4DZ3A

Crystal structure of a peptidyl-prolyl cis-trans isomerase with surface mutation m61h from burkholderia pseudomallei complexed with fk506
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
STVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGHVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title A structural biology approach enables the development of antimicrobials targeting bacterial immunophilins.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 29
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dz3A00
1BL4A 3H9RB 3ODKA 4ITZA 5DIVA 1FKTA 4ODPA 2M1IA 4JFLA 4LAWA 3UI6A 3GPKA 1BKFA 4W9OA 5J6EA 1QPLA 1W26A 2ZQSA 4R0XA 2XP8A 4ODOA 3O5KA 2RURA 3NI6A 5GPGA 5I98A 2DG4A 2Q5AA 4DZ2A 4LAXA 2ZQUA 1FKLA 1Q1CA 2KGJA 2M2AA 2PV2A 4IQ2A 1KT0A 1FKSA 5HW8A 3NTPA 1A7XA 4N19A 2N87A 2VCDA 4DRQA 4ODNA 1NMWA 2MLYA 3TCZA 1J4HA 3TDBA 3MDYB 5HW6A 1U79A 2ITKA 4G2PA 2DG3A 2PPNA 1ROTA 2ZQVA 4LAVA 4FAPA 1NMVA 3WH0A 2XP6A 4DT4A 3O5FA 1PBKA 4DRHA 2KO7A 3O5GA 4GIVA 4J4OA 1FAPA 4IQCA 4J4NA 4QT3A 1FJDA 4TW8A 2XPBA 3O5OA 1J4RA 4U85A 3IHZA 1HXVA 2FAPA 3KAIA 4O2TA 3O5IA 2XP7A 1Y0OA 4ODMA 5HWCA 2RSEA 3JYMA 4GGQA 2IF4A 1P5QA 1FD9A 3O5JA 4DZ3A 1FKIA 4ODLA 1JNTA 3LUOA 4NNRA 1QPFA 3JXVA 1D6OA 3KADA 3UQIA 1D7JA 5HWBA 1L1PA 3OOBA 4TX0A 2XP4A 1J4IA 3EY6A 3KACA 1EYMA 4MGVA 1FKRA 2KR7A 2RUCA 1T11A 2PV1A 3CGMA 1R9HA 4JYSA 3CGNA 2FKEA 2UZ5A 4W9QA 4TNSA 2PBCA 4DRIA 1N1AA 1PINA 2F2DA 2M08A 4QT2A 1JVWA 4DRKA 4JFKA 4MSPA 3RGCA 4JFJA 2AWGA 4DIPA 1Q6HA 2F21A 1J6YA 2OFNA 4JFIA 3O5RA 4FN2A 3UQAA 2RQSA 2ZR5A 3KAFA 1FKHA 1EQ3A 1Q6UA 4C02B 3KCEA 3I6CA 3B7XA 4TW7A 2ZR6A 3VAWA 5HKGA 1C9HA 2D9FA 2LPVA 5B8IC 3IK8A 4JFMA 1FKBA 2L2SA 2KFWA 5BXJA 1Q6IA 1ZCNA 2MPHA 3O5EA 3FAPA 1F8AB 1FKJA 2XPAA 1M5YA 2RUDA 2PV3A 2XP5A 4G50A 2KI3A 4DRJA 2PPOA 3PRBA 2LGOA 4W9PA 2JZVA 2K8IA 3RFWA 4QIBA 4TYOA 4DRMA 4U86A 1TCOC 1QZ2A 5D75A 4DRPA 4BF8A 3UF8A 2XP9A 1KT1A 3KAGA 2MLXA 3KZ7A 1FKKA 2MLZA 3NRKA 2KE0A 2DG9A 4U84A 2MF9A 5HTGA 5HUAA 1D7HA 2ZQTA 1F40A 2F4EA 3O5DA 3UI4A 4ODQA 1FKDA 4DH0A 2PPPA 4ODRA 3JYJA 3IKDA 3O5MA 4LAYA 5HT1A 1YW5A 3O5PA 1D7IA 1ROUA 4TW6A 2ZR4A 5DITA 2LJ4A 3O5LA 3UI5A 1ZK6A 4DROA 4ODKA 2Y78A 3TC5A 3KABA 1B6CA 1FKGA 3KAHA 3O5QA 4IPXA 2VN1A 3IKGA 1FKFA 3UQBA 3PA7A 2LKNA 2MNTA 2RUQA 4DRNA 1YATA 5DIUA 1NSGA 2XP3A 3PRDA 5HW7A 1JNSA
chains in the Genus database with same CATH superfamily
1BL4A 1X6LA 4MNLA 3RMEA 3WQVA 1FKTA 2M1IA 4LAWA 1EDQA 3ARUA 4W9OA 1W26A 1LL6A 4IT6A 4AY1A 4ML4A 2RURA 4WK9A 2PN0A 5I98A 2IUZA 1Q1CA 3RM9A 4N19A 1JNEA 1NWUA 5HW6A 4XAKA 4FAPA 1ROTA 1NMVA 1RD6A 1LG1A 4GIVA 4Q7NA 4ZPVR 3KAIA 2XP7A 4WJXA 2RSEA 2YBUA 2IF4A 3O5JA 1IX5A 3EIPA 3JXVA 1D6OA 5HWBA 1W9PA 1L1PA 3WD3A 4TX0A 1FKRA 4URIA 4MGVA 3WD1A 2KR7A 2G8ZA 3CHCA 4JYSA 4DWSD 1X6NA 4JFKA 3RGCA 3AS3A 1Q6HA 1EHNA 4Z2IA 2RQSA 2ZR5A 2EULA 1Q6UA 4HBOA 2F23A 2WLZA 1C9HA 3FXYA 2YBTA 1FKBA 3GTYX 3ARSA 1ZCNA 3O5EA 2DSZA 3PRBA 4TYOA 4DRMA 1GUVA 5D75A 2XP9A 1KT1A 4R5EA 1EIBA 4L72B 3B9AA 1F40A 1H0IA 1FKDA 4ZPWR 2FDMA 1FFRA 3ARTA 3O5PA 5DF0A 3ALGA 2Y78A 4IPXA 1UR9A 1H0GA 3RM8A 3OA5A 1NSGA 3PRDA 2DT1A 1JNSA 2A3CA 2O9OA 4ITZA 3AQUA 5DIVA 4ODPA 4JFLA 1ZBKA 1HJXA 3B9DA 1QPLA 2ZQSA 3ARWA 4Z2JA 4MNKA 2PI6A 5GPGA 3NI6A 2DG4A 2WLYA 4S3KA 4LAXA 1FKLA 2PV2A 4IQ2A 1KT0A 1A7XA 2VCDA 4ODNA 2MLYA 1J4HA 2ITKA 4G2PA 1UR8A 1HJVA 2XP6A 1ZBCA 4DRHA 4P8XA 2ETNA 1CTNA 4J4OA 4QT3A 2XPBA 1J4RA 3CHEA 3IHZA 4KR0B 2QF8A 4ODMA 4WKFA 1HKIA 4GGQA 2P4VA 1FKIA 4ODLA 3LUOA 3ARVA 4NNRA 3KADA 4Z2KA 1ZB5A 3AS0A 2XP4A 2RUCA 3WIJA 2UZ5A 2AOSA 1OWQA 4W9QA 2PBCA 4DRIA 1PINA 2F2DA 4MSPA 4JFJA 2AWGA 1J6YA 4IT4A 2OFNA 4HARA 1ZBVA 1JNDA 3KCEA 1D2KA 2DT2A 3VAWA 4MTVA 3WL0A 2L2SA 1Q6IA 3FAPA 4G50A 2XP5A 2PV3A 4DRJA 2PPOA 2JZVA 2K8IA 5HBFA 1KFWA 2DT3A 3UF8A 3KZ7A 3KAGA 2MLXA 1FKKA 3NRKA 3ARRA 4U84A 2MF9A 5HTGA 4S3JA 2WK2A 3WKZA 3UI4A 4DH0A 3WL1A 2PPPA 3JYJA 1D7IA 4WIWA 4DROA 1HKJA 1E6ZA 1B6CA 1FKGA 1W1PA 2DT0A 4WKHA 2DPEA 1W9VA 1FKFA 2VN1A 1HJWA 2MNTA 2RUQA 4DRNA 2ZQVA 1OGBA 5GQBA 3ODKA 1NWTA 3UI6A 1K9TA 1BKFA 5J6EA 4R0XA 4ODOA 2Q5AA 3AS2A 4DZ2A 2ZQUA 2M2AA 1FKSA 5HW8A 3TDBA 1XRVA 1NWRA 1VF8A 2PPNA 4LAVA 3PR9A 5DEZA 2KO7A 3O5GA 1FAPA 4J4NA 4TW8A 4KQZA 1GOIA 1GPFA 3ARPA 2FAPA 4O2TA 1NWSA 3O5IA 1Y0OA 5HWCA 1P5QA 2OLHA 1JNTA 1QPFA 3CH9A 1D7JA 2A3EA 4PTMA 1O6IA 1J4IA 1LJYA 3CGNA 2FKEA 4MNJA 4TNSA 1N1AA 2DSUA 2M08A 1JVWA 4DRKA 2F21A 3O5RA 4FN2A 3KAFA 1EQ3A 3RM4A 4C02B 1LL7A 4MNMA 3I6CA 4TW7A 2ZR6A 3GU0A 1ZL1A 4L3NA 5B8IC 3IK8A 5BXJA 1E15A 3UQAA 1F8AB 1FKJA 2RUDA 3RFWA 4QIBA 3BXWA 4U86A 4P8VA 2ESCA 4ZS6A 2DG9A 1E6RA 1HKMA 1D7HA 1ITXA 2F4EA 1ZBWA 4LAYA 4NZCA 3ARZA 5HT1A 3O5LA 3UI5A 2A3BA 3TC5A 3KABA 3O5QA 3IKGA 4NSBA 3UQBA 1E44A 3PRAA 2LKNA 3WD0A 1SYTA 1LQ0A 5DIUA 3G6LA 3ARXA 3H9RB 2DSWA 4Z2LA 3GPKA 5JH8A 2A3AA 2XP8A 3O5KA 5DO2A 1GRJA 2KGJA 5GPRA 3CHDA 3B9EA 3NTPA 1HKKA 1NH6A 2N87A 4DRQA 1NMWA 3TCZA 3MDYB 3ALFA 4Q22A 1U79A 3AS1A 2DG3A 3WH0A 3WQWA 1ZU8A 4DT4A 3O5FA 1PBKA 4DWSA 4IQCA 4HBEA 1FJDA 1XHGA 2O92A 3BMBA 3O5OA 4U85A 4W5UA 4P8WA 1HXVA 1WNOA 1E9LA 4MAVA 3JYMA 1SR0A 1FD9A 1E6PA 4LGXA 4DZ3A 4ZPTR 3UQIA 3W4RA 4P8UA 3G6MA 3OOBA 1LL4A 2DSVA 3EY6A 3KACA 1EYMA 1WAWA 1T11A 2PV1A 1LG2A 3CGMA 1R9HA 1W1TA 2B5UB 1WB0A 3CHFA 4QT2A 4Z2HA 4Z2GA 2WM0A 4QZVB 1E6NA 1OGGA 4DIPA 4JFIA 1FKHA 2G41A 1FFQA 3B7XA 5HKGA 2D9FA 4DWSB 2LPVA 4JFMA 3CZ8A 1W1VA 2KFWA 2MPHA 2XPAA 1M5YA 2KI3A 2LGOA 4W9PA 4WKAA 1W1YA 3WD4A 1TCOC 1QZ2A 3AROA 3FY1A 4DRPA 4BF8A 2MLZA 2KE0A 4DWSC 1JCHB 3WD2A 5HUAA 2ZQTA 3B8SA 3ARYA 3O5DA 4ODQA 4ODRA 1TFVA 3QOKA 3IKDA 3O5MA 1W9UA 1YW5A 1ROUA 4TW6A 5DITA 2ZR4A 2LJ4A 1ZK6A 4ODKA 2B31A 3KAHA 4MPKA 3PA7A 1YATA 5HW7A 2XP3A 4UDMA 3ARQA
chains in the Genus database with same CATH topology
1BL4A 1X6LA 4MNLA 3RMEA 3WQVA 1FKTA 2M1IA 4LAWA 1EDQA 3ARUA 4W9OA 1W26A 1LL6A 4IT6A 4AY1A 4ML4A 2RURA 4WK9A 5I98A 2IUZA 1Q1CA 3RM9A 4N19A 1JNEA 1NWUA 5HW6A 4XAKA 4FAPA 1ROTA 1NMVA 1RD6A 1LG1A 4GIVA 4Q7NA 4ZPVR 3KAIA 2XP7A 4WJXA 2RSEA 2YBUA 2IF4A 3O5JA 1IX5A 3JXVA 1D6OA 5HWBA 1W9PA 1L1PA 3WD3A 4TX0A 1FKRA 4URIA 4MGVA 3WD1A 2KR7A 2G8ZA 3CHCA 4JYSA 4DWSD 1X6NA 4JFKA 3RGCA 3AS3A 1Q6HA 1EHNA 4Z2IA 2RQSA 2ZR5A 1Q6UA 4HBOA 2WLZA 1C9HA 3FXYA 2YBTA 1FKBA 3ARSA 1ZCNA 3O5EA 2DSZA 3PRBA 4TYOA 4DRMA 1GUVA 5D75A 2XP9A 1KT1A 4R5EA 1EIBA 4L72B 3B9AA 1F40A 1H0IA 1FKDA 4ZPWR 2FDMA 1FFRA 3ARTA 3O5PA 5DF0A 3ALGA 2Y78A 4IPXA 1UR9A 1H0GA 3RM8A 3OA5A 1NSGA 3PRDA 2DT1A 1JNSA 2A3CA 2O9OA 4ITZA 3AQUA 5DIVA 4ODPA 4JFLA 1ZBKA 1HJXA 3B9DA 1QPLA 2ZQSA 3ARWA 4Z2JA 4MNKA 2PI6A 5GPGA 3NI6A 2DG4A 2WLYA 4S3KA 4LAXA 1FKLA 2PV2A 4IQ2A 1KT0A 1A7XA 2VCDA 4ODNA 2MLYA 1J4HA 2ITKA 4G2PA 1UR8A 1HJVA 2XP6A 1ZBCA 4DRHA 4P8XA 1CTNA 4J4OA 4QT3A 2XPBA 1J4RA 3CHEA 3IHZA 4KR0B 2QF8A 4ODMA 4WKFA 1HKIA 4GGQA 1FKIA 4ODLA 3LUOA 3ARVA 4NNRA 3KADA 4Z2KA 1ZB5A 3AS0A 2XP4A 2RUCA 3WIJA 2UZ5A 2AOSA 1OWQA 4W9QA 2PBCA 4DRIA 1PINA 2F2DA 4MSPA 4JFJA 2AWGA 1J6YA 4IT4A 2OFNA 4HARA 1ZBVA 1JNDA 3KCEA 1D2KA 2DT2A 3VAWA 4MTVA 3WL0A 2L2SA 1Q6IA 3FAPA 4G50A 2XP5A 2PV3A 4DRJA 2PPOA 2JZVA 2K8IA 5HBFA 1KFWA 2DT3A 3UF8A 3KZ7A 3KAGA 2MLXA 1FKKA 3NRKA 3ARRA 4U84A 2MF9A 5HTGA 4S3JA 2WK2A 3WKZA 3UI4A 4DH0A 3WL1A 2PPPA 3JYJA 1D7IA 4WIWA 4DROA 1HKJA 1E6ZA 1B6CA 1FKGA 1W1PA 2DT0A 4WKHA 2DPEA 1W9VA 1FKFA 2VN1A 1HJWA 2MNTA 2RUQA 4DRNA 2ZQVA 1OGBA 5GQBA 3ODKA 1NWTA 3UI6A 1K9TA 1BKFA 5J6EA 4R0XA 4ODOA 2Q5AA 3AS2A 4DZ2A 2ZQUA 2M2AA 1FKSA 5HW8A 3TDBA 1XRVA 1NWRA 1VF8A 2PPNA 4LAVA 3PR9A 5DEZA 2KO7A 3O5GA 1FAPA 4J4NA 4TW8A 4KQZA 1GOIA 1GPFA 3ARPA 2FAPA 4O2TA 1NWSA 3O5IA 1Y0OA 5HWCA 1P5QA 2OLHA 1JNTA 1QPFA 3CH9A 1D7JA 2A3EA 4PTMA 1O6IA 1J4IA 1LJYA 3CGNA 2FKEA 4MNJA 4TNSA 1N1AA 2DSUA 2M08A 1JVWA 4DRKA 2F21A 3O5RA 4FN2A 3KAFA 1EQ3A 3RM4A 4C02B 1LL7A 4MNMA 3I6CA 4TW7A 2ZR6A 1ZL1A 4L3NA 5B8IC 3IK8A 5BXJA 1E15A 3UQAA 1F8AB 1FKJA 2RUDA 3RFWA 4QIBA 3BXWA 4U86A 4P8VA 2ESCA 4ZS6A 2DG9A 1E6RA 1HKMA 1D7HA 1ITXA 2F4EA 1ZBWA 4LAYA 4NZCA 3ARZA 5HT1A 3O5LA 3UI5A 2A3BA 3TC5A 3KABA 3O5QA 3IKGA 4NSBA 3UQBA 3PRAA 2LKNA 1SYTA 1LQ0A 5DIUA 3G6LA 3ARXA 3H9RB 2DSWA 4Z2LA 3GPKA 5JH8A 2A3AA 2XP8A 3O5KA 5DO2A 2KGJA 5GPRA 3CHDA 3B9EA 3NTPA 1HKKA 1NH6A 2N87A 4DRQA 1NMWA 3TCZA 3MDYB 3ALFA 4Q22A 1U79A 3AS1A 2DG3A 3WH0A 3WQWA 1ZU8A 4DT4A 3O5FA 1PBKA 4DWSA 4IQCA 4HBEA 1FJDA 1XHGA 2O92A 3O5OA 4U85A 4W5UA 4P8WA 1HXVA 1WNOA 1E9LA 4MAVA 3JYMA 1SR0A 1FD9A 1E6PA 4LGXA 4DZ3A 4ZPTR 3UQIA 3W4RA 4P8UA 3G6MA 3OOBA 1LL4A 2DSVA 3EY6A 3KACA 1EYMA 1WAWA 1T11A 2PV1A 1LG2A 3CGMA 1R9HA 1W1TA 1WB0A 3CHFA 4QT2A 4Z2HA 4Z2GA 2WM0A 4QZVB 1E6NA 1OGGA 4DIPA 4JFIA 1FKHA 2G41A 1FFQA 3B7XA 5HKGA 2D9FA 4DWSB 2LPVA 4JFMA 3CZ8A 1W1VA 2KFWA 2MPHA 2XPAA 1M5YA 2KI3A 2LGOA 4W9PA 4WKAA 1W1YA 3WD4A 1TCOC 1QZ2A 3AROA 3FY1A 4DRPA 4BF8A 2MLZA 2KE0A 4DWSC 3WD2A 5HUAA 2ZQTA 3B8SA 3ARYA 3O5DA 4ODQA 4ODRA 1TFVA 3QOKA 3IKDA 3O5MA 1W9UA 1YW5A 1ROUA 4TW6A 5DITA 2ZR4A 2LJ4A 1ZK6A 4ODKA 2B31A 3KAHA 4MPKA 3PA7A 1YATA 5HW7A 2XP3A 3WD0A 3ARQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL4 A;  3H9R B;  3ODK A;  4ITZ A;  5DIV A;  1FKT A;  4ODP A;  2M1I A;  4JFL A;  4LAW A;  3UI6 A;  3GPK A;  1BKF A;  4W9O A;  5J6E A;  1QPL A;  1W26 A;  2ZQS A;  4R0X A;  2XP8 A;  4ODO A;  3O5K A;  2RUR A;  3NI6 A;  5GPG A;  5I98 A;  2DG4 A;  2Q5A A;  4DZ2 A;  4LAX A;  2ZQU A;  1FKL A;  1Q1C A;  2KGJ A;  2M2A A;  2PV2 A;  4IQ2 A;  1KT0 A;  1FKS A;  5HW8 A;  3NTP A;  1A7X A;  4N19 A;  2N87 A;  2VCD A;  4DRQ A;  4ODN A;  1NMW A;  2MLY A;  3TCZ A;  1J4H A;  3TDB A;  3MDY B;  5HW6 A;  1U79 A;  2ITK A;  4G2P A;  2DG3 A;  2PPN A;  1ROT A;  2ZQV A;  4LAV A;  4FAP A;  1NMV A;  3WH0 A;  2XP6 A;  4DT4 A;  3O5F A;  1PBK A;  4DRH A;  2KO7 A;  3O5G A;  4GIV A;  4J4O A;  1FAP A;  4IQC A;  4J4N A;  4QT3 A;  1FJD A;  4TW8 A;  2XPB A;  3O5O A;  1J4R A;  4U85 A;  3IHZ A;  1HXV A;  2FAP A;  3KAI A;  4O2T A;  3O5I A;  2XP7 A;  1Y0O A;  4ODM A;  5HWC A;  2RSE A;  3JYM A;  4GGQ A;  2IF4 A;  1P5Q A;  1FD9 A;  3O5J A;  4DZ3 A;  1FKI A;  4ODL A;  1JNT A;  3LUO A;  4NNR A;  1QPF A;  3JXV A;  1D6O A;  3KAD A;  3UQI A;  1D7J A;  5HWB A;  1L1P A;  3OOB A;  4TX0 A;  2XP4 A;  1J4I A;  3EY6 A;  3KAC A;  1EYM A;  4MGV A;  1FKR A;  2KR7 A;  2RUC A;  1T11 A;  2PV1 A;  3CGM A;  1R9H A;  4JYS A;  3CGN A;  2FKE A;  2UZ5 A;  4W9Q A;  4TNS A;  2PBC A;  4DRI A;  1N1A A;  1PIN A;  2F2D A;  2M08 A;  4QT2 A;  1JVW A;  4DRK A;  4JFK A;  4MSP A;  3RGC A;  4JFJ A;  2AWG A;  4DIP A;  1Q6H A;  2F21 A;  1J6Y A;  2OFN A;  4JFI A;  3O5R A;  4FN2 A;  3UQA A;  2RQS A;  2ZR5 A;  3KAF A;  1FKH A;  1EQ3 A;  1Q6U A;  4C02 B;  3KCE A;  3I6C A;  3B7X A;  4TW7 A;  2ZR6 A;  3VAW A;  5HKG A;  1C9H A;  2D9F A;  2LPV A;  5B8I C;  3IK8 A;  4JFM A;  1FKB A;  2L2S A;  2KFW A;  5BXJ A;  1Q6I A;  1ZCN A;  2MPH A;  3O5E A;  3FAP A;  1F8A B;  1FKJ A;  2XPA A;  1M5Y A;  2RUD A;  2PV3 A;  2XP5 A;  4G50 A;  2KI3 A;  4DRJ A;  2PPO A;  3PRB A;  2LGO A;  4W9P A;  2JZV A;  2K8I A;  3RFW A;  4QIB A;  4TYO A;  4DRM A;  4U86 A;  1TCO C;  1QZ2 A;  5D75 A;  4DRP A;  4BF8 A;  3UF8 A;  2XP9 A;  1KT1 A;  3KAG A;  2MLX A;  3KZ7 A;  1FKK A;  2MLZ A;  3NRK A;  2KE0 A;  2DG9 A;  4U84 A;  2MF9 A;  5HTG A;  5HUA A;  1D7H A;  2ZQT A;  1F40 A;  2F4E A;  3O5D A;  3UI4 A;  4ODQ A;  1FKD A;  4DH0 A;  2PPP A;  4ODR A;  3JYJ A;  3IKD A;  3O5M A;  4LAY A;  5HT1 A;  1YW5 A;  3O5P A;  1D7I A;  1ROU A;  4TW6 A;  2ZR4 A;  5DIT A;  2LJ4 A;  3O5L A;  3UI5 A;  1ZK6 A;  4DRO A;  4ODK A;  2Y78 A;  3TC5 A;  3KAB A;  1B6C A;  1FKG A;  3KAH A;  3O5Q A;  4IPX A;  2VN1 A;  3IKG A;  1FKF A;  3UQB A;  3PA7 A;  2LKN A;  2MNT A;  2RUQ A;  4DRN A;  1YAT A;  5DIU A;  1NSG A;  2XP3 A;  3PRD A;  5HW7 A;  1JNS A; 
#chains in the Genus database with same CATH topology
 1BL4 A;  1X6L A;  4MNL A;  3RME A;  3WQV A;  1FKT A;  2M1I A;  4LAW A;  1EDQ A;  3ARU A;  4W9O A;  1W26 A;  1LL6 A;  4IT6 A;  4AY1 A;  4ML4 A;  2RUR A;  4WK9 A;  2PN0 A;  5I98 A;  2IUZ A;  1Q1C A;  3RM9 A;  4N19 A;  1JNE A;  1NWU A;  5HW6 A;  4XAK A;  4FAP A;  1ROT A;  1NMV A;  1RD6 A;  1LG1 A;  4GIV A;  4Q7N A;  4ZPV R;  3KAI A;  2XP7 A;  4WJX A;  2RSE A;  2YBU A;  2IF4 A;  3O5J A;  1IX5 A;  3EIP A;  3JXV A;  1D6O A;  5HWB A;  1W9P A;  1L1P A;  3WD3 A;  4TX0 A;  1FKR A;  4URI A;  4MGV A;  3WD1 A;  2KR7 A;  2G8Z A;  3CHC A;  4JYS A;  4DWS D;  1X6N A;  4JFK A;  3RGC A;  3AS3 A;  1Q6H A;  1EHN A;  4Z2I A;  2RQS A;  2ZR5 A;  2EUL A;  1Q6U A;  4HBO A;  2F23 A;  2WLZ A;  1C9H A;  3FXY A;  2YBT A;  1FKB A;  3GTY X;  3ARS A;  1ZCN A;  3O5E A;  2DSZ A;  3PRB A;  4TYO A;  4DRM A;  1GUV A;  5D75 A;  2XP9 A;  1KT1 A;  4R5E A;  1EIB A;  4L72 B;  3B9A A;  1F40 A;  1H0I A;  1FKD A;  4ZPW R;  2FDM A;  1FFR A;  3ART A;  3O5P A;  5DF0 A;  3ALG A;  2Y78 A;  4IPX A;  1UR9 A;  1H0G A;  3RM8 A;  3OA5 A;  1NSG A;  3PRD A;  2DT1 A;  1JNS A;  2A3C A;  2O9O A;  4ITZ A;  3AQU A;  5DIV A;  4ODP A;  4JFL A;  1ZBK A;  1HJX A;  3B9D A;  1QPL A;  2ZQS A;  3ARW A;  4Z2J A;  4MNK A;  2PI6 A;  5GPG A;  3NI6 A;  2DG4 A;  2WLY A;  4S3K A;  4LAX A;  1FKL A;  2PV2 A;  4IQ2 A;  1KT0 A;  1A7X A;  2VCD A;  4ODN A;  2MLY A;  1J4H A;  2ITK A;  4G2P A;  1UR8 A;  1HJV A;  2XP6 A;  1ZBC A;  4DRH A;  4P8X A;  2ETN A;  1CTN A;  4J4O A;  4QT3 A;  2XPB A;  1J4R A;  3CHE A;  3IHZ A;  4KR0 B;  2QF8 A;  4ODM A;  4WKF A;  1HKI A;  4GGQ A;  2P4V A;  1FKI A;  4ODL A;  3LUO A;  3ARV A;  4NNR A;  3KAD A;  4Z2K A;  1ZB5 A;  3AS0 A;  2XP4 A;  2RUC A;  3WIJ A;  2UZ5 A;  2AOS A;  1OWQ A;  4W9Q A;  2PBC A;  4DRI A;  1PIN A;  2F2D A;  4MSP A;  4JFJ A;  2AWG A;  1J6Y A;  4IT4 A;  2OFN A;  4HAR A;  1ZBV A;  1JND A;  3KCE A;  1D2K A;  2DT2 A;  3VAW A;  4MTV A;  3WL0 A;  2L2S A;  1Q6I A;  3FAP A;  4G50 A;  2XP5 A;  2PV3 A;  4DRJ A;  2PPO A;  2JZV A;  2K8I A;  5HBF A;  1KFW A;  2DT3 A;  3UF8 A;  3KZ7 A;  3KAG A;  2MLX A;  1FKK A;  3NRK A;  3ARR A;  4U84 A;  2MF9 A;  5HTG A;  4S3J A;  2WK2 A;  3WKZ A;  3UI4 A;  4DH0 A;  3WL1 A;  2PPP A;  3JYJ A;  1D7I A;  4WIW A;  4DRO A;  1HKJ A;  1E6Z A;  1B6C A;  1FKG A;  1W1P A;  2DT0 A;  4WKH A;  2DPE A;  1W9V A;  1FKF A;  2VN1 A;  1HJW A;  2MNT A;  2RUQ A;  4DRN A;  2ZQV A;  1OGB A;  5GQB A;  3ODK A;  1NWT A;  3UI6 A;  1K9T A;  1BKF A;  5J6E A;  4R0X A;  4ODO A;  2Q5A A;  3AS2 A;  4DZ2 A;  2ZQU A;  2M2A A;  1FKS A;  5HW8 A;  3TDB A;  1XRV A;  1NWR A;  1VF8 A;  2PPN A;  4LAV A;  3PR9 A;  5DEZ A;  2KO7 A;  3O5G A;  1FAP A;  4J4N A;  4TW8 A;  4KQZ A;  1GOI A;  1GPF A;  3ARP A;  2FAP A;  4O2T A;  1NWS A;  3O5I A;  1Y0O A;  5HWC A;  1P5Q A;  2OLH A;  1JNT A;  1QPF A;  3CH9 A;  1D7J A;  2A3E A;  4PTM A;  1O6I A;  1J4I A;  1LJY A;  3CGN A;  2FKE A;  4MNJ A;  4TNS A;  1N1A A;  2DSU A;  2M08 A;  1JVW A;  4DRK A;  2F21 A;  3O5R A;  4FN2 A;  3KAF A;  1EQ3 A;  3RM4 A;  4C02 B;  1LL7 A;  4MNM A;  3I6C A;  4TW7 A;  2ZR6 A;  3GU0 A;  1ZL1 A;  4L3N A;  5B8I C;  3IK8 A;  5BXJ A;  1E15 A;  3UQA A;  1F8A B;  1FKJ A;  2RUD A;  3RFW A;  4QIB A;  3BXW A;  4U86 A;  4P8V A;  2ESC A;  4ZS6 A;  2DG9 A;  1E6R A;  1HKM A;  1D7H A;  1ITX A;  2F4E A;  1ZBW A;  4LAY A;  4NZC A;  3ARZ A;  5HT1 A;  3O5L A;  3UI5 A;  2A3B A;  3TC5 A;  3KAB A;  3O5Q A;  3IKG A;  4NSB A;  3UQB A;  1E44 A;  3PRA A;  2LKN A;  3WD0 A;  1SYT A;  1LQ0 A;  5DIU A;  3G6L A;  3ARX A;  3H9R B;  2DSW A;  4Z2L A;  3GPK A;  5JH8 A;  2A3A A;  2XP8 A;  3O5K A;  5DO2 A;  1GRJ A;  2KGJ A;  5GPR A;  3CHD A;  3B9E A;  3NTP A;  1HKK A;  1NH6 A;  2N87 A;  4DRQ A;  1NMW A;  3TCZ A;  3MDY B;  3ALF A;  4Q22 A;  1U79 A;  3AS1 A;  2DG3 A;  3WH0 A;  3WQW A;  1ZU8 A;  4DT4 A;  3O5F A;  1PBK A;  4DWS A;  4IQC A;  4HBE A;  1FJD A;  1XHG A;  2O92 A;  3BMB A;  3O5O A;  4U85 A;  4W5U A;  4P8W A;  1HXV A;  1WNO A;  1E9L A;  4MAV A;  3JYM A;  1SR0 A;  1FD9 A;  1E6P A;  4LGX A;  4DZ3 A;  4ZPT R;  3UQI A;  3W4R A;  4P8U A;  3G6M A;  3OOB A;  1LL4 A;  2DSV A;  3EY6 A;  3KAC A;  1EYM A;  1WAW A;  1T11 A;  2PV1 A;  1LG2 A;  3CGM A;  1R9H A;  1W1T A;  2B5U B;  1WB0 A;  3CHF A;  4QT2 A;  4Z2H A;  4Z2G A;  2WM0 A;  4QZV B;  1E6N A;  1OGG A;  4DIP A;  4JFI A;  1FKH A;  2G41 A;  1FFQ A;  3B7X A;  5HKG A;  2D9F A;  4DWS B;  2LPV A;  4JFM A;  3CZ8 A;  1W1V A;  2KFW A;  2MPH A;  2XPA A;  1M5Y A;  2KI3 A;  2LGO A;  4W9P A;  4WKA A;  1W1Y A;  3WD4 A;  1TCO C;  1QZ2 A;  3ARO A;  3FY1 A;  4DRP A;  4BF8 A;  2MLZ A;  2KE0 A;  4DWS C;  1JCH B;  3WD2 A;  5HUA A;  2ZQT A;  3B8S A;  3ARY A;  3O5D A;  4ODQ A;  4ODR A;  1TFV A;  3QOK A;  3IKD A;  3O5M A;  1W9U A;  1YW5 A;  1ROU A;  4TW6 A;  5DIT A;  2ZR4 A;  2LJ4 A;  1ZK6 A;  4ODK A;  2B31 A;  3KAH A;  4MPK A;  3PA7 A;  1YAT A;  5HW7 A;  2XP3 A;  4UDM A;  3ARQ A; 
#chains in the Genus database with same CATH homology
 1BL4 A;  1X6L A;  4MNL A;  3RME A;  3WQV A;  1FKT A;  2M1I A;  4LAW A;  1EDQ A;  3ARU A;  4W9O A;  1W26 A;  1LL6 A;  4IT6 A;  4AY1 A;  4ML4 A;  2RUR A;  4WK9 A;  5I98 A;  2IUZ A;  1Q1C A;  3RM9 A;  4N19 A;  1JNE A;  1NWU A;  5HW6 A;  4XAK A;  4FAP A;  1ROT A;  1NMV A;  1RD6 A;  1LG1 A;  4GIV A;  4Q7N A;  4ZPV R;  3KAI A;  2XP7 A;  4WJX A;  2RSE A;  2YBU A;  2IF4 A;  3O5J A;  1IX5 A;  3JXV A;  1D6O A;  5HWB A;  1W9P A;  1L1P A;  3WD3 A;  4TX0 A;  1FKR A;  4URI A;  4MGV A;  3WD1 A;  2KR7 A;  2G8Z A;  3CHC A;  4JYS A;  4DWS D;  1X6N A;  4JFK A;  3RGC A;  3AS3 A;  1Q6H A;  1EHN A;  4Z2I A;  2RQS A;  2ZR5 A;  1Q6U A;  4HBO A;  2WLZ A;  1C9H A;  3FXY A;  2YBT A;  1FKB A;  3ARS A;  1ZCN A;  3O5E A;  2DSZ A;  3PRB A;  4TYO A;  4DRM A;  1GUV A;  5D75 A;  2XP9 A;  1KT1 A;  4R5E A;  1EIB A;  4L72 B;  3B9A A;  1F40 A;  1H0I A;  1FKD A;  4ZPW R;  2FDM A;  1FFR A;  3ART A;  3O5P A;  5DF0 A;  3ALG A;  2Y78 A;  4IPX A;  1UR9 A;  1H0G A;  3RM8 A;  3OA5 A;  1NSG A;  3PRD A;  2DT1 A;  1JNS A;  2A3C A;  2O9O A;  4ITZ A;  3AQU A;  5DIV A;  4ODP A;  4JFL A;  1ZBK A;  1HJX A;  3B9D A;  1QPL A;  2ZQS A;  3ARW A;  4Z2J A;  4MNK A;  2PI6 A;  5GPG A;  3NI6 A;  2DG4 A;  2WLY A;  4S3K A;  4LAX A;  1FKL A;  2PV2 A;  4IQ2 A;  1KT0 A;  1A7X A;  2VCD A;  4ODN A;  2MLY A;  1J4H A;  2ITK A;  4G2P A;  1UR8 A;  1HJV A;  2XP6 A;  1ZBC A;  4DRH A;  4P8X A;  1CTN A;  4J4O A;  4QT3 A;  2XPB A;  1J4R A;  3CHE A;  3IHZ A;  4KR0 B;  2QF8 A;  4ODM A;  4WKF A;  1HKI A;  4GGQ A;  1FKI A;  4ODL A;  3LUO A;  3ARV A;  4NNR A;  3KAD A;  4Z2K A;  1ZB5 A;  3AS0 A;  2XP4 A;  2RUC A;  3WIJ A;  2UZ5 A;  2AOS A;  1OWQ A;  4W9Q A;  2PBC A;  4DRI A;  1PIN A;  2F2D A;  4MSP A;  4JFJ A;  2AWG A;  1J6Y A;  4IT4 A;  2OFN A;  4HAR A;  1ZBV A;  1JND A;  3KCE A;  1D2K A;  2DT2 A;  3VAW A;  4MTV A;  3WL0 A;  2L2S A;  1Q6I A;  3FAP A;  4G50 A;  2XP5 A;  2PV3 A;  4DRJ A;  2PPO A;  2JZV A;  2K8I A;  5HBF A;  1KFW A;  2DT3 A;  3UF8 A;  3KZ7 A;  3KAG A;  2MLX A;  1FKK A;  3NRK A;  3ARR A;  4U84 A;  2MF9 A;  5HTG A;  4S3J A;  2WK2 A;  3WKZ A;  3UI4 A;  4DH0 A;  3WL1 A;  2PPP A;  3JYJ A;  1D7I A;  4WIW A;  4DRO A;  1HKJ A;  1E6Z A;  1B6C A;  1FKG A;  1W1P A;  2DT0 A;  4WKH A;  2DPE A;  1W9V A;  1FKF A;  2VN1 A;  1HJW A;  2MNT A;  2RUQ A;  4DRN A;  2ZQV A;  1OGB A;  5GQB A;  3ODK A;  1NWT A;  3UI6 A;  1K9T A;  1BKF A;  5J6E A;  4R0X A;  4ODO A;  2Q5A A;  3AS2 A;  4DZ2 A;  2ZQU A;  2M2A A;  1FKS A;  5HW8 A;  3TDB A;  1XRV A;  1NWR A;  1VF8 A;  2PPN A;  4LAV A;  3PR9 A;  5DEZ A;  2KO7 A;  3O5G A;  1FAP A;  4J4N A;  4TW8 A;  4KQZ A;  1GOI A;  1GPF A;  3ARP A;  2FAP A;  4O2T A;  1NWS A;  3O5I A;  1Y0O A;  5HWC A;  1P5Q A;  2OLH A;  1JNT A;  1QPF A;  3CH9 A;  1D7J A;  2A3E A;  4PTM A;  1O6I A;  1J4I A;  1LJY A;  3CGN A;  2FKE A;  4MNJ A;  4TNS A;  1N1A A;  2DSU A;  2M08 A;  1JVW A;  4DRK A;  2F21 A;  3O5R A;  4FN2 A;  3KAF A;  1EQ3 A;  3RM4 A;  4C02 B;  1LL7 A;  4MNM A;  3I6C A;  4TW7 A;  2ZR6 A;  1ZL1 A;  4L3N A;  5B8I C;  3IK8 A;  5BXJ A;  1E15 A;  3UQA A;  1F8A B;  1FKJ A;  2RUD A;  3RFW A;  4QIB A;  3BXW A;  4U86 A;  4P8V A;  2ESC A;  4ZS6 A;  2DG9 A;  1E6R A;  1HKM A;  1D7H A;  1ITX A;  2F4E A;  1ZBW A;  4LAY A;  4NZC A;  3ARZ A;  5HT1 A;  3O5L A;  3UI5 A;  2A3B A;  3TC5 A;  3KAB A;  3O5Q A;  3IKG A;  4NSB A;  3UQB A;  3PRA A;  2LKN A;  1SYT A;  1LQ0 A;  5DIU A;  3G6L A;  3ARX A;  3H9R B;  2DSW A;  4Z2L A;  3GPK A;  5JH8 A;  2A3A A;  2XP8 A;  3O5K A;  5DO2 A;  2KGJ A;  5GPR A;  3CHD A;  3B9E A;  3NTP A;  1HKK A;  1NH6 A;  2N87 A;  4DRQ A;  1NMW A;  3TCZ A;  3MDY B;  3ALF A;  4Q22 A;  1U79 A;  3AS1 A;  2DG3 A;  3WH0 A;  3WQW A;  1ZU8 A;  4DT4 A;  3O5F A;  1PBK A;  4DWS A;  4IQC A;  4HBE A;  1FJD A;  1XHG A;  2O92 A;  3O5O A;  4U85 A;  4W5U A;  4P8W A;  1HXV A;  1WNO A;  1E9L A;  4MAV A;  3JYM A;  1SR0 A;  1FD9 A;  1E6P A;  4LGX A;  4DZ3 A;  4ZPT R;  3UQI A;  3W4R A;  4P8U A;  3G6M A;  3OOB A;  1LL4 A;  2DSV A;  3EY6 A;  3KAC A;  1EYM A;  1WAW A;  1T11 A;  2PV1 A;  1LG2 A;  3CGM A;  1R9H A;  1W1T A;  1WB0 A;  3CHF A;  4QT2 A;  4Z2H A;  4Z2G A;  2WM0 A;  4QZV B;  1E6N A;  1OGG A;  4DIP A;  4JFI A;  1FKH A;  2G41 A;  1FFQ A;  3B7X A;  5HKG A;  2D9F A;  4DWS B;  2LPV A;  4JFM A;  3CZ8 A;  1W1V A;  2KFW A;  2MPH A;  2XPA A;  1M5Y A;  2KI3 A;  2LGO A;  4W9P A;  4WKA A;  1W1Y A;  3WD4 A;  1TCO C;  1QZ2 A;  3ARO A;  3FY1 A;  4DRP A;  4BF8 A;  2MLZ A;  2KE0 A;  4DWS C;  3WD2 A;  5HUA A;  2ZQT A;  3B8S A;  3ARY A;  3O5D A;  4ODQ A;  4ODR A;  1TFV A;  3QOK A;  3IKD A;  3O5M A;  1W9U A;  1YW5 A;  1ROU A;  4TW6 A;  5DIT A;  2ZR4 A;  2LJ4 A;  1ZK6 A;  4ODK A;  2B31 A;  3KAH A;  4MPK A;  3PA7 A;  1YAT A;  5HW7 A;  2XP3 A;  3WD0 A;  3ARQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...