4DRQA

Exploration of pipecolate sulfonamides as binders of the fk506-binding proteins 51 and 52: complex of fkbp51 with 2-(3-((r)-1-((s)-1-(3,5-dichlorophenylsulfonyl)piperidine-2-carbonyloxy)-3-(3,4-dimethoxy -phenyl)propyl)phenoxy)acetic acid
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Exploration of Pipecolate Sulfonamides as Binders of the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drqA00
1ZK6A 2LKNA 4DRIA 3UQAA 2XP3A 4TX0A 1D6OA 2VCDA 3KAGA 1FKGA 1QPLA 3O5IA 2RUCA 4DRHA 2XP5A 3KZ7A 2N87A 3O5JA 4BF8A 3IKGA 4U86A 4DROA 2M2AA 3VAWA 5HW6A 2MLYA 1F40A 2VN1A 4MGVA 2ZR6A 4LAXA 2ZQSA 4DRJA 1EQ3A 2M08A 5HWBA 4DZ3A 3KABA 2LGOA 3PRBA 2MF9A 2KFWA 4LAYA 5HT1A 3UI6A 5HW7A 2ZR4A 4IQ2A 4DZ2A 4W9QA 1FKKA 2KI3A 1B6CA 5B8IC 4JFIA 2AWGA 3KACA 2RURA 4MSPA 1D7JA 2PPNA 4ODQA 3TC5A 1L1PA 1YW5A 1J4HA 2DG3A 1FKFA 3O5KA 4U84A 5HWCA 5J6EA 4ODOA 5HKGA 1F8AB 3O5GA 2XPBA 1Q6IA 1BKFA 2Y78A 3CGNA 4ODNA 1T11A 4ITZA 3O5DA 4TYOA 1YATA 2XPAA 3OOBA 2PV2A 4ODLA 2KE0A 2DG9A 1P5QA 1NMWA 3H9RB 4JFMA 4W9PA 4FAPA 1EYMA 2XP8A 3GPKA 2PBCA 3NI6A 4G50A 1FKTA 1KT1A 2XP7A 4IQCA 1FKLA 3UQIA 4JFLA 3JYJA 2MLZA 3JXVA 3KCEA 1FKJA 4LAWA 2MNTA 2KO7A 2F2DA 2UZ5A 2ZQTA 1Y0OA 5I98A 3TDBA 2DG4A 3O5PA 1J4RA 5DITA 3JYMA 1Q6HA 1ROTA 3PA7A 1FKRA 3IHZA 4DRMA 1FKHA 4IPXA 1JVWA 4U85A 2PPPA 1Q1CA 5DIUA 4DRQA 2PPOA 2OFNA 2RUQA 1M5YA 3RFWA 2FKEA 1C9HA 1A7XA 4N19A 2LPVA 1ZCNA 4DRKA 1D7HA 3B7XA 1D7IA 2ZQVA 2IF4A 2F4EA 1NMVA 3KAHA 3O5EA 1FKDA 1QZ2A 4JFKA 3LUOA 4GGQA 4ODPA 1HXVA 2KR7A 4GIVA 1KT0A 4FN2A 3I6CA 1QPFA 5GPGA 3O5OA 2XP6A 2XP9A 3RGCA 4J4OA 1JNTA 1W26A 2ZR5A 4J4NA 1ROUA 2RUDA 3WH0A 2FAPA 3TCZA 2JZVA 1FKSA 3O5MA 5BXJA 2XP4A 2MLXA 3KAIA 3CGMA 3KAFA 3O5FA 4LAVA 2ZQUA 3FAPA 1BL4A 3O5QA 4TNSA 3UF8A 4DH0A 4DT4A 5HW8A 4C02B 2L2SA 5HUAA 2RQSA 2PV1A 4G2PA 2RSEA 2K8IA 4QT2A 4DRPA 3UI5A 1JNSA 2PV3A 1R9HA 1FJDA 3IKDA 2ITKA 3MDYB 1J4IA 2KGJA 4TW7A 3PRDA 1Q6UA 4TW8A 3EY6A 3NRKA 1J6YA 1FKIA 4R0XA 4QIBA 3NTPA 1N1AA 2Q5AA 3ODKA 5D75A 4JFJA 3O5LA 4O2TA 1U79A 2D9FA 2M1IA 4ODMA 3IK8A 3UI4A 4DIPA 4DRNA 4ODRA 3KADA 2F21A 5HTGA 1PINA 3UQBA 1TCOC 1PBKA 1FKBA 2LJ4A 2MPHA 4QT3A 3O5RA 4ODKA 1NSGA 4TW6A 4JYSA 4NNRA 5DIVA 1FD9A 1FAPA 4W9OA
chains in the Genus database with same CATH superfamily
3RM8A 4DRIA 1EHNA 1QPLA 2EULA 3AS0A 3O5JA 4BF8A 1H0GA 2P4VA 4DROA 2M2AA 1W9PA 1F40A 1EIBA 1NH6A 4LAXA 2ZQSA 4DWSB 4DZ3A 4LAYA 2DSVA 1E6NA 4Z2HA 2DT0A 3ARQA 2PN0A 1LG2A 3KACA 2RURA 3TC5A 1J4HA 5HWCA 5J6EA 4ODOA 1F8AB 4ITZA 5JH8A 3O5DA 3ARYA 1JNEA 3EIPA 1E6ZA 1HKIA 3OOBA 2KE0A 3AQUA 1P5QA 3H9RB 2FDMA 4S3JA 4W9PA 3AS1A 4G50A 1NWRA 1KT1A 4WKHA 1E44A 3UQIA 1ZBCA 1E6RA 1K9TA 2A3AA 2QF8A 1FKJA 2MNTA 1Y0OA 3TDBA 2OLHA 1E9LA 4NSBA 3AS2A 1ROTA 1LL4A 1Q1CA 1M5YA 3WD4A 1D2KA 1ZCNA 1IX5A 4DRKA 3KAHA 1FKDA 1QZ2A 3LUOA 4Z2LA 1WB0A 4MTVA 1ZBWA 2KR7A 5GPGA 1LL7A 2XP9A 1JNSA 1XHGA 2AOSA 2RUDA 4J4NA 2WK2A 3KAIA 2DSZA 2ZQUA 3FAPA 2O92A 3O5QA 4TNSA 1HKJA 5HW8A 2L2SA 4G2PA 4DRPA 3UI5A 4Q22A 1FJDA 1J4IA 2KGJA 4TW8A 1HJXA 4HBOA 3NRKA 1N1AA 2Q5AA 4HBEA 4JFJA 3AROA 1GRJA 4O2TA 3UI4A 3B8SA 3KADA 1PBKA 4QT3A 5DO2A 1RD6A 1FAPA 2DT2A 1ZK6A 4W5UA 2IUZA 4TX0A 1D6OA 2VCDA 4WIWA 4DRHA 3KZ7A 3ARXA 2MLYA 4DRJA 3ARVA 1EQ3A 3ARWA 3KABA 4MNMA 3UI6A 2ZR4A 3ARTA 4XAKA 3FY1A 4QZVB 4JFIA 2DSUA 4ODQA 2PPNA 4U84A 3WL0A 4R5EA 1Q6IA 2Y78A 1ITXA 3RM4A 4MAVA 3G6MA 4ODLA 1EDQA 2DG9A 4JFMA 1EYMA 1FFRA 2A3EA 2PBCA 4MNJA 3BXWA 4S3KA 3JYJA 3WKZA 1HKMA 3JXVA 2F2DA 2ZQTA 2DG4A 5DITA 4URIA 1FKRA 3IHZA 4DRMA 4IPXA 2PPPA 1JNDA 2OFNA 2PPOA 2FKEA 1C9HA 1W1VA 2A3CA 4NZCA 1A7XA 4N19A 1D7HA 3WIJA 3O5EA 2IF4A 1HXVA 1KT0A 3I6CA 4DWSA 2A3BA 3OA5A 3RGCA 4J4OA 5BXJA 3TCZA 3O5MA 2XP4A 3CHEA 1JCHB 4LAVA 3ARZA 4C02B 4QT2A 2G41A 1OGGA 3PRDA 4QIBA 3ODKA 3ALGA 3O5LA 2D9FA 3PR9A 4ODMA 4UDMA 3IK8A 2F21A 1FKBA 1LJYA 1O6IA 4TW6A 4JYSA 4NNRA 5DIVA 1W1TA 5HKGA 3UQAA 2XP3A 1NWSA 3ARSA 3KAGA 1FKGA 2PI6A 2XP5A 4WKAA 1HJVA 3RM9A 1W1PA 4IT6A 4U86A 5HW6A 2VN1A 4MGVA 5HWBA 3WD0A 1FFQA 2KFWA 5HT1A 1W1YA 2YBUA 4DZ2A 1ZL1A 1NWUA 4W9QA 3CHDA 1B6CA 2KI3A 5B8IC 1D7JA 1X6LA 4LGXA 1YW5A 1FKFA 3O5KA 1OGBA 4Z2JA 3O5GA 1SYTA 4TYOA 1BKFA 1T11A 4ZPTR 3GTYX 1YATA 2DPEA 1ZBKA 2XPAA 1NMWA 3ARPA 4FAPA 4KQZA 2XP8A 1W9VA 2XP7A 3BMBA 5GQBA 4P8WA 3KCEA 2UZ5A 3CHCA 1LQ0A 4L72B 3O5PA 1J4RA 3PA7A 3B9DA 4PTMA 1JVWA 4U85A 4DRQA 5DIUA 3WD1A 3RFWA 3WL1A 2LPVA 5DEZA 3B7XA 2F4EA 4Q7NA 1X6NA 4GIVA 4FN2A 1QPFA 1W26A 4DH0A 2FAPA 2JZVA 1FKSA 1GUVA 1GPFA 2MLXA 3CH9A 3KAFA 3O5FA 1XRVA 1ZU8A 1BL4A 4DT4A 1KFWA 1GOIA 5HBFA 4MNKA 3ALFA 2RQSA 4ZPWR 2PV1A 2K8IA 4ZS6A 3IKDA 2ITKA 3RMEA 3WQWA 3G6LA 1J6YA 4L3NA 1E15A 1OWQA 5D75A 3B9EA 3QOKA 4P8XA 2O9OA 4DIPA 4DRNA 5HTGA 1TCOC 1SR0A 2MPHA 2YBTA 1LG1A 3B9AA 1UR8A 1NSGA 4ODKA 3ARRA 4W9OA 2LKNA 1ZB5A 2WLZA 3O5IA 2RUCA 2N87A 3IKGA 2B31A 3VAWA 1NWTA 2ZR6A 1CTNA 2ESCA 2M08A 2LGOA 3PRBA 2MF9A 5HW7A 4IQ2A 4P8UA 4WK9A 1FKKA 2AWGA 4Z2KA 4MSPA 1L1PA 2WM0A 2DG3A 1W9UA 2XPBA 3CGNA 4ODNA 4MNLA 1VF8A 2PV2A 1HJWA 3WD2A 1TFVA 3GPKA 3WQVA 3NI6A 1FKTA 4IQCA 1FKLA 4JFLA 1WNOA 4MPKA 2MLZA 5GPRA 4LAWA 1E6PA 2KO7A 4KR0B 5I98A 3CHFA 4ML4A 3JYMA 1Q6HA 2G8ZA 1FKHA 3ARUA 1HKKA 2RUQA 3CZ8A 4DWSC 1ZBVA 2F23A 4AY1A 1D7IA 2ZQVA 1NMVA 4JFKA 2B5UB 4GGQA 4ODPA 4ZPVR 4HARA 1UR9A 3O5OA 2XP6A 2DSWA 3W4RA 1JNTA 2ZR5A 3WH0A 1ROUA 3CGMA 3UF8A 4WKFA 5HUAA 3PRAA 2RSEA 4P8VA 4DWSD 2PV3A 1R9HA 3MDYB 3FXYA 4TW7A 1H0IA 1Q6UA 3AS3A 4Z2IA 3EY6A 2DT1A 1FKIA 4R0XA 1LL6A 3NTPA 2WLYA 2DT3A 1U79A 2M1IA 4ODRA 2ETNA 1PINA 3GU0A 4IT4A 2LJ4A 5DF0A 4WJXA 3UQBA 3O5RA 1WAWA 4Z2GA 1FD9A 3WD3A
chains in the Genus database with same CATH topology
3RM8A 4DRIA 1EHNA 1QPLA 3AS0A 3O5JA 4BF8A 1H0GA 4DROA 2M2AA 1W9PA 1F40A 1EIBA 1NH6A 4LAXA 2ZQSA 4DWSB 4DZ3A 4LAYA 2DSVA 1E6NA 4Z2HA 2DT0A 3ARQA 1LG2A 3KACA 2RURA 3TC5A 1J4HA 5HWCA 5J6EA 4ODOA 1F8AB 4ITZA 5JH8A 3O5DA 3ARYA 1JNEA 1E6ZA 1HKIA 3OOBA 2KE0A 3AQUA 1P5QA 3H9RB 2FDMA 4S3JA 4W9PA 3AS1A 4G50A 1NWRA 1KT1A 4WKHA 3UQIA 1ZBCA 1E6RA 1K9TA 2A3AA 2QF8A 1FKJA 2MNTA 1Y0OA 3TDBA 2OLHA 1E9LA 4NSBA 3AS2A 1ROTA 1LL4A 1Q1CA 1M5YA 3WD4A 1D2KA 1ZCNA 1IX5A 4DRKA 3KAHA 1FKDA 1QZ2A 3LUOA 4Z2LA 1WB0A 4MTVA 1ZBWA 2KR7A 5GPGA 1LL7A 2XP9A 1JNSA 1XHGA 2AOSA 2RUDA 4J4NA 2WK2A 3KAIA 2DSZA 2ZQUA 3FAPA 2O92A 3O5QA 4TNSA 1HKJA 5HW8A 2L2SA 4G2PA 4DRPA 3UI5A 4Q22A 1FJDA 1J4IA 2KGJA 4TW8A 1HJXA 4HBOA 3NRKA 1N1AA 2Q5AA 4HBEA 4JFJA 3AROA 4O2TA 3UI4A 3B8SA 3KADA 1PBKA 4QT3A 5DO2A 1RD6A 1FAPA 2DT2A 1ZK6A 4W5UA 2IUZA 4TX0A 1D6OA 2VCDA 4WIWA 4DRHA 3KZ7A 3ARXA 2MLYA 4DRJA 3ARVA 1EQ3A 3ARWA 3KABA 4MNMA 3UI6A 2ZR4A 3ARTA 4XAKA 3FY1A 4QZVB 4JFIA 2DSUA 4ODQA 2PPNA 4U84A 3WL0A 4R5EA 1Q6IA 2Y78A 1ITXA 3RM4A 4MAVA 3G6MA 4ODLA 1EDQA 2DG9A 4JFMA 1EYMA 1FFRA 2A3EA 2PBCA 4MNJA 3BXWA 4S3KA 3JYJA 3WKZA 1HKMA 3JXVA 2F2DA 2ZQTA 2DG4A 5DITA 4URIA 1FKRA 3IHZA 4DRMA 4IPXA 2PPPA 1JNDA 2OFNA 2PPOA 2FKEA 1C9HA 1W1VA 2A3CA 4NZCA 1A7XA 4N19A 1D7HA 3WIJA 3O5EA 2IF4A 1HXVA 1KT0A 3I6CA 4DWSA 2A3BA 3OA5A 3RGCA 4J4OA 5BXJA 3TCZA 3O5MA 2XP4A 3CHEA 4LAVA 3ARZA 4C02B 4QT2A 2G41A 1OGGA 3PRDA 4QIBA 3ODKA 3ALGA 3O5LA 2D9FA 3PR9A 4ODMA 3IK8A 2F21A 1FKBA 1LJYA 1O6IA 4TW6A 4JYSA 4NNRA 5DIVA 1W1TA 5HKGA 3UQAA 2XP3A 1NWSA 3ARSA 3KAGA 1FKGA 2PI6A 2XP5A 4WKAA 1HJVA 3RM9A 1W1PA 4IT6A 4U86A 5HW6A 2VN1A 4MGVA 5HWBA 3WD0A 1FFQA 2KFWA 5HT1A 1W1YA 2YBUA 4DZ2A 1ZL1A 1NWUA 4W9QA 3CHDA 1B6CA 2KI3A 5B8IC 1D7JA 1X6LA 4LGXA 1YW5A 1FKFA 3O5KA 1OGBA 4Z2JA 3O5GA 1SYTA 4TYOA 1BKFA 1T11A 4ZPTR 1YATA 2DPEA 1ZBKA 2XPAA 1NMWA 3ARPA 4FAPA 4KQZA 2XP8A 1W9VA 2XP7A 5GQBA 4P8WA 3KCEA 2UZ5A 3CHCA 1LQ0A 4L72B 3O5PA 1J4RA 3PA7A 3B9DA 4PTMA 1JVWA 4U85A 4DRQA 5DIUA 3WD1A 3RFWA 3WL1A 2LPVA 5DEZA 3B7XA 2F4EA 4Q7NA 1X6NA 4GIVA 4FN2A 1QPFA 1W26A 4DH0A 2FAPA 2JZVA 1FKSA 1GUVA 1GPFA 2MLXA 3CH9A 3KAFA 3O5FA 1XRVA 1ZU8A 1BL4A 4DT4A 1KFWA 1GOIA 5HBFA 4MNKA 3ALFA 2RQSA 4ZPWR 2PV1A 2K8IA 4ZS6A 3IKDA 2ITKA 3RMEA 3WQWA 3G6LA 1J6YA 4L3NA 1E15A 1OWQA 5D75A 3B9EA 3QOKA 4P8XA 2O9OA 4DIPA 4DRNA 5HTGA 1TCOC 1SR0A 2MPHA 2YBTA 1LG1A 3B9AA 1UR8A 1NSGA 4ODKA 3ARRA 4W9OA 2LKNA 1ZB5A 2WLZA 3O5IA 2RUCA 2N87A 3IKGA 2B31A 3VAWA 1NWTA 2ZR6A 1CTNA 2ESCA 2M08A 2LGOA 3PRBA 2MF9A 5HW7A 4IQ2A 4P8UA 4WK9A 1FKKA 2AWGA 4Z2KA 4MSPA 1L1PA 2WM0A 2DG3A 1W9UA 2XPBA 3CGNA 4ODNA 4MNLA 1VF8A 2PV2A 1HJWA 3WD2A 1TFVA 3GPKA 3WQVA 3NI6A 1FKTA 4IQCA 1FKLA 4JFLA 1WNOA 4MPKA 2MLZA 5GPRA 4LAWA 1E6PA 2KO7A 4KR0B 5I98A 3CHFA 4ML4A 3JYMA 1Q6HA 2G8ZA 1FKHA 3ARUA 1HKKA 2RUQA 3CZ8A 4DWSC 1ZBVA 4AY1A 1D7IA 2ZQVA 1NMVA 4JFKA 4GGQA 4ODPA 4ZPVR 4HARA 1UR9A 3O5OA 2XP6A 2DSWA 3W4RA 1JNTA 2ZR5A 3WH0A 1ROUA 3CGMA 3UF8A 4WKFA 5HUAA 3PRAA 2RSEA 4P8VA 4DWSD 2PV3A 1R9HA 3MDYB 3FXYA 4TW7A 1H0IA 1Q6UA 3AS3A 4Z2IA 3EY6A 2DT1A 1FKIA 4R0XA 1LL6A 3NTPA 2WLYA 2DT3A 1U79A 2M1IA 4ODRA 1PINA 4IT4A 3UQBA 2LJ4A 5DF0A 4WJXA 3O5RA 1WAWA 4Z2GA 1FD9A 3WD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZK6 A;  2LKN A;  4DRI A;  3UQA A;  2XP3 A;  4TX0 A;  1D6O A;  2VCD A;  3KAG A;  1FKG A;  1QPL A;  3O5I A;  2RUC A;  4DRH A;  2XP5 A;  3KZ7 A;  2N87 A;  3O5J A;  4BF8 A;  3IKG A;  4U86 A;  4DRO A;  2M2A A;  3VAW A;  5HW6 A;  2MLY A;  1F40 A;  2VN1 A;  4MGV A;  2ZR6 A;  4LAX A;  2ZQS A;  4DRJ A;  1EQ3 A;  2M08 A;  5HWB A;  4DZ3 A;  3KAB A;  2LGO A;  3PRB A;  2MF9 A;  2KFW A;  4LAY A;  5HT1 A;  3UI6 A;  5HW7 A;  2ZR4 A;  4IQ2 A;  4DZ2 A;  4W9Q A;  1FKK A;  2KI3 A;  1B6C A;  5B8I C;  4JFI A;  2AWG A;  3KAC A;  2RUR A;  4MSP A;  1D7J A;  2PPN A;  4ODQ A;  3TC5 A;  1L1P A;  1YW5 A;  1J4H A;  2DG3 A;  1FKF A;  3O5K A;  4U84 A;  5HWC A;  5J6E A;  4ODO A;  5HKG A;  1F8A B;  3O5G A;  2XPB A;  1Q6I A;  1BKF A;  2Y78 A;  3CGN A;  4ODN A;  1T11 A;  4ITZ A;  3O5D A;  4TYO A;  1YAT A;  2XPA A;  3OOB A;  2PV2 A;  4ODL A;  2KE0 A;  2DG9 A;  1P5Q A;  1NMW A;  3H9R B;  4JFM A;  4W9P A;  4FAP A;  1EYM A;  2XP8 A;  3GPK A;  2PBC A;  3NI6 A;  4G50 A;  1FKT A;  1KT1 A;  2XP7 A;  4IQC A;  1FKL A;  3UQI A;  4JFL A;  3JYJ A;  2MLZ A;  3JXV A;  3KCE A;  1FKJ A;  4LAW A;  2MNT A;  2KO7 A;  2F2D A;  2UZ5 A;  2ZQT A;  1Y0O A;  5I98 A;  3TDB A;  2DG4 A;  3O5P A;  1J4R A;  5DIT A;  3JYM A;  1Q6H A;  1ROT A;  3PA7 A;  1FKR A;  3IHZ A;  4DRM A;  1FKH A;  4IPX A;  1JVW A;  4U85 A;  2PPP A;  1Q1C A;  5DIU A;  4DRQ A;  2PPO A;  2OFN A;  2RUQ A;  1M5Y A;  3RFW A;  2FKE A;  1C9H A;  1A7X A;  4N19 A;  2LPV A;  1ZCN A;  4DRK A;  1D7H A;  3B7X A;  1D7I A;  2ZQV A;  2IF4 A;  2F4E A;  1NMV A;  3KAH A;  3O5E A;  1FKD A;  1QZ2 A;  4JFK A;  3LUO A;  4GGQ A;  4ODP A;  1HXV A;  2KR7 A;  4GIV A;  1KT0 A;  4FN2 A;  3I6C A;  1QPF A;  5GPG A;  3O5O A;  2XP6 A;  2XP9 A;  3RGC A;  4J4O A;  1JNT A;  1W26 A;  2ZR5 A;  4J4N A;  1ROU A;  2RUD A;  3WH0 A;  2FAP A;  3TCZ A;  2JZV A;  1FKS A;  3O5M A;  5BXJ A;  2XP4 A;  2MLX A;  3KAI A;  3CGM A;  3KAF A;  3O5F A;  4LAV A;  2ZQU A;  3FAP A;  1BL4 A;  3O5Q A;  4TNS A;  3UF8 A;  4DH0 A;  4DT4 A;  5HW8 A;  4C02 B;  2L2S A;  5HUA A;  2RQS A;  2PV1 A;  4G2P A;  2RSE A;  2K8I A;  4QT2 A;  4DRP A;  3UI5 A;  1JNS A;  2PV3 A;  1R9H A;  1FJD A;  3IKD A;  2ITK A;  3MDY B;  1J4I A;  2KGJ A;  4TW7 A;  3PRD A;  1Q6U A;  4TW8 A;  3EY6 A;  3NRK A;  1J6Y A;  1FKI A;  4R0X A;  4QIB A;  3NTP A;  1N1A A;  2Q5A A;  3ODK A;  5D75 A;  4JFJ A;  3O5L A;  4O2T A;  1U79 A;  2D9F A;  2M1I A;  4ODM A;  3IK8 A;  3UI4 A;  4DIP A;  4DRN A;  4ODR A;  3KAD A;  2F21 A;  5HTG A;  1PIN A;  3UQB A;  1TCO C;  1PBK A;  1FKB A;  2LJ4 A;  2MPH A;  4QT3 A;  3O5R A;  4ODK A;  1NSG A;  4TW6 A;  4JYS A;  4NNR A;  5DIV A;  1FD9 A;  1FAP A;  4W9O A; 
#chains in the Genus database with same CATH topology
 3RM8 A;  4DRI A;  1EHN A;  1QPL A;  2EUL A;  3AS0 A;  3O5J A;  4BF8 A;  1H0G A;  2P4V A;  4DRO A;  2M2A A;  1W9P A;  1F40 A;  1EIB A;  1NH6 A;  4LAX A;  2ZQS A;  4DWS B;  4DZ3 A;  4LAY A;  2DSV A;  1E6N A;  4Z2H A;  2DT0 A;  3ARQ A;  2PN0 A;  1LG2 A;  3KAC A;  2RUR A;  3TC5 A;  1J4H A;  5HWC A;  5J6E A;  4ODO A;  1F8A B;  4ITZ A;  5JH8 A;  3O5D A;  3ARY A;  1JNE A;  3EIP A;  1E6Z A;  1HKI A;  3OOB A;  2KE0 A;  3AQU A;  1P5Q A;  3H9R B;  2FDM A;  4S3J A;  4W9P A;  3AS1 A;  4G50 A;  1NWR A;  1KT1 A;  4WKH A;  1E44 A;  3UQI A;  1ZBC A;  1E6R A;  1K9T A;  2A3A A;  2QF8 A;  1FKJ A;  2MNT A;  1Y0O A;  3TDB A;  2OLH A;  1E9L A;  4NSB A;  3AS2 A;  1ROT A;  1LL4 A;  1Q1C A;  1M5Y A;  3WD4 A;  1D2K A;  1ZCN A;  1IX5 A;  4DRK A;  3KAH A;  1FKD A;  1QZ2 A;  3LUO A;  4Z2L A;  1WB0 A;  4MTV A;  1ZBW A;  2KR7 A;  5GPG A;  1LL7 A;  2XP9 A;  1JNS A;  1XHG A;  2AOS A;  2RUD A;  4J4N A;  2WK2 A;  3KAI A;  2DSZ A;  2ZQU A;  3FAP A;  2O92 A;  3O5Q A;  4TNS A;  1HKJ A;  5HW8 A;  2L2S A;  4G2P A;  4DRP A;  3UI5 A;  4Q22 A;  1FJD A;  1J4I A;  2KGJ A;  4TW8 A;  1HJX A;  4HBO A;  3NRK A;  1N1A A;  2Q5A A;  4HBE A;  4JFJ A;  3ARO A;  1GRJ A;  4O2T A;  3UI4 A;  3B8S A;  3KAD A;  1PBK A;  4QT3 A;  5DO2 A;  1RD6 A;  1FAP A;  2DT2 A;  1ZK6 A;  4W5U A;  2IUZ A;  4TX0 A;  1D6O A;  2VCD A;  4WIW A;  4DRH A;  3KZ7 A;  3ARX A;  2MLY A;  4DRJ A;  3ARV A;  1EQ3 A;  3ARW A;  3KAB A;  4MNM A;  3UI6 A;  2ZR4 A;  3ART A;  4XAK A;  3FY1 A;  4QZV B;  4JFI A;  2DSU A;  4ODQ A;  2PPN A;  4U84 A;  3WL0 A;  4R5E A;  1Q6I A;  2Y78 A;  1ITX A;  3RM4 A;  4MAV A;  3G6M A;  4ODL A;  1EDQ A;  2DG9 A;  4JFM A;  1EYM A;  1FFR A;  2A3E A;  2PBC A;  4MNJ A;  3BXW A;  4S3K A;  3JYJ A;  3WKZ A;  1HKM A;  3JXV A;  2F2D A;  2ZQT A;  2DG4 A;  5DIT A;  4URI A;  1FKR A;  3IHZ A;  4DRM A;  4IPX A;  2PPP A;  1JND A;  2OFN A;  2PPO A;  2FKE A;  1C9H A;  1W1V A;  2A3C A;  4NZC A;  1A7X A;  4N19 A;  1D7H A;  3WIJ A;  3O5E A;  2IF4 A;  1HXV A;  1KT0 A;  3I6C A;  4DWS A;  2A3B A;  3OA5 A;  3RGC A;  4J4O A;  5BXJ A;  3TCZ A;  3O5M A;  2XP4 A;  3CHE A;  1JCH B;  4LAV A;  3ARZ A;  4C02 B;  4QT2 A;  2G41 A;  1OGG A;  3PRD A;  4QIB A;  3ODK A;  3ALG A;  3O5L A;  2D9F A;  3PR9 A;  4ODM A;  4UDM A;  3IK8 A;  2F21 A;  1FKB A;  1LJY A;  1O6I A;  4TW6 A;  4JYS A;  4NNR A;  5DIV A;  1W1T A;  5HKG A;  3UQA A;  2XP3 A;  1NWS A;  3ARS A;  3KAG A;  1FKG A;  2PI6 A;  2XP5 A;  4WKA A;  1HJV A;  3RM9 A;  1W1P A;  4IT6 A;  4U86 A;  5HW6 A;  2VN1 A;  4MGV A;  5HWB A;  3WD0 A;  1FFQ A;  2KFW A;  5HT1 A;  1W1Y A;  2YBU A;  4DZ2 A;  1ZL1 A;  1NWU A;  4W9Q A;  3CHD A;  1B6C A;  2KI3 A;  5B8I C;  1D7J A;  1X6L A;  4LGX A;  1YW5 A;  1FKF A;  3O5K A;  1OGB A;  4Z2J A;  3O5G A;  1SYT A;  4TYO A;  1BKF A;  1T11 A;  4ZPT R;  3GTY X;  1YAT A;  2DPE A;  1ZBK A;  2XPA A;  1NMW A;  3ARP A;  4FAP A;  4KQZ A;  2XP8 A;  1W9V A;  2XP7 A;  3BMB A;  5GQB A;  4P8W A;  3KCE A;  2UZ5 A;  3CHC A;  1LQ0 A;  4L72 B;  3O5P A;  1J4R A;  3PA7 A;  3B9D A;  4PTM A;  1JVW A;  4U85 A;  4DRQ A;  5DIU A;  3WD1 A;  3RFW A;  3WL1 A;  2LPV A;  5DEZ A;  3B7X A;  2F4E A;  4Q7N A;  1X6N A;  4GIV A;  4FN2 A;  1QPF A;  1W26 A;  4DH0 A;  2FAP A;  2JZV A;  1FKS A;  1GUV A;  1GPF A;  2MLX A;  3CH9 A;  3KAF A;  3O5F A;  1XRV A;  1ZU8 A;  1BL4 A;  4DT4 A;  1KFW A;  1GOI A;  5HBF A;  4MNK A;  3ALF A;  2RQS A;  4ZPW R;  2PV1 A;  2K8I A;  4ZS6 A;  3IKD A;  2ITK A;  3RME A;  3WQW A;  3G6L A;  1J6Y A;  4L3N A;  1E15 A;  1OWQ A;  5D75 A;  3B9E A;  3QOK A;  4P8X A;  2O9O A;  4DIP A;  4DRN A;  5HTG A;  1TCO C;  1SR0 A;  2MPH A;  2YBT A;  1LG1 A;  3B9A A;  1UR8 A;  1NSG A;  4ODK A;  3ARR A;  4W9O A;  2LKN A;  1ZB5 A;  2WLZ A;  3O5I A;  2RUC A;  2N87 A;  3IKG A;  2B31 A;  3VAW A;  1NWT A;  2ZR6 A;  1CTN A;  2ESC A;  2M08 A;  2LGO A;  3PRB A;  2MF9 A;  5HW7 A;  4IQ2 A;  4P8U A;  4WK9 A;  1FKK A;  2AWG A;  4Z2K A;  4MSP A;  1L1P A;  2WM0 A;  2DG3 A;  1W9U A;  2XPB A;  3CGN A;  4ODN A;  4MNL A;  1VF8 A;  2PV2 A;  1HJW A;  3WD2 A;  1TFV A;  3GPK A;  3WQV A;  3NI6 A;  1FKT A;  4IQC A;  1FKL A;  4JFL A;  1WNO A;  4MPK A;  2MLZ A;  5GPR A;  4LAW A;  1E6P A;  2KO7 A;  4KR0 B;  5I98 A;  3CHF A;  4ML4 A;  3JYM A;  1Q6H A;  2G8Z A;  1FKH A;  3ARU A;  1HKK A;  2RUQ A;  3CZ8 A;  4DWS C;  1ZBV A;  2F23 A;  4AY1 A;  1D7I A;  2ZQV A;  1NMV A;  4JFK A;  2B5U B;  4GGQ A;  4ODP A;  4ZPV R;  4HAR A;  1UR9 A;  3O5O A;  2XP6 A;  2DSW A;  3W4R A;  1JNT A;  2ZR5 A;  3WH0 A;  1ROU A;  3CGM A;  3UF8 A;  4WKF A;  5HUA A;  3PRA A;  2RSE A;  4P8V A;  4DWS D;  2PV3 A;  1R9H A;  3MDY B;  3FXY A;  4TW7 A;  1H0I A;  1Q6U A;  3AS3 A;  4Z2I A;  3EY6 A;  2DT1 A;  1FKI A;  4R0X A;  1LL6 A;  3NTP A;  2WLY A;  2DT3 A;  1U79 A;  2M1I A;  4ODR A;  2ETN A;  1PIN A;  3GU0 A;  4IT4 A;  2LJ4 A;  5DF0 A;  4WJX A;  3UQB A;  3O5R A;  1WAW A;  4Z2G A;  1FD9 A;  3WD3 A; 
#chains in the Genus database with same CATH homology
 3RM8 A;  4DRI A;  1EHN A;  1QPL A;  3AS0 A;  3O5J A;  4BF8 A;  1H0G A;  4DRO A;  2M2A A;  1W9P A;  1F40 A;  1EIB A;  1NH6 A;  4LAX A;  2ZQS A;  4DWS B;  4DZ3 A;  4LAY A;  2DSV A;  1E6N A;  4Z2H A;  2DT0 A;  3ARQ A;  1LG2 A;  3KAC A;  2RUR A;  3TC5 A;  1J4H A;  5HWC A;  5J6E A;  4ODO A;  1F8A B;  4ITZ A;  5JH8 A;  3O5D A;  3ARY A;  1JNE A;  1E6Z A;  1HKI A;  3OOB A;  2KE0 A;  3AQU A;  1P5Q A;  3H9R B;  2FDM A;  4S3J A;  4W9P A;  3AS1 A;  4G50 A;  1NWR A;  1KT1 A;  4WKH A;  3UQI A;  1ZBC A;  1E6R A;  1K9T A;  2A3A A;  2QF8 A;  1FKJ A;  2MNT A;  1Y0O A;  3TDB A;  2OLH A;  1E9L A;  4NSB A;  3AS2 A;  1ROT A;  1LL4 A;  1Q1C A;  1M5Y A;  3WD4 A;  1D2K A;  1ZCN A;  1IX5 A;  4DRK A;  3KAH A;  1FKD A;  1QZ2 A;  3LUO A;  4Z2L A;  1WB0 A;  4MTV A;  1ZBW A;  2KR7 A;  5GPG A;  1LL7 A;  2XP9 A;  1JNS A;  1XHG A;  2AOS A;  2RUD A;  4J4N A;  2WK2 A;  3KAI A;  2DSZ A;  2ZQU A;  3FAP A;  2O92 A;  3O5Q A;  4TNS A;  1HKJ A;  5HW8 A;  2L2S A;  4G2P A;  4DRP A;  3UI5 A;  4Q22 A;  1FJD A;  1J4I A;  2KGJ A;  4TW8 A;  1HJX A;  4HBO A;  3NRK A;  1N1A A;  2Q5A A;  4HBE A;  4JFJ A;  3ARO A;  4O2T A;  3UI4 A;  3B8S A;  3KAD A;  1PBK A;  4QT3 A;  5DO2 A;  1RD6 A;  1FAP A;  2DT2 A;  1ZK6 A;  4W5U A;  2IUZ A;  4TX0 A;  1D6O A;  2VCD A;  4WIW A;  4DRH A;  3KZ7 A;  3ARX A;  2MLY A;  4DRJ A;  3ARV A;  1EQ3 A;  3ARW A;  3KAB A;  4MNM A;  3UI6 A;  2ZR4 A;  3ART A;  4XAK A;  3FY1 A;  4QZV B;  4JFI A;  2DSU A;  4ODQ A;  2PPN A;  4U84 A;  3WL0 A;  4R5E A;  1Q6I A;  2Y78 A;  1ITX A;  3RM4 A;  4MAV A;  3G6M A;  4ODL A;  1EDQ A;  2DG9 A;  4JFM A;  1EYM A;  1FFR A;  2A3E A;  2PBC A;  4MNJ A;  3BXW A;  4S3K A;  3JYJ A;  3WKZ A;  1HKM A;  3JXV A;  2F2D A;  2ZQT A;  2DG4 A;  5DIT A;  4URI A;  1FKR A;  3IHZ A;  4DRM A;  4IPX A;  2PPP A;  1JND A;  2OFN A;  2PPO A;  2FKE A;  1C9H A;  1W1V A;  2A3C A;  4NZC A;  1A7X A;  4N19 A;  1D7H A;  3WIJ A;  3O5E A;  2IF4 A;  1HXV A;  1KT0 A;  3I6C A;  4DWS A;  2A3B A;  3OA5 A;  3RGC A;  4J4O A;  5BXJ A;  3TCZ A;  3O5M A;  2XP4 A;  3CHE A;  4LAV A;  3ARZ A;  4C02 B;  4QT2 A;  2G41 A;  1OGG A;  3PRD A;  4QIB A;  3ODK A;  3ALG A;  3O5L A;  2D9F A;  3PR9 A;  4ODM A;  3IK8 A;  2F21 A;  1FKB A;  1LJY A;  1O6I A;  4TW6 A;  4JYS A;  4NNR A;  5DIV A;  1W1T A;  5HKG A;  3UQA A;  2XP3 A;  1NWS A;  3ARS A;  3KAG A;  1FKG A;  2PI6 A;  2XP5 A;  4WKA A;  1HJV A;  3RM9 A;  1W1P A;  4IT6 A;  4U86 A;  5HW6 A;  2VN1 A;  4MGV A;  5HWB A;  3WD0 A;  1FFQ A;  2KFW A;  5HT1 A;  1W1Y A;  2YBU A;  4DZ2 A;  1ZL1 A;  1NWU A;  4W9Q A;  3CHD A;  1B6C A;  2KI3 A;  5B8I C;  1D7J A;  1X6L A;  4LGX A;  1YW5 A;  1FKF A;  3O5K A;  1OGB A;  4Z2J A;  3O5G A;  1SYT A;  4TYO A;  1BKF A;  1T11 A;  4ZPT R;  1YAT A;  2DPE A;  1ZBK A;  2XPA A;  1NMW A;  3ARP A;  4FAP A;  4KQZ A;  2XP8 A;  1W9V A;  2XP7 A;  5GQB A;  4P8W A;  3KCE A;  2UZ5 A;  3CHC A;  1LQ0 A;  4L72 B;  3O5P A;  1J4R A;  3PA7 A;  3B9D A;  4PTM A;  1JVW A;  4U85 A;  4DRQ A;  5DIU A;  3WD1 A;  3RFW A;  3WL1 A;  2LPV A;  5DEZ A;  3B7X A;  2F4E A;  4Q7N A;  1X6N A;  4GIV A;  4FN2 A;  1QPF A;  1W26 A;  4DH0 A;  2FAP A;  2JZV A;  1FKS A;  1GUV A;  1GPF A;  2MLX A;  3CH9 A;  3KAF A;  3O5F A;  1XRV A;  1ZU8 A;  1BL4 A;  4DT4 A;  1KFW A;  1GOI A;  5HBF A;  4MNK A;  3ALF A;  2RQS A;  4ZPW R;  2PV1 A;  2K8I A;  4ZS6 A;  3IKD A;  2ITK A;  3RME A;  3WQW A;  3G6L A;  1J6Y A;  4L3N A;  1E15 A;  1OWQ A;  5D75 A;  3B9E A;  3QOK A;  4P8X A;  2O9O A;  4DIP A;  4DRN A;  5HTG A;  1TCO C;  1SR0 A;  2MPH A;  2YBT A;  1LG1 A;  3B9A A;  1UR8 A;  1NSG A;  4ODK A;  3ARR A;  4W9O A;  2LKN A;  1ZB5 A;  2WLZ A;  3O5I A;  2RUC A;  2N87 A;  3IKG A;  2B31 A;  3VAW A;  1NWT A;  2ZR6 A;  1CTN A;  2ESC A;  2M08 A;  2LGO A;  3PRB A;  2MF9 A;  5HW7 A;  4IQ2 A;  4P8U A;  4WK9 A;  1FKK A;  2AWG A;  4Z2K A;  4MSP A;  1L1P A;  2WM0 A;  2DG3 A;  1W9U A;  2XPB A;  3CGN A;  4ODN A;  4MNL A;  1VF8 A;  2PV2 A;  1HJW A;  3WD2 A;  1TFV A;  3GPK A;  3WQV A;  3NI6 A;  1FKT A;  4IQC A;  1FKL A;  4JFL A;  1WNO A;  4MPK A;  2MLZ A;  5GPR A;  4LAW A;  1E6P A;  2KO7 A;  4KR0 B;  5I98 A;  3CHF A;  4ML4 A;  3JYM A;  1Q6H A;  2G8Z A;  1FKH A;  3ARU A;  1HKK A;  2RUQ A;  3CZ8 A;  4DWS C;  1ZBV A;  4AY1 A;  1D7I A;  2ZQV A;  1NMV A;  4JFK A;  4GGQ A;  4ODP A;  4ZPV R;  4HAR A;  1UR9 A;  3O5O A;  2XP6 A;  2DSW A;  3W4R A;  1JNT A;  2ZR5 A;  3WH0 A;  1ROU A;  3CGM A;  3UF8 A;  4WKF A;  5HUA A;  3PRA A;  2RSE A;  4P8V A;  4DWS D;  2PV3 A;  1R9H A;  3MDY B;  3FXY A;  4TW7 A;  1H0I A;  1Q6U A;  3AS3 A;  4Z2I A;  3EY6 A;  2DT1 A;  1FKI A;  4R0X A;  1LL6 A;  3NTP A;  2WLY A;  2DT3 A;  1U79 A;  2M1I A;  4ODR A;  1PIN A;  4IT4 A;  3UQB A;  2LJ4 A;  5DF0 A;  4WJX A;  3O5R A;  1WAW A;  4Z2G A;  1FD9 A;  3WD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...