5B8IC

Crystal structure of calcineurin a and calcineurin b in complex with fkbp12 and fk506 from coccidioides immitis rs
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
GVTKKILKEGNGVDKPVKGDDIVMNYRGCLYDSSKPSEHFMGRKFDSTEERGEFKTKIGIGVVIRGWDEAVLQMSLGEKSILTITDDYAYGARGFPGLIPPHATLVFEVELKGINSKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase
publication title Crystal structure of Calcineurin A and Calcineurin B in complex with FKBP12 and FK506 from Coccidioides immitis RS
rcsb
source organism Coccidioides immitis (strain rs)
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5b8iC00
2DG9A 4ODLA 2N87A 1J4RA 2VN1A 3JYJA 4DRQA 4ODOA 1ZCNA 4DT4A 4GIVA 1PINA 3VAWA 2RUQA 3EY6A 1D6OA 3O5FA 4DRNA 1FKLA 2FKEA 1FKFA 2RSEA 3CGMA 2M08A 2XP5A 2RUCA 3O5RA 4W9OA 5HKGA 4IPXA 1QZ2A 3RGCA 1PBKA 3O5QA 1M5YA 3KZ7A 2PV3A 3O5GA 1U79A 4JFIA 4U85A 1FKIA 3ODKA 3IKGA 4TW8A 1F40A 1Q6HA 3KADA 3O5DA 4DZ3A 2XP6A 3IHZA 1P5QA 2ZQUA 4DZ2A 2F2DA 2XPBA 4DH0A 3B7XA 3IK8A 1KT1A 1N1AA 1FKSA 2DG4A 4TYOA 2KFWA 3KCEA 5HUAA 2PV1A 4ODNA 2KI3A 3UQIA 2ITKA 2KGJA 1D7IA 2XP4A 1FKGA 4JFJA 5HWCA 4JFLA 2LKNA 2ZQTA 1FKBA 1FKTA 2XPAA 4TW7A 3NTPA 1J4HA 1FAPA 3LUOA 4R0XA 4LAYA 1EYMA 4DRHA 3GPKA 4DIPA 3KACA 4MGVA 4DRIA 1EQ3A 1T11A 1YW5A 3WH0A 5HWBA 1J6YA 3O5LA 3O5JA 3O5KA 4W9PA 1Q6UA 2DG3A 2PPOA 3KAHA 4U84A 5BXJA 4TNSA 4DROA 1FKKA 4JFKA 4MSPA 4ODRA 1FKJA 5B8IC 2Q5AA 3PRDA 2M1IA 2ZR6A 4DRKA 3OOBA 2PPPA 1HXVA 2UZ5A 4ODPA 2OFNA 5J6EA 2KO7A 1FKDA 2MNTA 5GPGA 5HT1A 4ITZA 3IKDA 2MLXA 3H9RB 3NRKA 1F8AB 3JYMA 1A7XA 2Y78A 3PA7A 2MF9A 3MDYB 1TCOC 4G50A 1Q6IA 4FAPA 2L2SA 4J4OA 2IF4A 1KT0A 2LJ4A 2ZR4A 2LGOA 4JYSA 1R9HA 4N19A 2PV2A 4U86A 1ZK6A 2XP3A 1JNSA 2KR7A 4LAWA 3UQAA 2JZVA 1J4IA 1FJDA 4TW6A 4DRMA 4IQCA 2AWGA 3I6CA 5DITA 5DIUA 4IQ2A 4BF8A 1BL4A 2LPVA 3RFWA 2D9FA 4QT2A 5D75A 1FD9A 1ROUA 3KAFA 4ODMA 3TC5A 1B6CA 2K8IA 3NI6A 3UI6A 3FAPA 2VCDA 4ODKA 3TDBA 2XP7A 5HW7A 1C9HA 4LAVA 4J4NA 4ODQA 2MLYA 1FKHA 1D7HA 1W26A 2KE0A 3KAGA 5HW6A 2RQSA 1JVWA 2RUDA 5I98A 1Q1CA 2FAPA 2M2AA 1Y0OA 2PPNA 1D7JA 4C02B 2RURA 2F4EA 2MLZA 1L1PA 4QIBA 1QPLA 4W9QA 4NNRA 3UI5A 1NMWA 3O5IA 2PBCA 5DIVA 1YATA 3O5MA 5HTGA 4G2PA 3UQBA 4LAXA 3O5EA 3O5PA 2MPHA 3KABA 4DRJA 1ROTA 4QT3A 2XP9A 4DRPA 3UF8A 3JXVA 2ZQVA 4FN2A 1JNTA 2ZQSA 1BKFA 2ZR5A 4O2TA 4GGQA 4JFMA 2XP8A 3CGNA 3O5OA 5HW8A 3PRBA 4TX0A 3TCZA 3UI4A 1FKRA 1NMVA 1NSGA 3KAIA 2F21A 1QPFA
chains in the Genus database with same CATH superfamily
4ODLA 2YBUA 4DRQA 4MNKA 3ARUA 3VAWA 1GOIA 5DF0A 4DRNA 1FKFA 1XRVA 3ARTA 5HKGA 3RGCA 1QZ2A 3O5QA 4WKAA 4JFIA 4UDMA 1FKIA 1LL6A 4Z2KA 4DZ3A 4ML4A 3IHZA 2F2DA 3ALFA 3B7XA 3IK8A 1N1AA 4P8VA 1FKSA 2DG4A 4ODNA 2KI3A 2ITKA 5HWCA 2XP4A 2LKNA 1NWSA 2XPAA 3FY1A 4TW7A 1WB0A 5GQBA 2FDMA 4DRHA 4MPKA 4DIPA 2G41A 1EQ3A 1J6YA 3O5JA 2B31A 3ARPA 1W1VA 3OOBA 4ODPA 1HKJA 4Z2JA 5GPGA 5HT1A 4MAVA 2DSZA 3WKZA 1A7XA 3PA7A 4Z2IA 1SR0A 1W9PA 1KT0A 4JYSA 4Q7NA 2LGOA 1ITXA 1JNSA 2KR7A 1GPFA 3ARQA 2JZVA 3CHCA 4P8XA 2AWGA 2AOSA 4BF8A 2D9FA 4HBOA 4ODMA 3ARXA 4L3NA 3ALGA 1JCHB 2XP7A 4ZS6A 4LAVA 4P8WA 4IT4A 4ODQA 2KE0A 5HW6A 2RUDA 2O92A 1E15A 1FFRA 2MLZA 2PBCA 4HBEA 3O5MA 4Z2HA 4AY1A 4DRJA 3O5PA 4WK9A 1E6ZA 3B8SA 3WL0A 1W9VA 4QT3A 4WKFA 1HKKA 1BKFA 4ZPTR 4KR0B 4S3KA 3O5OA 4TX0A 1FKKA 1QPFA 2N87A 2VN1A 3RM9A 1ZCNA 4DT4A 2DT1A 1E44A 2RUQA 2A3BA 1D6OA 3O5FA 2WLYA 1KFWA 1FKLA 2WLZA 3CGMA 2RUCA 3ARZA 1VF8A 1M5YA 1RD6A 3RMEA 1HJVA 1NH6A 1P5QA 1IX5A 3B9DA 2WM0A 2A3CA 2PV1A 3LUOA 1FFQA 2YBTA 3GPKA 1TFVA 3KACA 4MGVA 3ARYA 1T11A 3AS1A 4U84A 2PPOA 5BXJA 4JFKA 2M1IA 1HXVA 2OFNA 2MLXA 3H9RB 3NRKA 1F8AB 3FXYA 4ZPWR 3MDYB 4G50A 5JH8A 4DWSC 4WJXA 4J4OA 2LJ4A 3BXWA 3PR9A 1R9HA 4N19A 2IUZA 3QOKA 4U86A 4LAWA 4TW6A 1OWQA 5DEZA 4DRMA 4IQCA 1LJYA 2DSWA 5DIUA 1BL4A 4QT2A 3TC5A 2B5UB 4ZPVR 2VCDA 3B9AA 4R5EA 1O6IA 5HW7A 1GRJA 3GTYX 1D7HA 4WKHA 3ARWA 2RQSA 1JVWA 3WQVA 3BMBA 1Q1CA 2PPNA 2G8ZA 4C02B 2RURA 4P8UA 2F4EA 1WAWA 3UI5A 1JNDA 1NMWA 3CHFA 3O5IA 4PTMA 1HJXA 2XP9A 3UF8A 4FN2A 1JNTA 2XP8A 3ARRA 3PRBA 4Z2LA 2DT3A 2OLHA 2DSVA 1NSGA 2F21A 1UR8A 2DG9A 4ODOA 4QZVB 1PINA 3EY6A 1NWRA 2FKEA 4URIA 3O5RA 1ZL1A 4W9OA 2DSUA 2PV3A 1U79A 4U85A 3PRAA 3ODKA 3IKGA 3O5DA 1K9TA 2XP6A 4DZ2A 5HUAA 3KCEA 2A3EA 4JFLA 1FKBA 1EHNA 1W1YA 3GU0A 3G6MA 3NTPA 1LG2A 3G6LA 4R0XA 4LAYA 1EYMA 1LL4A 4DRIA 3WH0A 1YW5A 5HWBA 3O5KA 1ZBKA 4W9PA 2DG3A 3KAHA 4TNSA 4DROA 4MSPA 4ODRA 5B8IC 3PRDA 1E9LA 1W9UA 5GPRA 4MNLA 1X6LA 1CTNA 1FKDA 1HKMA 4ITZA 3WIJA 3JYMA 2Y78A 2MF9A 2EULA 2A3AA 2ESCA 4FAPA 2L2SA 4DWSB 1E6NA 1NWUA 2DPEA 4KQZA 3CHEA 1J4IA 1FJDA 1WNOA 3I6CA 4MNMA 5DITA 4IQ2A 2LPVA 4W5UA 2F23A 5D75A 3KAFA 3WL1A 4Q22A 3UI6A 3FAPA 1GUVA 3TDBA 4NSBA 1OGBA 3CHDA 3RM4A 1E6PA 2MLYA 1FKHA 1W26A 1W1TA 3AS0A 3WQWA 1ZB5A 5I98A 1SYTA 1D7JA 4L72B 1L1PA 1ZBCA 3CH9A 1QPLA 4W9QA 4NNRA 3ARVA 5HTGA 4WIWA 1YATA 3UQBA 3AS3A 2MPHA 3KABA 2P4VA 4IT6A 4DRPA 3JXVA 3W4RA 4O2TA 4LGXA 3TCZA 3UI4A 1NMVA 4TW8A 1LL7A 1KT1A 3AROA 1J4RA 1OGGA 2ETNA 3JYJA 3AS2A 4GIVA 1W1PA 3RM8A 1ZU8A 2RSEA 3CZ8A 1X6NA 2M08A 2XP5A 3ARSA 4IPXA 4DWSA 1PBKA 1HJWA 1UR9A 3KZ7A 3O5GA 2DT0A 1F40A 1Q6HA 3KADA 2ZQUA 3B9EA 2XPBA 4DH0A 3WD1A 4MNJA 4TYOA 2QF8A 2KFWA 3UQIA 2KGJA 1D7IA 4JFJA 1FKGA 3WD2A 2ZQTA 1FKTA 2WK2A 1J4HA 1EDQA 1FAPA 2O9OA 3O5LA 1Q6UA 2PN0A 1FKJA 2PI6A 2Q5AA 4Z2GA 2ZR6A 4DRKA 2PPPA 2UZ5A 5J6EA 2KO7A 1E6RA 2MNTA 3IKDA 1H0IA 1TCOC 1Q6IA 2IF4A 1JNEA 1ZBVA 2ZR4A 4DWSD 2PV2A 1LQ0A 1ZK6A 2XP3A 3UQAA 1XHGA 5DO2A 3OA5A 3RFWA 1FD9A 1ROUA 3EIPA 1ZBWA 1B6CA 2K8IA 3NI6A 4ODKA 3WD3A 4XAKA 1C9HA 4J4NA 3KAGA 1LG1A 2DT2A 3WD0A 2FAPA 2M2AA 1NWTA 1D2KA 1Y0OA 5HBFA 4MTVA 4HARA 4QIBA 5DIVA 4G2PA 4LAXA 3O5EA 4NZCA 1ROTA 1HKIA 3AQUA 4S3JA 2ZQVA 2ZQSA 1H0GA 2ZR5A 4GGQA 4JFMA 3CGNA 5HW8A 1FKRA 3KAIA 3WD4A 1EIBA
chains in the Genus database with same CATH topology
4ODLA 2YBUA 4DRQA 4MNKA 3ARUA 3VAWA 1GOIA 5DF0A 4DRNA 1FKFA 1XRVA 3ARTA 5HKGA 3RGCA 1QZ2A 3O5QA 4WKAA 4JFIA 1FKIA 1LL6A 4Z2KA 4DZ3A 4ML4A 3IHZA 2F2DA 3ALFA 3B7XA 3IK8A 1N1AA 4P8VA 1FKSA 2DG4A 4ODNA 2KI3A 2ITKA 5HWCA 2XP4A 2LKNA 1NWSA 2XPAA 3FY1A 4TW7A 1WB0A 5GQBA 2FDMA 4DRHA 4MPKA 4DIPA 2G41A 1EQ3A 1J6YA 3O5JA 2B31A 3ARPA 1W1VA 3OOBA 4ODPA 1HKJA 4Z2JA 5GPGA 5HT1A 4MAVA 2DSZA 3WKZA 1A7XA 3PA7A 4Z2IA 1SR0A 1W9PA 1KT0A 4JYSA 4Q7NA 2LGOA 1ITXA 1JNSA 2KR7A 1GPFA 3ARQA 2JZVA 3CHCA 4P8XA 2AWGA 2AOSA 4BF8A 2D9FA 4HBOA 4ODMA 3ARXA 4L3NA 3ALGA 2XP7A 4ZS6A 4LAVA 4P8WA 4IT4A 4ODQA 2KE0A 5HW6A 2RUDA 2O92A 1E15A 1FFRA 2MLZA 2PBCA 4HBEA 3O5MA 4Z2HA 4AY1A 4DRJA 3O5PA 4WK9A 1E6ZA 3B8SA 3WL0A 1W9VA 4QT3A 4WKFA 1HKKA 1BKFA 4ZPTR 4KR0B 4S3KA 3O5OA 4TX0A 1FKKA 1QPFA 2N87A 2VN1A 3RM9A 1ZCNA 4DT4A 2DT1A 2RUQA 2A3BA 1D6OA 3O5FA 2WLYA 1KFWA 1FKLA 2WLZA 3CGMA 2RUCA 3ARZA 1VF8A 1M5YA 1RD6A 3RMEA 1HJVA 1NH6A 1P5QA 1IX5A 3B9DA 2WM0A 2A3CA 2PV1A 3LUOA 1FFQA 2YBTA 3GPKA 1TFVA 3KACA 4MGVA 3ARYA 1T11A 3AS1A 4U84A 2PPOA 5BXJA 4JFKA 2M1IA 1HXVA 2OFNA 2MLXA 3H9RB 3NRKA 1F8AB 3FXYA 4ZPWR 3MDYB 4G50A 5JH8A 4DWSC 4WJXA 4J4OA 2LJ4A 3BXWA 3PR9A 1R9HA 4N19A 2IUZA 3QOKA 4U86A 4LAWA 4TW6A 1OWQA 5DEZA 4DRMA 4IQCA 1LJYA 2DSWA 5DIUA 1BL4A 4QT2A 3TC5A 4ZPVR 2VCDA 3B9AA 4R5EA 1O6IA 5HW7A 1D7HA 4WKHA 3ARWA 2RQSA 1JVWA 3WQVA 1Q1CA 2PPNA 2G8ZA 4C02B 2RURA 4P8UA 2F4EA 1WAWA 3UI5A 1JNDA 1NMWA 3CHFA 3O5IA 4PTMA 1HJXA 2XP9A 3UF8A 4FN2A 1JNTA 2XP8A 3ARRA 3PRBA 4Z2LA 2DT3A 2OLHA 2DSVA 1NSGA 2F21A 1UR8A 2DG9A 4ODOA 4QZVB 1PINA 3EY6A 1NWRA 2FKEA 4URIA 3O5RA 1ZL1A 4W9OA 2DSUA 2PV3A 1U79A 4U85A 3PRAA 3ODKA 3IKGA 3O5DA 1K9TA 2XP6A 4DZ2A 5HUAA 3KCEA 2A3EA 4JFLA 1FKBA 1EHNA 1W1YA 3G6MA 3NTPA 1LG2A 3G6LA 4R0XA 4LAYA 1EYMA 1LL4A 4DRIA 3WH0A 1YW5A 5HWBA 3O5KA 1ZBKA 4W9PA 2DG3A 3KAHA 4TNSA 4DROA 4MSPA 4ODRA 5B8IC 3PRDA 1E9LA 1W9UA 5GPRA 4MNLA 1X6LA 1CTNA 1FKDA 1HKMA 4ITZA 3WIJA 3JYMA 2Y78A 2MF9A 2A3AA 2ESCA 4FAPA 2L2SA 4DWSB 1E6NA 1NWUA 2DPEA 4KQZA 3CHEA 1J4IA 1FJDA 1WNOA 3I6CA 4MNMA 5DITA 4IQ2A 2LPVA 4W5UA 5D75A 3KAFA 3WL1A 4Q22A 3UI6A 3FAPA 1GUVA 3TDBA 4NSBA 1OGBA 3CHDA 3RM4A 1E6PA 2MLYA 1FKHA 1W26A 1W1TA 3AS0A 3WQWA 1ZB5A 5I98A 1SYTA 1D7JA 4L72B 1L1PA 1ZBCA 3CH9A 1QPLA 4W9QA 4NNRA 3ARVA 5HTGA 4WIWA 1YATA 3UQBA 3AS3A 2MPHA 3KABA 4IT6A 4DRPA 3JXVA 3W4RA 4O2TA 4LGXA 3TCZA 3UI4A 1NMVA 4TW8A 1LL7A 1KT1A 3AROA 1J4RA 1OGGA 3JYJA 3AS2A 4GIVA 1W1PA 3RM8A 1ZU8A 2RSEA 3CZ8A 1X6NA 2M08A 2XP5A 3ARSA 4IPXA 4DWSA 1PBKA 1HJWA 1UR9A 3KZ7A 3O5GA 2DT0A 1F40A 1Q6HA 3KADA 2ZQUA 3B9EA 2XPBA 4DH0A 3WD1A 4MNJA 4TYOA 2QF8A 2KFWA 3UQIA 2KGJA 1D7IA 4JFJA 1FKGA 3WD2A 2ZQTA 1FKTA 2WK2A 1J4HA 1EDQA 1FAPA 2O9OA 3O5LA 1Q6UA 1FKJA 2PI6A 2Q5AA 4Z2GA 2ZR6A 4DRKA 2PPPA 2UZ5A 5J6EA 2KO7A 1E6RA 2MNTA 3IKDA 1H0IA 1TCOC 1Q6IA 2IF4A 1JNEA 1ZBVA 2ZR4A 4DWSD 2PV2A 1LQ0A 1ZK6A 2XP3A 3UQAA 1XHGA 5DO2A 3OA5A 3RFWA 1FD9A 1ROUA 1ZBWA 1B6CA 2K8IA 3NI6A 4ODKA 3WD3A 4XAKA 1C9HA 4J4NA 3KAGA 1LG1A 2DT2A 3WD0A 2FAPA 2M2AA 1NWTA 1D2KA 1Y0OA 5HBFA 4MTVA 4HARA 4QIBA 5DIVA 4G2PA 4LAXA 3O5EA 4NZCA 1ROTA 1HKIA 3AQUA 4S3JA 2ZQVA 2ZQSA 1H0GA 2ZR5A 4GGQA 4JFMA 3CGNA 5HW8A 1FKRA 3KAIA 3WD4A 1EIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG9 A;  4ODL A;  2N87 A;  1J4R A;  2VN1 A;  3JYJ A;  4DRQ A;  4ODO A;  1ZCN A;  4DT4 A;  4GIV A;  1PIN A;  3VAW A;  2RUQ A;  3EY6 A;  1D6O A;  3O5F A;  4DRN A;  1FKL A;  2FKE A;  1FKF A;  2RSE A;  3CGM A;  2M08 A;  2XP5 A;  2RUC A;  3O5R A;  4W9O A;  5HKG A;  4IPX A;  1QZ2 A;  3RGC A;  1PBK A;  3O5Q A;  1M5Y A;  3KZ7 A;  2PV3 A;  3O5G A;  1U79 A;  4JFI A;  4U85 A;  1FKI A;  3ODK A;  3IKG A;  4TW8 A;  1F40 A;  1Q6H A;  3KAD A;  3O5D A;  4DZ3 A;  2XP6 A;  3IHZ A;  1P5Q A;  2ZQU A;  4DZ2 A;  2F2D A;  2XPB A;  4DH0 A;  3B7X A;  3IK8 A;  1KT1 A;  1N1A A;  1FKS A;  2DG4 A;  4TYO A;  2KFW A;  3KCE A;  5HUA A;  2PV1 A;  4ODN A;  2KI3 A;  3UQI A;  2ITK A;  2KGJ A;  1D7I A;  2XP4 A;  1FKG A;  4JFJ A;  5HWC A;  4JFL A;  2LKN A;  2ZQT A;  1FKB A;  1FKT A;  2XPA A;  4TW7 A;  3NTP A;  1J4H A;  1FAP A;  3LUO A;  4R0X A;  4LAY A;  1EYM A;  4DRH A;  3GPK A;  4DIP A;  3KAC A;  4MGV A;  4DRI A;  1EQ3 A;  1T11 A;  1YW5 A;  3WH0 A;  5HWB A;  1J6Y A;  3O5L A;  3O5J A;  3O5K A;  4W9P A;  1Q6U A;  2DG3 A;  2PPO A;  3KAH A;  4U84 A;  5BXJ A;  4TNS A;  4DRO A;  1FKK A;  4JFK A;  4MSP A;  4ODR A;  1FKJ A;  5B8I C;  2Q5A A;  3PRD A;  2M1I A;  2ZR6 A;  4DRK A;  3OOB A;  2PPP A;  1HXV A;  2UZ5 A;  4ODP A;  2OFN A;  5J6E A;  2KO7 A;  1FKD A;  2MNT A;  5GPG A;  5HT1 A;  4ITZ A;  3IKD A;  2MLX A;  3H9R B;  3NRK A;  1F8A B;  3JYM A;  1A7X A;  2Y78 A;  3PA7 A;  2MF9 A;  3MDY B;  1TCO C;  4G50 A;  1Q6I A;  4FAP A;  2L2S A;  4J4O A;  2IF4 A;  1KT0 A;  2LJ4 A;  2ZR4 A;  2LGO A;  4JYS A;  1R9H A;  4N19 A;  2PV2 A;  4U86 A;  1ZK6 A;  2XP3 A;  1JNS A;  2KR7 A;  4LAW A;  3UQA A;  2JZV A;  1J4I A;  1FJD A;  4TW6 A;  4DRM A;  4IQC A;  2AWG A;  3I6C A;  5DIT A;  5DIU A;  4IQ2 A;  4BF8 A;  1BL4 A;  2LPV A;  3RFW A;  2D9F A;  4QT2 A;  5D75 A;  1FD9 A;  1ROU A;  3KAF A;  4ODM A;  3TC5 A;  1B6C A;  2K8I A;  3NI6 A;  3UI6 A;  3FAP A;  2VCD A;  4ODK A;  3TDB A;  2XP7 A;  5HW7 A;  1C9H A;  4LAV A;  4J4N A;  4ODQ A;  2MLY A;  1FKH A;  1D7H A;  1W26 A;  2KE0 A;  3KAG A;  5HW6 A;  2RQS A;  1JVW A;  2RUD A;  5I98 A;  1Q1C A;  2FAP A;  2M2A A;  1Y0O A;  2PPN A;  1D7J A;  4C02 B;  2RUR A;  2F4E A;  2MLZ A;  1L1P A;  4QIB A;  1QPL A;  4W9Q A;  4NNR A;  3UI5 A;  1NMW A;  3O5I A;  2PBC A;  5DIV A;  1YAT A;  3O5M A;  5HTG A;  4G2P A;  3UQB A;  4LAX A;  3O5E A;  3O5P A;  2MPH A;  3KAB A;  4DRJ A;  1ROT A;  4QT3 A;  2XP9 A;  4DRP A;  3UF8 A;  3JXV A;  2ZQV A;  4FN2 A;  1JNT A;  2ZQS A;  1BKF A;  2ZR5 A;  4O2T A;  4GGQ A;  4JFM A;  2XP8 A;  3CGN A;  3O5O A;  5HW8 A;  3PRB A;  4TX0 A;  3TCZ A;  3UI4 A;  1FKR A;  1NMV A;  1NSG A;  3KAI A;  2F21 A;  1QPF A; 
#chains in the Genus database with same CATH topology
 4ODL A;  2YBU A;  4DRQ A;  4MNK A;  3ARU A;  3VAW A;  1GOI A;  5DF0 A;  4DRN A;  1FKF A;  1XRV A;  3ART A;  5HKG A;  3RGC A;  1QZ2 A;  3O5Q A;  4WKA A;  4JFI A;  4UDM A;  1FKI A;  1LL6 A;  4Z2K A;  4DZ3 A;  4ML4 A;  3IHZ A;  2F2D A;  3ALF A;  3B7X A;  3IK8 A;  1N1A A;  4P8V A;  1FKS A;  2DG4 A;  4ODN A;  2KI3 A;  2ITK A;  5HWC A;  2XP4 A;  2LKN A;  1NWS A;  2XPA A;  3FY1 A;  4TW7 A;  1WB0 A;  5GQB A;  2FDM A;  4DRH A;  4MPK A;  4DIP A;  2G41 A;  1EQ3 A;  1J6Y A;  3O5J A;  2B31 A;  3ARP A;  1W1V A;  3OOB A;  4ODP A;  1HKJ A;  4Z2J A;  5GPG A;  5HT1 A;  4MAV A;  2DSZ A;  3WKZ A;  1A7X A;  3PA7 A;  4Z2I A;  1SR0 A;  1W9P A;  1KT0 A;  4JYS A;  4Q7N A;  2LGO A;  1ITX A;  1JNS A;  2KR7 A;  1GPF A;  3ARQ A;  2JZV A;  3CHC A;  4P8X A;  2AWG A;  2AOS A;  4BF8 A;  2D9F A;  4HBO A;  4ODM A;  3ARX A;  4L3N A;  3ALG A;  1JCH B;  2XP7 A;  4ZS6 A;  4LAV A;  4P8W A;  4IT4 A;  4ODQ A;  2KE0 A;  5HW6 A;  2RUD A;  2O92 A;  1E15 A;  1FFR A;  2MLZ A;  2PBC A;  4HBE A;  3O5M A;  4Z2H A;  4AY1 A;  4DRJ A;  3O5P A;  4WK9 A;  1E6Z A;  3B8S A;  3WL0 A;  1W9V A;  4QT3 A;  4WKF A;  1HKK A;  1BKF A;  4ZPT R;  4KR0 B;  4S3K A;  3O5O A;  4TX0 A;  1FKK A;  1QPF A;  2N87 A;  2VN1 A;  3RM9 A;  1ZCN A;  4DT4 A;  2DT1 A;  1E44 A;  2RUQ A;  2A3B A;  1D6O A;  3O5F A;  2WLY A;  1KFW A;  1FKL A;  2WLZ A;  3CGM A;  2RUC A;  3ARZ A;  1VF8 A;  1M5Y A;  1RD6 A;  3RME A;  1HJV A;  1NH6 A;  1P5Q A;  1IX5 A;  3B9D A;  2WM0 A;  2A3C A;  2PV1 A;  3LUO A;  1FFQ A;  2YBT A;  3GPK A;  1TFV A;  3KAC A;  4MGV A;  3ARY A;  1T11 A;  3AS1 A;  4U84 A;  2PPO A;  5BXJ A;  4JFK A;  2M1I A;  1HXV A;  2OFN A;  2MLX A;  3H9R B;  3NRK A;  1F8A B;  3FXY A;  4ZPW R;  3MDY B;  4G50 A;  5JH8 A;  4DWS C;  4WJX A;  4J4O A;  2LJ4 A;  3BXW A;  3PR9 A;  1R9H A;  4N19 A;  2IUZ A;  3QOK A;  4U86 A;  4LAW A;  4TW6 A;  1OWQ A;  5DEZ A;  4DRM A;  4IQC A;  1LJY A;  2DSW A;  5DIU A;  1BL4 A;  4QT2 A;  3TC5 A;  2B5U B;  4ZPV R;  2VCD A;  3B9A A;  4R5E A;  1O6I A;  5HW7 A;  1GRJ A;  3GTY X;  1D7H A;  4WKH A;  3ARW A;  2RQS A;  1JVW A;  3WQV A;  3BMB A;  1Q1C A;  2PPN A;  2G8Z A;  4C02 B;  2RUR A;  4P8U A;  2F4E A;  1WAW A;  3UI5 A;  1JND A;  1NMW A;  3CHF A;  3O5I A;  4PTM A;  1HJX A;  2XP9 A;  3UF8 A;  4FN2 A;  1JNT A;  2XP8 A;  3ARR A;  3PRB A;  4Z2L A;  2DT3 A;  2OLH A;  2DSV A;  1NSG A;  2F21 A;  1UR8 A;  2DG9 A;  4ODO A;  4QZV B;  1PIN A;  3EY6 A;  1NWR A;  2FKE A;  4URI A;  3O5R A;  1ZL1 A;  4W9O A;  2DSU A;  2PV3 A;  1U79 A;  4U85 A;  3PRA A;  3ODK A;  3IKG A;  3O5D A;  1K9T A;  2XP6 A;  4DZ2 A;  5HUA A;  3KCE A;  2A3E A;  4JFL A;  1FKB A;  1EHN A;  1W1Y A;  3GU0 A;  3G6M A;  3NTP A;  1LG2 A;  3G6L A;  4R0X A;  4LAY A;  1EYM A;  1LL4 A;  4DRI A;  3WH0 A;  1YW5 A;  5HWB A;  3O5K A;  1ZBK A;  4W9P A;  2DG3 A;  3KAH A;  4TNS A;  4DRO A;  4MSP A;  4ODR A;  5B8I C;  3PRD A;  1E9L A;  1W9U A;  5GPR A;  4MNL A;  1X6L A;  1CTN A;  1FKD A;  1HKM A;  4ITZ A;  3WIJ A;  3JYM A;  2Y78 A;  2MF9 A;  2EUL A;  2A3A A;  2ESC A;  4FAP A;  2L2S A;  4DWS B;  1E6N A;  1NWU A;  2DPE A;  4KQZ A;  3CHE A;  1J4I A;  1FJD A;  1WNO A;  3I6C A;  4MNM A;  5DIT A;  4IQ2 A;  2LPV A;  4W5U A;  2F23 A;  5D75 A;  3KAF A;  3WL1 A;  4Q22 A;  3UI6 A;  3FAP A;  1GUV A;  3TDB A;  4NSB A;  1OGB A;  3CHD A;  3RM4 A;  1E6P A;  2MLY A;  1FKH A;  1W26 A;  1W1T A;  3AS0 A;  3WQW A;  1ZB5 A;  5I98 A;  1SYT A;  1D7J A;  4L72 B;  1L1P A;  1ZBC A;  3CH9 A;  1QPL A;  4W9Q A;  4NNR A;  3ARV A;  5HTG A;  4WIW A;  1YAT A;  3UQB A;  3AS3 A;  2MPH A;  3KAB A;  2P4V A;  4IT6 A;  4DRP A;  3JXV A;  3W4R A;  4O2T A;  4LGX A;  3TCZ A;  3UI4 A;  1NMV A;  4TW8 A;  1LL7 A;  1KT1 A;  3ARO A;  1J4R A;  1OGG A;  2ETN A;  3JYJ A;  3AS2 A;  4GIV A;  1W1P A;  3RM8 A;  1ZU8 A;  2RSE A;  3CZ8 A;  1X6N A;  2M08 A;  2XP5 A;  3ARS A;  4IPX A;  4DWS A;  1PBK A;  1HJW A;  1UR9 A;  3KZ7 A;  3O5G A;  2DT0 A;  1F40 A;  1Q6H A;  3KAD A;  2ZQU A;  3B9E A;  2XPB A;  4DH0 A;  3WD1 A;  4MNJ A;  4TYO A;  2QF8 A;  2KFW A;  3UQI A;  2KGJ A;  1D7I A;  4JFJ A;  1FKG A;  3WD2 A;  2ZQT A;  1FKT A;  2WK2 A;  1J4H A;  1EDQ A;  1FAP A;  2O9O A;  3O5L A;  1Q6U A;  2PN0 A;  1FKJ A;  2PI6 A;  2Q5A A;  4Z2G A;  2ZR6 A;  4DRK A;  2PPP A;  2UZ5 A;  5J6E A;  2KO7 A;  1E6R A;  2MNT A;  3IKD A;  1H0I A;  1TCO C;  1Q6I A;  2IF4 A;  1JNE A;  1ZBV A;  2ZR4 A;  4DWS D;  2PV2 A;  1LQ0 A;  1ZK6 A;  2XP3 A;  3UQA A;  1XHG A;  5DO2 A;  3OA5 A;  3RFW A;  1FD9 A;  1ROU A;  3EIP A;  1ZBW A;  1B6C A;  2K8I A;  3NI6 A;  4ODK A;  3WD3 A;  4XAK A;  1C9H A;  4J4N A;  3KAG A;  1LG1 A;  2DT2 A;  3WD0 A;  2FAP A;  2M2A A;  1NWT A;  1D2K A;  1Y0O A;  5HBF A;  4MTV A;  4HAR A;  4QIB A;  5DIV A;  4G2P A;  4LAX A;  3O5E A;  4NZC A;  1ROT A;  1HKI A;  3AQU A;  4S3J A;  2ZQV A;  2ZQS A;  1H0G A;  2ZR5 A;  4GGQ A;  4JFM A;  3CGN A;  5HW8 A;  1FKR A;  3KAI A;  3WD4 A;  1EIB A; 
#chains in the Genus database with same CATH homology
 4ODL A;  2YBU A;  4DRQ A;  4MNK A;  3ARU A;  3VAW A;  1GOI A;  5DF0 A;  4DRN A;  1FKF A;  1XRV A;  3ART A;  5HKG A;  3RGC A;  1QZ2 A;  3O5Q A;  4WKA A;  4JFI A;  1FKI A;  1LL6 A;  4Z2K A;  4DZ3 A;  4ML4 A;  3IHZ A;  2F2D A;  3ALF A;  3B7X A;  3IK8 A;  1N1A A;  4P8V A;  1FKS A;  2DG4 A;  4ODN A;  2KI3 A;  2ITK A;  5HWC A;  2XP4 A;  2LKN A;  1NWS A;  2XPA A;  3FY1 A;  4TW7 A;  1WB0 A;  5GQB A;  2FDM A;  4DRH A;  4MPK A;  4DIP A;  2G41 A;  1EQ3 A;  1J6Y A;  3O5J A;  2B31 A;  3ARP A;  1W1V A;  3OOB A;  4ODP A;  1HKJ A;  4Z2J A;  5GPG A;  5HT1 A;  4MAV A;  2DSZ A;  3WKZ A;  1A7X A;  3PA7 A;  4Z2I A;  1SR0 A;  1W9P A;  1KT0 A;  4JYS A;  4Q7N A;  2LGO A;  1ITX A;  1JNS A;  2KR7 A;  1GPF A;  3ARQ A;  2JZV A;  3CHC A;  4P8X A;  2AWG A;  2AOS A;  4BF8 A;  2D9F A;  4HBO A;  4ODM A;  3ARX A;  4L3N A;  3ALG A;  2XP7 A;  4ZS6 A;  4LAV A;  4P8W A;  4IT4 A;  4ODQ A;  2KE0 A;  5HW6 A;  2RUD A;  2O92 A;  1E15 A;  1FFR A;  2MLZ A;  2PBC A;  4HBE A;  3O5M A;  4Z2H A;  4AY1 A;  4DRJ A;  3O5P A;  4WK9 A;  1E6Z A;  3B8S A;  3WL0 A;  1W9V A;  4QT3 A;  4WKF A;  1HKK A;  1BKF A;  4ZPT R;  4KR0 B;  4S3K A;  3O5O A;  4TX0 A;  1FKK A;  1QPF A;  2N87 A;  2VN1 A;  3RM9 A;  1ZCN A;  4DT4 A;  2DT1 A;  2RUQ A;  2A3B A;  1D6O A;  3O5F A;  2WLY A;  1KFW A;  1FKL A;  2WLZ A;  3CGM A;  2RUC A;  3ARZ A;  1VF8 A;  1M5Y A;  1RD6 A;  3RME A;  1HJV A;  1NH6 A;  1P5Q A;  1IX5 A;  3B9D A;  2WM0 A;  2A3C A;  2PV1 A;  3LUO A;  1FFQ A;  2YBT A;  3GPK A;  1TFV A;  3KAC A;  4MGV A;  3ARY A;  1T11 A;  3AS1 A;  4U84 A;  2PPO A;  5BXJ A;  4JFK A;  2M1I A;  1HXV A;  2OFN A;  2MLX A;  3H9R B;  3NRK A;  1F8A B;  3FXY A;  4ZPW R;  3MDY B;  4G50 A;  5JH8 A;  4DWS C;  4WJX A;  4J4O A;  2LJ4 A;  3BXW A;  3PR9 A;  1R9H A;  4N19 A;  2IUZ A;  3QOK A;  4U86 A;  4LAW A;  4TW6 A;  1OWQ A;  5DEZ A;  4DRM A;  4IQC A;  1LJY A;  2DSW A;  5DIU A;  1BL4 A;  4QT2 A;  3TC5 A;  4ZPV R;  2VCD A;  3B9A A;  4R5E A;  1O6I A;  5HW7 A;  1D7H A;  4WKH A;  3ARW A;  2RQS A;  1JVW A;  3WQV A;  1Q1C A;  2PPN A;  2G8Z A;  4C02 B;  2RUR A;  4P8U A;  2F4E A;  1WAW A;  3UI5 A;  1JND A;  1NMW A;  3CHF A;  3O5I A;  4PTM A;  1HJX A;  2XP9 A;  3UF8 A;  4FN2 A;  1JNT A;  2XP8 A;  3ARR A;  3PRB A;  4Z2L A;  2DT3 A;  2OLH A;  2DSV A;  1NSG A;  2F21 A;  1UR8 A;  2DG9 A;  4ODO A;  4QZV B;  1PIN A;  3EY6 A;  1NWR A;  2FKE A;  4URI A;  3O5R A;  1ZL1 A;  4W9O A;  2DSU A;  2PV3 A;  1U79 A;  4U85 A;  3PRA A;  3ODK A;  3IKG A;  3O5D A;  1K9T A;  2XP6 A;  4DZ2 A;  5HUA A;  3KCE A;  2A3E A;  4JFL A;  1FKB A;  1EHN A;  1W1Y A;  3G6M A;  3NTP A;  1LG2 A;  3G6L A;  4R0X A;  4LAY A;  1EYM A;  1LL4 A;  4DRI A;  3WH0 A;  1YW5 A;  5HWB A;  3O5K A;  1ZBK A;  4W9P A;  2DG3 A;  3KAH A;  4TNS A;  4DRO A;  4MSP A;  4ODR A;  5B8I C;  3PRD A;  1E9L A;  1W9U A;  5GPR A;  4MNL A;  1X6L A;  1CTN A;  1FKD A;  1HKM A;  4ITZ A;  3WIJ A;  3JYM A;  2Y78 A;  2MF9 A;  2A3A A;  2ESC A;  4FAP A;  2L2S A;  4DWS B;  1E6N A;  1NWU A;  2DPE A;  4KQZ A;  3CHE A;  1J4I A;  1FJD A;  1WNO A;  3I6C A;  4MNM A;  5DIT A;  4IQ2 A;  2LPV A;  4W5U A;  5D75 A;  3KAF A;  3WL1 A;  4Q22 A;  3UI6 A;  3FAP A;  1GUV A;  3TDB A;  4NSB A;  1OGB A;  3CHD A;  3RM4 A;  1E6P A;  2MLY A;  1FKH A;  1W26 A;  1W1T A;  3AS0 A;  3WQW A;  1ZB5 A;  5I98 A;  1SYT A;  1D7J A;  4L72 B;  1L1P A;  1ZBC A;  3CH9 A;  1QPL A;  4W9Q A;  4NNR A;  3ARV A;  5HTG A;  4WIW A;  1YAT A;  3UQB A;  3AS3 A;  2MPH A;  3KAB A;  4IT6 A;  4DRP A;  3JXV A;  3W4R A;  4O2T A;  4LGX A;  3TCZ A;  3UI4 A;  1NMV A;  4TW8 A;  1LL7 A;  1KT1 A;  3ARO A;  1J4R A;  1OGG A;  3JYJ A;  3AS2 A;  4GIV A;  1W1P A;  3RM8 A;  1ZU8 A;  2RSE A;  3CZ8 A;  1X6N A;  2M08 A;  2XP5 A;  3ARS A;  4IPX A;  4DWS A;  1PBK A;  1HJW A;  1UR9 A;  3KZ7 A;  3O5G A;  2DT0 A;  1F40 A;  1Q6H A;  3KAD A;  2ZQU A;  3B9E A;  2XPB A;  4DH0 A;  3WD1 A;  4MNJ A;  4TYO A;  2QF8 A;  2KFW A;  3UQI A;  2KGJ A;  1D7I A;  4JFJ A;  1FKG A;  3WD2 A;  2ZQT A;  1FKT A;  2WK2 A;  1J4H A;  1EDQ A;  1FAP A;  2O9O A;  3O5L A;  1Q6U A;  1FKJ A;  2PI6 A;  2Q5A A;  4Z2G A;  2ZR6 A;  4DRK A;  2PPP A;  2UZ5 A;  5J6E A;  2KO7 A;  1E6R A;  2MNT A;  3IKD A;  1H0I A;  1TCO C;  1Q6I A;  2IF4 A;  1JNE A;  1ZBV A;  2ZR4 A;  4DWS D;  2PV2 A;  1LQ0 A;  1ZK6 A;  2XP3 A;  3UQA A;  1XHG A;  5DO2 A;  3OA5 A;  3RFW A;  1FD9 A;  1ROU A;  1ZBW A;  1B6C A;  2K8I A;  3NI6 A;  4ODK A;  3WD3 A;  4XAK A;  1C9H A;  4J4N A;  3KAG A;  1LG1 A;  2DT2 A;  3WD0 A;  2FAP A;  2M2A A;  1NWT A;  1D2K A;  1Y0O A;  5HBF A;  4MTV A;  4HAR A;  4QIB A;  5DIV A;  4G2P A;  4LAX A;  3O5E A;  4NZC A;  1ROT A;  1HKI A;  3AQU A;  4S3J A;  2ZQV A;  2ZQS A;  1H0G A;  2ZR5 A;  4GGQ A;  4JFM A;  3CGN A;  5HW8 A;  1FKR A;  3KAI A;  3WD4 A;  1EIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...