5HKGA

Total chemical synthesis, refolding and crystallographic structure of a fully active immunophilin: calstabin 2 (fkbp12.6).
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1B
publication title Total chemical synthesis, refolding, and crystallographic structure of fully active immunophilin calstabin 2 (FKBP12.6).
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hkgA00
2L2SA 1D7IA 1FKLA 3O5KA 5I98A 1T11A 4ODLA 4LAWA 4IQ2A 2RQSA 1FKKA 3PA7A 3KAIA 4O2TA 1FKSA 4TW8A 3O5FA 1J6YA 5HWCA 4ITZA 2XP6A 1FAPA 4N19A 3UQBA 2F21A 3LUOA 1KT0A 4DRPA 2DG3A 2XP3A 3IHZA 3IKDA 2KFWA 3KZ7A 3GPKA 3KAHA 3RFWA 2PPOA 4FAPA 1F8AB 4GIVA 4ODOA 2MLYA 1EYMA 2PBCA 5GPGA 2XP5A 1J4RA 4ODKA 3PRBA 3UI5A 4QT2A 1NSGA 2PV1A 3O5MA 3ODKA 1P5QA 1FKJA 4GGQA 4MGVA 3UI6A 4DROA 1NMVA 2XP7A 1M5YA 2XP4A 2ZR4A 3H9RB 1ZCNA 3PRDA 1C9HA 1Q6HA 3O5LA 3JXVA 3KAFA 3JYJA 1FJDA 3TC5A 2RUQA 5HW6A 1JNSA 2KO7A 3EY6A 3FAPA 4JFIA 3O5PA 5B8IC 1EQ3A 1U79A 4R0XA 3WH0A 4DRHA 3O5DA 3O5RA 3IK8A 1ROTA 3O5JA 3I6CA 4JFKA 2Y78A 1FD9A 4W9QA 1W26A 2ZQUA 2MF9A 4DRIA 4DRMA 2OFNA 3KACA 1J4HA 2F4EA 2XPBA 3NTPA 1N1AA 2XPAA 2LJ4A 3KABA 2JZVA 2KI3A 1TCOC 3CGMA 2RSEA 4C02B 1YW5A 4W9PA 3OOBA 4DIPA 2XP9A 2ZQSA 3UQAA 2FKEA 3O5QA 1FKTA 1D7JA 2KE0A 1JVWA 2VCDA 3KCEA 4J4OA 4TYOA 1QPLA 3KAGA 5DIUA 1A7XA 4TW7A 3O5IA 5DIVA 3TDBA 4QT3A 1F40A 1Q6UA 3NI6A 4JFLA 3O5GA 3VAWA 2KR7A 2RURA 4ODPA 2M1IA 2VN1A 2ITKA 1PBKA 2F2DA 2M2AA 2MLXA 2UZ5A 4LAYA 2PV2A 4ODNA 1FKBA 2K8IA 4G50A 4TX0A 3CGNA 4DZ3A 1FKRA 1D6OA 3RGCA 4MSPA 3UQIA 5J6EA 1KT1A 2ZQVA 4JFMA 1YATA 1ZK6A 2MNTA 1PINA 1FKGA 4ODQA 1Y0OA 2AWGA 4DZ2A 5HW7A 1L1PA 2D9FA 4FN2A 2ZQTA 3UI4A 4QIBA 4DRQA 3JYMA 5HUAA 4G2PA 3O5OA 1Q1CA 2LGOA 4DRNA 2RUCA 1QPFA 2DG4A 4LAXA 3O5EA 4TW6A 5HWBA 4U86A 1Q6IA 2IF4A 1B6CA 1J4IA 2MPHA 2RUDA 3KADA 2ZR6A 4JYSA 2LKNA 1JNTA 2KGJA 4IQCA 2Q5AA 1FKFA 4DT4A 1FKHA 1QZ2A 1ROUA 4W9OA 3IKGA 2LPVA 5HKGA 1HXVA 1BKFA 2N87A 2ZR5A 4IPXA 4J4NA 4U85A 5BXJA 2PV3A 1BL4A 3B7XA 4NNRA 4ODMA 3TCZA 3UF8A 1FKDA 1D7HA 2FAPA 2PPNA 4BF8A 4DH0A 4U84A 1NMWA 2M08A 3NRKA 4TNSA 3MDYB 5D75A 4ODRA 4DRKA 2XP8A 5HW8A 5HTGA 4LAVA 2MLZA 5DITA 4DRJA 5HT1A 4JFJA 1FKIA 1R9HA 2PPPA 2DG9A
chains in the Genus database with same CATH superfamily
3ARUA 4ODLA 4Z2LA 2WLYA 4IT6A 3O5FA 4ITZA 3UQBA 3LUOA 2DG3A 1SR0A 4WK9A 2IUZA 3GPKA 3KAHA 3RFWA 4DWSD 4GIVA 1E6PA 2MLYA 1FFRA 2XP5A 3PRBA 1NSGA 3ODKA 4GGQA 2XP7A 5DEZA 1OGBA 1Q6HA 3JXVA 3TC5A 5HW6A 1W1YA 2OLHA 2WM0A 4S3KA 3WH0A 4ZS6A 1HKIA 1W26A 2DT0A 2P4VA 3AS0A 5DO2A 1J4HA 4L72B 3ARPA 4MNMA 1ZB5A 2KI3A 3OOBA 2ZQSA 2A3AA 3GTYX 2YBTA 2KE0A 1JVWA 3KCEA 5DIUA 1OGGA 3TDBA 1F40A 2AOSA 3RM9A 1Q6UA 3NI6A 2KR7A 2A3CA 3WD0A 1OWQA 4WIWA 5HBFA 2O9OA 3BXWA 2PV2A 4TX0A 4G50A 4Z2IA 1D6OA 1XHGA 1O6IA 1W1PA 3UQIA 4ZPVR 5J6EA 1YATA 4DZ2A 1PINA 1WB0A 5HUAA 4URIA 3B9EA 1NWRA 2DG4A 3O5EA 1B6CA 1J4IA 4JYSA 2DSZA 3WQWA 1JNTA 1FKHA 1X6NA 1HJWA 3B7XA 3TCZA 4ODMA 1D7HA 2FAPA 4MNJA 3PR9A 4DH0A 4U84A 5HW8A 4DRKA 2XP8A 3AS3A 4LAVA 2DPEA 5DITA 4JFJA 4KQZA 2PPPA 2DG9A 2L2SA 1D7IA 1FKLA 5I98A 2RQSA 3ARVA 1FAPA 2PN0A 4DRPA 3IHZA 5GPRA 2PPOA 3CHDA 3CZ8A 4LGXA 1HJXA 1TFVA 4S3JA 4Z2JA 3UI5A 3BMBA 4XAKA 4MGVA 3G6MA 3PRDA 4W5UA 2A3BA 3O5LA 3KAFA 1FJDA 3JYJA 1W1VA 1JNSA 3ARSA 2KO7A 3EY6A 3FAPA 1EQ3A 1XRVA 4R0XA 3O5RA 3O5JA 3ARRA 1D2KA 4JFKA 5GQBA 2Y78A 4W9QA 2ZQUA 4QZVB 4DRIA 5JH8A 2OFNA 3B8SA 4Q7NA 4WJXA 2XPBA 1N1AA 4P8WA 1FFQA 4C02B 4DIPA 3UQAA 4L3NA 2XP9A 3O5QA 4J4OA 4TYOA 4DWSC 1ZBKA 1UR8A 4TW7A 1E6NA 4JFLA 4ODPA 2ITKA 4LAYA 1NWTA 2M2AA 3CGNA 1GRJA 4UDMA 4ODQA 3W4RA 1L1PA 2AWGA 4FN2A 1LL7A 2B31A 3AROA 3WD4A 4DRQA 1LG1A 4MNLA 2G41A 3O5OA 3CHFA 4DRNA 5HWBA 2IF4A 2DSUA 4IQCA 2Q5AA 1FKFA 4W9OA 2N87A 2ZR5A 4IPXA 4PTMA 3AS1A 1UR9A 3UF8A 4ZPWR 1NMWA 5D75A 4ODRA 5HTGA 3WD2A 2DT1A 2MLZA 1ZBVA 4ZPTR 4DRJA 4AY1A 1E15A 4NNRA 2PI6A 3O5KA 1ITXA 4IQ2A 3CHEA 1VF8A 4HARA 3ARYA 2B5UB 3KAIA 3PA7A 1E6RA 1J6YA 5HWCA 4DWSA 4WKHA 3IKDA 4P8VA 3KZ7A 1E9LA 4FAPA 4ODOA 2PBCA 1EYMA 3CHCA 5GPGA 1J4RA 4ODKA 1LL6A 3WQVA 3RM4A 3O5MA 1P5QA 1NMVA 3B9DA 1E6ZA 2ZR4A 1ZCNA 3FXYA 1RD6A 1HKMA 3RMEA 2RUQA 4MTVA 4Z2KA 5B8IC 3O5DA 1ROTA 4KR0B 2MF9A 3AS2A 2F4EA 1IX5A 4P8XA 3KABA 2LJ4A 1SYTA 1LL4A 1W9VA 2RSEA 4MNKA 1WAWA 1FKTA 4HBEA 1NWSA 3WL1A 1D7JA 4NZCA 3KAGA 1A7XA 2ESCA 3O5IA 1EHNA 3O5GA 3VAWA 2RURA 2VN1A 2DSWA 2UZ5A 3QOKA 2MLXA 4ODNA 1FKBA 2K8IA 5DF0A 1W9UA 4MSPA 3GU0A 2ZQVA 4JFMA 4R5EA 1Y0OA 2D9FA 2WK2A 1HJVA 4G2PA 1ZU8A 2LGOA 3WL0A 1QPFA 1EDQA 4TW6A 3KADA 2QF8A 2RUDA 1EIBA 2A3EA 4DT4A 1ROUA 4IT4A 4Z2GA 3WKZA 1LQ0A 1HXVA 4U85A 3G6LA 1FKDA 1HKKA 2DT2A 2M08A 3ARWA 3EIPA 2DSVA 2EULA 2ETNA 1NH6A 5HT1A 4Z2HA 4WKFA 3ARZA 1T11A 4LAWA 2WLZA 3ARQA 1FKKA 4O2TA 1FKSA 4TW8A 2XP6A 4N19A 2F21A 1KT0A 2XP3A 1HKJA 2O92A 2KFWA 3B9AA 1F8AB 2F23A 3AQUA 1X6LA 4P8UA 3ARTA 4QT2A 1NWUA 2PV1A 1JNEA 4DROA 3UI6A 1FKJA 3WD3A 1M5YA 2XP4A 3H9RB 1C9HA 1H0IA 2DT3A 1W1TA 4JFIA 3O5PA 1U79A 2FDMA 4DRHA 1K9TA 3IK8A 3I6CA 2G8ZA 1FD9A 1GOIA 4DRMA 3CH9A 3KACA 1ZBWA 1H0GA 2YBUA 3NTPA 2XPAA 1WNOA 1ZBCA 2JZVA 3CGMA 1TCOC 1YW5A 4W9PA 4WKAA 2FKEA 1JCHB 4ML4A 1GPFA 2VCDA 1ZL1A 1QPLA 1GUVA 5DIVA 4QT3A 3WIJA 3ARXA 3RM8A 1KFWA 2M1IA 1PBKA 2F2DA 3ALFA 1LG2A 4DZ3A 1CTNA 1FKRA 4DWSB 3FY1A 1KT1A 3RGCA 1ZK6A 2MNTA 1FKGA 5HW7A 1JNDA 2ZQTA 3UI4A 4QIBA 3JYMA 3WD1A 1Q1CA 3ALGA 4Q22A 2RUCA 4LAXA 4U86A 1E44A 1Q6IA 2MPHA 2ZR6A 2LKNA 2KGJA 1QZ2A 3OA5A 3IKGA 2LPVA 5HKGA 1BKFA 3PRAA 4J4NA 5BXJA 1W9PA 4MPKA 2PV3A 1BL4A 4BF8A 2PPNA 4HBOA 3NRKA 4TNSA 3MDYB 1LJYA 4NSBA 4MAVA 1FKIA 1R9HA
chains in the Genus database with same CATH topology
3ARUA 4ODLA 4Z2LA 2WLYA 4IT6A 3O5FA 4ITZA 3UQBA 3LUOA 2DG3A 1SR0A 4WK9A 2IUZA 3GPKA 3KAHA 3RFWA 4DWSD 4GIVA 1E6PA 2MLYA 1FFRA 2XP5A 3PRBA 1NSGA 3ODKA 4GGQA 2XP7A 5DEZA 1OGBA 1Q6HA 3JXVA 3TC5A 5HW6A 1W1YA 2OLHA 2WM0A 4S3KA 3WH0A 4ZS6A 1HKIA 1W26A 2DT0A 3AS0A 5DO2A 1J4HA 4L72B 3ARPA 4MNMA 1ZB5A 2KI3A 3OOBA 2ZQSA 2A3AA 2YBTA 2KE0A 1JVWA 3KCEA 5DIUA 1OGGA 3TDBA 1F40A 2AOSA 3RM9A 1Q6UA 3NI6A 2KR7A 2A3CA 3WD0A 1OWQA 4WIWA 5HBFA 2O9OA 3BXWA 2PV2A 4TX0A 4G50A 4Z2IA 1D6OA 1XHGA 1O6IA 1W1PA 3UQIA 4ZPVR 5J6EA 1YATA 4DZ2A 1PINA 1WB0A 5HUAA 4URIA 3B9EA 1NWRA 2DG4A 3O5EA 1B6CA 1J4IA 4JYSA 2DSZA 3WQWA 1JNTA 1FKHA 1X6NA 1HJWA 3B7XA 3TCZA 4ODMA 1D7HA 2FAPA 4MNJA 3PR9A 4DH0A 4U84A 5HW8A 4DRKA 2XP8A 3AS3A 4LAVA 2DPEA 5DITA 4JFJA 4KQZA 2PPPA 2DG9A 2L2SA 1D7IA 1FKLA 5I98A 2RQSA 3ARVA 1FAPA 4DRPA 3IHZA 5GPRA 2PPOA 3CHDA 3CZ8A 4LGXA 1HJXA 1TFVA 4S3JA 4Z2JA 3UI5A 4XAKA 4MGVA 3G6MA 3PRDA 4W5UA 2A3BA 3O5LA 3KAFA 1FJDA 3JYJA 1W1VA 1JNSA 3ARSA 2KO7A 3EY6A 3FAPA 1EQ3A 1XRVA 4R0XA 3O5RA 3O5JA 3ARRA 1D2KA 4JFKA 5GQBA 2Y78A 4W9QA 2ZQUA 4QZVB 4DRIA 5JH8A 2OFNA 3B8SA 4Q7NA 4WJXA 2XPBA 1N1AA 4P8WA 1FFQA 4C02B 4DIPA 3UQAA 4L3NA 2XP9A 3O5QA 4J4OA 4TYOA 4DWSC 1ZBKA 1UR8A 4TW7A 1E6NA 4JFLA 4ODPA 2ITKA 4LAYA 1NWTA 2M2AA 3CGNA 4ODQA 3W4RA 1L1PA 2AWGA 4FN2A 1LL7A 2B31A 3AROA 3WD4A 4DRQA 1LG1A 4MNLA 2G41A 3O5OA 3CHFA 4DRNA 5HWBA 2IF4A 2DSUA 4IQCA 2Q5AA 1FKFA 4W9OA 2N87A 2ZR5A 4IPXA 4PTMA 3AS1A 1UR9A 3UF8A 4ZPWR 1NMWA 5D75A 4ODRA 5HTGA 3WD2A 2DT1A 2MLZA 1ZBVA 4ZPTR 4DRJA 4AY1A 1E15A 4NNRA 2PI6A 3O5KA 1ITXA 4IQ2A 3CHEA 1VF8A 4HARA 3ARYA 3PA7A 3KAIA 1E6RA 1J6YA 5HWCA 4DWSA 4WKHA 3IKDA 4P8VA 3KZ7A 1E9LA 4FAPA 4ODOA 2PBCA 1EYMA 3CHCA 5GPGA 1J4RA 4ODKA 1LL6A 3WQVA 3RM4A 3O5MA 1P5QA 1NMVA 3B9DA 1E6ZA 2ZR4A 1ZCNA 3FXYA 1RD6A 1HKMA 3RMEA 2RUQA 4MTVA 4Z2KA 5B8IC 3O5DA 1ROTA 4KR0B 2MF9A 3AS2A 2F4EA 1IX5A 4P8XA 3KABA 2LJ4A 1SYTA 1LL4A 1W9VA 2RSEA 4MNKA 1WAWA 1FKTA 4HBEA 1NWSA 3WL1A 1D7JA 4NZCA 3KAGA 1A7XA 2ESCA 3O5IA 1EHNA 3O5GA 3VAWA 2RURA 2VN1A 2DSWA 2UZ5A 3QOKA 2MLXA 4ODNA 1FKBA 2K8IA 5DF0A 1W9UA 4MSPA 2ZQVA 4JFMA 4R5EA 1Y0OA 2D9FA 2WK2A 1HJVA 4G2PA 1ZU8A 2LGOA 3WL0A 1QPFA 1EDQA 4TW6A 3KADA 2QF8A 2RUDA 1EIBA 2A3EA 4DT4A 1ROUA 4IT4A 4Z2GA 3WKZA 1LQ0A 1HXVA 4U85A 3G6LA 1FKDA 1HKKA 2DT2A 2M08A 3ARWA 2DSVA 1NH6A 5HT1A 4Z2HA 4WKFA 3ARZA 1T11A 4LAWA 2WLZA 3ARQA 1FKKA 4O2TA 1FKSA 4TW8A 2XP6A 4N19A 2F21A 1KT0A 2XP3A 1HKJA 2O92A 2KFWA 3B9AA 1F8AB 3AQUA 1X6LA 4P8UA 3ARTA 4QT2A 1NWUA 2PV1A 1JNEA 4DROA 3UI6A 1FKJA 3WD3A 1M5YA 2XP4A 3H9RB 1C9HA 1H0IA 2DT3A 1W1TA 4JFIA 3O5PA 1U79A 2FDMA 4DRHA 1K9TA 3IK8A 3I6CA 2G8ZA 1FD9A 1GOIA 4DRMA 3CH9A 3KACA 1ZBWA 1H0GA 2YBUA 3NTPA 2XPAA 1WNOA 1ZBCA 2JZVA 3CGMA 1TCOC 1YW5A 4W9PA 4WKAA 2FKEA 4ML4A 1GPFA 2VCDA 1ZL1A 1QPLA 1GUVA 5DIVA 4QT3A 3WIJA 3ARXA 3RM8A 1KFWA 2M1IA 1PBKA 2F2DA 3ALFA 1LG2A 4DZ3A 1CTNA 1FKRA 4DWSB 3FY1A 1KT1A 3RGCA 1ZK6A 2MNTA 1FKGA 5HW7A 1JNDA 2ZQTA 3UI4A 4QIBA 3JYMA 3WD1A 1Q1CA 3ALGA 4Q22A 2RUCA 4LAXA 4U86A 1Q6IA 2MPHA 2ZR6A 2LKNA 2KGJA 1QZ2A 3OA5A 3IKGA 2LPVA 5HKGA 1BKFA 3PRAA 4J4NA 5BXJA 1W9PA 4MPKA 2PV3A 1BL4A 4BF8A 2PPNA 4HBOA 3NRKA 4TNSA 3MDYB 1LJYA 4NSBA 4MAVA 1FKIA 1R9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2S A;  1D7I A;  1FKL A;  3O5K A;  5I98 A;  1T11 A;  4ODL A;  4LAW A;  4IQ2 A;  2RQS A;  1FKK A;  3PA7 A;  3KAI A;  4O2T A;  1FKS A;  4TW8 A;  3O5F A;  1J6Y A;  5HWC A;  4ITZ A;  2XP6 A;  1FAP A;  4N19 A;  3UQB A;  2F21 A;  3LUO A;  1KT0 A;  4DRP A;  2DG3 A;  2XP3 A;  3IHZ A;  3IKD A;  2KFW A;  3KZ7 A;  3GPK A;  3KAH A;  3RFW A;  2PPO A;  4FAP A;  1F8A B;  4GIV A;  4ODO A;  2MLY A;  1EYM A;  2PBC A;  5GPG A;  2XP5 A;  1J4R A;  4ODK A;  3PRB A;  3UI5 A;  4QT2 A;  1NSG A;  2PV1 A;  3O5M A;  3ODK A;  1P5Q A;  1FKJ A;  4GGQ A;  4MGV A;  3UI6 A;  4DRO A;  1NMV A;  2XP7 A;  1M5Y A;  2XP4 A;  2ZR4 A;  3H9R B;  1ZCN A;  3PRD A;  1C9H A;  1Q6H A;  3O5L A;  3JXV A;  3KAF A;  3JYJ A;  1FJD A;  3TC5 A;  2RUQ A;  5HW6 A;  1JNS A;  2KO7 A;  3EY6 A;  3FAP A;  4JFI A;  3O5P A;  5B8I C;  1EQ3 A;  1U79 A;  4R0X A;  3WH0 A;  4DRH A;  3O5D A;  3O5R A;  3IK8 A;  1ROT A;  3O5J A;  3I6C A;  4JFK A;  2Y78 A;  1FD9 A;  4W9Q A;  1W26 A;  2ZQU A;  2MF9 A;  4DRI A;  4DRM A;  2OFN A;  3KAC A;  1J4H A;  2F4E A;  2XPB A;  3NTP A;  1N1A A;  2XPA A;  2LJ4 A;  3KAB A;  2JZV A;  2KI3 A;  1TCO C;  3CGM A;  2RSE A;  4C02 B;  1YW5 A;  4W9P A;  3OOB A;  4DIP A;  2XP9 A;  2ZQS A;  3UQA A;  2FKE A;  3O5Q A;  1FKT A;  1D7J A;  2KE0 A;  1JVW A;  2VCD A;  3KCE A;  4J4O A;  4TYO A;  1QPL A;  3KAG A;  5DIU A;  1A7X A;  4TW7 A;  3O5I A;  5DIV A;  3TDB A;  4QT3 A;  1F40 A;  1Q6U A;  3NI6 A;  4JFL A;  3O5G A;  3VAW A;  2KR7 A;  2RUR A;  4ODP A;  2M1I A;  2VN1 A;  2ITK A;  1PBK A;  2F2D A;  2M2A A;  2MLX A;  2UZ5 A;  4LAY A;  2PV2 A;  4ODN A;  1FKB A;  2K8I A;  4G50 A;  4TX0 A;  3CGN A;  4DZ3 A;  1FKR A;  1D6O A;  3RGC A;  4MSP A;  3UQI A;  5J6E A;  1KT1 A;  2ZQV A;  4JFM A;  1YAT A;  1ZK6 A;  2MNT A;  1PIN A;  1FKG A;  4ODQ A;  1Y0O A;  2AWG A;  4DZ2 A;  5HW7 A;  1L1P A;  2D9F A;  4FN2 A;  2ZQT A;  3UI4 A;  4QIB A;  4DRQ A;  3JYM A;  5HUA A;  4G2P A;  3O5O A;  1Q1C A;  2LGO A;  4DRN A;  2RUC A;  1QPF A;  2DG4 A;  4LAX A;  3O5E A;  4TW6 A;  5HWB A;  4U86 A;  1Q6I A;  2IF4 A;  1B6C A;  1J4I A;  2MPH A;  2RUD A;  3KAD A;  2ZR6 A;  4JYS A;  2LKN A;  1JNT A;  2KGJ A;  4IQC A;  2Q5A A;  1FKF A;  4DT4 A;  1FKH A;  1QZ2 A;  1ROU A;  4W9O A;  3IKG A;  2LPV A;  5HKG A;  1HXV A;  1BKF A;  2N87 A;  2ZR5 A;  4IPX A;  4J4N A;  4U85 A;  5BXJ A;  2PV3 A;  1BL4 A;  3B7X A;  4NNR A;  4ODM A;  3TCZ A;  3UF8 A;  1FKD A;  1D7H A;  2FAP A;  2PPN A;  4BF8 A;  4DH0 A;  4U84 A;  1NMW A;  2M08 A;  3NRK A;  4TNS A;  3MDY B;  5D75 A;  4ODR A;  4DRK A;  2XP8 A;  5HW8 A;  5HTG A;  4LAV A;  2MLZ A;  5DIT A;  4DRJ A;  5HT1 A;  4JFJ A;  1FKI A;  1R9H A;  2PPP A;  2DG9 A; 
#chains in the Genus database with same CATH topology
 3ARU A;  4ODL A;  4Z2L A;  2WLY A;  4IT6 A;  3O5F A;  4ITZ A;  3UQB A;  3LUO A;  2DG3 A;  1SR0 A;  4WK9 A;  2IUZ A;  3GPK A;  3KAH A;  3RFW A;  4DWS D;  4GIV A;  1E6P A;  2MLY A;  1FFR A;  2XP5 A;  3PRB A;  1NSG A;  3ODK A;  4GGQ A;  2XP7 A;  5DEZ A;  1OGB A;  1Q6H A;  3JXV A;  3TC5 A;  5HW6 A;  1W1Y A;  2OLH A;  2WM0 A;  4S3K A;  3WH0 A;  4ZS6 A;  1HKI A;  1W26 A;  2DT0 A;  2P4V A;  3AS0 A;  5DO2 A;  1J4H A;  4L72 B;  3ARP A;  4MNM A;  1ZB5 A;  2KI3 A;  3OOB A;  2ZQS A;  2A3A A;  3GTY X;  2YBT A;  2KE0 A;  1JVW A;  3KCE A;  5DIU A;  1OGG A;  3TDB A;  1F40 A;  2AOS A;  3RM9 A;  1Q6U A;  3NI6 A;  2KR7 A;  2A3C A;  3WD0 A;  1OWQ A;  4WIW A;  5HBF A;  2O9O A;  3BXW A;  2PV2 A;  4TX0 A;  4G50 A;  4Z2I A;  1D6O A;  1XHG A;  1O6I A;  1W1P A;  3UQI A;  4ZPV R;  5J6E A;  1YAT A;  4DZ2 A;  1PIN A;  1WB0 A;  5HUA A;  4URI A;  3B9E A;  1NWR A;  2DG4 A;  3O5E A;  1B6C A;  1J4I A;  4JYS A;  2DSZ A;  3WQW A;  1JNT A;  1FKH A;  1X6N A;  1HJW A;  3B7X A;  3TCZ A;  4ODM A;  1D7H A;  2FAP A;  4MNJ A;  3PR9 A;  4DH0 A;  4U84 A;  5HW8 A;  4DRK A;  2XP8 A;  3AS3 A;  4LAV A;  2DPE A;  5DIT A;  4JFJ A;  4KQZ A;  2PPP A;  2DG9 A;  2L2S A;  1D7I A;  1FKL A;  5I98 A;  2RQS A;  3ARV A;  1FAP A;  2PN0 A;  4DRP A;  3IHZ A;  5GPR A;  2PPO A;  3CHD A;  3CZ8 A;  4LGX A;  1HJX A;  1TFV A;  4S3J A;  4Z2J A;  3UI5 A;  3BMB A;  4XAK A;  4MGV A;  3G6M A;  3PRD A;  4W5U A;  2A3B A;  3O5L A;  3KAF A;  1FJD A;  3JYJ A;  1W1V A;  1JNS A;  3ARS A;  2KO7 A;  3EY6 A;  3FAP A;  1EQ3 A;  1XRV A;  4R0X A;  3O5R A;  3O5J A;  3ARR A;  1D2K A;  4JFK A;  5GQB A;  2Y78 A;  4W9Q A;  2ZQU A;  4QZV B;  4DRI A;  5JH8 A;  2OFN A;  3B8S A;  4Q7N A;  4WJX A;  2XPB A;  1N1A A;  4P8W A;  1FFQ A;  4C02 B;  4DIP A;  3UQA A;  4L3N A;  2XP9 A;  3O5Q A;  4J4O A;  4TYO A;  4DWS C;  1ZBK A;  1UR8 A;  4TW7 A;  1E6N A;  4JFL A;  4ODP A;  2ITK A;  4LAY A;  1NWT A;  2M2A A;  3CGN A;  1GRJ A;  4UDM A;  4ODQ A;  3W4R A;  1L1P A;  2AWG A;  4FN2 A;  1LL7 A;  2B31 A;  3ARO A;  3WD4 A;  4DRQ A;  1LG1 A;  4MNL A;  2G41 A;  3O5O A;  3CHF A;  4DRN A;  5HWB A;  2IF4 A;  2DSU A;  4IQC A;  2Q5A A;  1FKF A;  4W9O A;  2N87 A;  2ZR5 A;  4IPX A;  4PTM A;  3AS1 A;  1UR9 A;  3UF8 A;  4ZPW R;  1NMW A;  5D75 A;  4ODR A;  5HTG A;  3WD2 A;  2DT1 A;  2MLZ A;  1ZBV A;  4ZPT R;  4DRJ A;  4AY1 A;  1E15 A;  4NNR A;  2PI6 A;  3O5K A;  1ITX A;  4IQ2 A;  3CHE A;  1VF8 A;  4HAR A;  3ARY A;  2B5U B;  3KAI A;  3PA7 A;  1E6R A;  1J6Y A;  5HWC A;  4DWS A;  4WKH A;  3IKD A;  4P8V A;  3KZ7 A;  1E9L A;  4FAP A;  4ODO A;  2PBC A;  1EYM A;  3CHC A;  5GPG A;  1J4R A;  4ODK A;  1LL6 A;  3WQV A;  3RM4 A;  3O5M A;  1P5Q A;  1NMV A;  3B9D A;  1E6Z A;  2ZR4 A;  1ZCN A;  3FXY A;  1RD6 A;  1HKM A;  3RME A;  2RUQ A;  4MTV A;  4Z2K A;  5B8I C;  3O5D A;  1ROT A;  4KR0 B;  2MF9 A;  3AS2 A;  2F4E A;  1IX5 A;  4P8X A;  3KAB A;  2LJ4 A;  1SYT A;  1LL4 A;  1W9V A;  2RSE A;  4MNK A;  1WAW A;  1FKT A;  4HBE A;  1NWS A;  3WL1 A;  1D7J A;  4NZC A;  3KAG A;  1A7X A;  2ESC A;  3O5I A;  1EHN A;  3O5G A;  3VAW A;  2RUR A;  2VN1 A;  2DSW A;  2UZ5 A;  3QOK A;  2MLX A;  4ODN A;  1FKB A;  2K8I A;  5DF0 A;  1W9U A;  4MSP A;  3GU0 A;  2ZQV A;  4JFM A;  4R5E A;  1Y0O A;  2D9F A;  2WK2 A;  1HJV A;  4G2P A;  1ZU8 A;  2LGO A;  3WL0 A;  1QPF A;  1EDQ A;  4TW6 A;  3KAD A;  2QF8 A;  2RUD A;  1EIB A;  2A3E A;  4DT4 A;  1ROU A;  4IT4 A;  4Z2G A;  3WKZ A;  1LQ0 A;  1HXV A;  4U85 A;  3G6L A;  1FKD A;  1HKK A;  2DT2 A;  2M08 A;  3ARW A;  3EIP A;  2DSV A;  2EUL A;  2ETN A;  1NH6 A;  5HT1 A;  4Z2H A;  4WKF A;  3ARZ A;  1T11 A;  4LAW A;  2WLZ A;  3ARQ A;  1FKK A;  4O2T A;  1FKS A;  4TW8 A;  2XP6 A;  4N19 A;  2F21 A;  1KT0 A;  2XP3 A;  1HKJ A;  2O92 A;  2KFW A;  3B9A A;  1F8A B;  2F23 A;  3AQU A;  1X6L A;  4P8U A;  3ART A;  4QT2 A;  1NWU A;  2PV1 A;  1JNE A;  4DRO A;  3UI6 A;  1FKJ A;  3WD3 A;  1M5Y A;  2XP4 A;  3H9R B;  1C9H A;  1H0I A;  2DT3 A;  1W1T A;  4JFI A;  3O5P A;  1U79 A;  2FDM A;  4DRH A;  1K9T A;  3IK8 A;  3I6C A;  2G8Z A;  1FD9 A;  1GOI A;  4DRM A;  3CH9 A;  3KAC A;  1ZBW A;  1H0G A;  2YBU A;  3NTP A;  2XPA A;  1WNO A;  1ZBC A;  2JZV A;  3CGM A;  1TCO C;  1YW5 A;  4W9P A;  4WKA A;  2FKE A;  1JCH B;  4ML4 A;  1GPF A;  2VCD A;  1ZL1 A;  1QPL A;  1GUV A;  5DIV A;  4QT3 A;  3WIJ A;  3ARX A;  3RM8 A;  1KFW A;  2M1I A;  1PBK A;  2F2D A;  3ALF A;  1LG2 A;  4DZ3 A;  1CTN A;  1FKR A;  4DWS B;  3FY1 A;  1KT1 A;  3RGC A;  1ZK6 A;  2MNT A;  1FKG A;  5HW7 A;  1JND A;  2ZQT A;  3UI4 A;  4QIB A;  3JYM A;  3WD1 A;  1Q1C A;  3ALG A;  4Q22 A;  2RUC A;  4LAX A;  4U86 A;  1E44 A;  1Q6I A;  2MPH A;  2ZR6 A;  2LKN A;  2KGJ A;  1QZ2 A;  3OA5 A;  3IKG A;  2LPV A;  5HKG A;  1BKF A;  3PRA A;  4J4N A;  5BXJ A;  1W9P A;  4MPK A;  2PV3 A;  1BL4 A;  4BF8 A;  2PPN A;  4HBO A;  3NRK A;  4TNS A;  3MDY B;  1LJY A;  4NSB A;  4MAV A;  1FKI A;  1R9H A; 
#chains in the Genus database with same CATH homology
 3ARU A;  4ODL A;  4Z2L A;  2WLY A;  4IT6 A;  3O5F A;  4ITZ A;  3UQB A;  3LUO A;  2DG3 A;  1SR0 A;  4WK9 A;  2IUZ A;  3GPK A;  3KAH A;  3RFW A;  4DWS D;  4GIV A;  1E6P A;  2MLY A;  1FFR A;  2XP5 A;  3PRB A;  1NSG A;  3ODK A;  4GGQ A;  2XP7 A;  5DEZ A;  1OGB A;  1Q6H A;  3JXV A;  3TC5 A;  5HW6 A;  1W1Y A;  2OLH A;  2WM0 A;  4S3K A;  3WH0 A;  4ZS6 A;  1HKI A;  1W26 A;  2DT0 A;  3AS0 A;  5DO2 A;  1J4H A;  4L72 B;  3ARP A;  4MNM A;  1ZB5 A;  2KI3 A;  3OOB A;  2ZQS A;  2A3A A;  2YBT A;  2KE0 A;  1JVW A;  3KCE A;  5DIU A;  1OGG A;  3TDB A;  1F40 A;  2AOS A;  3RM9 A;  1Q6U A;  3NI6 A;  2KR7 A;  2A3C A;  3WD0 A;  1OWQ A;  4WIW A;  5HBF A;  2O9O A;  3BXW A;  2PV2 A;  4TX0 A;  4G50 A;  4Z2I A;  1D6O A;  1XHG A;  1O6I A;  1W1P A;  3UQI A;  4ZPV R;  5J6E A;  1YAT A;  4DZ2 A;  1PIN A;  1WB0 A;  5HUA A;  4URI A;  3B9E A;  1NWR A;  2DG4 A;  3O5E A;  1B6C A;  1J4I A;  4JYS A;  2DSZ A;  3WQW A;  1JNT A;  1FKH A;  1X6N A;  1HJW A;  3B7X A;  3TCZ A;  4ODM A;  1D7H A;  2FAP A;  4MNJ A;  3PR9 A;  4DH0 A;  4U84 A;  5HW8 A;  4DRK A;  2XP8 A;  3AS3 A;  4LAV A;  2DPE A;  5DIT A;  4JFJ A;  4KQZ A;  2PPP A;  2DG9 A;  2L2S A;  1D7I A;  1FKL A;  5I98 A;  2RQS A;  3ARV A;  1FAP A;  4DRP A;  3IHZ A;  5GPR A;  2PPO A;  3CHD A;  3CZ8 A;  4LGX A;  1HJX A;  1TFV A;  4S3J A;  4Z2J A;  3UI5 A;  4XAK A;  4MGV A;  3G6M A;  3PRD A;  4W5U A;  2A3B A;  3O5L A;  3KAF A;  1FJD A;  3JYJ A;  1W1V A;  1JNS A;  3ARS A;  2KO7 A;  3EY6 A;  3FAP A;  1EQ3 A;  1XRV A;  4R0X A;  3O5R A;  3O5J A;  3ARR A;  1D2K A;  4JFK A;  5GQB A;  2Y78 A;  4W9Q A;  2ZQU A;  4QZV B;  4DRI A;  5JH8 A;  2OFN A;  3B8S A;  4Q7N A;  4WJX A;  2XPB A;  1N1A A;  4P8W A;  1FFQ A;  4C02 B;  4DIP A;  3UQA A;  4L3N A;  2XP9 A;  3O5Q A;  4J4O A;  4TYO A;  4DWS C;  1ZBK A;  1UR8 A;  4TW7 A;  1E6N A;  4JFL A;  4ODP A;  2ITK A;  4LAY A;  1NWT A;  2M2A A;  3CGN A;  4ODQ A;  3W4R A;  1L1P A;  2AWG A;  4FN2 A;  1LL7 A;  2B31 A;  3ARO A;  3WD4 A;  4DRQ A;  1LG1 A;  4MNL A;  2G41 A;  3O5O A;  3CHF A;  4DRN A;  5HWB A;  2IF4 A;  2DSU A;  4IQC A;  2Q5A A;  1FKF A;  4W9O A;  2N87 A;  2ZR5 A;  4IPX A;  4PTM A;  3AS1 A;  1UR9 A;  3UF8 A;  4ZPW R;  1NMW A;  5D75 A;  4ODR A;  5HTG A;  3WD2 A;  2DT1 A;  2MLZ A;  1ZBV A;  4ZPT R;  4DRJ A;  4AY1 A;  1E15 A;  4NNR A;  2PI6 A;  3O5K A;  1ITX A;  4IQ2 A;  3CHE A;  1VF8 A;  4HAR A;  3ARY A;  3PA7 A;  3KAI A;  1E6R A;  1J6Y A;  5HWC A;  4DWS A;  4WKH A;  3IKD A;  4P8V A;  3KZ7 A;  1E9L A;  4FAP A;  4ODO A;  2PBC A;  1EYM A;  3CHC A;  5GPG A;  1J4R A;  4ODK A;  1LL6 A;  3WQV A;  3RM4 A;  3O5M A;  1P5Q A;  1NMV A;  3B9D A;  1E6Z A;  2ZR4 A;  1ZCN A;  3FXY A;  1RD6 A;  1HKM A;  3RME A;  2RUQ A;  4MTV A;  4Z2K A;  5B8I C;  3O5D A;  1ROT A;  4KR0 B;  2MF9 A;  3AS2 A;  2F4E A;  1IX5 A;  4P8X A;  3KAB A;  2LJ4 A;  1SYT A;  1LL4 A;  1W9V A;  2RSE A;  4MNK A;  1WAW A;  1FKT A;  4HBE A;  1NWS A;  3WL1 A;  1D7J A;  4NZC A;  3KAG A;  1A7X A;  2ESC A;  3O5I A;  1EHN A;  3O5G A;  3VAW A;  2RUR A;  2VN1 A;  2DSW A;  2UZ5 A;  3QOK A;  2MLX A;  4ODN A;  1FKB A;  2K8I A;  5DF0 A;  1W9U A;  4MSP A;  2ZQV A;  4JFM A;  4R5E A;  1Y0O A;  2D9F A;  2WK2 A;  1HJV A;  4G2P A;  1ZU8 A;  2LGO A;  3WL0 A;  1QPF A;  1EDQ A;  4TW6 A;  3KAD A;  2QF8 A;  2RUD A;  1EIB A;  2A3E A;  4DT4 A;  1ROU A;  4IT4 A;  4Z2G A;  3WKZ A;  1LQ0 A;  1HXV A;  4U85 A;  3G6L A;  1FKD A;  1HKK A;  2DT2 A;  2M08 A;  3ARW A;  2DSV A;  1NH6 A;  5HT1 A;  4Z2H A;  4WKF A;  3ARZ A;  1T11 A;  4LAW A;  2WLZ A;  3ARQ A;  1FKK A;  4O2T A;  1FKS A;  4TW8 A;  2XP6 A;  4N19 A;  2F21 A;  1KT0 A;  2XP3 A;  1HKJ A;  2O92 A;  2KFW A;  3B9A A;  1F8A B;  3AQU A;  1X6L A;  4P8U A;  3ART A;  4QT2 A;  1NWU A;  2PV1 A;  1JNE A;  4DRO A;  3UI6 A;  1FKJ A;  3WD3 A;  1M5Y A;  2XP4 A;  3H9R B;  1C9H A;  1H0I A;  2DT3 A;  1W1T A;  4JFI A;  3O5P A;  1U79 A;  2FDM A;  4DRH A;  1K9T A;  3IK8 A;  3I6C A;  2G8Z A;  1FD9 A;  1GOI A;  4DRM A;  3CH9 A;  3KAC A;  1ZBW A;  1H0G A;  2YBU A;  3NTP A;  2XPA A;  1WNO A;  1ZBC A;  2JZV A;  3CGM A;  1TCO C;  1YW5 A;  4W9P A;  4WKA A;  2FKE A;  4ML4 A;  1GPF A;  2VCD A;  1ZL1 A;  1QPL A;  1GUV A;  5DIV A;  4QT3 A;  3WIJ A;  3ARX A;  3RM8 A;  1KFW A;  2M1I A;  1PBK A;  2F2D A;  3ALF A;  1LG2 A;  4DZ3 A;  1CTN A;  1FKR A;  4DWS B;  3FY1 A;  1KT1 A;  3RGC A;  1ZK6 A;  2MNT A;  1FKG A;  5HW7 A;  1JND A;  2ZQT A;  3UI4 A;  4QIB A;  3JYM A;  3WD1 A;  1Q1C A;  3ALG A;  4Q22 A;  2RUC A;  4LAX A;  4U86 A;  1Q6I A;  2MPH A;  2ZR6 A;  2LKN A;  2KGJ A;  1QZ2 A;  3OA5 A;  3IKG A;  2LPV A;  5HKG A;  1BKF A;  3PRA A;  4J4N A;  5BXJ A;  1W9P A;  4MPK A;  2PV3 A;  1BL4 A;  4BF8 A;  2PPN A;  4HBO A;  3NRK A;  4TNS A;  3MDY B;  1LJY A;  4NSB A;  4MAV A;  1FKI A;  1R9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...