4FAPA

Atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords FK506-BINDING PROTEIN
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4fapA00
3IK8A 3OOBA 3TDBA 4J4OA 4LAVA 3O5JA 3RGCA 3GPKA 1PBKA 1FKIA 3KAIA 1Q6IA 2PV2A 3O5EA 4ODQA 3JXVA 2XP3A 1HXVA 4W9PA 4LAXA 4DIPA 1L1PA 5HKGA 3MDYB 1F40A 4DH0A 4ODRA 2XP7A 5HT1A 2ITKA 3PRBA 4TX0A 2LKNA 3O5FA 3KAGA 2F4EA 4LAWA 4DRIA 2PPNA 5HUAA 1ROUA 3JYMA 3O5QA 4ODPA 4QIBA 5GPGA 3FAPA 3TCZA 1FKKA 3UF8A 3JYJA 1F8AB 2PPOA 1T11A 2MLYA 3O5RA 4DRNA 4JFJA 1EYMA 1W26A 4U85A 4TYOA 3O5IA 2MLZA 2IF4A 3H9RB 4C02B 2L2SA 1FKGA 1C9HA 2XP4A 3KCEA 3PRDA 1Q1CA 4ITZA 4IQCA 4G50A 1P5QA 1FKTA 4FN2A 1B6CA 5HW8A 1Q6HA 3O5KA 3IHZA 4DZ2A 1N1AA 3TC5A 2JZVA 3UI5A 1J6YA 1YATA 2RQSA 3EY6A 3UI6A 1YW5A 3KAHA 1FJDA 2KE0A 2XPBA 3CGNA 2RUQA 1FKHA 2F2DA 2MF9A 2RUDA 2DG4A 1BKFA 1JVWA 1ROTA 4JFLA 2KI3A 3KADA 1D7IA 1PINA 3NTPA 4JFKA 5HTGA 2KO7A 1BL4A 4DRHA 2ZR4A 5HW7A 5DIVA 3LUOA 4DROA 1J4IA 3KABA 1FD9A 3IKDA 1Q6UA 2LJ4A 4NNRA 4DZ3A 1FKFA 5HWBA 1M5YA 3NI6A 2RSEA 3VAWA 1FAPA 1ZCNA 3CGMA 1D7HA 3WH0A 4DRMA 2VCDA 2RURA 2FAPA 2UZ5A 5D75A 1NMWA 3RFWA 4ODNA 4DRQA 4DT4A 4N19A 2KFWA 1TCOC 5DIUA 2VN1A 2FKEA 4QT2A 1EQ3A 4JYSA 4TW7A 2XP9A 4O2TA 4GIVA 1NMVA 5HWCA 2DG9A 3IKGA 4JFMA 4ODMA 2XP6A 2XPAA 2PV3A 3NRKA 1FKJA 1ZK6A 4IPXA 1QZ2A 4U84A 2F21A 2N87A 3UQBA 3B7XA 4BF8A 1JNSA 4MGVA 4ODLA 5HW6A 1Y0OA 2PV1A 2MPHA 2DG3A 4TW8A 3O5MA 2ZQVA 2M08A 3UQAA 2Q5AA 1FKDA 3O5GA 3O5DA 4IQ2A 3UQIA 1J4RA 4FAPA 2XP5A 2PBCA 2XP8A 1D7JA 4G2PA 4W9QA 1FKRA 1D6OA 3UI4A 2AWGA 4U86A 2ZR5A 2ZQUA 3I6CA 4R0XA 3KACA 5DITA 1FKSA 2PPPA 2ZQSA 5J6EA 4JFIA 1NSGA 3KAFA 3KZ7A 2LPVA 3ODKA 2KR7A 4DRPA 1A7XA 4W9OA 2K8IA 1KT0A 4DRJA 4GGQA 4J4NA 4ODOA 2ZR6A 1QPFA 2LGOA 2D9FA 4QT3A 1KT1A 2ZQTA 5B8IC 1J4HA 1JNTA 2RUCA 4TW6A 3O5PA 1QPLA 4ODKA 2KGJA 2M1IA 3O5OA 2OFNA 4MSPA 3PA7A 4TNSA 5I98A 2MNTA 5BXJA 4LAYA 2M2AA 2MLXA 4DRKA 3O5LA 1FKBA 1R9HA 1FKLA 1U79A 2Y78A
chains in the Genus database with same CATH superfamily
3TDBA 2O92A 4J4OA 4LAVA 4ZPWR 1KFWA 2XP3A 5HBFA 5HKGA 2XP7A 3ARUA 1X6NA 3O5FA 2F4EA 4LAWA 4XAKA 4L3NA 3ARRA 4Z2KA 1LJYA 4QIBA 3TCZA 1RD6A 4MNJA 2DT2A 3GTYX 1E6NA 4TYOA 2IF4A 4C02B 2XP4A 4WIWA 2IUZA 1UR9A 3WD3A 4IQCA 4G50A 2DSZA 1Q6HA 1N1AA 2JZVA 4WK9A 3ARXA 2XPBA 3AS2A 1HKJA 1H0IA 1TFVA 1BKFA 1ROTA 3EIPA 2B5UB 1WB0A 3KADA 1D7IA 1VF8A 2P4VA 3NTPA 1E15A 4DRHA 5DIVA 3LUOA 4DZ3A 3ARWA 3VAWA 2RSEA 3BXWA 3WH0A 1W1PA 2UZ5A 5D75A 1NMWA 4N19A 4ZS6A 1WAWA 4DWSB 1IX5A 1NH6A 1O6IA 4GIVA 3NRKA 3UQBA 1JNSA 4ODLA 1Y0OA 4WJXA 1D2KA 1LL6A 3G6MA 3AS0A 3O5GA 1J4RA 3ARPA 2YBTA 2XP5A 4G2PA 1FKRA 4NSBA 4MNLA 1H0GA 2PPPA 1HJXA 4IT4A 4R5EA 3CZ8A 3GU0A 3KAFA 2LPVA 4Q22A 4ML4A 4GGQA 4ODOA 1QPFA 5B8IC 1E6RA 1QPLA 4Z2GA 2KGJA 3O5OA 4TNSA 2WM0A 4MNMA 1GPFA 4WKFA 4LAYA 4L72B 1LL4A 1U79A 3IK8A 1ZBKA 3O5JA 3RMEA 2PV2A 3O5EA 3ARSA 2QF8A 3ALFA 1HXVA 4LAXA 3MDYB 4DH0A 3PRBA 4HARA 3FY1A 2EULA 1W9PA 4P8UA 1NWUA 2FDMA 3O5QA 5GPGA 3ARVA 1F8AB 1T11A 5DEZA 1JNDA 3H9RB 2PI6A 1JNEA 1EDQA 4ITZA 4LGXA 1P5QA 3IHZA 4Z2HA 1J6YA 4MAVA 1YATA 2RQSA 4QZVB 3UI6A 1YW5A 1FJDA 3CHFA 1ZBWA 2YBUA 1EHNA 4JFLA 2A3CA 2KO7A 2ZR4A 3CHDA 1J4IA 3KABA 1OWQA 1Q6UA 4NNRA 1FKFA 2ESCA 4DRQA 2VCDA 2DSVA 4ODNA 2WLYA 1TCOC 2DSUA 4JYSA 4TW7A 2O9OA 4O2TA 5HWCA 1ZL1A 4ODMA 1ZBVA 4IPXA 1ZK6A 1NWRA 1QZ2A 3WD0A 2F21A 2DT3A 3B7XA 1W1YA 3RM9A 2PN0A 4TW8A 2DG3A 2DT1A 1HJVA 3AS3A 2ZQVA 1E6PA 3UQIA 4FAPA 1NWSA 5DF0A 1ZB5A 4W9QA 1D6OA 4R0XA 3I6CA 1XRVA 1GOIA 5DITA 2WK2A 4JFIA 4DRPA 1A7XA 1KT0A 4J4NA 3QOKA 1KT1A 1JNTA 2RUCA 4ODKA 2M1IA 3WD4A 2B31A 3G6LA 2AOSA 5I98A 2M2AA 2MLXA 2G8ZA 1ITXA 1R9HA 1FKLA 2Y78A 1LG1A 3OOBA 2A3BA 1PBKA 1Q6IA 4KQZA 3JXVA 4DIPA 1L1PA 4ODRA 2ITKA 4TX0A 2PPNA 4DWSD 5HUAA 3WD1A 3FAPA 1OGBA 1UR8A 1FKKA 3UF8A 2MLYA 3O5RA 4JFJA 1W26A 4U85A 4AY1A 2MLZA 2L2SA 1C9HA 3KCEA 3PRDA 1FFQA 1Q1CA 1FKTA 4FN2A 1B6CA 1XHGA 3TC5A 3UI5A 3EY6A 4URIA 1E44A 3KAHA 2KE0A 3WL1A 3AS1A 2RUQA 1E9LA 3PRAA 4KR0B 2F2DA 2MF9A 1W1TA 2RUDA 4WKHA 1CTNA 1JVWA 1W9UA 2KI3A 1PINA 3WQWA 4JFKA 5HTGA 1BL4A 3FXYA 5HW7A 5HWBA 1M5YA 4P8WA 1D7HA 3B9EA 2RURA 2FAPA 3RFWA 2KFWA 4QT2A 3BMBA 1LQ0A 2XP9A 1HKKA 4JFMA 4U84A 1FKJA 2N87A 3B9DA 2MPHA 3O5MA 1ZBCA 4Z2LA 2M08A 3UQAA 3O5DA 1FKDA 1FFRA 4IQ2A 1EQ3A 4NZCA 4UDMA 2WLZA 2XP8A 1D7JA 2ZR5A 2ZQUA 3KACA 5J6EA 1NSGA 1W9VA 3KZ7A 3ODKA 3ARYA 3RM4A 4Q7NA 4MTVA 2A3EA 4QT3A 1J4HA 3ARQA 4TW6A 3O5PA 2DSWA 4MSPA 3PA7A 5BXJA 3PR9A 3WL0A 3O5LA 1FKBA 1JCHB 3RGCA 3GPKA 3AROA 3KAIA 4ODQA 4W9PA 3B9AA 1F40A 5HT1A 3W4RA 2LKNA 1SYTA 3KAGA 4Z2JA 4DRIA 1OGGA 1ROUA 3JYMA 4ODPA 3JYJA 2PPOA 4DRNA 1EYMA 2F23A 4WKAA 3O5IA 1HJWA 1FKGA 1HKIA 2DPEA 5GQBA 3WKZA 4MNKA 5HW8A 3CHCA 4P8XA 3O5KA 4DZ2A 5JH8A 2A3AA 1W1VA 1ZU8A 2G41A 1NWTA 4Z2IA 3CGNA 4PTMA 1FKHA 4DWSC 1HKMA 2DG4A 3AQUA 4W5UA 2OLHA 3WQVA 2DT0A 4MPKA 4DROA 1K9TA 1FD9A 3IKDA 2LJ4A 3NI6A 4ZPTR 1FAPA 4DWSA 1ZCNA 3CGMA 4DRMA 4DT4A 1GRJA 1WNOA 4IT6A 1E6ZA 3WD2A 5DIUA 1LG2A 2VN1A 2FKEA 3ALGA 1NMVA 2DG9A 3IKGA 2XP6A 3CH9A 2XPAA 2PV3A 3B8SA 5DO2A 4BF8A 4MGVA 5HW6A 2PV1A 3ARTA 5GPRA 2Q5AA 1LL7A 3CHEA 2PBCA 3UI4A 2AWGA 4U86A 4ZPVR 4HBEA 1EIBA 3ARZA 1FKSA 2ZQSA 1GUVA 3OA5A 3WIJA 2KR7A 4S3KA 4W9OA 2K8IA 4DRJA 4P8VA 2ZR6A 2LGOA 2D9FA 3RM8A 2ZQTA 4S3JA 2ETNA 1SR0A 2OFNA 2MNTA 1X6LA 4DRKA 4HBOA 1FKIA
chains in the Genus database with same CATH topology
3TDBA 2O92A 4J4OA 4LAVA 4ZPWR 1KFWA 2XP3A 5HBFA 5HKGA 2XP7A 3ARUA 1X6NA 3O5FA 2F4EA 4LAWA 4XAKA 4L3NA 3ARRA 4Z2KA 1LJYA 4QIBA 3TCZA 1RD6A 4MNJA 2DT2A 1E6NA 4TYOA 2IF4A 4C02B 2XP4A 4WIWA 2IUZA 1UR9A 3WD3A 4IQCA 4G50A 2DSZA 1Q6HA 1N1AA 2JZVA 4WK9A 3ARXA 2XPBA 3AS2A 1HKJA 1H0IA 1TFVA 1BKFA 1ROTA 1WB0A 3KADA 1D7IA 1VF8A 3NTPA 1E15A 4DRHA 5DIVA 3LUOA 4DZ3A 3ARWA 3VAWA 2RSEA 3BXWA 3WH0A 1W1PA 2UZ5A 5D75A 1NMWA 4N19A 4ZS6A 1WAWA 4DWSB 1IX5A 1NH6A 1O6IA 4GIVA 3NRKA 3UQBA 1JNSA 4ODLA 1Y0OA 4WJXA 1D2KA 1LL6A 3G6MA 3AS0A 3O5GA 1J4RA 3ARPA 2YBTA 2XP5A 4G2PA 1FKRA 4NSBA 4MNLA 1H0GA 2PPPA 1HJXA 4IT4A 4R5EA 3CZ8A 3KAFA 2LPVA 4Q22A 4ML4A 4GGQA 4ODOA 1QPFA 5B8IC 1E6RA 1QPLA 4Z2GA 2KGJA 3O5OA 4TNSA 2WM0A 4MNMA 1GPFA 4WKFA 4LAYA 4L72B 1LL4A 1U79A 3IK8A 1ZBKA 3O5JA 3RMEA 2PV2A 3O5EA 3ARSA 2QF8A 3ALFA 1HXVA 4LAXA 3MDYB 4DH0A 3PRBA 4HARA 3FY1A 1W9PA 4P8UA 1NWUA 2FDMA 3O5QA 5GPGA 3ARVA 1F8AB 1T11A 5DEZA 1JNDA 3H9RB 2PI6A 1JNEA 1EDQA 4ITZA 4LGXA 1P5QA 3IHZA 4Z2HA 1J6YA 4MAVA 1YATA 2RQSA 4QZVB 3UI6A 1YW5A 1FJDA 3CHFA 1ZBWA 2YBUA 1EHNA 4JFLA 2A3CA 2KO7A 2ZR4A 3CHDA 1J4IA 3KABA 1OWQA 1Q6UA 4NNRA 1FKFA 2ESCA 4DRQA 2VCDA 2DSVA 4ODNA 2WLYA 1TCOC 2DSUA 4JYSA 4TW7A 2O9OA 4O2TA 5HWCA 1ZL1A 4ODMA 1ZBVA 4IPXA 1ZK6A 1NWRA 1QZ2A 3WD0A 2F21A 2DT3A 3B7XA 1W1YA 3RM9A 4TW8A 2DG3A 2DT1A 1HJVA 3AS3A 2ZQVA 1E6PA 3UQIA 4FAPA 1NWSA 5DF0A 1ZB5A 4W9QA 1D6OA 4R0XA 3I6CA 1XRVA 1GOIA 5DITA 2WK2A 4JFIA 4DRPA 1A7XA 1KT0A 4J4NA 3QOKA 1KT1A 1JNTA 2RUCA 4ODKA 2M1IA 3WD4A 2B31A 3G6LA 2AOSA 5I98A 2M2AA 2MLXA 2G8ZA 1ITXA 1R9HA 1FKLA 2Y78A 1LG1A 3OOBA 2A3BA 1PBKA 1Q6IA 4KQZA 3JXVA 4DIPA 1L1PA 4ODRA 2ITKA 4TX0A 2PPNA 4DWSD 5HUAA 3WD1A 3FAPA 1OGBA 1UR8A 1FKKA 3UF8A 2MLYA 3O5RA 4JFJA 1W26A 4U85A 4AY1A 2MLZA 2L2SA 1C9HA 3KCEA 3PRDA 1FFQA 1Q1CA 1FKTA 4FN2A 1B6CA 1XHGA 3TC5A 3UI5A 3EY6A 4URIA 3KAHA 2KE0A 3WL1A 3AS1A 2RUQA 1E9LA 3PRAA 4KR0B 2F2DA 2MF9A 1W1TA 2RUDA 4WKHA 1CTNA 1JVWA 1W9UA 2KI3A 1PINA 3WQWA 4JFKA 5HTGA 1BL4A 3FXYA 5HW7A 5HWBA 1M5YA 4P8WA 1D7HA 3B9EA 2RURA 2FAPA 3RFWA 2KFWA 4QT2A 1LQ0A 2XP9A 1HKKA 4JFMA 4U84A 1FKJA 2N87A 3B9DA 2MPHA 3O5MA 1ZBCA 4Z2LA 2M08A 3UQAA 3O5DA 1FKDA 1FFRA 4IQ2A 1EQ3A 4NZCA 2WLZA 2XP8A 1D7JA 2ZR5A 2ZQUA 3KACA 5J6EA 1NSGA 1W9VA 3KZ7A 3ODKA 3ARYA 3RM4A 4Q7NA 4MTVA 2A3EA 4QT3A 1J4HA 3ARQA 4TW6A 3O5PA 2DSWA 4MSPA 3PA7A 5BXJA 3PR9A 3WL0A 3O5LA 1FKBA 3RGCA 3GPKA 3AROA 3KAIA 4ODQA 4W9PA 3B9AA 1F40A 5HT1A 3W4RA 2LKNA 1SYTA 3KAGA 4Z2JA 4DRIA 1OGGA 1ROUA 3JYMA 4ODPA 3JYJA 2PPOA 4DRNA 1EYMA 4WKAA 3O5IA 1HJWA 1FKGA 1HKIA 2DPEA 5GQBA 3WKZA 4MNKA 5HW8A 3CHCA 4P8XA 3O5KA 4DZ2A 5JH8A 2A3AA 1W1VA 1ZU8A 2G41A 1NWTA 4Z2IA 3CGNA 4PTMA 1FKHA 4DWSC 1HKMA 2DG4A 3AQUA 4W5UA 2OLHA 3WQVA 2DT0A 4MPKA 4DROA 1K9TA 1FD9A 3IKDA 2LJ4A 3NI6A 4ZPTR 1FAPA 4DWSA 1ZCNA 3CGMA 4DRMA 4DT4A 1WNOA 4IT6A 1E6ZA 3WD2A 5DIUA 1LG2A 2VN1A 2FKEA 3ALGA 1NMVA 2DG9A 3IKGA 2XP6A 3CH9A 2XPAA 2PV3A 3B8SA 5DO2A 4BF8A 4MGVA 5HW6A 2PV1A 3ARTA 5GPRA 2Q5AA 1LL7A 3CHEA 2PBCA 3UI4A 2AWGA 4U86A 4ZPVR 4HBEA 1EIBA 3ARZA 1FKSA 2ZQSA 1GUVA 3OA5A 3WIJA 2KR7A 4S3KA 4W9OA 2K8IA 4DRJA 4P8VA 2ZR6A 2LGOA 2D9FA 3RM8A 2ZQTA 4S3JA 2OFNA 1SR0A 2MNTA 1X6LA 4DRKA 4HBOA 1FKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IK8 A;  3OOB A;  3TDB A;  4J4O A;  4LAV A;  3O5J A;  3RGC A;  3GPK A;  1PBK A;  1FKI A;  3KAI A;  1Q6I A;  2PV2 A;  3O5E A;  4ODQ A;  3JXV A;  2XP3 A;  1HXV A;  4W9P A;  4LAX A;  4DIP A;  1L1P A;  5HKG A;  3MDY B;  1F40 A;  4DH0 A;  4ODR A;  2XP7 A;  5HT1 A;  2ITK A;  3PRB A;  4TX0 A;  2LKN A;  3O5F A;  3KAG A;  2F4E A;  4LAW A;  4DRI A;  2PPN A;  5HUA A;  1ROU A;  3JYM A;  3O5Q A;  4ODP A;  4QIB A;  5GPG A;  3FAP A;  3TCZ A;  1FKK A;  3UF8 A;  3JYJ A;  1F8A B;  2PPO A;  1T11 A;  2MLY A;  3O5R A;  4DRN A;  4JFJ A;  1EYM A;  1W26 A;  4U85 A;  4TYO A;  3O5I A;  2MLZ A;  2IF4 A;  3H9R B;  4C02 B;  2L2S A;  1FKG A;  1C9H A;  2XP4 A;  3KCE A;  3PRD A;  1Q1C A;  4ITZ A;  4IQC A;  4G50 A;  1P5Q A;  1FKT A;  4FN2 A;  1B6C A;  5HW8 A;  1Q6H A;  3O5K A;  3IHZ A;  4DZ2 A;  1N1A A;  3TC5 A;  2JZV A;  3UI5 A;  1J6Y A;  1YAT A;  2RQS A;  3EY6 A;  3UI6 A;  1YW5 A;  3KAH A;  1FJD A;  2KE0 A;  2XPB A;  3CGN A;  2RUQ A;  1FKH A;  2F2D A;  2MF9 A;  2RUD A;  2DG4 A;  1BKF A;  1JVW A;  1ROT A;  4JFL A;  2KI3 A;  3KAD A;  1D7I A;  1PIN A;  3NTP A;  4JFK A;  5HTG A;  2KO7 A;  1BL4 A;  4DRH A;  2ZR4 A;  5HW7 A;  5DIV A;  3LUO A;  4DRO A;  1J4I A;  3KAB A;  1FD9 A;  3IKD A;  1Q6U A;  2LJ4 A;  4NNR A;  4DZ3 A;  1FKF A;  5HWB A;  1M5Y A;  3NI6 A;  2RSE A;  3VAW A;  1FAP A;  1ZCN A;  3CGM A;  1D7H A;  3WH0 A;  4DRM A;  2VCD A;  2RUR A;  2FAP A;  2UZ5 A;  5D75 A;  1NMW A;  3RFW A;  4ODN A;  4DRQ A;  4DT4 A;  4N19 A;  2KFW A;  1TCO C;  5DIU A;  2VN1 A;  2FKE A;  4QT2 A;  1EQ3 A;  4JYS A;  4TW7 A;  2XP9 A;  4O2T A;  4GIV A;  1NMV A;  5HWC A;  2DG9 A;  3IKG A;  4JFM A;  4ODM A;  2XP6 A;  2XPA A;  2PV3 A;  3NRK A;  1FKJ A;  1ZK6 A;  4IPX A;  1QZ2 A;  4U84 A;  2F21 A;  2N87 A;  3UQB A;  3B7X A;  4BF8 A;  1JNS A;  4MGV A;  4ODL A;  5HW6 A;  1Y0O A;  2PV1 A;  2MPH A;  2DG3 A;  4TW8 A;  3O5M A;  2ZQV A;  2M08 A;  3UQA A;  2Q5A A;  1FKD A;  3O5G A;  3O5D A;  4IQ2 A;  3UQI A;  1J4R A;  4FAP A;  2XP5 A;  2PBC A;  2XP8 A;  1D7J A;  4G2P A;  4W9Q A;  1FKR A;  1D6O A;  3UI4 A;  2AWG A;  4U86 A;  2ZR5 A;  2ZQU A;  3I6C A;  4R0X A;  3KAC A;  5DIT A;  1FKS A;  2PPP A;  2ZQS A;  5J6E A;  4JFI A;  1NSG A;  3KAF A;  3KZ7 A;  2LPV A;  3ODK A;  2KR7 A;  4DRP A;  1A7X A;  4W9O A;  2K8I A;  1KT0 A;  4DRJ A;  4GGQ A;  4J4N A;  4ODO A;  2ZR6 A;  1QPF A;  2LGO A;  2D9F A;  4QT3 A;  1KT1 A;  2ZQT A;  5B8I C;  1J4H A;  1JNT A;  2RUC A;  4TW6 A;  3O5P A;  1QPL A;  4ODK A;  2KGJ A;  2M1I A;  3O5O A;  2OFN A;  4MSP A;  3PA7 A;  4TNS A;  5I98 A;  2MNT A;  5BXJ A;  4LAY A;  2M2A A;  2MLX A;  4DRK A;  3O5L A;  1FKB A;  1R9H A;  1FKL A;  1U79 A;  2Y78 A; 
#chains in the Genus database with same CATH topology
 3TDB A;  2O92 A;  4J4O A;  4LAV A;  4ZPW R;  1KFW A;  2XP3 A;  5HBF A;  5HKG A;  2XP7 A;  3ARU A;  1X6N A;  3O5F A;  2F4E A;  4LAW A;  4XAK A;  4L3N A;  3ARR A;  4Z2K A;  1LJY A;  4QIB A;  3TCZ A;  1RD6 A;  4MNJ A;  2DT2 A;  3GTY X;  1E6N A;  4TYO A;  2IF4 A;  4C02 B;  2XP4 A;  4WIW A;  2IUZ A;  1UR9 A;  3WD3 A;  4IQC A;  4G50 A;  2DSZ A;  1Q6H A;  1N1A A;  2JZV A;  4WK9 A;  3ARX A;  2XPB A;  3AS2 A;  1HKJ A;  1H0I A;  1TFV A;  1BKF A;  1ROT A;  3EIP A;  2B5U B;  1WB0 A;  3KAD A;  1D7I A;  1VF8 A;  2P4V A;  3NTP A;  1E15 A;  4DRH A;  5DIV A;  3LUO A;  4DZ3 A;  3ARW A;  3VAW A;  2RSE A;  3BXW A;  3WH0 A;  1W1P A;  2UZ5 A;  5D75 A;  1NMW A;  4N19 A;  4ZS6 A;  1WAW A;  4DWS B;  1IX5 A;  1NH6 A;  1O6I A;  4GIV A;  3NRK A;  3UQB A;  1JNS A;  4ODL A;  1Y0O A;  4WJX A;  1D2K A;  1LL6 A;  3G6M A;  3AS0 A;  3O5G A;  1J4R A;  3ARP A;  2YBT A;  2XP5 A;  4G2P A;  1FKR A;  4NSB A;  4MNL A;  1H0G A;  2PPP A;  1HJX A;  4IT4 A;  4R5E A;  3CZ8 A;  3GU0 A;  3KAF A;  2LPV A;  4Q22 A;  4ML4 A;  4GGQ A;  4ODO A;  1QPF A;  5B8I C;  1E6R A;  1QPL A;  4Z2G A;  2KGJ A;  3O5O A;  4TNS A;  2WM0 A;  4MNM A;  1GPF A;  4WKF A;  4LAY A;  4L72 B;  1LL4 A;  1U79 A;  3IK8 A;  1ZBK A;  3O5J A;  3RME A;  2PV2 A;  3O5E A;  3ARS A;  2QF8 A;  3ALF A;  1HXV A;  4LAX A;  3MDY B;  4DH0 A;  3PRB A;  4HAR A;  3FY1 A;  2EUL A;  1W9P A;  4P8U A;  1NWU A;  2FDM A;  3O5Q A;  5GPG A;  3ARV A;  1F8A B;  1T11 A;  5DEZ A;  1JND A;  3H9R B;  2PI6 A;  1JNE A;  1EDQ A;  4ITZ A;  4LGX A;  1P5Q A;  3IHZ A;  4Z2H A;  1J6Y A;  4MAV A;  1YAT A;  2RQS A;  4QZV B;  3UI6 A;  1YW5 A;  1FJD A;  3CHF A;  1ZBW A;  2YBU A;  1EHN A;  4JFL A;  2A3C A;  2KO7 A;  2ZR4 A;  3CHD A;  1J4I A;  3KAB A;  1OWQ A;  1Q6U A;  4NNR A;  1FKF A;  2ESC A;  4DRQ A;  2VCD A;  2DSV A;  4ODN A;  2WLY A;  1TCO C;  2DSU A;  4JYS A;  4TW7 A;  2O9O A;  4O2T A;  5HWC A;  1ZL1 A;  4ODM A;  1ZBV A;  4IPX A;  1ZK6 A;  1NWR A;  1QZ2 A;  3WD0 A;  2F21 A;  2DT3 A;  3B7X A;  1W1Y A;  3RM9 A;  2PN0 A;  4TW8 A;  2DG3 A;  2DT1 A;  1HJV A;  3AS3 A;  2ZQV A;  1E6P A;  3UQI A;  4FAP A;  1NWS A;  5DF0 A;  1ZB5 A;  4W9Q A;  1D6O A;  4R0X A;  3I6C A;  1XRV A;  1GOI A;  5DIT A;  2WK2 A;  4JFI A;  4DRP A;  1A7X A;  1KT0 A;  4J4N A;  3QOK A;  1KT1 A;  1JNT A;  2RUC A;  4ODK A;  2M1I A;  3WD4 A;  2B31 A;  3G6L A;  2AOS A;  5I98 A;  2M2A A;  2MLX A;  2G8Z A;  1ITX A;  1R9H A;  1FKL A;  2Y78 A;  1LG1 A;  3OOB A;  2A3B A;  1PBK A;  1Q6I A;  4KQZ A;  3JXV A;  4DIP A;  1L1P A;  4ODR A;  2ITK A;  4TX0 A;  2PPN A;  4DWS D;  5HUA A;  3WD1 A;  3FAP A;  1OGB A;  1UR8 A;  1FKK A;  3UF8 A;  2MLY A;  3O5R A;  4JFJ A;  1W26 A;  4U85 A;  4AY1 A;  2MLZ A;  2L2S A;  1C9H A;  3KCE A;  3PRD A;  1FFQ A;  1Q1C A;  1FKT A;  4FN2 A;  1B6C A;  1XHG A;  3TC5 A;  3UI5 A;  3EY6 A;  4URI A;  1E44 A;  3KAH A;  2KE0 A;  3WL1 A;  3AS1 A;  2RUQ A;  1E9L A;  3PRA A;  4KR0 B;  2F2D A;  2MF9 A;  1W1T A;  2RUD A;  4WKH A;  1CTN A;  1JVW A;  1W9U A;  2KI3 A;  1PIN A;  3WQW A;  4JFK A;  5HTG A;  1BL4 A;  3FXY A;  5HW7 A;  5HWB A;  1M5Y A;  4P8W A;  1D7H A;  3B9E A;  2RUR A;  2FAP A;  3RFW A;  2KFW A;  4QT2 A;  3BMB A;  1LQ0 A;  2XP9 A;  1HKK A;  4JFM A;  4U84 A;  1FKJ A;  2N87 A;  3B9D A;  2MPH A;  3O5M A;  1ZBC A;  4Z2L A;  2M08 A;  3UQA A;  3O5D A;  1FKD A;  1FFR A;  4IQ2 A;  1EQ3 A;  4NZC A;  4UDM A;  2WLZ A;  2XP8 A;  1D7J A;  2ZR5 A;  2ZQU A;  3KAC A;  5J6E A;  1NSG A;  1W9V A;  3KZ7 A;  3ODK A;  3ARY A;  3RM4 A;  4Q7N A;  4MTV A;  2A3E A;  4QT3 A;  1J4H A;  3ARQ A;  4TW6 A;  3O5P A;  2DSW A;  4MSP A;  3PA7 A;  5BXJ A;  3PR9 A;  3WL0 A;  3O5L A;  1FKB A;  1JCH B;  3RGC A;  3GPK A;  3ARO A;  3KAI A;  4ODQ A;  4W9P A;  3B9A A;  1F40 A;  5HT1 A;  3W4R A;  2LKN A;  1SYT A;  3KAG A;  4Z2J A;  4DRI A;  1OGG A;  1ROU A;  3JYM A;  4ODP A;  3JYJ A;  2PPO A;  4DRN A;  1EYM A;  2F23 A;  4WKA A;  3O5I A;  1HJW A;  1FKG A;  1HKI A;  2DPE A;  5GQB A;  3WKZ A;  4MNK A;  5HW8 A;  3CHC A;  4P8X A;  3O5K A;  4DZ2 A;  5JH8 A;  2A3A A;  1W1V A;  1ZU8 A;  2G41 A;  1NWT A;  4Z2I A;  3CGN A;  4PTM A;  1FKH A;  4DWS C;  1HKM A;  2DG4 A;  3AQU A;  4W5U A;  2OLH A;  3WQV A;  2DT0 A;  4MPK A;  4DRO A;  1K9T A;  1FD9 A;  3IKD A;  2LJ4 A;  3NI6 A;  4ZPT R;  1FAP A;  4DWS A;  1ZCN A;  3CGM A;  4DRM A;  4DT4 A;  1GRJ A;  1WNO A;  4IT6 A;  1E6Z A;  3WD2 A;  5DIU A;  1LG2 A;  2VN1 A;  2FKE A;  3ALG A;  1NMV A;  2DG9 A;  3IKG A;  2XP6 A;  3CH9 A;  2XPA A;  2PV3 A;  3B8S A;  5DO2 A;  4BF8 A;  4MGV A;  5HW6 A;  2PV1 A;  3ART A;  5GPR A;  2Q5A A;  1LL7 A;  3CHE A;  2PBC A;  3UI4 A;  2AWG A;  4U86 A;  4ZPV R;  4HBE A;  1EIB A;  3ARZ A;  1FKS A;  2ZQS A;  1GUV A;  3OA5 A;  3WIJ A;  2KR7 A;  4S3K A;  4W9O A;  2K8I A;  4DRJ A;  4P8V A;  2ZR6 A;  2LGO A;  2D9F A;  3RM8 A;  2ZQT A;  4S3J A;  2ETN A;  1SR0 A;  2OFN A;  2MNT A;  1X6L A;  4DRK A;  4HBO A;  1FKI A; 
#chains in the Genus database with same CATH homology
 3TDB A;  2O92 A;  4J4O A;  4LAV A;  4ZPW R;  1KFW A;  2XP3 A;  5HBF A;  5HKG A;  2XP7 A;  3ARU A;  1X6N A;  3O5F A;  2F4E A;  4LAW A;  4XAK A;  4L3N A;  3ARR A;  4Z2K A;  1LJY A;  4QIB A;  3TCZ A;  1RD6 A;  4MNJ A;  2DT2 A;  1E6N A;  4TYO A;  2IF4 A;  4C02 B;  2XP4 A;  4WIW A;  2IUZ A;  1UR9 A;  3WD3 A;  4IQC A;  4G50 A;  2DSZ A;  1Q6H A;  1N1A A;  2JZV A;  4WK9 A;  3ARX A;  2XPB A;  3AS2 A;  1HKJ A;  1H0I A;  1TFV A;  1BKF A;  1ROT A;  1WB0 A;  3KAD A;  1D7I A;  1VF8 A;  3NTP A;  1E15 A;  4DRH A;  5DIV A;  3LUO A;  4DZ3 A;  3ARW A;  3VAW A;  2RSE A;  3BXW A;  3WH0 A;  1W1P A;  2UZ5 A;  5D75 A;  1NMW A;  4N19 A;  4ZS6 A;  1WAW A;  4DWS B;  1IX5 A;  1NH6 A;  1O6I A;  4GIV A;  3NRK A;  3UQB A;  1JNS A;  4ODL A;  1Y0O A;  4WJX A;  1D2K A;  1LL6 A;  3G6M A;  3AS0 A;  3O5G A;  1J4R A;  3ARP A;  2YBT A;  2XP5 A;  4G2P A;  1FKR A;  4NSB A;  4MNL A;  1H0G A;  2PPP A;  1HJX A;  4IT4 A;  4R5E A;  3CZ8 A;  3KAF A;  2LPV A;  4Q22 A;  4ML4 A;  4GGQ A;  4ODO A;  1QPF A;  5B8I C;  1E6R A;  1QPL A;  4Z2G A;  2KGJ A;  3O5O A;  4TNS A;  2WM0 A;  4MNM A;  1GPF A;  4WKF A;  4LAY A;  4L72 B;  1LL4 A;  1U79 A;  3IK8 A;  1ZBK A;  3O5J A;  3RME A;  2PV2 A;  3O5E A;  3ARS A;  2QF8 A;  3ALF A;  1HXV A;  4LAX A;  3MDY B;  4DH0 A;  3PRB A;  4HAR A;  3FY1 A;  1W9P A;  4P8U A;  1NWU A;  2FDM A;  3O5Q A;  5GPG A;  3ARV A;  1F8A B;  1T11 A;  5DEZ A;  1JND A;  3H9R B;  2PI6 A;  1JNE A;  1EDQ A;  4ITZ A;  4LGX A;  1P5Q A;  3IHZ A;  4Z2H A;  1J6Y A;  4MAV A;  1YAT A;  2RQS A;  4QZV B;  3UI6 A;  1YW5 A;  1FJD A;  3CHF A;  1ZBW A;  2YBU A;  1EHN A;  4JFL A;  2A3C A;  2KO7 A;  2ZR4 A;  3CHD A;  1J4I A;  3KAB A;  1OWQ A;  1Q6U A;  4NNR A;  1FKF A;  2ESC A;  4DRQ A;  2VCD A;  2DSV A;  4ODN A;  2WLY A;  1TCO C;  2DSU A;  4JYS A;  4TW7 A;  2O9O A;  4O2T A;  5HWC A;  1ZL1 A;  4ODM A;  1ZBV A;  4IPX A;  1ZK6 A;  1NWR A;  1QZ2 A;  3WD0 A;  2F21 A;  2DT3 A;  3B7X A;  1W1Y A;  3RM9 A;  4TW8 A;  2DG3 A;  2DT1 A;  1HJV A;  3AS3 A;  2ZQV A;  1E6P A;  3UQI A;  4FAP A;  1NWS A;  5DF0 A;  1ZB5 A;  4W9Q A;  1D6O A;  4R0X A;  3I6C A;  1XRV A;  1GOI A;  5DIT A;  2WK2 A;  4JFI A;  4DRP A;  1A7X A;  1KT0 A;  4J4N A;  3QOK A;  1KT1 A;  1JNT A;  2RUC A;  4ODK A;  2M1I A;  3WD4 A;  2B31 A;  3G6L A;  2AOS A;  5I98 A;  2M2A A;  2MLX A;  2G8Z A;  1ITX A;  1R9H A;  1FKL A;  2Y78 A;  1LG1 A;  3OOB A;  2A3B A;  1PBK A;  1Q6I A;  4KQZ A;  3JXV A;  4DIP A;  1L1P A;  4ODR A;  2ITK A;  4TX0 A;  2PPN A;  4DWS D;  5HUA A;  3WD1 A;  3FAP A;  1OGB A;  1UR8 A;  1FKK A;  3UF8 A;  2MLY A;  3O5R A;  4JFJ A;  1W26 A;  4U85 A;  4AY1 A;  2MLZ A;  2L2S A;  1C9H A;  3KCE A;  3PRD A;  1FFQ A;  1Q1C A;  1FKT A;  4FN2 A;  1B6C A;  1XHG A;  3TC5 A;  3UI5 A;  3EY6 A;  4URI A;  3KAH A;  2KE0 A;  3WL1 A;  3AS1 A;  2RUQ A;  1E9L A;  3PRA A;  4KR0 B;  2F2D A;  2MF9 A;  1W1T A;  2RUD A;  4WKH A;  1CTN A;  1JVW A;  1W9U A;  2KI3 A;  1PIN A;  3WQW A;  4JFK A;  5HTG A;  1BL4 A;  3FXY A;  5HW7 A;  5HWB A;  1M5Y A;  4P8W A;  1D7H A;  3B9E A;  2RUR A;  2FAP A;  3RFW A;  2KFW A;  4QT2 A;  1LQ0 A;  2XP9 A;  1HKK A;  4JFM A;  4U84 A;  1FKJ A;  2N87 A;  3B9D A;  2MPH A;  3O5M A;  1ZBC A;  4Z2L A;  2M08 A;  3UQA A;  3O5D A;  1FKD A;  1FFR A;  4IQ2 A;  1EQ3 A;  4NZC A;  2WLZ A;  2XP8 A;  1D7J A;  2ZR5 A;  2ZQU A;  3KAC A;  5J6E A;  1NSG A;  1W9V A;  3KZ7 A;  3ODK A;  3ARY A;  3RM4 A;  4Q7N A;  4MTV A;  2A3E A;  4QT3 A;  1J4H A;  3ARQ A;  4TW6 A;  3O5P A;  2DSW A;  4MSP A;  3PA7 A;  5BXJ A;  3PR9 A;  3WL0 A;  3O5L A;  1FKB A;  3RGC A;  3GPK A;  3ARO A;  3KAI A;  4ODQ A;  4W9P A;  3B9A A;  1F40 A;  5HT1 A;  3W4R A;  2LKN A;  1SYT A;  3KAG A;  4Z2J A;  4DRI A;  1OGG A;  1ROU A;  3JYM A;  4ODP A;  3JYJ A;  2PPO A;  4DRN A;  1EYM A;  4WKA A;  3O5I A;  1HJW A;  1FKG A;  1HKI A;  2DPE A;  5GQB A;  3WKZ A;  4MNK A;  5HW8 A;  3CHC A;  4P8X A;  3O5K A;  4DZ2 A;  5JH8 A;  2A3A A;  1W1V A;  1ZU8 A;  2G41 A;  1NWT A;  4Z2I A;  3CGN A;  4PTM A;  1FKH A;  4DWS C;  1HKM A;  2DG4 A;  3AQU A;  4W5U A;  2OLH A;  3WQV A;  2DT0 A;  4MPK A;  4DRO A;  1K9T A;  1FD9 A;  3IKD A;  2LJ4 A;  3NI6 A;  4ZPT R;  1FAP A;  4DWS A;  1ZCN A;  3CGM A;  4DRM A;  4DT4 A;  1WNO A;  4IT6 A;  1E6Z A;  3WD2 A;  5DIU A;  1LG2 A;  2VN1 A;  2FKE A;  3ALG A;  1NMV A;  2DG9 A;  3IKG A;  2XP6 A;  3CH9 A;  2XPA A;  2PV3 A;  3B8S A;  5DO2 A;  4BF8 A;  4MGV A;  5HW6 A;  2PV1 A;  3ART A;  5GPR A;  2Q5A A;  1LL7 A;  3CHE A;  2PBC A;  3UI4 A;  2AWG A;  4U86 A;  4ZPV R;  4HBE A;  1EIB A;  3ARZ A;  1FKS A;  2ZQS A;  1GUV A;  3OA5 A;  3WIJ A;  2KR7 A;  4S3K A;  4W9O A;  2K8I A;  4DRJ A;  4P8V A;  2ZR6 A;  2LGO A;  2D9F A;  3RM8 A;  2ZQT A;  4S3J A;  2OFN A;  1SR0 A;  2MNT A;  1X6L A;  4DRK A;  4HBO A;  1FKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...