FFQA 1Q6HA 4JYSA 2ITKA 2IF4A 2VCDA 3ARRA 4TYOA 5HT1A 2KR7A 1LG1A 2DT3A 1ZB5A 2AWGA 2WK2A 5HW6A 1HKMA 3AS0A 4N19A 2UZ5A 4Q7NA 2VN1A 1OGBA 4W9OA 4ZPVR 1U79A 1D7IA 4DRHA 1E6NA 3H9RB 3UF8A 3O5PA 1EHNA 3PR9A 1NWTA 5HUAA 1HJWA 3WIJA 1JNDA 1R9HA 4IQCA 3PRDA 2RQSA 1GUVA 2RUCA 3AROA 4MAVA 3IHZA 2XP5A 1FKKA 4KR0B 5J6EA 1UR8A 5JH8A 1SR0A 4LAVA 4DH0A 3CHEA 3B9AA 1E15A 2M08A 3KAFA 3IKDA 1ZBKA 1HXVA 1K9TA 5HW7A 2ZR4A 5DEZA 2A3CA 1FKSA 3IK8A 3RFWA 4IPXA 2Q5AA 3WD3A 2LJ4A 2ESCA 4QT2A 3AS1A 3ARYA 1FKDA 4DIPA 4TW8A 2DG4A 2XPBA 1ZCNA 1FKJA 3TDBA 1ZK6A 4LAXA 3ALGA 3CHFA 1E9LA 3KAIA 4QIBA 4Z2HA 1J4IA 5HWCA 1HJXA 3AQUA 4BF8A 1ZBCA 1E6PA 4MSPA 2DG9A 3ARTA 2MNTA 4ODKA 5BXJA 2YBTA 3JYMA 4TW7A 4XAKA 1NWSA 3B8SA 2MPHA 2YBUA 2B31A 2XP8A 3I6CA 1W9VA 3O5EA 4Z2LA 3PRBA 1LL6A 2PV3A 1BL4A 3NI6A 2G8ZA 4DWSB 1OGGA 2O9OA 5HW8A 3GPKA 4AY1A 4ODRA 2A3BA 1NH6A 2DSVA 2FAPA 1M5YA 2M2AA 1FKLA 2A3EA 4R0XA 2DG3A 2MLYA 4ITZA 1YATA 4TX0A 4L72B 4MGVA 1NWUA 5DIVA 2FKEA 3RGCA 1LL7A 3WKZA 4HBOA 1ZBVA 1E6RA 2JZVA 4JFIA 3O5FA 2RUQA 4ZPWR 4Z2IA 4LAYA 1FKFA 4S3KA 1TCOC 5DITA 1Q6IA 3PRAA 2PPNA 4MTVA 1EIBA 2XP9A 2D9FA 3EY6A 4JFKA 3UI4A 1L1PA 3ALFA 1ZU8A 1FKHA 4DWSD 1LQ0A 4MNKA 3CH9A 1F40A 2F21A 1FKBA 1PINA 2RURA 3ARZA 1BKFA 4WKHA 1FKIA 2ZQSA 4DWSA 1QPFA 1W1TA 1EDQA 3JYJA 4JFJA 3O5IA 3CHDA 1J4HA 1QPLA 4DRMA 3WD4A 4TW6A 1C9HA 2KFWA 3B7XA 4IT6A 1FKTA 3WL0A 3O5JA 1ROTA 4IQ2A 1GPFA 1O6IA 3G6LA 4P8WA 4Z2KA 2DT2A 3ARSA 2Y78A 4P8VA 4MNLA 2MLXA 2XP4A 3OOBA 1N1AA 3RM4A 3WL1A 1J4RA 1QZ2A 1P5QA 1F8AB 2ZQUA 1EQ3A 3UQBA 1VF8A 4HBEA 3AS3A 2O92A 2DPEA 4GGQA 3O5MA 3O5LA 2PV1A 1HKIA 4ZPTR 2PPOA 1KT1A 3B9EA 4WIWA 4GIVA 1ITXA 3ARWA 3KABA 3WQVA 3WD0A 4DRJA 3ARUA 2MLZA 5HTGA 2ZQVA 2WLYA 5D75A 2RUDA 5HBFA 3FAPA 1X6NA 4O2TA 3UI5A 2LPVA 3CGMA 4W9PA 2QF8A 5HKGA 3ARVA 3O5KA 1Q6UA 4S3JA 4W5UA 4DRKA 1CTNA 3ODKA 3NRKA 4P8UA 5GPRA 2AOSA 1W1YA 2KGJA 4NSBA 1W9PA 4MNMA 4ODLA 1D6OA 2ZR5A 3BXWA 4QZVB 5DF0A 1XHGA 4DRIA 4IT4A 4U86A 3TCZA 3W4RA 1HKKA 1EYMA 4ODNA 2DT0A 4R5EA 3RM8A 2N87A 4Z2GA 2PBCA 2K8IA 1H0IA 1XRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NNR A;  2XP7 A;  3JYJ A;  3O5G A;  1FKD A;  2LGO A;  4JFJ A;  4DIP A;  4TW8 A;  3O5O A;  3KAD A;  3PA7 A;  1J6Y A;  3O5I A;  2DG4 A;  1J4H A;  2XPB A;  1ZCN A;  1FKJ A;  1QPL A;  4DRM A;  4TW6 A;  3TDB A;  3MDY B;  4ODO A;  1C9H A;  1ZK6 A;  4LAX A;  3UI6 A;  4DRN A;  2KFW A;  3B7X A;  4JFM A;  4C02 B;  1FKT A;  1PBK A;  2F4E A;  2OFN A;  3O5J A;  1ROT A;  1W26 A;  4IQ2 A;  5GPG A;  3TC5 A;  3VAW A;  3KCE A;  4W9Q A;  1FD9 A;  3O5R A;  3KAI A;  4QIB A;  1JNS A;  3KZ7 A;  4U84 A;  2XPA A;  1J4I A;  5HWC A;  4J4N A;  2RSE A;  4QT3 A;  4BF8 A;  4DT4 A;  4DZ3 A;  2KI3 A;  4LAW A;  2Y78 A;  2DG9 A;  4MSP A;  2MNT A;  1JNT A;  2XP3 A;  2MLX A;  4ODQ A;  2LKN A;  2XP4 A;  3JXV A;  1N1A A;  3OOB A;  4ODK A;  5BXJ A;  3JYM A;  1J4R A;  1QZ2 A;  1P5Q A;  1F8A B;  2ZQU A;  3O5D A;  4TW7 A;  4G2P A;  4DRP A;  3UQB A;  1EQ3 A;  1FJD A;  1D7J A;  2MPH A;  4TNS A;  5HWB A;  2MF9 A;  2XP8 A;  3I6C A;  4G50 A;  1Q6H A;  4GGQ A;  3O5Q A;  3O5M A;  3O5E A;  3O5L A;  3WH0 A;  4JYS A;  2ITK A;  2PV1 A;  2IF4 A;  2VCD A;  4TYO A;  3PRB A;  2PPO A;  2PPP A;  1KT1 A;  1BL4 A;  2PV3 A;  3KAC A;  3NI6 A;  5HT1 A;  1T11 A;  4GIV A;  4DZ2 A;  3KAB A;  2K8I A;  5HW8 A;  2KR7 A;  4ODP A;  3GPK A;  4ODR A;  4FAP A;  1NMW A;  2KE0 A;  5I98 A;  2AWG A;  1FKG A;  2L2S A;  2FAP A;  4DRJ A;  5HW6 A;  1M5Y A;  2M2A A;  1Q1C A;  1FKL A;  2MLZ A;  4R0X A;  2DG3 A;  4N19 A;  2MLY A;  2ZQV A;  4ITZ A;  5HTG A;  1YAT A;  4DRQ A;  5B8I C;  2UZ5 A;  3KAG A;  5D75 A;  2VN1 A;  2RUD A;  2ZQT A;  4TX0 A;  4W9O A;  4MGV A;  1U79 A;  3FAP A;  5DIU A;  5DIV A;  2FKE A;  3RGC A;  4O2T A;  2PV2 A;  3UI5 A;  2LPV A;  3CGM A;  1D7I A;  4DRH A;  3H9R B;  4JFI A;  2JZV A;  4W9P A;  3UF8 A;  5HKG A;  3O5P A;  3O5K A;  3O5F A;  1Q6U A;  1NMV A;  4JFL A;  1FKR A;  2RUQ A;  5HUA A;  4DRK A;  4LAY A;  4J4O A;  4DRO A;  1FKF A;  1TCO C;  5DIT A;  1Q6I A;  3ODK A;  1R9H A;  3CGN A;  3UQI A;  4IQC A;  2ZR6 A;  3NRK A;  2RQS A;  2RUC A;  3PRD A;  4FN2 A;  3IKG A;  1KT0 A;  2PPN A;  1Y0O A;  4ODM A;  3IHZ A;  1JVW A;  1D7H A;  1ROU A;  2XP5 A;  1FKK A;  2XP9 A;  2D9F A;  2KGJ A;  3EY6 A;  4JFK A;  3UI4 A;  5J6E A;  1L1P A;  2XP6 A;  1FKH A;  4LAV A;  4DH0 A;  1FAP A;  4ODL A;  1D6O A;  2M08 A;  2ZR5 A;  2KO7 A;  3KAF A;  4DRI A;  1F40 A;  3IKD A;  1HXV A;  4U86 A;  2F21 A;  3UQA A;  3NTP A;  3TCZ A;  5HW7 A;  2ZR4 A;  1A7X A;  1FKB A;  1PIN A;  1EYM A;  2F2D A;  1FKS A;  2RUR A;  1BKF A;  4ODN A;  4U85 A;  3IK8 A;  3RFW A;  1B6C A;  1FKI A;  2M1I A;  2N87 A;  3LUO A;  4IPX A;  2Q5A A;  2LJ4 A;  2ZQS A;  2PBC A;  1YW5 A;  3KAH A;  1QPF A;  1NSG A;  4QT2 A; 
#chains in the Genus database with same CATH topology
 4NNR A;  3O5G A;  1W1V A;  2DSU A;  2LGO A;  3O5O A;  4Z2J A;  3PA7 A;  4HAR A;  1LG2 A;  2ETN A;  3MDY B;  4ODO A;  4WK9 A;  4JFM A;  4C02 B;  1D2K A;  1LJY A;  2OLH A;  2F4E A;  3TC5 A;  4KQZ A;  3KCE A;  3O5R A;  3KZ7 A;  4U84 A;  3WQW A;  2XPA A;  1ZBW A;  2DT1 A;  5DO2 A;  4QT3 A;  2KI3 A;  4LAW A;  2LKN A;  3JXV A;  3O5D A;  4DRP A;  4WJX A;  4G2P A;  4TNS A;  4DWS C;  4G50 A;  3O5Q A;  1H0G A;  2IUZ A;  3WH0 A;  4UDM A;  1TFV A;  2PPP A;  3KAC A;  4L3N A;  2B5U B;  1T11 A;  4DZ2 A;  1OWQ A;  3OA5 A;  1W1P A;  4PTM A;  4ODP A;  3ARX A;  4URI A;  4MNJ A;  4FAP A;  1NMW A;  2KE0 A;  5I98 A;  1FKG A;  3RME A;  2L2S A;  2FDM A;  1Q1C A;  2A3A A;  4ZS6 A;  3RM9 A;  1KFW A;  5GQB A;  3AS2 A;  4DRQ A;  5B8I C;  1UR9 A;  3GU0 A;  3KAG A;  2ZQT A;  1RD6 A;  3BMB A;  4Q22 A;  4WKA A;  1WAW A;  5DIU A;  2PV2 A;  4NZC A;  3QOK A;  3ARP A;  2P4V A;  1NMV A;  4JFL A;  4WKF A;  1JNE A;  1W9U A;  4J4O A;  4DRO A;  3UQI A;  3CGN A;  2DSW A;  2ZR6 A;  2WLZ A;  4FN2 A;  3IKG A;  1KT0 A;  1Y0O A;  4ODM A;  1JVW A;  1D7H A;  1ROU A;  3CHC A;  1SYT A;  2WM0 A;  4P8X A;  2XP6 A;  1WNO A;  3B9D A;  1FAP A;  1WB0 A;  3WD2 A;  3G6M A;  2KO7 A;  4MPK A;  3UQA A;  3NTP A;  1A7X A;  2F2D A;  1LL4 A;  1NWR A;  4U85 A;  3CZ8 A;  1B6C A;  2M1I A;  3LUO A;  1YW5 A;  3KAH A;  1FFR A;  1NSG A;  3WD1 A;  2XP7 A;  1J6Y A;  4ML4 A;  3KAD A;  1ZL1 A;  1GOI A;  3UI6 A;  4DRN A;  1PBK A;  2OFN A;  5GPG A;  1W26 A;  2G41 A;  3VAW A;  4W9Q A;  1FD9 A;  1X6L A;  1JNS A;  4J4N A;  1HKJ A;  2RSE A;  3FXY A;  3ARQ A;  4DT4 A;  2PI6 A;  4DZ3 A;  1JNT A;  2XP3 A;  4ODQ A;  1HJV A;  1FKR A;  3FY1 A;  1E6Z A;  4LGX A;  1IX5 A;  1FJD A;  1D7J A;  5HWB A;  2DSZ A;  2MF9 A;  1FFQ A;  1Q6H A;  4JYS A;  2ITK A;  2IF4 A;  2VCD A;  3ARR A;  4TYO A;  5HT1 A;  2KR7 A;  1LG1 A;  2DT3 A;  1ZB5 A;  2AWG A;  2WK2 A;  5HW6 A;  1HKM A;  3AS0 A;  4N19 A;  2UZ5 A;  4Q7N A;  2VN1 A;  1OGB A;  4W9O A;  4ZPV R;  1U79 A;  1D7I A;  4DRH A;  1E6N A;  3H9R B;  3UF8 A;  3O5P A;  1EHN A;  3PR9 A;  1NWT A;  5HUA A;  1HJW A;  3WIJ A;  1JND A;  1R9H A;  4IQC A;  3PRD A;  2RQS A;  1GUV A;  2RUC A;  3ARO A;  4MAV A;  3IHZ A;  2XP5 A;  1FKK A;  4KR0 B;  5J6E A;  1UR8 A;  5JH8 A;  1SR0 A;  4LAV A;  4DH0 A;  3CHE A;  3B9A A;  1E15 A;  2M08 A;  3KAF A;  3IKD A;  1ZBK A;  1HXV A;  1K9T A;  5HW7 A;  2ZR4 A;  5DEZ A;  2A3C A;  1FKS A;  3IK8 A;  3RFW A;  4IPX A;  2Q5A A;  3WD3 A;  2LJ4 A;  2ESC A;  4QT2 A;  3AS1 A;  3ARY A;  1FKD A;  4DIP A;  4TW8 A;  2DG4 A;  2XPB A;  1ZCN A;  1FKJ A;  3TDB A;  1ZK6 A;  4LAX A;  2F23 A;  1GRJ A;  3ALG A;  3CHF A;  1E9L A;  3KAI A;  4QIB A;  4Z2H A;  1J4I A;  5HWC A;  1HJX A;  3AQU A;  4BF8 A;  1ZBC A;  1E6P A;  4MSP A;  2DG9 A;  3ART A;  2MNT A;  4ODK A;  5BXJ A;  2YBT A;  3JYM A;  4TW7 A;  4XAK A;  1NWS A;  3B8S A;  2MPH A;  2YBU A;  2B31 A;  2XP8 A;  3I6C A;  1W9V A;  3O5E A;  4Z2L A;  3PRB A;  1LL6 A;  2PV3 A;  1BL4 A;  3NI6 A;  2G8Z A;  4DWS B;  1OGG A;  2O9O A;  5HW8 A;  3GPK A;  4AY1 A;  4ODR A;  2A3B A;  1NH6 A;  2DSV A;  2FAP A;  1M5Y A;  2M2A A;  1FKL A;  2A3E A;  4R0X A;  2DG3 A;  2MLY A;  4ITZ A;  1YAT A;  4TX0 A;  4L72 B;  4MGV A;  1NWU A;  5DIV A;  2FKE A;  3RGC A;  1LL7 A;  3WKZ A;  4HBO A;  1ZBV A;  1E6R A;  2JZV A;  4JFI A;  3O5F A;  2RUQ A;  4ZPW R;  4Z2I A;  4LAY A;  1FKF A;  4S3K A;  1TCO C;  5DIT A;  1Q6I A;  3PRA A;  2PPN A;  4MTV A;  1EIB A;  2XP9 A;  2D9F A;  3EY6 A;  4JFK A;  3UI4 A;  1L1P A;  3ALF A;  1ZU8 A;  1FKH A;  4DWS D;  1LQ0 A;  3GTY X;  4MNK A;  2PN0 A;  3CH9 A;  1F40 A;  2F21 A;  1E44 A;  1FKB A;  1PIN A;  2RUR A;  3ARZ A;  1BKF A;  4WKH A;  1FKI A;  2ZQS A;  4DWS A;  1QPF A;  1W1T A;  1EDQ A;  3JYJ A;  4JFJ A;  3EIP A;  3O5I A;  3CHD A;  1J4H A;  1QPL A;  4DRM A;  3WD4 A;  4TW6 A;  1C9H A;  2KFW A;  3B7X A;  4IT6 A;  1FKT A;  3WL0 A;  3O5J A;  1ROT A;  4IQ2 A;  1GPF A;  1O6I A;  3G6L A;  4P8W A;  4Z2K A;  2DT2 A;  3ARS A;  2Y78 A;  4P8V A;  4MNL A;  2MLX A;  2XP4 A;  2EUL A;  3OOB A;  1N1A A;  3RM4 A;  3WL1 A;  1J4R A;  1QZ2 A;  1P5Q A;  1F8A B;  2ZQU A;  1EQ3 A;  3UQB A;  1VF8 A;  4HBE A;  3AS3 A;  2O92 A;  2DPE A;  4GGQ A;  3O5M A;  3O5L A;  2PV1 A;  1HKI A;  4ZPT R;  2PPO A;  1KT1 A;  3B9E A;  4WIW A;  4GIV A;  1ITX A;  3ARW A;  3KAB A;  3WQV A;  3WD0 A;  4DRJ A;  3ARU A;  2MLZ A;  5HTG A;  2ZQV A;  2WLY A;  5D75 A;  2RUD A;  5HBF A;  3FAP A;  1X6N A;  4O2T A;  3UI5 A;  2LPV A;  3CGM A;  4W9P A;  2QF8 A;  5HKG A;  3ARV A;  3O5K A;  1Q6U A;  4S3J A;  1JCH B;  4W5U A;  4DRK A;  1CTN A;  3ODK A;  3NRK A;  4P8U A;  5GPR A;  2AOS A;  1W1Y A;  2KGJ A;  4NSB A;  1W9P A;  4MNM A;  4ODL A;  1D6O A;  2ZR5 A;  3BXW A;  4QZV B;  5DF0 A;  1XHG A;  4DRI A;  4IT4 A;  4U86 A;  3TCZ A;  3W4R A;  1HKK A;  1EYM A;  4ODN A;  2DT0 A;  4R5E A;  3RM8 A;  2N87 A;  4Z2G A;  2PBC A;  2K8I A;  1H0I A;  1XRV A; 
#chains in the Genus database with same CATH homology
 4NNR A;  3O5G A;  1W1V A;  2DSU A;  2LGO A;  3O5O A;  4Z2J A;  3PA7 A;  4HAR A;  1LG2 A;  3MDY B;  4ODO A;  4WK9 A;  4JFM A;  4C02 B;  1D2K A;  1LJY A;  2OLH A;  2F4E A;  3TC5 A;  4KQZ A;  3KCE A;  3O5R A;  3KZ7 A;  4U84 A;  3WQW A;  2XPA A;  1ZBW A;  2DT1 A;  5DO2 A;  4QT3 A;  2KI3 A;  4LAW A;  2LKN A;  3JXV A;  3O5D A;  4DRP A;  4WJX A;  4G2P A;  4TNS A;  4DWS C;  4G50 A;  3O5Q A;  1H0G A;  2IUZ A;  3WH0 A;  1TFV A;  2PPP A;  3KAC A;  4L3N A;  1T11 A;  4DZ2 A;  1OWQ A;  3OA5 A;  1W1P A;  4PTM A;  4ODP A;  3ARX A;  4URI A;  4MNJ A;  4FAP A;  1NMW A;  2KE0 A;  5I98 A;  1FKG A;  3RME A;  2L2S A;  2FDM A;  1Q1C A;  2A3A A;  4ZS6 A;  3RM9 A;  1KFW A;  5GQB A;  3AS2 A;  4DRQ A;  5B8I C;  1UR9 A;  3KAG A;  2ZQT A;  1RD6 A;  4WKA A;  4Q22 A;  5DIU A;  1WAW A;  2PV2 A;  4NZC A;  3QOK A;  3ARP A;  1NMV A;  4JFL A;  4WKF A;  1JNE A;  1W9U A;  4J4O A;  4DRO A;  3UQI A;  3CGN A;  2DSW A;  2ZR6 A;  2WLZ A;  4FN2 A;  3IKG A;  1KT0 A;  1Y0O A;  4ODM A;  1JVW A;  1D7H A;  1ROU A;  3CHC A;  1SYT A;  2WM0 A;  4P8X A;  2XP6 A;  1WNO A;  3B9D A;  1FAP A;  1WB0 A;  3WD2 A;  3G6M A;  2KO7 A;  4MPK A;  3UQA A;  3NTP A;  1A7X A;  2F2D A;  1LL4 A;  1NWR A;  4U85 A;  3CZ8 A;  1B6C A;  2M1I A;  3LUO A;  1YW5 A;  3KAH A;  1FFR A;  1NSG A;  3WD1 A;  2XP7 A;  1J6Y A;  4ML4 A;  3KAD A;  1ZL1 A;  1GOI A;  3UI6 A;  4DRN A;  1PBK A;  2OFN A;  5GPG A;  1W26 A;  2G41 A;  3VAW A;  4W9Q A;  1FD9 A;  1X6L A;  1JNS A;  4J4N A;  1HKJ A;  2RSE A;  3FXY A;  3ARQ A;  4DT4 A;  2PI6 A;  4DZ3 A;  1JNT A;  2XP3 A;  4ODQ A;  1HJV A;  1FKR A;  3FY1 A;  1E6Z A;  4LGX A;  1IX5 A;  1FJD A;  1D7J A;  5HWB A;  2DSZ A;  2MF9 A;  1FFQ A;  1Q6H A;  4JYS A;  2ITK A;  2IF4 A;  2VCD A;  3ARR A;  4TYO A;  5HT1 A;  2KR7 A;  1LG1 A;  2DT3 A;  1ZB5 A;  2AWG A;  2WK2 A;  5HW6 A;  1HKM A;  3AS0 A;  4N19 A;  2UZ5 A;  4Q7N A;  2VN1 A;  1OGB A;  4W9O A;  4ZPV R;  1U79 A;  1D7I A;  4DRH A;  1E6N A;  3H9R B;  3UF8 A;  3O5P A;  1EHN A;  3PR9 A;  1NWT A;  5HUA A;  1HJW A;  3WIJ A;  1JND A;  1R9H A;  4IQC A;  3PRD A;  2RQS A;  1GUV A;  2RUC A;  3ARO A;  4MAV A;  3IHZ A;  2XP5 A;  1FKK A;  4KR0 B;  5J6E A;  1UR8 A;  5JH8 A;  1SR0 A;  4LAV A;  4DH0 A;  3CHE A;  3B9A A;  1E15 A;  2M08 A;  3KAF A;  3IKD A;  1ZBK A;  1HXV A;  1K9T A;  5HW7 A;  2ZR4 A;  5DEZ A;  2A3C A;  1FKS A;  3IK8 A;  3RFW A;  4IPX A;  2Q5A A;  3WD3 A;  2LJ4 A;  2ESC A;  4QT2 A;  3AS1 A;  3ARY A;  1FKD A;  4DIP A;  4TW8 A;  2DG4 A;  2XPB A;  1ZCN A;  1FKJ A;  3TDB A;  1ZK6 A;  4LAX A;  3ALG A;  3CHF A;  1E9L A;  3KAI A;  4QIB A;  4Z2H A;  1J4I A;  5HWC A;  1HJX A;  3AQU A;  4BF8 A;  1ZBC A;  1E6P A;  4MSP A;  2DG9 A;  3ART A;  2MNT A;  4ODK A;  5BXJ A;  2YBT A;  3JYM A;  4TW7 A;  4XAK A;  1NWS A;  3B8S A;  2MPH A;  2YBU A;  2B31 A;  2XP8 A;  3I6C A;  1W9V A;  3O5E A;  4Z2L A;  3PRB A;  1LL6 A;  2PV3 A;  1BL4 A;  3NI6 A;  2G8Z A;  4DWS B;  1OGG A;  2O9O A;  5HW8 A;  3GPK A;  4AY1 A;  4ODR A;  2A3B A;  1NH6 A;  2DSV A;  2FAP A;  1M5Y A;  2M2A A;  1FKL A;  2A3E A;  4R0X A;  2DG3 A;  2MLY A;  4ITZ A;  1YAT A;  4TX0 A;  4L72 B;  4MGV A;  1NWU A;  5DIV A;  2FKE A;  3RGC A;  1LL7 A;  3WKZ A;  4HBO A;  1ZBV A;  1E6R A;  2JZV A;  4JFI A;  3O5F A;  2RUQ A;  4ZPW R;  4Z2I A;  4LAY A;  1FKF A;  4S3K A;  1TCO C;  5DIT A;  1Q6I A;  3PRA A;  2PPN A;  4MTV A;  1EIB A;  2XP9 A;  2D9F A;  3EY6 A;  4JFK A;  3UI4 A;  1L1P A;  3ALF A;  1ZU8 A;  1FKH A;  4DWS D;  1LQ0 A;  4MNK A;  3CH9 A;  1F40 A;  2F21 A;  1FKB A;  1PIN A;  2RUR A;  3ARZ A;  1BKF A;  4WKH A;  1FKI A;  2ZQS A;  4DWS A;  1QPF A;  1W1T A;  1EDQ A;  3JYJ A;  4JFJ A;  3O5I A;  3CHD A;  1J4H A;  1QPL A;  4DRM A;  3WD4 A;  4TW6 A;  1C9H A;  2KFW A;  3B7X A;  4IT6 A;  1FKT A;  3WL0 A;  3O5J A;  1ROT A;  4IQ2 A;  1GPF A;  1O6I A;  3G6L A;  4P8W A;  4Z2K A;  2DT2 A;  3ARS A;  2Y78 A;  4P8V A;  4MNL A;  2MLX A;  2XP4 A;  3OOB A;  1N1A A;  3RM4 A;  3WL1 A;  1J4R A;  1QZ2 A;  1P5Q A;  1F8A B;  2ZQU A;  1EQ3 A;  3UQB A;  1VF8 A;  4HBE A;  3AS3 A;  2O92 A;  2DPE A;  4GGQ A;  3O5M A;  3O5L A;  2PV1 A;  1HKI A;  4ZPT R;  2PPO A;  1KT1 A;  3B9E A;  4WIW A;  4GIV A;  1ITX A;  3ARW A;  3KAB A;  3WQV A;  3WD0 A;  4DRJ A;  3ARU A;  2MLZ A;  5HTG A;  2ZQV A;  2WLY A;  5D75 A;  2RUD A;  5HBF A;  3FAP A;  1X6N A;  4O2T A;  3UI5 A;  2LPV A;  3CGM A;  4W9P A;  2QF8 A;  5HKG A;  3ARV A;  3O5K A;  1Q6U A;  4S3J A;  4W5U A;  4DRK A;  1CTN A;  3ODK A;  3NRK A;  4P8U A;  5GPR A;  2AOS A;  1W1Y A;  2KGJ A;  4NSB A;  1W9P A;  4MNM A;  4ODL A;  1D6O A;  2ZR5 A;  3BXW A;  4QZV B;  5DF0 A;  1XHG A;  4DRI A;  4IT4 A;  4U86 A;  3TCZ A;  3W4R A;  1HKK A;  1EYM A;  4ODN A;  2DT0 A;  4R5E A;  3RM8 A;  2N87 A;  4Z2G A;  2PBC A;  2K8I A;  1H0I A;  1XRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...