4DZ2A

Crystal structure of a peptidyl-prolyl cis-trans isomerase with surface mutation r92g from burkholderia pseudomallei complexed with fk506
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
STVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGAGGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title A structural biology approach enables the development of antimicrobials targeting bacterial immunophilins.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 25
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dz2A00
5DIVA 2KE0A 1D7JA 3JYMA 2XP9A 4QIBA 1Y0OA 1FKKA 1D7HA 2MF9A 3MDYB 2PV2A 3KAIA 1QZ2A 3VAWA 1ROTA 5J6EA 4N19A 4TW6A 4DRHA 4LAVA 2F4EA 4W9PA 4TX0A 4BF8A 4ODQA 3UF8A 2KO7A 5HW6A 5HWBA 1JVWA 4DRMA 3OOBA 2N87A 2RQSA 1QPFA 4DRKA 3O5RA 1PINA 3O5MA 3O5PA 1A7XA 4J4OA 4DROA 5HKGA 4FN2A 4R0XA 3TDBA 1D7IA 2K8IA 2XP4A 1U79A 1FKTA 2XP6A 3KAHA 2L2SA 1FKGA 1D6OA 3NI6A 4GIVA 5B8IC 4ITZA 2ITKA 3O5LA 5D75A 2F21A 4QT2A 1YATA 1FKFA 3O5GA 2IF4A 2RUDA 1T11A 3CGNA 3WH0A 1Q6HA 1FKSA 4J4NA 5DITA 4DIPA 2MLYA 4JYSA 4ODMA 1PBKA 4MSPA 4TW8A 3B7XA 4DRQA 5I98A 2D9FA 3UQAA 3RFWA 1J6YA 2XP5A 1F8AB 2PBCA 3EY6A 4NNRA 2DG3A 2MLXA 3PRDA 4W9OA 3KABA 1YW5A 4W9QA 4IPXA 1L1PA 4FAPA 3O5FA 4G2PA 2PPPA 4LAYA 3NTPA 2AWGA 1B6CA 1FKJA 3O5DA 4ODNA 4QT3A 2FKEA 5GPGA 5HUAA 3O5QA 1KT0A 1FD9A 4ODRA 3JXVA 1NSGA 3O5EA 4C02B 3KAFA 1M5YA 4DZ3A 3UI5A 2KFWA 1FJDA 2KI3A 3IHZA 1FKHA 1N1AA 1QPLA 3I6CA 1FKRA 4O2TA 3UQIA 3TC5A 1ROUA 1W26A 1J4IA 4JFLA 4DRPA 2ZQUA 2FAPA 1HXVA 1EQ3A 4DRNA 1BKFA 1Q6UA 3IKDA 4JFKA 4JFMA 3RGCA 4ODLA 2RUCA 4ODOA 1F40A 1FKIA 5DIUA 3H9RB 1KT1A 3KZ7A 2MNTA 3KAGA 2ZR6A 2ZQVA 2DG4A 3JYJA 4U86A 4TNSA 1BL4A 3O5KA 3PRBA 4IQ2A 1FKLA 2KR7A 2M1IA 1ZK6A 5BXJA 5HTGA 3IKGA 1TCOC 2RSEA 5HW7A 3UI6A 1Q6IA 1R9HA 3FAPA 3IK8A 2XPBA 2RUQA 2XP7A 1JNSA 4IQCA 3KCEA 1EYMA 2MPHA 1J4RA 2MLZA 2RURA 2Q5AA 4JFIA 4ODPA 3TCZA 4DH0A 2DG9A 4DRJA 4DZ2A 1FAPA 2VCDA 4G50A 4DRIA 2PV3A 3UI4A 2OFNA 3GPKA 4TW7A 3ODKA 1FKDA 3UQBA 2F2DA 2XP3A 3PA7A 2ZQSA 2XPAA 4LAWA 1Q1CA 1JNTA 4MGVA 2PPNA 2Y78A 2ZR5A 5HW8A 2ZQTA 4LAXA 2LGOA 5HT1A 1J4HA 1FKBA 2UZ5A 2XP8A 3NRKA 3O5OA 3O5IA 4U85A 1NMWA 1C9HA 4GGQA 2VN1A 2PPOA 3KACA 3KADA 5HWCA 2LPVA 2ZR4A 4ODKA 2M08A 4TYOA 2PV1A 1P5QA 4U84A 3CGMA 2KGJA 3O5JA 1ZCNA 2JZVA 4DT4A 2M2AA 3LUOA 4JFJA 1NMVA 2LKNA 2LJ4A
chains in the Genus database with same CATH superfamily
3AS2A 5DIVA 2KE0A 3RM4A 4KR0B 2MF9A 2PV2A 1GUVA 3UF8A 1W9VA 1ZL1A 3OOBA 1XHGA 2RQSA 1OGBA 1QPFA 1LL7A 4J4OA 4DROA 2WLYA 3ARYA 2L2SA 1FKGA 1W9PA 1EIBA 3B8SA 1FKSA 2A3AA 2OLHA 5DF0A 4JYSA 4ODMA 3UQAA 4DRQA 4Z2JA 4TW8A 4WJXA 2D9FA 2PBCA 3EY6A 2DG3A 4W9OA 1YW5A 4W9QA 4IPXA 4FAPA 2AWGA 1D2KA 3G6MA 1KT0A 4IT4A 1HJWA 3ARSA 1M5YA 4DZ3A 3IHZA 5DEZA 3I6CA 2G41A 4KQZA 4DRPA 1GPFA 3B9DA 1NWRA 5HBFA 3RM9A 2ZR6A 2ZQVA 4PTMA 4WIWA 4U86A 1BL4A 3O5KA 3PRBA 1HJXA 1FKLA 2M1IA 5BXJA 5HTGA 1TCOC 2RSEA 5HW7A 4HARA 4IQCA 1EYMA 3BMBA 1J4RA 3CH9A 4ZPVR 2MLZA 2RURA 4ODPA 3TCZA 4L3NA 1VF8A 1K9TA 2F2DA 4DWSA 1Q1CA 2Y78A 3ARZA 2XP8A 3NRKA 1WB0A 2WK2A 2DSVA 3ARPA 4ODKA 4U84A 1FFRA 1EDQA 2KGJA 3O5JA 1H0IA 2JZVA 2M2AA 4P8WA 3IK8A 1XRVA 1ROTA 4XAKA 2F4EA 1HKIA 4W9PA 5GPRA 4BF8A 2KO7A 5HW6A 2PI6A 4URIA 3O5MA 1PINA 3CZ8A 1A7XA 4FN2A 3WQWA 3TDBA 1TFVA 2WLZA 3KAHA 3WIJA 3NI6A 4GIVA 1D6OA 5B8IC 2YBTA 3O5LA 4P8XA 2A3EA 4QT2A 1YATA 1FKFA 3O5GA 3CGNA 1T11A 1Q6HA 4J4NA 5I98A 3B7XA 3CHFA 1NH6A 2O9OA 3O5FA 4P8VA 2YBUA 3ARUA 1W1TA 1E44A 3O5DA 4LAYA 5HUAA 4ZS6A 1LG1A 1UR8A 1UR9A 3JXVA 1JNEA 1IX5A 1FKRA 1E15A 2A3CA 1ROUA 3UQIA 4JFLA 2ZQUA 2FAPA 2RUCA 4Z2HA 1FKIA 1OGGA 2QF8A 1KT1A 1NWUA 2MNTA 3FY1A 3ARQA 2DG4A 3JYJA 1E6NA 4IQ2A 2KR7A 1ZB5A 3IKGA 3ARWA 3AS3A 3UI6A 1R9HA 3WD2A 1SR0A 2XPBA 1JCHB 4LGXA 2Q5AA 1L1PA 2DSZA 4DRJA 2VCDA 3UI4A 1W1VA 2OFNA 4L72B 4TW7A 3ODKA 1FKDA 1WNOA 2XP3A 3UQBA 2XPAA 3OA5A 4ML4A 2PPNA 2ZR5A 3CHCA 3WD4A 5HT1A 2UZ5A 3O5OA 2B5UB 4U85A 1NMWA 3WD3A 3CHEA 3KACA 4P8UA 2LPVA 2P4VA 4TYOA 3B9EA 4HBEA 1E6PA 1JNDA 1OWQA 4IT6A 4JFJA 2O92A 1H0GA 3JYMA 2XP9A 3G6LA 4QIBA 1FKKA 3WD0A 4N19A 1HKKA 4TW6A 4LAVA 4WK9A 4TX0A 4ODQA 4MNMA 1HKJA 5HWBA 1E9LA 3WQVA 1LL6A 1LG2A 4DRKA 2F23A 1NWTA 2WM0A 4MAVA 5HKGA 2ESCA 4R0XA 4DWSB 1W9UA 2XP6A 2A3BA 3FXYA 4ITZA 3WL1A 1ZBVA 3EIPA 2RUDA 1ZU8A 4DIPA 4MSPA 3RFWA 1LL4A 1F8AB 3ALFA 2MLXA 3AS1A 3CHDA 3KABA 1HJVA 2IUZA 2PPPA 4QT3A 3NTPA 1FKJA 3GTYX 5GPGA 4NSBA 5DO2A 1FFQA 4C02B 1NSGA 3O5EA 3UI5A 1FKHA 4S3JA 3TC5A 4HBOA 4JFKA 4JFMA 3WKZA 4NZCA 3KZ7A 3KAGA 1RD6A 3WL0A 4MPKA 4TNSA 1ZK6A 3PR9A 3RM8A 1WAWA 5JH8A 1JNSA 3KCEA 2MPHA 4WKFA 4DZ2A 4DH0A 2DG9A 3RMEA 4QZVB 4G50A 3W4RA 4DRIA 3GPKA 3PRAA 4LAWA 4MGVA 3AS0A 1CTNA 2B31A 2ETNA 3AROA 2ZQTA 4S3KA 3ARXA 4LAXA 1ZBWA 3O5IA 1C9HA 2PPOA 5HWCA 1GOIA 2M08A 2PV1A 4Z2GA 3CGMA 1X6NA 1GRJA 3LUOA 2LJ4A 4Z2IA 3WD1A 1D7JA 1Y0OA 1D7HA 3MDYB 3KAIA 1QZ2A 3QOKA 3VAWA 5J6EA 4DRHA 4WKAA 4DWSC 1LQ0A 1JVWA 4DRMA 1E6RA 2N87A 2DT0A 3O5RA 3O5PA 2FDMA 1D7IA 2K8IA 2XP4A 4ZPWR 1U79A 1FKTA 1O6IA 2ITKA 5D75A 2F21A 3WH0A 2IF4A 5GQBA 5DITA 1LJYA 2MLYA 1PBKA 1J6YA 4MNKA 2XP5A 4DWSD 4NNRA 4UDMA 3ARRA 2DSWA 3PRDA 3ARTA 4MTVA 4G2PA 1B6CA 4ODNA 2FKEA 3BXWA 3O5QA 4WKHA 1FD9A 3AQUA 4ODRA 3KAFA 4Q22A 2KFWA 1ITXA 2KI3A 4Z2KA 1FJDA 1N1AA 1QPLA 4O2TA 4ZPTR 2AOSA 1W26A 3ALGA 1J4IA 1HXVA 1EQ3A 4DRNA 1BKFA 1Q6UA 3IKDA 1NWSA 3RGCA 4ODLA 4ODOA 1F40A 5DIUA 3H9RB 1EHNA 4R5EA 1X6LA 3ARVA 4W5UA 4Q7NA 2DT2A 2G8ZA 1ZBCA 1Q6IA 1W1YA 2DPEA 2PN0A 3FAPA 2RUQA 2XP7A 1E6ZA 3B9AA 4JFIA 4AY1A 1FAPA 1SYTA 2PV3A 3PA7A 2DT1A 2ZQSA 1JNTA 3GU0A 5HW8A 4Z2LA 2LGOA 1J4HA 1FKBA 1W1PA 4GGQA 2VN1A 3KADA 1HKMA 2EULA 2ZR4A 4MNLA 1ZBKA 1KFWA 4MNJA 1P5QA 2DSUA 1ZCNA 4DT4A 1NMVA 2LKNA 2DT3A
chains in the Genus database with same CATH topology
3AS2A 5DIVA 2KE0A 3RM4A 4KR0B 2MF9A 2PV2A 1GUVA 3UF8A 1W9VA 1ZL1A 3OOBA 1XHGA 2RQSA 1OGBA 1QPFA 1LL7A 4J4OA 4DROA 2WLYA 3ARYA 2L2SA 1FKGA 1W9PA 1EIBA 3B8SA 1FKSA 2A3AA 2OLHA 5DF0A 4JYSA 4ODMA 3UQAA 4DRQA 4Z2JA 4TW8A 4WJXA 2D9FA 2PBCA 3EY6A 2DG3A 4W9OA 1YW5A 4W9QA 4IPXA 4FAPA 2AWGA 1D2KA 3G6MA 1KT0A 4IT4A 1HJWA 3ARSA 1M5YA 4DZ3A 3IHZA 5DEZA 3I6CA 2G41A 4KQZA 4DRPA 1GPFA 3B9DA 1NWRA 5HBFA 3RM9A 2ZR6A 2ZQVA 4PTMA 4WIWA 4U86A 1BL4A 3O5KA 3PRBA 1HJXA 1FKLA 2M1IA 5BXJA 5HTGA 1TCOC 2RSEA 5HW7A 4HARA 4IQCA 1EYMA 1J4RA 3CH9A 4ZPVR 2MLZA 2RURA 4ODPA 3TCZA 4L3NA 1VF8A 1K9TA 2F2DA 4DWSA 1Q1CA 2Y78A 3ARZA 2XP8A 3NRKA 1WB0A 2WK2A 2DSVA 3ARPA 4ODKA 4U84A 1FFRA 1EDQA 2KGJA 3O5JA 1H0IA 2JZVA 2M2AA 4P8WA 3IK8A 1XRVA 1ROTA 4XAKA 2F4EA 1HKIA 4W9PA 5GPRA 4BF8A 2KO7A 5HW6A 2PI6A 4URIA 3O5MA 1PINA 3CZ8A 1A7XA 4FN2A 3WQWA 3TDBA 1TFVA 2WLZA 3KAHA 3WIJA 3NI6A 4GIVA 1D6OA 5B8IC 2YBTA 3O5LA 4P8XA 2A3EA 4QT2A 1YATA 1FKFA 3O5GA 3CGNA 1T11A 1Q6HA 4J4NA 5I98A 3B7XA 3CHFA 1NH6A 2O9OA 3O5FA 4P8VA 2YBUA 3ARUA 1W1TA 3O5DA 4LAYA 5HUAA 4ZS6A 1LG1A 1UR8A 1UR9A 3JXVA 1JNEA 1IX5A 1FKRA 1E15A 2A3CA 1ROUA 3UQIA 4JFLA 2ZQUA 2FAPA 2RUCA 4Z2HA 1FKIA 1OGGA 2QF8A 1KT1A 1NWUA 2MNTA 3FY1A 3ARQA 2DG4A 3JYJA 1E6NA 4IQ2A 2KR7A 1ZB5A 3IKGA 3ARWA 3AS3A 3UI6A 1R9HA 3WD2A 1SR0A 2XPBA 4LGXA 2Q5AA 1L1PA 2DSZA 4DRJA 2VCDA 3UI4A 1W1VA 2OFNA 4L72B 4TW7A 3ODKA 1FKDA 1WNOA 2XP3A 3UQBA 2XPAA 3OA5A 4ML4A 2PPNA 2ZR5A 3CHCA 3WD4A 5HT1A 2UZ5A 3O5OA 4U85A 1NMWA 3WD3A 3CHEA 3KACA 4P8UA 2LPVA 4TYOA 3B9EA 4HBEA 1E6PA 1JNDA 1OWQA 4IT6A 4JFJA 2O92A 1H0GA 3JYMA 2XP9A 3G6LA 4QIBA 1FKKA 3WD0A 4N19A 1HKKA 4TW6A 4LAVA 4WK9A 4TX0A 4ODQA 4MNMA 1HKJA 5HWBA 1E9LA 3WQVA 1LL6A 1LG2A 4DRKA 1NWTA 2WM0A 4MAVA 5HKGA 2ESCA 4R0XA 4DWSB 1W9UA 2XP6A 2A3BA 3FXYA 4ITZA 3WL1A 1ZBVA 2RUDA 1ZU8A 4DIPA 4MSPA 3RFWA 1LL4A 1F8AB 3ALFA 2MLXA 3AS1A 3CHDA 3KABA 1HJVA 2IUZA 2PPPA 4QT3A 3NTPA 1FKJA 5GPGA 4NSBA 5DO2A 1FFQA 4C02B 1NSGA 3O5EA 3UI5A 1FKHA 4S3JA 3TC5A 4HBOA 4JFKA 4JFMA 3WKZA 4NZCA 3KZ7A 3KAGA 1RD6A 3WL0A 4MPKA 4TNSA 1ZK6A 3PR9A 3RM8A 1WAWA 5JH8A 1JNSA 3KCEA 2MPHA 4WKFA 4DZ2A 4DH0A 2DG9A 3RMEA 4QZVB 4G50A 3W4RA 4DRIA 3GPKA 3PRAA 4LAWA 4MGVA 3AS0A 1CTNA 2B31A 3AROA 2ZQTA 4S3KA 3ARXA 4LAXA 1ZBWA 3O5IA 1C9HA 2PPOA 5HWCA 1GOIA 2M08A 2PV1A 4Z2GA 3CGMA 1X6NA 3LUOA 2LJ4A 4Z2IA 3WD1A 1D7JA 1Y0OA 1D7HA 3MDYB 3KAIA 1QZ2A 3QOKA 3VAWA 5J6EA 4DRHA 4WKAA 4DWSC 1LQ0A 1JVWA 4DRMA 1E6RA 2N87A 2DT0A 3O5RA 3O5PA 2FDMA 1D7IA 2K8IA 2XP4A 4ZPWR 1U79A 1FKTA 1O6IA 2ITKA 5D75A 2F21A 3WH0A 2IF4A 5GQBA 5DITA 1LJYA 2MLYA 1PBKA 1J6YA 4MNKA 2XP5A 4DWSD 4NNRA 3ARRA 2DSWA 3PRDA 3ARTA 4MTVA 4G2PA 1B6CA 4ODNA 2FKEA 3BXWA 3O5QA 4WKHA 1FD9A 3AQUA 4ODRA 3KAFA 4Q22A 2KFWA 1ITXA 2KI3A 4Z2KA 1FJDA 1N1AA 1QPLA 4O2TA 4ZPTR 2AOSA 1W26A 3ALGA 1J4IA 1HXVA 1EQ3A 4DRNA 1BKFA 1Q6UA 3IKDA 1NWSA 3RGCA 4ODLA 4ODOA 1F40A 5DIUA 3H9RB 1EHNA 4R5EA 1X6LA 3ARVA 4W5UA 4Q7NA 2DT2A 2G8ZA 1ZBCA 1Q6IA 1W1YA 2DPEA 3FAPA 2RUQA 2XP7A 1E6ZA 3B9AA 4JFIA 4AY1A 1FAPA 1SYTA 2PV3A 3PA7A 2DT1A 2ZQSA 1JNTA 5HW8A 4Z2LA 2LGOA 1J4HA 1FKBA 1W1PA 4GGQA 2VN1A 3KADA 1HKMA 2ZR4A 4MNLA 1ZBKA 1KFWA 4MNJA 1P5QA 2DSUA 1ZCNA 4DT4A 1NMVA 2LKNA 2DT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIV A;  2KE0 A;  1D7J A;  3JYM A;  2XP9 A;  4QIB A;  1Y0O A;  1FKK A;  1D7H A;  2MF9 A;  3MDY B;  2PV2 A;  3KAI A;  1QZ2 A;  3VAW A;  1ROT A;  5J6E A;  4N19 A;  4TW6 A;  4DRH A;  4LAV A;  2F4E A;  4W9P A;  4TX0 A;  4BF8 A;  4ODQ A;  3UF8 A;  2KO7 A;  5HW6 A;  5HWB A;  1JVW A;  4DRM A;  3OOB A;  2N87 A;  2RQS A;  1QPF A;  4DRK A;  3O5R A;  1PIN A;  3O5M A;  3O5P A;  1A7X A;  4J4O A;  4DRO A;  5HKG A;  4FN2 A;  4R0X A;  3TDB A;  1D7I A;  2K8I A;  2XP4 A;  1U79 A;  1FKT A;  2XP6 A;  3KAH A;  2L2S A;  1FKG A;  1D6O A;  3NI6 A;  4GIV A;  5B8I C;  4ITZ A;  2ITK A;  3O5L A;  5D75 A;  2F21 A;  4QT2 A;  1YAT A;  1FKF A;  3O5G A;  2IF4 A;  2RUD A;  1T11 A;  3CGN A;  3WH0 A;  1Q6H A;  1FKS A;  4J4N A;  5DIT A;  4DIP A;  2MLY A;  4JYS A;  4ODM A;  1PBK A;  4MSP A;  4TW8 A;  3B7X A;  4DRQ A;  5I98 A;  2D9F A;  3UQA A;  3RFW A;  1J6Y A;  2XP5 A;  1F8A B;  2PBC A;  3EY6 A;  4NNR A;  2DG3 A;  2MLX A;  3PRD A;  4W9O A;  3KAB A;  1YW5 A;  4W9Q A;  4IPX A;  1L1P A;  4FAP A;  3O5F A;  4G2P A;  2PPP A;  4LAY A;  3NTP A;  2AWG A;  1B6C A;  1FKJ A;  3O5D A;  4ODN A;  4QT3 A;  2FKE A;  5GPG A;  5HUA A;  3O5Q A;  1KT0 A;  1FD9 A;  4ODR A;  3JXV A;  1NSG A;  3O5E A;  4C02 B;  3KAF A;  1M5Y A;  4DZ3 A;  3UI5 A;  2KFW A;  1FJD A;  2KI3 A;  3IHZ A;  1FKH A;  1N1A A;  1QPL A;  3I6C A;  1FKR A;  4O2T A;  3UQI A;  3TC5 A;  1ROU A;  1W26 A;  1J4I A;  4JFL A;  4DRP A;  2ZQU A;  2FAP A;  1HXV A;  1EQ3 A;  4DRN A;  1BKF A;  1Q6U A;  3IKD A;  4JFK A;  4JFM A;  3RGC A;  4ODL A;  2RUC A;  4ODO A;  1F40 A;  1FKI A;  5DIU A;  3H9R B;  1KT1 A;  3KZ7 A;  2MNT A;  3KAG A;  2ZR6 A;  2ZQV A;  2DG4 A;  3JYJ A;  4U86 A;  4TNS A;  1BL4 A;  3O5K A;  3PRB A;  4IQ2 A;  1FKL A;  2KR7 A;  2M1I A;  1ZK6 A;  5BXJ A;  5HTG A;  3IKG A;  1TCO C;  2RSE A;  5HW7 A;  3UI6 A;  1Q6I A;  1R9H A;  3FAP A;  3IK8 A;  2XPB A;  2RUQ A;  2XP7 A;  1JNS A;  4IQC A;  3KCE A;  1EYM A;  2MPH A;  1J4R A;  2MLZ A;  2RUR A;  2Q5A A;  4JFI A;  4ODP A;  3TCZ A;  4DH0 A;  2DG9 A;  4DRJ A;  4DZ2 A;  1FAP A;  2VCD A;  4G50 A;  4DRI A;  2PV3 A;  3UI4 A;  2OFN A;  3GPK A;  4TW7 A;  3ODK A;  1FKD A;  3UQB A;  2F2D A;  2XP3 A;  3PA7 A;  2ZQS A;  2XPA A;  4LAW A;  1Q1C A;  1JNT A;  4MGV A;  2PPN A;  2Y78 A;  2ZR5 A;  5HW8 A;  2ZQT A;  4LAX A;  2LGO A;  5HT1 A;  1J4H A;  1FKB A;  2UZ5 A;  2XP8 A;  3NRK A;  3O5O A;  3O5I A;  4U85 A;  1NMW A;  1C9H A;  4GGQ A;  2VN1 A;  2PPO A;  3KAC A;  3KAD A;  5HWC A;  2LPV A;  2ZR4 A;  4ODK A;  2M08 A;  4TYO A;  2PV1 A;  1P5Q A;  4U84 A;  3CGM A;  2KGJ A;  3O5J A;  1ZCN A;  2JZV A;  4DT4 A;  2M2A A;  3LUO A;  4JFJ A;  1NMV A;  2LKN A;  2LJ4 A; 
#chains in the Genus database with same CATH topology
 3AS2 A;  5DIV A;  2KE0 A;  3RM4 A;  4KR0 B;  2MF9 A;  2PV2 A;  1GUV A;  3UF8 A;  1W9V A;  1ZL1 A;  3OOB A;  1XHG A;  2RQS A;  1OGB A;  1QPF A;  1LL7 A;  4J4O A;  4DRO A;  2WLY A;  3ARY A;  2L2S A;  1FKG A;  1W9P A;  1EIB A;  3B8S A;  1FKS A;  2A3A A;  2OLH A;  5DF0 A;  4JYS A;  4ODM A;  3UQA A;  4DRQ A;  4Z2J A;  4TW8 A;  4WJX A;  2D9F A;  2PBC A;  3EY6 A;  2DG3 A;  4W9O A;  1YW5 A;  4W9Q A;  4IPX A;  4FAP A;  2AWG A;  1D2K A;  3G6M A;  1KT0 A;  4IT4 A;  1HJW A;  3ARS A;  1M5Y A;  4DZ3 A;  3IHZ A;  5DEZ A;  3I6C A;  2G41 A;  4KQZ A;  4DRP A;  1GPF A;  3B9D A;  1NWR A;  5HBF A;  3RM9 A;  2ZR6 A;  2ZQV A;  4PTM A;  4WIW A;  4U86 A;  1BL4 A;  3O5K A;  3PRB A;  1HJX A;  1FKL A;  2M1I A;  5BXJ A;  5HTG A;  1TCO C;  2RSE A;  5HW7 A;  4HAR A;  4IQC A;  1EYM A;  3BMB A;  1J4R A;  3CH9 A;  4ZPV R;  2MLZ A;  2RUR A;  4ODP A;  3TCZ A;  4L3N A;  1VF8 A;  1K9T A;  2F2D A;  4DWS A;  1Q1C A;  2Y78 A;  3ARZ A;  2XP8 A;  3NRK A;  1WB0 A;  2WK2 A;  2DSV A;  3ARP A;  4ODK A;  4U84 A;  1FFR A;  1EDQ A;  2KGJ A;  3O5J A;  1H0I A;  2JZV A;  2M2A A;  4P8W A;  3IK8 A;  1XRV A;  1ROT A;  4XAK A;  2F4E A;  1HKI A;  4W9P A;  5GPR A;  4BF8 A;  2KO7 A;  5HW6 A;  2PI6 A;  4URI A;  3O5M A;  1PIN A;  3CZ8 A;  1A7X A;  4FN2 A;  3WQW A;  3TDB A;  1TFV A;  2WLZ A;  3KAH A;  3WIJ A;  3NI6 A;  4GIV A;  1D6O A;  5B8I C;  2YBT A;  3O5L A;  4P8X A;  2A3E A;  4QT2 A;  1YAT A;  1FKF A;  3O5G A;  3CGN A;  1T11 A;  1Q6H A;  4J4N A;  5I98 A;  3B7X A;  3CHF A;  1NH6 A;  2O9O A;  3O5F A;  4P8V A;  2YBU A;  3ARU A;  1W1T A;  1E44 A;  3O5D A;  4LAY A;  5HUA A;  4ZS6 A;  1LG1 A;  1UR8 A;  1UR9 A;  3JXV A;  1JNE A;  1IX5 A;  1FKR A;  1E15 A;  2A3C A;  1ROU A;  3UQI A;  4JFL A;  2ZQU A;  2FAP A;  2RUC A;  4Z2H A;  1FKI A;  1OGG A;  2QF8 A;  1KT1 A;  1NWU A;  2MNT A;  3FY1 A;  3ARQ A;  2DG4 A;  3JYJ A;  1E6N A;  4IQ2 A;  2KR7 A;  1ZB5 A;  3IKG A;  3ARW A;  3AS3 A;  3UI6 A;  1R9H A;  3WD2 A;  1SR0 A;  2XPB A;  1JCH B;  4LGX A;  2Q5A A;  1L1P A;  2DSZ A;  4DRJ A;  2VCD A;  3UI4 A;  1W1V A;  2OFN A;  4L72 B;  4TW7 A;  3ODK A;  1FKD A;  1WNO A;  2XP3 A;  3UQB A;  2XPA A;  3OA5 A;  4ML4 A;  2PPN A;  2ZR5 A;  3CHC A;  3WD4 A;  5HT1 A;  2UZ5 A;  3O5O A;  2B5U B;  4U85 A;  1NMW A;  3WD3 A;  3CHE A;  3KAC A;  4P8U A;  2LPV A;  2P4V A;  4TYO A;  3B9E A;  4HBE A;  1E6P A;  1JND A;  1OWQ A;  4IT6 A;  4JFJ A;  2O92 A;  1H0G A;  3JYM A;  2XP9 A;  3G6L A;  4QIB A;  1FKK A;  3WD0 A;  4N19 A;  1HKK A;  4TW6 A;  4LAV A;  4WK9 A;  4TX0 A;  4ODQ A;  4MNM A;  1HKJ A;  5HWB A;  1E9L A;  3WQV A;  1LL6 A;  1LG2 A;  4DRK A;  2F23 A;  1NWT A;  2WM0 A;  4MAV A;  5HKG A;  2ESC A;  4R0X A;  4DWS B;  1W9U A;  2XP6 A;  2A3B A;  3FXY A;  4ITZ A;  3WL1 A;  1ZBV A;  3EIP A;  2RUD A;  1ZU8 A;  4DIP A;  4MSP A;  3RFW A;  1LL4 A;  1F8A B;  3ALF A;  2MLX A;  3AS1 A;  3CHD A;  3KAB A;  1HJV A;  2IUZ A;  2PPP A;  4QT3 A;  3NTP A;  1FKJ A;  3GTY X;  5GPG A;  4NSB A;  5DO2 A;  1FFQ A;  4C02 B;  1NSG A;  3O5E A;  3UI5 A;  1FKH A;  4S3J A;  3TC5 A;  4HBO A;  4JFK A;  4JFM A;  3WKZ A;  4NZC A;  3KZ7 A;  3KAG A;  1RD6 A;  3WL0 A;  4MPK A;  4TNS A;  1ZK6 A;  3PR9 A;  3RM8 A;  1WAW A;  5JH8 A;  1JNS A;  3KCE A;  2MPH A;  4WKF A;  4DZ2 A;  4DH0 A;  2DG9 A;  3RME A;  4QZV B;  4G50 A;  3W4R A;  4DRI A;  3GPK A;  3PRA A;  4LAW A;  4MGV A;  3AS0 A;  1CTN A;  2B31 A;  2ETN A;  3ARO A;  2ZQT A;  4S3K A;  3ARX A;  4LAX A;  1ZBW A;  3O5I A;  1C9H A;  2PPO A;  5HWC A;  1GOI A;  2M08 A;  2PV1 A;  4Z2G A;  3CGM A;  1X6N A;  1GRJ A;  3LUO A;  2LJ4 A;  4Z2I A;  3WD1 A;  1D7J A;  1Y0O A;  1D7H A;  3MDY B;  3KAI A;  1QZ2 A;  3QOK A;  3VAW A;  5J6E A;  4DRH A;  4WKA A;  4DWS C;  1LQ0 A;  1JVW A;  4DRM A;  1E6R A;  2N87 A;  2DT0 A;  3O5R A;  3O5P A;  2FDM A;  1D7I A;  2K8I A;  2XP4 A;  4ZPW R;  1U79 A;  1FKT A;  1O6I A;  2ITK A;  5D75 A;  2F21 A;  3WH0 A;  2IF4 A;  5GQB A;  5DIT A;  1LJY A;  2MLY A;  1PBK A;  1J6Y A;  4MNK A;  2XP5 A;  4DWS D;  4NNR A;  4UDM A;  3ARR A;  2DSW A;  3PRD A;  3ART A;  4MTV A;  4G2P A;  1B6C A;  4ODN A;  2FKE A;  3BXW A;  3O5Q A;  4WKH A;  1FD9 A;  3AQU A;  4ODR A;  3KAF A;  4Q22 A;  2KFW A;  1ITX A;  2KI3 A;  4Z2K A;  1FJD A;  1N1A A;  1QPL A;  4O2T A;  4ZPT R;  2AOS A;  1W26 A;  3ALG A;  1J4I A;  1HXV A;  1EQ3 A;  4DRN A;  1BKF A;  1Q6U A;  3IKD A;  1NWS A;  3RGC A;  4ODL A;  4ODO A;  1F40 A;  5DIU A;  3H9R B;  1EHN A;  4R5E A;  1X6L A;  3ARV A;  4W5U A;  4Q7N A;  2DT2 A;  2G8Z A;  1ZBC A;  1Q6I A;  1W1Y A;  2DPE A;  2PN0 A;  3FAP A;  2RUQ A;  2XP7 A;  1E6Z A;  3B9A A;  4JFI A;  4AY1 A;  1FAP A;  1SYT A;  2PV3 A;  3PA7 A;  2DT1 A;  2ZQS A;  1JNT A;  3GU0 A;  5HW8 A;  4Z2L A;  2LGO A;  1J4H A;  1FKB A;  1W1P A;  4GGQ A;  2VN1 A;  3KAD A;  1HKM A;  2EUL A;  2ZR4 A;  4MNL A;  1ZBK A;  1KFW A;  4MNJ A;  1P5Q A;  2DSU A;  1ZCN A;  4DT4 A;  1NMV A;  2LKN A;  2DT3 A; 
#chains in the Genus database with same CATH homology
 3AS2 A;  5DIV A;  2KE0 A;  3RM4 A;  4KR0 B;  2MF9 A;  2PV2 A;  1GUV A;  3UF8 A;  1W9V A;  1ZL1 A;  3OOB A;  1XHG A;  2RQS A;  1OGB A;  1QPF A;  1LL7 A;  4J4O A;  4DRO A;  2WLY A;  3ARY A;  2L2S A;  1FKG A;  1W9P A;  1EIB A;  3B8S A;  1FKS A;  2A3A A;  2OLH A;  5DF0 A;  4JYS A;  4ODM A;  3UQA A;  4DRQ A;  4Z2J A;  4TW8 A;  4WJX A;  2D9F A;  2PBC A;  3EY6 A;  2DG3 A;  4W9O A;  1YW5 A;  4W9Q A;  4IPX A;  4FAP A;  2AWG A;  1D2K A;  3G6M A;  1KT0 A;  4IT4 A;  1HJW A;  3ARS A;  1M5Y A;  4DZ3 A;  3IHZ A;  5DEZ A;  3I6C A;  2G41 A;  4KQZ A;  4DRP A;  1GPF A;  3B9D A;  1NWR A;  5HBF A;  3RM9 A;  2ZR6 A;  2ZQV A;  4PTM A;  4WIW A;  4U86 A;  1BL4 A;  3O5K A;  3PRB A;  1HJX A;  1FKL A;  2M1I A;  5BXJ A;  5HTG A;  1TCO C;  2RSE A;  5HW7 A;  4HAR A;  4IQC A;  1EYM A;  1J4R A;  3CH9 A;  4ZPV R;  2MLZ A;  2RUR A;  4ODP A;  3TCZ A;  4L3N A;  1VF8 A;  1K9T A;  2F2D A;  4DWS A;  1Q1C A;  2Y78 A;  3ARZ A;  2XP8 A;  3NRK A;  1WB0 A;  2WK2 A;  2DSV A;  3ARP A;  4ODK A;  4U84 A;  1FFR A;  1EDQ A;  2KGJ A;  3O5J A;  1H0I A;  2JZV A;  2M2A A;  4P8W A;  3IK8 A;  1XRV A;  1ROT A;  4XAK A;  2F4E A;  1HKI A;  4W9P A;  5GPR A;  4BF8 A;  2KO7 A;  5HW6 A;  2PI6 A;  4URI A;  3O5M A;  1PIN A;  3CZ8 A;  1A7X A;  4FN2 A;  3WQW A;  3TDB A;  1TFV A;  2WLZ A;  3KAH A;  3WIJ A;  3NI6 A;  4GIV A;  1D6O A;  5B8I C;  2YBT A;  3O5L A;  4P8X A;  2A3E A;  4QT2 A;  1YAT A;  1FKF A;  3O5G A;  3CGN A;  1T11 A;  1Q6H A;  4J4N A;  5I98 A;  3B7X A;  3CHF A;  1NH6 A;  2O9O A;  3O5F A;  4P8V A;  2YBU A;  3ARU A;  1W1T A;  3O5D A;  4LAY A;  5HUA A;  4ZS6 A;  1LG1 A;  1UR8 A;  1UR9 A;  3JXV A;  1JNE A;  1IX5 A;  1FKR A;  1E15 A;  2A3C A;  1ROU A;  3UQI A;  4JFL A;  2ZQU A;  2FAP A;  2RUC A;  4Z2H A;  1FKI A;  1OGG A;  2QF8 A;  1KT1 A;  1NWU A;  2MNT A;  3FY1 A;  3ARQ A;  2DG4 A;  3JYJ A;  1E6N A;  4IQ2 A;  2KR7 A;  1ZB5 A;  3IKG A;  3ARW A;  3AS3 A;  3UI6 A;  1R9H A;  3WD2 A;  1SR0 A;  2XPB A;  4LGX A;  2Q5A A;  1L1P A;  2DSZ A;  4DRJ A;  2VCD A;  3UI4 A;  1W1V A;  2OFN A;  4L72 B;  4TW7 A;  3ODK A;  1FKD A;  1WNO A;  2XP3 A;  3UQB A;  2XPA A;  3OA5 A;  4ML4 A;  2PPN A;  2ZR5 A;  3CHC A;  3WD4 A;  5HT1 A;  2UZ5 A;  3O5O A;  4U85 A;  1NMW A;  3WD3 A;  3CHE A;  3KAC A;  4P8U A;  2LPV A;  4TYO A;  3B9E A;  4HBE A;  1E6P A;  1JND A;  1OWQ A;  4IT6 A;  4JFJ A;  2O92 A;  1H0G A;  3JYM A;  2XP9 A;  3G6L A;  4QIB A;  1FKK A;  3WD0 A;  4N19 A;  1HKK A;  4TW6 A;  4LAV A;  4WK9 A;  4TX0 A;  4ODQ A;  4MNM A;  1HKJ A;  5HWB A;  1E9L A;  3WQV A;  1LL6 A;  1LG2 A;  4DRK A;  1NWT A;  2WM0 A;  4MAV A;  5HKG A;  2ESC A;  4R0X A;  4DWS B;  1W9U A;  2XP6 A;  2A3B A;  3FXY A;  4ITZ A;  3WL1 A;  1ZBV A;  2RUD A;  1ZU8 A;  4DIP A;  4MSP A;  3RFW A;  1LL4 A;  1F8A B;  3ALF A;  2MLX A;  3AS1 A;  3CHD A;  3KAB A;  1HJV A;  2IUZ A;  2PPP A;  4QT3 A;  3NTP A;  1FKJ A;  5GPG A;  4NSB A;  5DO2 A;  1FFQ A;  4C02 B;  1NSG A;  3O5E A;  3UI5 A;  1FKH A;  4S3J A;  3TC5 A;  4HBO A;  4JFK A;  4JFM A;  3WKZ A;  4NZC A;  3KZ7 A;  3KAG A;  1RD6 A;  3WL0 A;  4MPK A;  4TNS A;  1ZK6 A;  3PR9 A;  3RM8 A;  1WAW A;  5JH8 A;  1JNS A;  3KCE A;  2MPH A;  4WKF A;  4DZ2 A;  4DH0 A;  2DG9 A;  3RME A;  4QZV B;  4G50 A;  3W4R A;  4DRI A;  3GPK A;  3PRA A;  4LAW A;  4MGV A;  3AS0 A;  1CTN A;  2B31 A;  3ARO A;  2ZQT A;  4S3K A;  3ARX A;  4LAX A;  1ZBW A;  3O5I A;  1C9H A;  2PPO A;  5HWC A;  1GOI A;  2M08 A;  2PV1 A;  4Z2G A;  3CGM A;  1X6N A;  3LUO A;  2LJ4 A;  4Z2I A;  3WD1 A;  1D7J A;  1Y0O A;  1D7H A;  3MDY B;  3KAI A;  1QZ2 A;  3QOK A;  3VAW A;  5J6E A;  4DRH A;  4WKA A;  4DWS C;  1LQ0 A;  1JVW A;  4DRM A;  1E6R A;  2N87 A;  2DT0 A;  3O5R A;  3O5P A;  2FDM A;  1D7I A;  2K8I A;  2XP4 A;  4ZPW R;  1U79 A;  1FKT A;  1O6I A;  2ITK A;  5D75 A;  2F21 A;  3WH0 A;  2IF4 A;  5GQB A;  5DIT A;  1LJY A;  2MLY A;  1PBK A;  1J6Y A;  4MNK A;  2XP5 A;  4DWS D;  4NNR A;  3ARR A;  2DSW A;  3PRD A;  3ART A;  4MTV A;  4G2P A;  1B6C A;  4ODN A;  2FKE A;  3BXW A;  3O5Q A;  4WKH A;  1FD9 A;  3AQU A;  4ODR A;  3KAF A;  4Q22 A;  2KFW A;  1ITX A;  2KI3 A;  4Z2K A;  1FJD A;  1N1A A;  1QPL A;  4O2T A;  4ZPT R;  2AOS A;  1W26 A;  3ALG A;  1J4I A;  1HXV A;  1EQ3 A;  4DRN A;  1BKF A;  1Q6U A;  3IKD A;  1NWS A;  3RGC A;  4ODL A;  4ODO A;  1F40 A;  5DIU A;  3H9R B;  1EHN A;  4R5E A;  1X6L A;  3ARV A;  4W5U A;  4Q7N A;  2DT2 A;  2G8Z A;  1ZBC A;  1Q6I A;  1W1Y A;  2DPE A;  3FAP A;  2RUQ A;  2XP7 A;  1E6Z A;  3B9A A;  4JFI A;  4AY1 A;  1FAP A;  1SYT A;  2PV3 A;  3PA7 A;  2DT1 A;  2ZQS A;  1JNT A;  5HW8 A;  4Z2L A;  2LGO A;  1J4H A;  1FKB A;  1W1P A;  4GGQ A;  2VN1 A;  3KAD A;  1HKM A;  2ZR4 A;  4MNL A;  1ZBK A;  1KFW A;  4MNJ A;  1P5Q A;  2DSU A;  1ZCN A;  4DT4 A;  1NMV A;  2LKN A;  2DT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...