4FAPA

Atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords FK506-BINDING PROTEIN
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4fapA00
2KI3A 3KAIA 1T11A 3O5EA 2LGOA 2DG4A 3CGNA 1FKBA 2DG9A 2XP7A 2KR7A 3O5GA 2M08A 5DIUA 4DH0A 2ZR6A 3KAHA 2PBCA 4DRJA 3JXVA 2XP6A 4DZ3A 3UF8A 4W9QA 2PV3A 2ITKA 2D9FA 3O5QA 4TNSA 2K8IA 4ODOA 4FAPA 5B8IC 1NMWA 3O5PA 1J6YA 3IKDA 4JFJA 1NSGA 4TW6A 3KZ7A 4DT4A 1FKKA 2PV1A 2KFWA 4J4NA 3GPKA 2F21A 4U86A 4G50A 4GGQA 2ZQUA 1J4HA 3RFWA 1Q6HA 2XP4A 2LKNA 1JVWA 4FN2A 4J4OA 5HWBA 2MF9A 3KADA 2MLXA 1YW5A 2RUCA 3B7XA 1W26A 2MPHA 4LAXA 4IQ2A 1Q6UA 2OFNA 2N87A 5HW7A 2M1IA 2MNTA 1N1AA 2PV2A 3UI4A 1EQ3A 1PINA 4NNRA 5BXJA 2RSEA 4JFIA 1F40A 3TDBA 2XP8A 4ODMA 3UQAA 1ROTA 1YATA 2ZR4A 1FKIA 2Y78A 3I6CA 4N19A 3NI6A 4QT3A 1HXVA 3O5LA 2ZQTA 4U84A 1JNSA 2VCDA 1TCOC 2PPOA 2MLZA 4IQCA 3LUOA 4ODKA 2F4EA 1J4IA 4G2PA 2FKEA 3EY6A 3OOBA 4DRMA 1A7XA 5HT1A 5HW6A 3IK8A 4ODNA 2IF4A 1FKLA 1ZCNA 1M5YA 1NMVA 1P5QA 3NRKA 4MSPA 4ODPA 1D7JA 4DRPA 3PA7A 1QZ2A 1F8AB 1FAPA 3O5KA 2DG3A 3KAFA 1Y0OA 5GPGA 2LJ4A 3PRDA 3O5MA 3RGCA 5HUAA 1ROUA 1KT1A 1FKFA 3CGMA 2RUQA 3ODKA 3KACA 3KCEA 4ITZA 1D7IA 5DITA 4QT2A 3NTPA 3IHZA 3O5RA 2MLYA 1FKHA 1Q1CA 1EYMA 1FKTA 1QPLA 1QPFA 4W9OA 4LAYA 4C02B 5I98A 2LPVA 2RUDA 3UI6A 1J4RA 1KT0A 2M2AA 3O5OA 3WH0A 4DZ2A 1FD9A 1R9HA 2AWGA 3JYMA 1D7HA 2KO7A 1JNTA 1FKJA 2PPPA 2VN1A 4LAWA 3O5IA 4DROA 4TW8A 3O5FA 4GIVA 1U79A 4JFKA 1BKFA 2XPBA 1BL4A 5HTGA 1FKRA 2JZVA 2PPNA 1FJDA 4MGVA 4IPXA 4W9PA 2XP3A 5DIVA 4LAVA 4DRQA 3JYJA 3IKGA 4DIPA 2KGJA 1Q6IA 1PBKA 4BF8A 3UQIA 4TYOA 4DRIA 2FAPA 2RURA 3PRBA 4DRNA 2L2SA 4R0XA 2XP5A 4O2TA 3KAGA 3UQBA 2ZR5A 1ZK6A 3O5DA 2XP9A 2XPAA 1FKGA 2KE0A 1C9HA 2ZQVA 4TW7A 4ODLA 3TCZA 3TC5A 4DRHA 4JYSA 4QIBA 3FAPA 5HKGA 1L1PA 2Q5AA 5D75A 5HWCA 4JFLA 3H9RB 3O5JA 4U85A 3VAWA 3KABA 4ODQA 4JFMA 3UI5A 5J6EA 3MDYB 1D6OA 4ODRA 4DRKA 1B6CA 1FKDA 2F2DA 2RQSA 2UZ5A 4TX0A 1FKSA 5HW8A 2ZQSA
chains in the Genus database with same CATH superfamily
2KI3A 3O5EA 3OA5A 2XP7A 4DH0A 3W4RA 2PBCA 3WKZA 4W9QA 1X6LA 3O5QA 2K8IA 5B8IC 3O5PA 1J6YA 4JFJA 1NSGA 4TW6A 2PV1A 2KFWA 3ALFA 2F21A 4GGQA 2PN0A 2MF9A 4WJXA 3ARSA 1WB0A 1Q6UA 2OFNA 4ZPWR 1EQ3A 3UI4A 1LJYA 5BXJA 2RSEA 2XP8A 1ROTA 3ARWA 2WK2A 2Y78A 3I6CA 4N19A 4QT3A 2VCDA 2PPOA 4IQCA 3AS1A 3G6MA 4DRMA 4ZS6A 2QF8A 1A7XA 4ODNA 2FDMA 4MSPA 1QZ2A 2DG3A 1E6ZA 1Y0OA 2EULA 3O5MA 1UR8A 3CGMA 3QOKA 3AS2A 3IHZA 3ARXA 3O5RA 4ML4A 1QPFA 4C02B 3CHEA 4URIA 1E9LA 4LAWA 2VN1A 4DROA 4TW8A 2DT1A 3B9DA 1E6RA 1FJDA 1K9TA 1ZBWA 1CTNA 5DIVA 2ETNA 3AS0A 4P8WA 2FAPA 2F23A 3CHDA 3KAGA 2ZR5A 3O5DA 3WIJA 2DSUA 2XP9A 1SYTA 4TW7A 1WAWA 3FAPA 1L1PA 2Q5AA 1W1PA 4U85A 4ODRA 2F2DA 2ZQSA 3WD0A 3KAIA 2LGOA 2DG4A 5DIUA 2KR7A 4WKHA 4DWSD 5HBFA 4P8VA 2XP6A 1HKJA 1HKMA 5DF0A 2D9FA 3RMEA 4UDMA 4FAPA 2DSVA 2G8ZA 1GRJA 3KZ7A 3WQVA 4DT4A 3ARYA 1FFQA 2ZQUA 3RM4A 1D2KA 4FN2A 1E6NA 1JVWA 5HWBA 3KADA 1YW5A 2RUCA 3G6LA 2OLHA 3PR9A 4IQ2A 5HW7A 4MNLA 1OWQA 1W1VA 3EIPA 1F40A 3ARRA 4HBEA 3BXWA 1FKIA 4ZPVR 3NI6A 4U84A 1ZBKA 1ITXA 3WD1A 1TCOC 4ODKA 1GOIA 1ZB5A 2F4EA 4G2PA 2FKEA 3EY6A 3OOBA 5HT1A 3NRKA 1M5YA 4ODPA 1LG1A 3CHCA 4ZPTR 1FAPA 3O5KA 5HUAA 2LJ4A 1ROUA 1FKFA 3ODKA 3KACA 3FY1A 1D7IA 5DITA 3NTPA 4HARA 3B8SA 2MLYA 4Q7NA 4MNMA 4LAYA 4W9OA 3UI6A 4PTMA 3O5OA 4WKAA 1R9HA 1OGBA 2AWGA 1D7HA 2KO7A 4MPKA 3ARQA 3O5IA 1U79A 1BL4A 2JZVA 2XP3A 2P4VA 4DWSB 1E6PA 4DIPA 3PRAA 2WLYA 1Q6IA 4BF8A 3UQIA 1O6IA 3AQUA 4DRNA 4Z2IA 4KQZA 2XP5A 4MNKA 1ZBVA 4ODLA 3WQWA 4QIBA 5D75A 5HWCA 1KFWA 5JH8A 3KABA 5J6EA 1D6OA 4DRKA 1FKDA 4TX0A 1JCHB 3ARPA 4WIWA 1T11A 3CGNA 1LG2A 3O5GA 2IUZA 2M08A 3KAHA 4DRJA 4DZ3A 4Z2HA 2ITKA 2A3AA 1UR9A 1LL4A 1ZBCA 4Q22A 4ODOA 1NMWA 3IKDA 2DSWA 4DWSC 1FKKA 4J4NA 3CZ8A 4W5UA 4U86A 4G50A 3WL0A 3RFWA 1Q6HA 2XP4A 4J4OA 2MLXA 1LQ0A 4MAVA 4KR0B 1FFRA 2N87A 1NWSA 2PV2A 1N1AA 4NNRA 4JFIA 3TDBA 3UQAA 1YATA 2ZR4A 1EIBA 4Z2KA 3WD2A 4QZVB 4WK9A 1NH6A 2B5UB 3LUOA 1LL7A 4NSBA 3AROA 3IK8A 2IF4A 3RM9A 2DSZA 3B9EA 3WD3A 1P5QA 3GU0A 4L3NA 1D7JA 2DPEA 1F8AB 1E44A 3RGCA 1HKKA 2RUQA 3KCEA 4ITZA 4R5EA 1H0IA 4XAKA 4P8XA 1Q1CA 1EYMA 1FKTA 1QPLA 3ARTA 1E15A 2RUDA 1RD6A 1KT0A 2M2AA 1W1TA 3JYMA 2PPPA 1JNTA 1FKJA 2WLZA 4Z2GA 3RM8A 1BKFA 3FXYA 2XPBA 1EDQA 5HTGA 1W1YA 1NWRA 4MGVA 3AS3A 2G41A 4LAVA 1IX5A 2PI6A 2KGJA 1PBKA 3ARUA 4TYOA 2L2SA 4AY1A 4O2TA 3UQBA 1ZK6A 1XHGA 1FKGA 2KE0A 1C9HA 2XPAA 2ZQVA 4DRHA 5HKGA 4JYSA 1W9PA 1GPFA 1W9UA 3O5JA 3VAWA 4ODQA 4JFMA 4Z2LA 5DO2A 2A3CA 1LL6A 1B6CA 4S3KA 2RQSA 2UZ5A 1ZU8A 1FKSA 4S3JA 1NWTA 1WNOA 4LGXA 1FKBA 1JNDA 2DG9A 2ZR6A 1ZL1A 3JXVA 3UF8A 2ESCA 2PV3A 4P8UA 4TNSA 4MNJA 1VF8A 2YBTA 1HJVA 3BMBA 3GPKA 4HBOA 1J4HA 4WKFA 2LKNA 3CH9A 3B7XA 2DT2A 1HJWA 1W26A 2MPHA 4LAXA 2M1IA 2MNTA 1PINA 4NZCA 4ODMA 3ALGA 1HXVA 3O5LA 2ZQTA 1W9VA 3GTYX 3ARZA 1JNSA 3WD4A 2MLZA 4MTVA 1J4IA 1JNEA 5HW6A 1TFVA 2DT3A 4L72B 1FKLA 1ZCNA 1NMVA 4DWSA 4DRPA 5GQBA 3PA7A 3KAFA 5GPGA 3PRDA 1HJXA 1KT1A 4QT2A 2DT0A 1H0GA 1FKHA 3WL1A 5I98A 2LPVA 1J4RA 2A3BA 3WH0A 4DZ2A 1FD9A 2WM0A 1SR0A 3O5FA 4GIVA 4JFKA 2B31A 2O9OA 3CHFA 1FKRA 2PPNA 1EHNA 4IPXA 1X6NA 4W9PA 2AOSA 5DEZA 2YBUA 1OGGA 4DRQA 3JYJA 3IKGA 1GUVA 4IT6A 4DRIA 2RURA 3PRBA 1NWUA 3TC5A 3TCZA 5GPRA 2A3EA 1HKIA 4JFLA 4IT4A 3H9RB 3UI5A 3ARVA 1XRVA 3MDYB 2O92A 4Z2JA 3B9AA 4R0XA 5HW8A
chains in the Genus database with same CATH topology
2KI3A 3O5EA 3OA5A 2XP7A 4DH0A 3W4RA 2PBCA 3WKZA 4W9QA 1X6LA 3O5QA 2K8IA 5B8IC 3O5PA 1J6YA 4JFJA 1NSGA 4TW6A 2PV1A 2KFWA 3ALFA 2F21A 4GGQA 2MF9A 4WJXA 3ARSA 1WB0A 1Q6UA 2OFNA 4ZPWR 1EQ3A 3UI4A 1LJYA 5BXJA 2RSEA 2XP8A 1ROTA 3ARWA 2WK2A 2Y78A 3I6CA 4N19A 4QT3A 2VCDA 2PPOA 4IQCA 3AS1A 3G6MA 4DRMA 4ZS6A 2QF8A 1A7XA 4ODNA 2FDMA 4MSPA 1QZ2A 2DG3A 1E6ZA 1Y0OA 3O5MA 1UR8A 3CGMA 3QOKA 3AS2A 3IHZA 3ARXA 3O5RA 4ML4A 1QPFA 4C02B 3CHEA 4URIA 1E9LA 4LAWA 2VN1A 4DROA 4TW8A 2DT1A 3B9DA 1E6RA 1FJDA 1K9TA 1ZBWA 1CTNA 5DIVA 3AS0A 4P8WA 2FAPA 3CHDA 3KAGA 2ZR5A 3O5DA 3WIJA 2DSUA 2XP9A 1SYTA 4TW7A 1WAWA 3FAPA 1L1PA 2Q5AA 1W1PA 4U85A 4ODRA 2F2DA 2ZQSA 3WD0A 3KAIA 2LGOA 2DG4A 5DIUA 2KR7A 4WKHA 4DWSD 5HBFA 4P8VA 2XP6A 1HKJA 1HKMA 5DF0A 2D9FA 3RMEA 4FAPA 2DSVA 2G8ZA 3KZ7A 3WQVA 4DT4A 3ARYA 1FFQA 2ZQUA 3RM4A 1D2KA 4FN2A 1E6NA 1JVWA 5HWBA 3KADA 1YW5A 2RUCA 3G6LA 2OLHA 3PR9A 4IQ2A 5HW7A 4MNLA 1OWQA 1W1VA 1F40A 3ARRA 4HBEA 3BXWA 1FKIA 4ZPVR 3NI6A 4U84A 1ZBKA 1ITXA 3WD1A 1TCOC 4ODKA 1GOIA 1ZB5A 2F4EA 4G2PA 2FKEA 3EY6A 3OOBA 5HT1A 3NRKA 1M5YA 4ODPA 1LG1A 3CHCA 4ZPTR 1FAPA 3O5KA 5HUAA 2LJ4A 1ROUA 1FKFA 3ODKA 3KACA 3FY1A 1D7IA 5DITA 3NTPA 4HARA 3B8SA 2MLYA 4Q7NA 4MNMA 4LAYA 4W9OA 3UI6A 4PTMA 3O5OA 4WKAA 1R9HA 1OGBA 2AWGA 1D7HA 2KO7A 4MPKA 3ARQA 3O5IA 1U79A 1BL4A 2JZVA 2XP3A 4DWSB 1E6PA 4DIPA 3PRAA 2WLYA 1Q6IA 4BF8A 3UQIA 1O6IA 3AQUA 4DRNA 4Z2IA 4KQZA 2XP5A 4MNKA 1ZBVA 4ODLA 3WQWA 4QIBA 5D75A 5HWCA 1KFWA 5JH8A 3KABA 5J6EA 1D6OA 4DRKA 1FKDA 4TX0A 3ARPA 4WIWA 1T11A 3CGNA 1LG2A 3O5GA 2IUZA 2M08A 3KAHA 4DRJA 4DZ3A 4Z2HA 2ITKA 2A3AA 1UR9A 1LL4A 1ZBCA 4Q22A 4ODOA 1NMWA 3IKDA 2DSWA 4DWSC 1FKKA 4J4NA 3CZ8A 4W5UA 4U86A 4G50A 3WL0A 3RFWA 1Q6HA 2XP4A 4J4OA 2MLXA 1LQ0A 4MAVA 4KR0B 1FFRA 2N87A 1NWSA 2PV2A 1N1AA 4NNRA 4JFIA 3TDBA 3UQAA 1YATA 2ZR4A 1EIBA 4Z2KA 3WD2A 4QZVB 4WK9A 1NH6A 3LUOA 1LL7A 4NSBA 3AROA 3IK8A 2IF4A 3RM9A 2DSZA 3B9EA 3WD3A 1P5QA 4L3NA 1D7JA 2DPEA 1F8AB 3RGCA 1HKKA 2RUQA 3KCEA 4ITZA 4R5EA 1H0IA 4XAKA 4P8XA 1Q1CA 1EYMA 1FKTA 1QPLA 3ARTA 1E15A 2RUDA 1RD6A 1KT0A 2M2AA 1W1TA 3JYMA 2PPPA 1JNTA 1FKJA 2WLZA 4Z2GA 3RM8A 1BKFA 3FXYA 2XPBA 1EDQA 5HTGA 1W1YA 1NWRA 4MGVA 3AS3A 2G41A 4LAVA 1IX5A 2PI6A 2KGJA 1PBKA 3ARUA 4TYOA 2L2SA 4AY1A 4O2TA 3UQBA 1ZK6A 1XHGA 1FKGA 2KE0A 1C9HA 2XPAA 2ZQVA 4DRHA 5HKGA 4JYSA 1W9PA 1GPFA 1W9UA 3O5JA 3VAWA 4ODQA 4JFMA 4Z2LA 5DO2A 2A3CA 1LL6A 1B6CA 4S3KA 2RQSA 2UZ5A 1ZU8A 1FKSA 4S3JA 1NWTA 1WNOA 4LGXA 1FKBA 1JNDA 2DG9A 2ZR6A 1ZL1A 3JXVA 3UF8A 2ESCA 2PV3A 4P8UA 4TNSA 4MNJA 1VF8A 2YBTA 1HJVA 3GPKA 4HBOA 1J4HA 4WKFA 2LKNA 3CH9A 3B7XA 2DT2A 1HJWA 1W26A 2MPHA 4LAXA 2M1IA 2MNTA 1PINA 4NZCA 4ODMA 3ALGA 1HXVA 3O5LA 2ZQTA 1W9VA 3ARZA 1JNSA 3WD4A 2MLZA 4MTVA 1J4IA 1JNEA 5HW6A 1TFVA 2DT3A 4L72B 1FKLA 1ZCNA 1NMVA 4DWSA 4DRPA 5GQBA 3PA7A 3KAFA 5GPGA 3PRDA 1HJXA 1KT1A 4QT2A 2DT0A 1H0GA 1FKHA 3WL1A 5I98A 2LPVA 1J4RA 2A3BA 3WH0A 4DZ2A 1FD9A 2WM0A 1SR0A 3O5FA 4GIVA 4JFKA 2B31A 2O9OA 3CHFA 1FKRA 2PPNA 1EHNA 4IPXA 1X6NA 4W9PA 2AOSA 5DEZA 2YBUA 1OGGA 4DRQA 3JYJA 3IKGA 1GUVA 4IT6A 4DRIA 2RURA 3PRBA 1NWUA 3TC5A 3TCZA 5GPRA 2A3EA 1HKIA 4JFLA 4IT4A 3H9RB 3UI5A 3ARVA 1XRVA 3MDYB 2O92A 4Z2JA 3B9AA 4R0XA 5HW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI3 A;  3KAI A;  1T11 A;  3O5E A;  2LGO A;  2DG4 A;  3CGN A;  1FKB A;  2DG9 A;  2XP7 A;  2KR7 A;  3O5G A;  2M08 A;  5DIU A;  4DH0 A;  2ZR6 A;  3KAH A;  2PBC A;  4DRJ A;  3JXV A;  2XP6 A;  4DZ3 A;  3UF8 A;  4W9Q A;  2PV3 A;  2ITK A;  2D9F A;  3O5Q A;  4TNS A;  2K8I A;  4ODO A;  4FAP A;  5B8I C;  1NMW A;  3O5P A;  1J6Y A;  3IKD A;  4JFJ A;  1NSG A;  4TW6 A;  3KZ7 A;  4DT4 A;  1FKK A;  2PV1 A;  2KFW A;  4J4N A;  3GPK A;  2F21 A;  4U86 A;  4G50 A;  4GGQ A;  2ZQU A;  1J4H A;  3RFW A;  1Q6H A;  2XP4 A;  2LKN A;  1JVW A;  4FN2 A;  4J4O A;  5HWB A;  2MF9 A;  3KAD A;  2MLX A;  1YW5 A;  2RUC A;  3B7X A;  1W26 A;  2MPH A;  4LAX A;  4IQ2 A;  1Q6U A;  2OFN A;  2N87 A;  5HW7 A;  2M1I A;  2MNT A;  1N1A A;  2PV2 A;  3UI4 A;  1EQ3 A;  1PIN A;  4NNR A;  5BXJ A;  2RSE A;  4JFI A;  1F40 A;  3TDB A;  2XP8 A;  4ODM A;  3UQA A;  1ROT A;  1YAT A;  2ZR4 A;  1FKI A;  2Y78 A;  3I6C A;  4N19 A;  3NI6 A;  4QT3 A;  1HXV A;  3O5L A;  2ZQT A;  4U84 A;  1JNS A;  2VCD A;  1TCO C;  2PPO A;  2MLZ A;  4IQC A;  3LUO A;  4ODK A;  2F4E A;  1J4I A;  4G2P A;  2FKE A;  3EY6 A;  3OOB A;  4DRM A;  1A7X A;  5HT1 A;  5HW6 A;  3IK8 A;  4ODN A;  2IF4 A;  1FKL A;  1ZCN A;  1M5Y A;  1NMV A;  1P5Q A;  3NRK A;  4MSP A;  4ODP A;  1D7J A;  4DRP A;  3PA7 A;  1QZ2 A;  1F8A B;  1FAP A;  3O5K A;  2DG3 A;  3KAF A;  1Y0O A;  5GPG A;  2LJ4 A;  3PRD A;  3O5M A;  3RGC A;  5HUA A;  1ROU A;  1KT1 A;  1FKF A;  3CGM A;  2RUQ A;  3ODK A;  3KAC A;  3KCE A;  4ITZ A;  1D7I A;  5DIT A;  4QT2 A;  3NTP A;  3IHZ A;  3O5R A;  2MLY A;  1FKH A;  1Q1C A;  1EYM A;  1FKT A;  1QPL A;  1QPF A;  4W9O A;  4LAY A;  4C02 B;  5I98 A;  2LPV A;  2RUD A;  3UI6 A;  1J4R A;  1KT0 A;  2M2A A;  3O5O A;  3WH0 A;  4DZ2 A;  1FD9 A;  1R9H A;  2AWG A;  3JYM A;  1D7H A;  2KO7 A;  1JNT A;  1FKJ A;  2PPP A;  2VN1 A;  4LAW A;  3O5I A;  4DRO A;  4TW8 A;  3O5F A;  4GIV A;  1U79 A;  4JFK A;  1BKF A;  2XPB A;  1BL4 A;  5HTG A;  1FKR A;  2JZV A;  2PPN A;  1FJD A;  4MGV A;  4IPX A;  4W9P A;  2XP3 A;  5DIV A;  4LAV A;  4DRQ A;  3JYJ A;  3IKG A;  4DIP A;  2KGJ A;  1Q6I A;  1PBK A;  4BF8 A;  3UQI A;  4TYO A;  4DRI A;  2FAP A;  2RUR A;  3PRB A;  4DRN A;  2L2S A;  4R0X A;  2XP5 A;  4O2T A;  3KAG A;  3UQB A;  2ZR5 A;  1ZK6 A;  3O5D A;  2XP9 A;  2XPA A;  1FKG A;  2KE0 A;  1C9H A;  2ZQV A;  4TW7 A;  4ODL A;  3TCZ A;  3TC5 A;  4DRH A;  4JYS A;  4QIB A;  3FAP A;  5HKG A;  1L1P A;  2Q5A A;  5D75 A;  5HWC A;  4JFL A;  3H9R B;  3O5J A;  4U85 A;  3VAW A;  3KAB A;  4ODQ A;  4JFM A;  3UI5 A;  5J6E A;  3MDY B;  1D6O A;  4ODR A;  4DRK A;  1B6C A;  1FKD A;  2F2D A;  2RQS A;  2UZ5 A;  4TX0 A;  1FKS A;  5HW8 A;  2ZQS A; 
#chains in the Genus database with same CATH topology
 2KI3 A;  3O5E A;  3OA5 A;  2XP7 A;  4DH0 A;  3W4R A;  2PBC A;  3WKZ A;  4W9Q A;  1X6L A;  3O5Q A;  2K8I A;  5B8I C;  3O5P A;  1J6Y A;  4JFJ A;  1NSG A;  4TW6 A;  2PV1 A;  2KFW A;  3ALF A;  2F21 A;  4GGQ A;  2PN0 A;  2MF9 A;  4WJX A;  3ARS A;  1WB0 A;  1Q6U A;  2OFN A;  4ZPW R;  1EQ3 A;  3UI4 A;  1LJY A;  5BXJ A;  2RSE A;  2XP8 A;  1ROT A;  3ARW A;  2WK2 A;  2Y78 A;  3I6C A;  4N19 A;  4QT3 A;  2VCD A;  2PPO A;  4IQC A;  3AS1 A;  3G6M A;  4DRM A;  4ZS6 A;  2QF8 A;  1A7X A;  4ODN A;  2FDM A;  4MSP A;  1QZ2 A;  2DG3 A;  1E6Z A;  1Y0O A;  2EUL A;  3O5M A;  1UR8 A;  3CGM A;  3QOK A;  3AS2 A;  3IHZ A;  3ARX A;  3O5R A;  4ML4 A;  1QPF A;  4C02 B;  3CHE A;  4URI A;  1E9L A;  4LAW A;  2VN1 A;  4DRO A;  4TW8 A;  2DT1 A;  3B9D A;  1E6R A;  1FJD A;  1K9T A;  1ZBW A;  1CTN A;  5DIV A;  2ETN A;  3AS0 A;  4P8W A;  2FAP A;  2F23 A;  3CHD A;  3KAG A;  2ZR5 A;  3O5D A;  3WIJ A;  2DSU A;  2XP9 A;  1SYT A;  4TW7 A;  1WAW A;  3FAP A;  1L1P A;  2Q5A A;  1W1P A;  4U85 A;  4ODR A;  2F2D A;  2ZQS A;  3WD0 A;  3KAI A;  2LGO A;  2DG4 A;  5DIU A;  2KR7 A;  4WKH A;  4DWS D;  5HBF A;  4P8V A;  2XP6 A;  1HKJ A;  1HKM A;  5DF0 A;  2D9F A;  3RME A;  4UDM A;  4FAP A;  2DSV A;  2G8Z A;  1GRJ A;  3KZ7 A;  3WQV A;  4DT4 A;  3ARY A;  1FFQ A;  2ZQU A;  3RM4 A;  1D2K A;  4FN2 A;  1E6N A;  1JVW A;  5HWB A;  3KAD A;  1YW5 A;  2RUC A;  3G6L A;  2OLH A;  3PR9 A;  4IQ2 A;  5HW7 A;  4MNL A;  1OWQ A;  1W1V A;  3EIP A;  1F40 A;  3ARR A;  4HBE A;  3BXW A;  1FKI A;  4ZPV R;  3NI6 A;  4U84 A;  1ZBK A;  1ITX A;  3WD1 A;  1TCO C;  4ODK A;  1GOI A;  1ZB5 A;  2F4E A;  4G2P A;  2FKE A;  3EY6 A;  3OOB A;  5HT1 A;  3NRK A;  1M5Y A;  4ODP A;  1LG1 A;  3CHC A;  4ZPT R;  1FAP A;  3O5K A;  5HUA A;  2LJ4 A;  1ROU A;  1FKF A;  3ODK A;  3KAC A;  3FY1 A;  1D7I A;  5DIT A;  3NTP A;  4HAR A;  3B8S A;  2MLY A;  4Q7N A;  4MNM A;  4LAY A;  4W9O A;  3UI6 A;  4PTM A;  3O5O A;  4WKA A;  1R9H A;  1OGB A;  2AWG A;  1D7H A;  2KO7 A;  4MPK A;  3ARQ A;  3O5I A;  1U79 A;  1BL4 A;  2JZV A;  2XP3 A;  2P4V A;  4DWS B;  1E6P A;  4DIP A;  3PRA A;  2WLY A;  1Q6I A;  4BF8 A;  3UQI A;  1O6I A;  3AQU A;  4DRN A;  4Z2I A;  4KQZ A;  2XP5 A;  4MNK A;  1ZBV A;  4ODL A;  3WQW A;  4QIB A;  5D75 A;  5HWC A;  1KFW A;  5JH8 A;  3KAB A;  5J6E A;  1D6O A;  4DRK A;  1FKD A;  4TX0 A;  1JCH B;  3ARP A;  4WIW A;  1T11 A;  3CGN A;  1LG2 A;  3O5G A;  2IUZ A;  2M08 A;  3KAH A;  4DRJ A;  4DZ3 A;  4Z2H A;  2ITK A;  2A3A A;  1UR9 A;  1LL4 A;  1ZBC A;  4Q22 A;  4ODO A;  1NMW A;  3IKD A;  2DSW A;  4DWS C;  1FKK A;  4J4N A;  3CZ8 A;  4W5U A;  4U86 A;  4G50 A;  3WL0 A;  3RFW A;  1Q6H A;  2XP4 A;  4J4O A;  2MLX A;  1LQ0 A;  4MAV A;  4KR0 B;  1FFR A;  2N87 A;  1NWS A;  2PV2 A;  1N1A A;  4NNR A;  4JFI A;  3TDB A;  3UQA A;  1YAT A;  2ZR4 A;  1EIB A;  4Z2K A;  3WD2 A;  4QZV B;  4WK9 A;  1NH6 A;  2B5U B;  3LUO A;  1LL7 A;  4NSB A;  3ARO A;  3IK8 A;  2IF4 A;  3RM9 A;  2DSZ A;  3B9E A;  3WD3 A;  1P5Q A;  3GU0 A;  4L3N A;  1D7J A;  2DPE A;  1F8A B;  1E44 A;  3RGC A;  1HKK A;  2RUQ A;  3KCE A;  4ITZ A;  4R5E A;  1H0I A;  4XAK A;  4P8X A;  1Q1C A;  1EYM A;  1FKT A;  1QPL A;  3ART A;  1E15 A;  2RUD A;  1RD6 A;  1KT0 A;  2M2A A;  1W1T A;  3JYM A;  2PPP A;  1JNT A;  1FKJ A;  2WLZ A;  4Z2G A;  3RM8 A;  1BKF A;  3FXY A;  2XPB A;  1EDQ A;  5HTG A;  1W1Y A;  1NWR A;  4MGV A;  3AS3 A;  2G41 A;  4LAV A;  1IX5 A;  2PI6 A;  2KGJ A;  1PBK A;  3ARU A;  4TYO A;  2L2S A;  4AY1 A;  4O2T A;  3UQB A;  1ZK6 A;  1XHG A;  1FKG A;  2KE0 A;  1C9H A;  2XPA A;  2ZQV A;  4DRH A;  5HKG A;  4JYS A;  1W9P A;  1GPF A;  1W9U A;  3O5J A;  3VAW A;  4ODQ A;  4JFM A;  4Z2L A;  5DO2 A;  2A3C A;  1LL6 A;  1B6C A;  4S3K A;  2RQS A;  2UZ5 A;  1ZU8 A;  1FKS A;  4S3J A;  1NWT A;  1WNO A;  4LGX A;  1FKB A;  1JND A;  2DG9 A;  2ZR6 A;  1ZL1 A;  3JXV A;  3UF8 A;  2ESC A;  2PV3 A;  4P8U A;  4TNS A;  4MNJ A;  1VF8 A;  2YBT A;  1HJV A;  3BMB A;  3GPK A;  4HBO A;  1J4H A;  4WKF A;  2LKN A;  3CH9 A;  3B7X A;  2DT2 A;  1HJW A;  1W26 A;  2MPH A;  4LAX A;  2M1I A;  2MNT A;  1PIN A;  4NZC A;  4ODM A;  3ALG A;  1HXV A;  3O5L A;  2ZQT A;  1W9V A;  3GTY X;  3ARZ A;  1JNS A;  3WD4 A;  2MLZ A;  4MTV A;  1J4I A;  1JNE A;  5HW6 A;  1TFV A;  2DT3 A;  4L72 B;  1FKL A;  1ZCN A;  1NMV A;  4DWS A;  4DRP A;  5GQB A;  3PA7 A;  3KAF A;  5GPG A;  3PRD A;  1HJX A;  1KT1 A;  4QT2 A;  2DT0 A;  1H0G A;  1FKH A;  3WL1 A;  5I98 A;  2LPV A;  1J4R A;  2A3B A;  3WH0 A;  4DZ2 A;  1FD9 A;  2WM0 A;  1SR0 A;  3O5F A;  4GIV A;  4JFK A;  2B31 A;  2O9O A;  3CHF A;  1FKR A;  2PPN A;  1EHN A;  4IPX A;  1X6N A;  4W9P A;  2AOS A;  5DEZ A;  2YBU A;  1OGG A;  4DRQ A;  3JYJ A;  3IKG A;  1GUV A;  4IT6 A;  4DRI A;  2RUR A;  3PRB A;  1NWU A;  3TC5 A;  3TCZ A;  5GPR A;  2A3E A;  1HKI A;  4JFL A;  4IT4 A;  3H9R B;  3UI5 A;  3ARV A;  1XRV A;  3MDY B;  2O92 A;  4Z2J A;  3B9A A;  4R0X A;  5HW8 A; 
#chains in the Genus database with same CATH homology
 2KI3 A;  3O5E A;  3OA5 A;  2XP7 A;  4DH0 A;  3W4R A;  2PBC A;  3WKZ A;  4W9Q A;  1X6L A;  3O5Q A;  2K8I A;  5B8I C;  3O5P A;  1J6Y A;  4JFJ A;  1NSG A;  4TW6 A;  2PV1 A;  2KFW A;  3ALF A;  2F21 A;  4GGQ A;  2MF9 A;  4WJX A;  3ARS A;  1WB0 A;  1Q6U A;  2OFN A;  4ZPW R;  1EQ3 A;  3UI4 A;  1LJY A;  5BXJ A;  2RSE A;  2XP8 A;  1ROT A;  3ARW A;  2WK2 A;  2Y78 A;  3I6C A;  4N19 A;  4QT3 A;  2VCD A;  2PPO A;  4IQC A;  3AS1 A;  3G6M A;  4DRM A;  4ZS6 A;  2QF8 A;  1A7X A;  4ODN A;  2FDM A;  4MSP A;  1QZ2 A;  2DG3 A;  1E6Z A;  1Y0O A;  3O5M A;  1UR8 A;  3CGM A;  3QOK A;  3AS2 A;  3IHZ A;  3ARX A;  3O5R A;  4ML4 A;  1QPF A;  4C02 B;  3CHE A;  4URI A;  1E9L A;  4LAW A;  2VN1 A;  4DRO A;  4TW8 A;  2DT1 A;  3B9D A;  1E6R A;  1FJD A;  1K9T A;  1ZBW A;  1CTN A;  5DIV A;  3AS0 A;  4P8W A;  2FAP A;  3CHD A;  3KAG A;  2ZR5 A;  3O5D A;  3WIJ A;  2DSU A;  2XP9 A;  1SYT A;  4TW7 A;  1WAW A;  3FAP A;  1L1P A;  2Q5A A;  1W1P A;  4U85 A;  4ODR A;  2F2D A;  2ZQS A;  3WD0 A;  3KAI A;  2LGO A;  2DG4 A;  5DIU A;  2KR7 A;  4WKH A;  4DWS D;  5HBF A;  4P8V A;  2XP6 A;  1HKJ A;  1HKM A;  5DF0 A;  2D9F A;  3RME A;  4FAP A;  2DSV A;  2G8Z A;  3KZ7 A;  3WQV A;  4DT4 A;  3ARY A;  1FFQ A;  2ZQU A;  3RM4 A;  1D2K A;  4FN2 A;  1E6N A;  1JVW A;  5HWB A;  3KAD A;  1YW5 A;  2RUC A;  3G6L A;  2OLH A;  3PR9 A;  4IQ2 A;  5HW7 A;  4MNL A;  1OWQ A;  1W1V A;  1F40 A;  3ARR A;  4HBE A;  3BXW A;  1FKI A;  4ZPV R;  3NI6 A;  4U84 A;  1ZBK A;  1ITX A;  3WD1 A;  1TCO C;  4ODK A;  1GOI A;  1ZB5 A;  2F4E A;  4G2P A;  2FKE A;  3EY6 A;  3OOB A;  5HT1 A;  3NRK A;  1M5Y A;  4ODP A;  1LG1 A;  3CHC A;  4ZPT R;  1FAP A;  3O5K A;  5HUA A;  2LJ4 A;  1ROU A;  1FKF A;  3ODK A;  3KAC A;  3FY1 A;  1D7I A;  5DIT A;  3NTP A;  4HAR A;  3B8S A;  2MLY A;  4Q7N A;  4MNM A;  4LAY A;  4W9O A;  3UI6 A;  4PTM A;  3O5O A;  4WKA A;  1R9H A;  1OGB A;  2AWG A;  1D7H A;  2KO7 A;  4MPK A;  3ARQ A;  3O5I A;  1U79 A;  1BL4 A;  2JZV A;  2XP3 A;  4DWS B;  1E6P A;  4DIP A;  3PRA A;  2WLY A;  1Q6I A;  4BF8 A;  3UQI A;  1O6I A;  3AQU A;  4DRN A;  4Z2I A;  4KQZ A;  2XP5 A;  4MNK A;  1ZBV A;  4ODL A;  3WQW A;  4QIB A;  5D75 A;  5HWC A;  1KFW A;  5JH8 A;  3KAB A;  5J6E A;  1D6O A;  4DRK A;  1FKD A;  4TX0 A;  3ARP A;  4WIW A;  1T11 A;  3CGN A;  1LG2 A;  3O5G A;  2IUZ A;  2M08 A;  3KAH A;  4DRJ A;  4DZ3 A;  4Z2H A;  2ITK A;  2A3A A;  1UR9 A;  1LL4 A;  1ZBC A;  4Q22 A;  4ODO A;  1NMW A;  3IKD A;  2DSW A;  4DWS C;  1FKK A;  4J4N A;  3CZ8 A;  4W5U A;  4U86 A;  4G50 A;  3WL0 A;  3RFW A;  1Q6H A;  2XP4 A;  4J4O A;  2MLX A;  1LQ0 A;  4MAV A;  4KR0 B;  1FFR A;  2N87 A;  1NWS A;  2PV2 A;  1N1A A;  4NNR A;  4JFI A;  3TDB A;  3UQA A;  1YAT A;  2ZR4 A;  1EIB A;  4Z2K A;  3WD2 A;  4QZV B;  4WK9 A;  1NH6 A;  3LUO A;  1LL7 A;  4NSB A;  3ARO A;  3IK8 A;  2IF4 A;  3RM9 A;  2DSZ A;  3B9E A;  3WD3 A;  1P5Q A;  4L3N A;  1D7J A;  2DPE A;  1F8A B;  3RGC A;  1HKK A;  2RUQ A;  3KCE A;  4ITZ A;  4R5E A;  1H0I A;  4XAK A;  4P8X A;  1Q1C A;  1EYM A;  1FKT A;  1QPL A;  3ART A;  1E15 A;  2RUD A;  1RD6 A;  1KT0 A;  2M2A A;  1W1T A;  3JYM A;  2PPP A;  1JNT A;  1FKJ A;  2WLZ A;  4Z2G A;  3RM8 A;  1BKF A;  3FXY A;  2XPB A;  1EDQ A;  5HTG A;  1W1Y A;  1NWR A;  4MGV A;  3AS3 A;  2G41 A;  4LAV A;  1IX5 A;  2PI6 A;  2KGJ A;  1PBK A;  3ARU A;  4TYO A;  2L2S A;  4AY1 A;  4O2T A;  3UQB A;  1ZK6 A;  1XHG A;  1FKG A;  2KE0 A;  1C9H A;  2XPA A;  2ZQV A;  4DRH A;  5HKG A;  4JYS A;  1W9P A;  1GPF A;  1W9U A;  3O5J A;  3VAW A;  4ODQ A;  4JFM A;  4Z2L A;  5DO2 A;  2A3C A;  1LL6 A;  1B6C A;  4S3K A;  2RQS A;  2UZ5 A;  1ZU8 A;  1FKS A;  4S3J A;  1NWT A;  1WNO A;  4LGX A;  1FKB A;  1JND A;  2DG9 A;  2ZR6 A;  1ZL1 A;  3JXV A;  3UF8 A;  2ESC A;  2PV3 A;  4P8U A;  4TNS A;  4MNJ A;  1VF8 A;  2YBT A;  1HJV A;  3GPK A;  4HBO A;  1J4H A;  4WKF A;  2LKN A;  3CH9 A;  3B7X A;  2DT2 A;  1HJW A;  1W26 A;  2MPH A;  4LAX A;  2M1I A;  2MNT A;  1PIN A;  4NZC A;  4ODM A;  3ALG A;  1HXV A;  3O5L A;  2ZQT A;  1W9V A;  3ARZ A;  1JNS A;  3WD4 A;  2MLZ A;  4MTV A;  1J4I A;  1JNE A;  5HW6 A;  1TFV A;  2DT3 A;  4L72 B;  1FKL A;  1ZCN A;  1NMV A;  4DWS A;  4DRP A;  5GQB A;  3PA7 A;  3KAF A;  5GPG A;  3PRD A;  1HJX A;  1KT1 A;  4QT2 A;  2DT0 A;  1H0G A;  1FKH A;  3WL1 A;  5I98 A;  2LPV A;  1J4R A;  2A3B A;  3WH0 A;  4DZ2 A;  1FD9 A;  2WM0 A;  1SR0 A;  3O5F A;  4GIV A;  4JFK A;  2B31 A;  2O9O A;  3CHF A;  1FKR A;  2PPN A;  1EHN A;  4IPX A;  1X6N A;  4W9P A;  2AOS A;  5DEZ A;  2YBU A;  1OGG A;  4DRQ A;  3JYJ A;  3IKG A;  1GUV A;  4IT6 A;  4DRI A;  2RUR A;  3PRB A;  1NWU A;  3TC5 A;  3TCZ A;  5GPR A;  2A3E A;  1HKI A;  4JFL A;  4IT4 A;  3H9R B;  3UI5 A;  3ARV A;  1XRV A;  3MDY B;  2O92 A;  4Z2J A;  3B9A A;  4R0X A;  5HW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...