5HKGA

Total chemical synthesis, refolding and crystallographic structure of a fully active immunophilin: calstabin 2 (fkbp12.6).
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Total chemical synthesis, refolding, and crystallographic structure of fully active immunophilin calstabin 2 (FKBP12.6).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1B
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hkgA00
3O5GA 1EQ3A 3OOBA 4DROA 2MF9A 2XP6A 4W9QA 3ODKA 2ZR4A 3IHZA 4G2PA 4TX0A 1FKTA 1NSGA 2MPHA 3I6CA 5BXJA 4MGVA 2PPPA 1ROUA 4JFJA 2RURA 4FN2A 4DH0A 1L1PA 2IF4A 1JNSA 4ODQA 1D7HA 2Q5AA 4DRNA 4LAWA 3IKGA 4DRMA 4J4OA 2JZVA 2XP4A 2FAPA 2DG4A 2XPBA 3KAHA 3O5IA 4IQ2A 5I98A 2RUQA 5J6EA 4DZ2A 1FKLA 1NMVA 1N1AA 4W9OA 2DG9A 3KAIA 5DIUA 4DRIA 3RGCA 3MDYB 4NNRA 2OFNA 2PV1A 3RFWA 1P5QA 1YATA 2KGJA 2RQSA 1T11A 2RSEA 2MLZA 3GPKA 2KI3A 2LKNA 1JVWA 3IK8A 3LUOA 4JFLA 3NRKA 3VAWA 5HW8A 1D7JA 5HTGA 3O5FA 1J4RA 4U86A 1PINA 2ITKA 3O5MA 4ODOA 4U85A 3EY6A 1M5YA 4J4NA 4DRPA 2KO7A 4LAYA 4DIPA 1BL4A 4DRHA 3UI6A 4R0XA 1PBKA 4GIVA 5HKGA 3PRDA 3UQIA 4N19A 3JYMA 3O5RA 1J4HA 4IPXA 4LAXA 5HWCA 3CGNA 1FKBA 2PV2A 3JXVA 4QT2A 4ODRA 2XPAA 2XP3A 2XP5A 4ODNA 2AWGA 3UF8A 5HT1A 3UQBA 3PRBA 3UQAA 1TCOC 2KFWA 2XP8A 1BKFA 1QZ2A 3O5PA 4G50A 2VN1A 2XP7A 4MSPA 2KR7A 1Q6HA 3O5KA 4ODPA 4ODMA 1R9HA 2MLYA 2N87A 1FD9A 2ZR5A 4TW8A 5DITA 5B8IC 1QPFA 3TC5A 2XP9A 3NI6A 4JFIA 4U84A 2PV3A 3KAGA 3TCZA 4C02B 4FAPA 2ZQTA 1FKFA 2VCDA 2ZQUA 3TDBA 4ITZA 1U79A 3O5EA 2L2SA 1Q1CA 3KADA 5DIVA 1FAPA 3CGMA 1NMWA 2M2AA 2PBCA 2PPOA 2LPVA 1FKDA 4BF8A 4QIBA 3KZ7A 2MNTA 3O5DA 2Y78A 3KACA 2LGOA 4GGQA 1D7IA 4QT3A 3O5QA 1ZCNA 1Q6UA 2DG3A 1C9HA 1EYMA 2UZ5A 1FKKA 4ODLA 2KE0A 2ZQSA 2M1IA 3IKDA 4JYSA 4DT4A 4TW7A 1A7XA 1W26A 1FKHA 1Q6IA 1YW5A 3JYJA 3WH0A 1B6CA 3FAPA 4DRJA 5D75A 1JNTA 4O2TA 4DRQA 1FKIA 1ROTA 2M08A 4DRKA 5HUAA 1KT1A 1FJDA 1HXVA 3NTPA 1FKSA 2F21A 1FKJA 4W9PA 1FKRA 1J6YA 1KT0A 4JFMA 4IQCA 1D6OA 2F2DA 1F8AB 1F40A 4ODKA 2ZR6A 3H9RB 2RUCA 3UI4A 2K8IA 3O5OA 1ZK6A 3KABA 2RUDA 3KCEA 4TNSA 3UI5A 2D9FA 2F4EA 4TYOA 3KAFA 1QPLA 1FKGA 2FKEA 3O5LA 4LAVA 2LJ4A 2PPNA 3O5JA 4DZ3A 5HW6A 1J4IA 3PA7A 4TW6A 1Y0OA 3B7XA 5HWBA 2MLXA 2ZQVA 5HW7A 4JFKA 5GPGA
chains in the Genus database with same CATH superfamily
3WQVA 1W1YA 3O5GA 3OOBA 4W9QA 2O92A 4WKHA 3ARTA 4TX0A 4MGVA 2IF4A 3PRAA 1LG2A 2F23A 3QOKA 4ODQA 3ARVA 1D7HA 2JZVA 2XP4A 5J6EA 2DG4A 4WKAA 5DIUA 4W9OA 4DRIA 1NWUA 2RSEA 3GPKA 2LKNA 1JVWA 3IK8A 4JFLA 3NRKA 1D7JA 4ODOA 4U85A 1M5YA 4DRHA 1ZU8A 4R0XA 4GIVA 1J4HA 2A3EA 4IPXA 5HWCA 3CGNA 1FKBA 4ZPWR 2XPAA 2XP3A 4ODNA 4Q7NA 2AWGA 3UF8A 3WQWA 1NWSA 1E6RA 1TFVA 1W1PA 4MSPA 4ODPA 4U84A 4FAPA 1WAWA 2VCDA 1U79A 3O5EA 1E6PA 1X6NA 1NMWA 4MNJA 2DSVA 2YBUA 2LGOA 4GGQA 1D7IA 3O5QA 4S3KA 5GPRA 4ZPVR 2DG3A 4Q22A 3ARPA 2ZQSA 1GUVA 2O9OA 1A7XA 4ZS6A 1FFRA 4O2TA 3RM9A 3W4RA 1FKSA 2F21A 4W9PA 1SR0A 3CHCA 2F2DA 2ZR6A 1KFWA 4ZPTR 1HKIA 4DWSB 2F4EA 3KAFA 3WL0A 1QPLA 1FKGA 4LAVA 3O5JA 5HW6A 4DWSA 4PTMA 4P8XA 2DT2A 3RM8A 5HW7A 1JCHB 3FXYA 1EIBA 1EQ3A 1E9LA 3IHZA 1NSGA 4DH0A 4JFJA 2RURA 1L1PA 2Q5AA 4DRMA 3EIPA 4J4OA 2DT1A 3B9DA 3KAHA 3O5IA 5I98A 4DZ2A 1FKLA 1N1AA 2G41A 3KAIA 2EULA 3RGCA 1K9TA 2KGJA 4P8VA 2RQSA 1T11A 3WD3A 2G8ZA 5HW8A 1W9UA 2ITKA 3ARXA 3EY6A 4LAYA 1XRVA 1BL4A 2WLYA 1H0GA 1PBKA 3PRDA 2WM0A 3UQIA 4N19A 1ZL1A 3AS3A 1D2KA 3PR9A 4LAXA 4WK9A 2PV2A 5DO2A 2ETNA 3AS1A 2PI6A 3B9AA 3UQAA 2KFWA 1BKFA 1QZ2A 3CHDA 1Q6HA 2KR7A 4ODMA 5DITA 5GQBA 2ZR5A 1QPFA 2XP9A 3ALFA 3ARRA 3TCZA 3KAGA 4C02B 3WD2A 2ZQTA 2ZQUA 2L2SA 5DIVA 3WL1A 3CGMA 4L72B 2PBCA 2PPOA 1UR8A 3ARUA 4BF8A 1ITXA 3O5DA 3KACA 4R5EA 4QT3A 1C9HA 4MNLA 4ODLA 2KE0A 4JYSA 4MAVA 1HJVA 1SYTA 3JYJA 1B6CA 1W1TA 1JNTA 2OLHA 5HUAA 2M08A 1EHNA 1HJWA 3NTPA 1FKJA 1JNDA 4P8UA 3WD0A 1F8AB 4ODKA 1HJXA 3H9RB 1O6IA 1OGGA 2K8IA 3O5OA 3UI5A 2D9FA 4TYOA 2A3AA 2FKEA 2PN0A 2PPNA 3GTYX 1J4IA 4MTVA 4JFKA 4DROA 2A3BA 2MF9A 2YBTA 2XP6A 3ODKA 1NWTA 2DPEA 2MPHA 4HBOA 1ROUA 4FN2A 4DRNA 4LAWA 3IKGA 2XPBA 1H0IA 2RUQA 1NMVA 4NNRA 2PV1A 1P5QA 1YATA 4WIWA 5DF0A 2KI3A 4MNKA 3VAWA 2B31A 1LL6A 1NH6A 1J4RA 4Z2IA 3B8SA 3CHFA 5HBFA 3CH9A 2KO7A 3WKZA 3UI6A 3ARSA 4MNMA 3JYMA 1E6NA 4QT2A 3JXVA 3CZ8A 4S3JA 4ODRA 5HT1A 3UQBA 3PRBA 1TCOC 3AS0A 3O5PA 4G50A 2VN1A 4UDMA 2N87A 4KQZA 3TC5A 5BXJA 4JFIA 4WJXA 1OWQA 4Z2JA 5JH8A 3TDBA 4ITZA 1GRJA 4HBEA 2DSWA 1FKDA 1ZBWA 4QIBA 2DSZA 3KZ7A 2MNTA 1EDQA 1LG1A 1W9PA 2DT3A 2UZ5A 3ARQA 1FKKA 1ZBCA 4DT4A 1HKKA 3CHEA 4TW7A 1Q6IA 3WH0A 3FAPA 4DRJA 5D75A 1RD6A 3G6LA 4DRQA 1ROTA 4DRKA 2WK2A 1FJDA 4L3NA 3RMEA 1E44A 1J6YA 1KT0A 1OGBA 1F40A 2RUCA 4Z2KA 3UI4A 3KCEA 4TNSA 5DEZA 1XHGA 1JNEA 3WD1A 3O5LA 2LJ4A 2WLZA 4DZ3A 4TW6A 1Y0OA 4AY1A 2B5UB 1ZBKA 2ZQVA 3WD4A 5GPGA 2DT0A 4ML4A 3BXWA 1LL4A 2ZR4A 4G2PA 4WKFA 1FKTA 3I6CA 2PPPA 1LQ0A 2ESCA 3BMBA 1JNSA 2A3CA 4URIA 4Z2LA 4Z2HA 2FAPA 2FDMA 4IQ2A 4NZCA 2DG9A 2IUZA 3MDYB 3ARZA 2OFNA 3RFWA 1ZB5A 2MLZA 4IT4A 3LUOA 4QZVB 3AROA 5HTGA 1LL7A 2AOSA 3O5FA 4U86A 1PINA 3O5MA 1LJYA 3RM4A 3ARWA 4J4NA 4DRPA 4DIPA 1HKJA 3AQUA 4Z2GA 5HKGA 1GOIA 3ARYA 4W5UA 3O5RA 1ZBVA 2P4VA 3AS2A 1GPFA 2XP5A 4LGXA 1W9VA 4P8WA 3WIJA 1HKMA 2XP8A 3OA5A 3G6MA 2XP7A 1FFQA 3O5KA 4TW8A 5B8IC 1R9HA 2MLYA 1FD9A 4MPKA 1E15A 3NI6A 2PV3A 2QF8A 1IX5A 1FKFA 4DWSC 1Q1CA 3ALGA 3KADA 1FAPA 2M2AA 2LPVA 1CTNA 2Y78A 1ZCNA 1Q6UA 4HARA 1EYMA 2DSUA 4XAKA 4IT6A 2M1IA 3IKDA 1FKHA 1W26A 1WNOA 1X6LA 1YW5A 1VF8A 1FKIA 1NWRA 1KT1A 1HXVA 1FKRA 4JFMA 4IQCA 1D6OA 1UR9A 1ZK6A 3GU0A 3KABA 2RUDA 4NSBA 3FY1A 1E6ZA 1WB0A 4DWSD 3PA7A 3B7XA 5HWBA 1W1VA 4KR0B 3B9EA 2MLXA
chains in the Genus database with same CATH topology
3WQVA 1W1YA 3O5GA 3OOBA 4W9QA 2O92A 4WKHA 3ARTA 4TX0A 4MGVA 2IF4A 3PRAA 1LG2A 3QOKA 4ODQA 3ARVA 1D7HA 2JZVA 2XP4A 5J6EA 2DG4A 4WKAA 5DIUA 4W9OA 4DRIA 1NWUA 2RSEA 3GPKA 2LKNA 1JVWA 3IK8A 4JFLA 3NRKA 1D7JA 4ODOA 4U85A 1M5YA 4DRHA 1ZU8A 4R0XA 4GIVA 1J4HA 2A3EA 4IPXA 5HWCA 3CGNA 1FKBA 4ZPWR 2XPAA 2XP3A 4ODNA 4Q7NA 2AWGA 3UF8A 3WQWA 1NWSA 1E6RA 1TFVA 1W1PA 4MSPA 4ODPA 4U84A 4FAPA 1WAWA 2VCDA 1U79A 3O5EA 1E6PA 1X6NA 1NMWA 4MNJA 2DSVA 2YBUA 2LGOA 4GGQA 1D7IA 3O5QA 4S3KA 5GPRA 4ZPVR 2DG3A 4Q22A 3ARPA 2ZQSA 1GUVA 2O9OA 1A7XA 4ZS6A 1FFRA 4O2TA 3RM9A 3W4RA 1FKSA 2F21A 4W9PA 1SR0A 3CHCA 2F2DA 2ZR6A 1KFWA 4ZPTR 1HKIA 4DWSB 2F4EA 3KAFA 3WL0A 1QPLA 1FKGA 4LAVA 3O5JA 5HW6A 4DWSA 4PTMA 4P8XA 2DT2A 3RM8A 5HW7A 3FXYA 1EIBA 1EQ3A 1E9LA 3IHZA 1NSGA 4DH0A 4JFJA 2RURA 1L1PA 2Q5AA 4DRMA 4J4OA 2DT1A 3B9DA 3KAHA 3O5IA 5I98A 4DZ2A 1FKLA 1N1AA 2G41A 3KAIA 3RGCA 1K9TA 2KGJA 4P8VA 2RQSA 1T11A 3WD3A 2G8ZA 5HW8A 1W9UA 2ITKA 3ARXA 3EY6A 4LAYA 1XRVA 1BL4A 2WLYA 1H0GA 1PBKA 3PRDA 2WM0A 3UQIA 4N19A 1ZL1A 3AS3A 1D2KA 3PR9A 4LAXA 4WK9A 2PV2A 5DO2A 3AS1A 2PI6A 3B9AA 3UQAA 2KFWA 1BKFA 1QZ2A 3CHDA 1Q6HA 2KR7A 4ODMA 5DITA 5GQBA 2ZR5A 1QPFA 2XP9A 3ALFA 3ARRA 3TCZA 3KAGA 4C02B 3WD2A 2ZQTA 2ZQUA 2L2SA 5DIVA 3WL1A 3CGMA 4L72B 2PBCA 2PPOA 1UR8A 3ARUA 4BF8A 1ITXA 3O5DA 3KACA 4R5EA 4QT3A 1C9HA 4MNLA 4ODLA 2KE0A 4JYSA 4MAVA 1HJVA 1SYTA 3JYJA 1B6CA 1W1TA 1JNTA 2OLHA 5HUAA 2M08A 1EHNA 1HJWA 3NTPA 1FKJA 1JNDA 4P8UA 3WD0A 1F8AB 4ODKA 1HJXA 3H9RB 1O6IA 1OGGA 2K8IA 3O5OA 3UI5A 2D9FA 4TYOA 2A3AA 2FKEA 2PPNA 1J4IA 4MTVA 4JFKA 4DROA 2A3BA 2MF9A 2YBTA 2XP6A 3ODKA 1NWTA 2DPEA 2MPHA 4HBOA 1ROUA 4FN2A 4DRNA 4LAWA 3IKGA 2XPBA 1H0IA 2RUQA 1NMVA 4NNRA 2PV1A 1P5QA 1YATA 4WIWA 5DF0A 2KI3A 4MNKA 3VAWA 2B31A 1LL6A 1NH6A 1J4RA 4Z2IA 3B8SA 3CHFA 5HBFA 3CH9A 2KO7A 3WKZA 3UI6A 3ARSA 4MNMA 3JYMA 1E6NA 4QT2A 3JXVA 3CZ8A 4S3JA 4ODRA 5HT1A 3UQBA 3PRBA 1TCOC 3AS0A 3O5PA 4G50A 2VN1A 2N87A 4KQZA 3TC5A 5BXJA 4JFIA 4WJXA 1OWQA 4Z2JA 5JH8A 3TDBA 4ITZA 4HBEA 2DSWA 1FKDA 1ZBWA 4QIBA 2DSZA 3KZ7A 2MNTA 1EDQA 1LG1A 1W9PA 2DT3A 2UZ5A 3ARQA 1FKKA 1ZBCA 4DT4A 1HKKA 3CHEA 4TW7A 1Q6IA 3WH0A 3FAPA 4DRJA 5D75A 1RD6A 3G6LA 4DRQA 1ROTA 4DRKA 2WK2A 1FJDA 4L3NA 3RMEA 1J6YA 1KT0A 1OGBA 1F40A 2RUCA 4Z2KA 3UI4A 3KCEA 4TNSA 5DEZA 1XHGA 1JNEA 3WD1A 3O5LA 2LJ4A 2WLZA 4DZ3A 4TW6A 1Y0OA 4AY1A 1ZBKA 2ZQVA 3WD4A 5GPGA 2DT0A 4ML4A 3BXWA 1LL4A 2ZR4A 4G2PA 4WKFA 1FKTA 3I6CA 2PPPA 1LQ0A 2ESCA 1JNSA 2A3CA 4URIA 4Z2LA 4Z2HA 2FAPA 2FDMA 4IQ2A 4NZCA 2DG9A 2IUZA 3MDYB 3ARZA 2OFNA 3RFWA 1ZB5A 2MLZA 4IT4A 3LUOA 4QZVB 3AROA 5HTGA 1LL7A 2AOSA 3O5FA 4U86A 1PINA 3O5MA 1LJYA 3RM4A 3ARWA 4J4NA 4DRPA 4DIPA 1HKJA 3AQUA 4Z2GA 5HKGA 1GOIA 3ARYA 4W5UA 3O5RA 1ZBVA 3AS2A 1GPFA 2XP5A 4LGXA 1W9VA 4P8WA 3WIJA 1HKMA 2XP8A 3OA5A 3G6MA 2XP7A 1FFQA 3O5KA 4TW8A 5B8IC 1R9HA 2MLYA 1FD9A 4MPKA 1E15A 3NI6A 2PV3A 2QF8A 1IX5A 1FKFA 4DWSC 1Q1CA 3ALGA 3KADA 1FAPA 2M2AA 2LPVA 1CTNA 2Y78A 1ZCNA 1Q6UA 4HARA 1EYMA 2DSUA 4XAKA 4IT6A 2M1IA 3IKDA 1FKHA 1W26A 1WNOA 1X6LA 1YW5A 1VF8A 1FKIA 1NWRA 1KT1A 1HXVA 1FKRA 4JFMA 4IQCA 1D6OA 1UR9A 1ZK6A 4NSBA 3KABA 2RUDA 3FY1A 1E6ZA 1WB0A 4DWSD 3PA7A 3B7XA 5HWBA 1W1VA 4KR0B 3B9EA 2MLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5G A;  1EQ3 A;  3OOB A;  4DRO A;  2MF9 A;  2XP6 A;  4W9Q A;  3ODK A;  2ZR4 A;  3IHZ A;  4G2P A;  4TX0 A;  1FKT A;  1NSG A;  2MPH A;  3I6C A;  5BXJ A;  4MGV A;  2PPP A;  1ROU A;  4JFJ A;  2RUR A;  4FN2 A;  4DH0 A;  1L1P A;  2IF4 A;  1JNS A;  4ODQ A;  1D7H A;  2Q5A A;  4DRN A;  4LAW A;  3IKG A;  4DRM A;  4J4O A;  2JZV A;  2XP4 A;  2FAP A;  2DG4 A;  2XPB A;  3KAH A;  3O5I A;  4IQ2 A;  5I98 A;  2RUQ A;  5J6E A;  4DZ2 A;  1FKL A;  1NMV A;  1N1A A;  4W9O A;  2DG9 A;  3KAI A;  5DIU A;  4DRI A;  3RGC A;  3MDY B;  4NNR A;  2OFN A;  2PV1 A;  3RFW A;  1P5Q A;  1YAT A;  2KGJ A;  2RQS A;  1T11 A;  2RSE A;  2MLZ A;  3GPK A;  2KI3 A;  2LKN A;  1JVW A;  3IK8 A;  3LUO A;  4JFL A;  3NRK A;  3VAW A;  5HW8 A;  1D7J A;  5HTG A;  3O5F A;  1J4R A;  4U86 A;  1PIN A;  2ITK A;  3O5M A;  4ODO A;  4U85 A;  3EY6 A;  1M5Y A;  4J4N A;  4DRP A;  2KO7 A;  4LAY A;  4DIP A;  1BL4 A;  4DRH A;  3UI6 A;  4R0X A;  1PBK A;  4GIV A;  5HKG A;  3PRD A;  3UQI A;  4N19 A;  3JYM A;  3O5R A;  1J4H A;  4IPX A;  4LAX A;  5HWC A;  3CGN A;  1FKB A;  2PV2 A;  3JXV A;  4QT2 A;  4ODR A;  2XPA A;  2XP3 A;  2XP5 A;  4ODN A;  2AWG A;  3UF8 A;  5HT1 A;  3UQB A;  3PRB A;  3UQA A;  1TCO C;  2KFW A;  2XP8 A;  1BKF A;  1QZ2 A;  3O5P A;  4G50 A;  2VN1 A;  2XP7 A;  4MSP A;  2KR7 A;  1Q6H A;  3O5K A;  4ODP A;  4ODM A;  1R9H A;  2MLY A;  2N87 A;  1FD9 A;  2ZR5 A;  4TW8 A;  5DIT A;  5B8I C;  1QPF A;  3TC5 A;  2XP9 A;  3NI6 A;  4JFI A;  4U84 A;  2PV3 A;  3KAG A;  3TCZ A;  4C02 B;  4FAP A;  2ZQT A;  1FKF A;  2VCD A;  2ZQU A;  3TDB A;  4ITZ A;  1U79 A;  3O5E A;  2L2S A;  1Q1C A;  3KAD A;  5DIV A;  1FAP A;  3CGM A;  1NMW A;  2M2A A;  2PBC A;  2PPO A;  2LPV A;  1FKD A;  4BF8 A;  4QIB A;  3KZ7 A;  2MNT A;  3O5D A;  2Y78 A;  3KAC A;  2LGO A;  4GGQ A;  1D7I A;  4QT3 A;  3O5Q A;  1ZCN A;  1Q6U A;  2DG3 A;  1C9H A;  1EYM A;  2UZ5 A;  1FKK A;  4ODL A;  2KE0 A;  2ZQS A;  2M1I A;  3IKD A;  4JYS A;  4DT4 A;  4TW7 A;  1A7X A;  1W26 A;  1FKH A;  1Q6I A;  1YW5 A;  3JYJ A;  3WH0 A;  1B6C A;  3FAP A;  4DRJ A;  5D75 A;  1JNT A;  4O2T A;  4DRQ A;  1FKI A;  1ROT A;  2M08 A;  4DRK A;  5HUA A;  1KT1 A;  1FJD A;  1HXV A;  3NTP A;  1FKS A;  2F21 A;  1FKJ A;  4W9P A;  1FKR A;  1J6Y A;  1KT0 A;  4JFM A;  4IQC A;  1D6O A;  2F2D A;  1F8A B;  1F40 A;  4ODK A;  2ZR6 A;  3H9R B;  2RUC A;  3UI4 A;  2K8I A;  3O5O A;  1ZK6 A;  3KAB A;  2RUD A;  3KCE A;  4TNS A;  3UI5 A;  2D9F A;  2F4E A;  4TYO A;  3KAF A;  1QPL A;  1FKG A;  2FKE A;  3O5L A;  4LAV A;  2LJ4 A;  2PPN A;  3O5J A;  4DZ3 A;  5HW6 A;  1J4I A;  3PA7 A;  4TW6 A;  1Y0O A;  3B7X A;  5HWB A;  2MLX A;  2ZQV A;  5HW7 A;  4JFK A;  5GPG A; 
#chains in the Genus database with same CATH topology
 3WQV A;  1W1Y A;  3O5G A;  3OOB A;  4W9Q A;  2O92 A;  4WKH A;  3ART A;  4TX0 A;  4MGV A;  2IF4 A;  3PRA A;  1LG2 A;  2F23 A;  3QOK A;  4ODQ A;  3ARV A;  1D7H A;  2JZV A;  2XP4 A;  5J6E A;  2DG4 A;  4WKA A;  5DIU A;  4W9O A;  4DRI A;  1NWU A;  2RSE A;  3GPK A;  2LKN A;  1JVW A;  3IK8 A;  4JFL A;  3NRK A;  1D7J A;  4ODO A;  4U85 A;  1M5Y A;  4DRH A;  1ZU8 A;  4R0X A;  4GIV A;  1J4H A;  2A3E A;  4IPX A;  5HWC A;  3CGN A;  1FKB A;  4ZPW R;  2XPA A;  2XP3 A;  4ODN A;  4Q7N A;  2AWG A;  3UF8 A;  3WQW A;  1NWS A;  1E6R A;  1TFV A;  1W1P A;  4MSP A;  4ODP A;  4U84 A;  4FAP A;  1WAW A;  2VCD A;  1U79 A;  3O5E A;  1E6P A;  1X6N A;  1NMW A;  4MNJ A;  2DSV A;  2YBU A;  2LGO A;  4GGQ A;  1D7I A;  3O5Q A;  4S3K A;  5GPR A;  4ZPV R;  2DG3 A;  4Q22 A;  3ARP A;  2ZQS A;  1GUV A;  2O9O A;  1A7X A;  4ZS6 A;  1FFR A;  4O2T A;  3RM9 A;  3W4R A;  1FKS A;  2F21 A;  4W9P A;  1SR0 A;  3CHC A;  2F2D A;  2ZR6 A;  1KFW A;  4ZPT R;  1HKI A;  4DWS B;  2F4E A;  3KAF A;  3WL0 A;  1QPL A;  1FKG A;  4LAV A;  3O5J A;  5HW6 A;  4DWS A;  4PTM A;  4P8X A;  2DT2 A;  3RM8 A;  5HW7 A;  1JCH B;  3FXY A;  1EIB A;  1EQ3 A;  1E9L A;  3IHZ A;  1NSG A;  4DH0 A;  4JFJ A;  2RUR A;  1L1P A;  2Q5A A;  4DRM A;  3EIP A;  4J4O A;  2DT1 A;  3B9D A;  3KAH A;  3O5I A;  5I98 A;  4DZ2 A;  1FKL A;  1N1A A;  2G41 A;  3KAI A;  2EUL A;  3RGC A;  1K9T A;  2KGJ A;  4P8V A;  2RQS A;  1T11 A;  3WD3 A;  2G8Z A;  5HW8 A;  1W9U A;  2ITK A;  3ARX A;  3EY6 A;  4LAY A;  1XRV A;  1BL4 A;  2WLY A;  1H0G A;  1PBK A;  3PRD A;  2WM0 A;  3UQI A;  4N19 A;  1ZL1 A;  3AS3 A;  1D2K A;  3PR9 A;  4LAX A;  4WK9 A;  2PV2 A;  5DO2 A;  2ETN A;  3AS1 A;  2PI6 A;  3B9A A;  3UQA A;  2KFW A;  1BKF A;  1QZ2 A;  3CHD A;  1Q6H A;  2KR7 A;  4ODM A;  5DIT A;  5GQB A;  2ZR5 A;  1QPF A;  2XP9 A;  3ALF A;  3ARR A;  3TCZ A;  3KAG A;  4C02 B;  3WD2 A;  2ZQT A;  2ZQU A;  2L2S A;  5DIV A;  3WL1 A;  3CGM A;  4L72 B;  2PBC A;  2PPO A;  1UR8 A;  3ARU A;  4BF8 A;  1ITX A;  3O5D A;  3KAC A;  4R5E A;  4QT3 A;  1C9H A;  4MNL A;  4ODL A;  2KE0 A;  4JYS A;  4MAV A;  1HJV A;  1SYT A;  3JYJ A;  1B6C A;  1W1T A;  1JNT A;  2OLH A;  5HUA A;  2M08 A;  1EHN A;  1HJW A;  3NTP A;  1FKJ A;  1JND A;  4P8U A;  3WD0 A;  1F8A B;  4ODK A;  1HJX A;  3H9R B;  1O6I A;  1OGG A;  2K8I A;  3O5O A;  3UI5 A;  2D9F A;  4TYO A;  2A3A A;  2FKE A;  2PN0 A;  2PPN A;  3GTY X;  1J4I A;  4MTV A;  4JFK A;  4DRO A;  2A3B A;  2MF9 A;  2YBT A;  2XP6 A;  3ODK A;  1NWT A;  2DPE A;  2MPH A;  4HBO A;  1ROU A;  4FN2 A;  4DRN A;  4LAW A;  3IKG A;  2XPB A;  1H0I A;  2RUQ A;  1NMV A;  4NNR A;  2PV1 A;  1P5Q A;  1YAT A;  4WIW A;  5DF0 A;  2KI3 A;  4MNK A;  3VAW A;  2B31 A;  1LL6 A;  1NH6 A;  1J4R A;  4Z2I A;  3B8S A;  3CHF A;  5HBF A;  3CH9 A;  2KO7 A;  3WKZ A;  3UI6 A;  3ARS A;  4MNM A;  3JYM A;  1E6N A;  4QT2 A;  3JXV A;  3CZ8 A;  4S3J A;  4ODR A;  5HT1 A;  3UQB A;  3PRB A;  1TCO C;  3AS0 A;  3O5P A;  4G50 A;  2VN1 A;  4UDM A;  2N87 A;  4KQZ A;  3TC5 A;  5BXJ A;  4JFI A;  4WJX A;  1OWQ A;  4Z2J A;  5JH8 A;  3TDB A;  4ITZ A;  1GRJ A;  4HBE A;  2DSW A;  1FKD A;  1ZBW A;  4QIB A;  2DSZ A;  3KZ7 A;  2MNT A;  1EDQ A;  1LG1 A;  1W9P A;  2DT3 A;  2UZ5 A;  3ARQ A;  1FKK A;  1ZBC A;  4DT4 A;  1HKK A;  3CHE A;  4TW7 A;  1Q6I A;  3WH0 A;  3FAP A;  4DRJ A;  5D75 A;  1RD6 A;  3G6L A;  4DRQ A;  1ROT A;  4DRK A;  2WK2 A;  1FJD A;  4L3N A;  3RME A;  1E44 A;  1J6Y A;  1KT0 A;  1OGB A;  1F40 A;  2RUC A;  4Z2K A;  3UI4 A;  3KCE A;  4TNS A;  5DEZ A;  1XHG A;  1JNE A;  3WD1 A;  3O5L A;  2LJ4 A;  2WLZ A;  4DZ3 A;  4TW6 A;  1Y0O A;  4AY1 A;  2B5U B;  1ZBK A;  2ZQV A;  3WD4 A;  5GPG A;  2DT0 A;  4ML4 A;  3BXW A;  1LL4 A;  2ZR4 A;  4G2P A;  4WKF A;  1FKT A;  3I6C A;  2PPP A;  1LQ0 A;  2ESC A;  3BMB A;  1JNS A;  2A3C A;  4URI A;  4Z2L A;  4Z2H A;  2FAP A;  2FDM A;  4IQ2 A;  4NZC A;  2DG9 A;  2IUZ A;  3MDY B;  3ARZ A;  2OFN A;  3RFW A;  1ZB5 A;  2MLZ A;  4IT4 A;  3LUO A;  4QZV B;  3ARO A;  5HTG A;  1LL7 A;  2AOS A;  3O5F A;  4U86 A;  1PIN A;  3O5M A;  1LJY A;  3RM4 A;  3ARW A;  4J4N A;  4DRP A;  4DIP A;  1HKJ A;  3AQU A;  4Z2G A;  5HKG A;  1GOI A;  3ARY A;  4W5U A;  3O5R A;  1ZBV A;  2P4V A;  3AS2 A;  1GPF A;  2XP5 A;  4LGX A;  1W9V A;  4P8W A;  3WIJ A;  1HKM A;  2XP8 A;  3OA5 A;  3G6M A;  2XP7 A;  1FFQ A;  3O5K A;  4TW8 A;  5B8I C;  1R9H A;  2MLY A;  1FD9 A;  4MPK A;  1E15 A;  3NI6 A;  2PV3 A;  2QF8 A;  1IX5 A;  1FKF A;  4DWS C;  1Q1C A;  3ALG A;  3KAD A;  1FAP A;  2M2A A;  2LPV A;  1CTN A;  2Y78 A;  1ZCN A;  1Q6U A;  4HAR A;  1EYM A;  2DSU A;  4XAK A;  4IT6 A;  2M1I A;  3IKD A;  1FKH A;  1W26 A;  1WNO A;  1X6L A;  1YW5 A;  1VF8 A;  1FKI A;  1NWR A;  1KT1 A;  1HXV A;  1FKR A;  4JFM A;  4IQC A;  1D6O A;  1UR9 A;  1ZK6 A;  3GU0 A;  3KAB A;  2RUD A;  4NSB A;  3FY1 A;  1E6Z A;  1WB0 A;  4DWS D;  3PA7 A;  3B7X A;  5HWB A;  1W1V A;  4KR0 B;  3B9E A;  2MLX A; 
#chains in the Genus database with same CATH homology
 3WQV A;  1W1Y A;  3O5G A;  3OOB A;  4W9Q A;  2O92 A;  4WKH A;  3ART A;  4TX0 A;  4MGV A;  2IF4 A;  3PRA A;  1LG2 A;  3QOK A;  4ODQ A;  3ARV A;  1D7H A;  2JZV A;  2XP4 A;  5J6E A;  2DG4 A;  4WKA A;  5DIU A;  4W9O A;  4DRI A;  1NWU A;  2RSE A;  3GPK A;  2LKN A;  1JVW A;  3IK8 A;  4JFL A;  3NRK A;  1D7J A;  4ODO A;  4U85 A;  1M5Y A;  4DRH A;  1ZU8 A;  4R0X A;  4GIV A;  1J4H A;  2A3E A;  4IPX A;  5HWC A;  3CGN A;  1FKB A;  4ZPW R;  2XPA A;  2XP3 A;  4ODN A;  4Q7N A;  2AWG A;  3UF8 A;  3WQW A;  1NWS A;  1E6R A;  1TFV A;  1W1P A;  4MSP A;  4ODP A;  4U84 A;  4FAP A;  1WAW A;  2VCD A;  1U79 A;  3O5E A;  1E6P A;  1X6N A;  1NMW A;  4MNJ A;  2DSV A;  2YBU A;  2LGO A;  4GGQ A;  1D7I A;  3O5Q A;  4S3K A;  5GPR A;  4ZPV R;  2DG3 A;  4Q22 A;  3ARP A;  2ZQS A;  1GUV A;  2O9O A;  1A7X A;  4ZS6 A;  1FFR A;  4O2T A;  3RM9 A;  3W4R A;  1FKS A;  2F21 A;  4W9P A;  1SR0 A;  3CHC A;  2F2D A;  2ZR6 A;  1KFW A;  4ZPT R;  1HKI A;  4DWS B;  2F4E A;  3KAF A;  3WL0 A;  1QPL A;  1FKG A;  4LAV A;  3O5J A;  5HW6 A;  4DWS A;  4PTM A;  4P8X A;  2DT2 A;  3RM8 A;  5HW7 A;  3FXY A;  1EIB A;  1EQ3 A;  1E9L A;  3IHZ A;  1NSG A;  4DH0 A;  4JFJ A;  2RUR A;  1L1P A;  2Q5A A;  4DRM A;  4J4O A;  2DT1 A;  3B9D A;  3KAH A;  3O5I A;  5I98 A;  4DZ2 A;  1FKL A;  1N1A A;  2G41 A;  3KAI A;  3RGC A;  1K9T A;  2KGJ A;  4P8V A;  2RQS A;  1T11 A;  3WD3 A;  2G8Z A;  5HW8 A;  1W9U A;  2ITK A;  3ARX A;  3EY6 A;  4LAY A;  1XRV A;  1BL4 A;  2WLY A;  1H0G A;  1PBK A;  3PRD A;  2WM0 A;  3UQI A;  4N19 A;  1ZL1 A;  3AS3 A;  1D2K A;  3PR9 A;  4LAX A;  4WK9 A;  2PV2 A;  5DO2 A;  3AS1 A;  2PI6 A;  3B9A A;  3UQA A;  2KFW A;  1BKF A;  1QZ2 A;  3CHD A;  1Q6H A;  2KR7 A;  4ODM A;  5DIT A;  5GQB A;  2ZR5 A;  1QPF A;  2XP9 A;  3ALF A;  3ARR A;  3TCZ A;  3KAG A;  4C02 B;  3WD2 A;  2ZQT A;  2ZQU A;  2L2S A;  5DIV A;  3WL1 A;  3CGM A;  4L72 B;  2PBC A;  2PPO A;  1UR8 A;  3ARU A;  4BF8 A;  1ITX A;  3O5D A;  3KAC A;  4R5E A;  4QT3 A;  1C9H A;  4MNL A;  4ODL A;  2KE0 A;  4JYS A;  4MAV A;  1HJV A;  1SYT A;  3JYJ A;  1B6C A;  1W1T A;  1JNT A;  2OLH A;  5HUA A;  2M08 A;  1EHN A;  1HJW A;  3NTP A;  1FKJ A;  1JND A;  4P8U A;  3WD0 A;  1F8A B;  4ODK A;  1HJX A;  3H9R B;  1O6I A;  1OGG A;  2K8I A;  3O5O A;  3UI5 A;  2D9F A;  4TYO A;  2A3A A;  2FKE A;  2PPN A;  1J4I A;  4MTV A;  4JFK A;  4DRO A;  2A3B A;  2MF9 A;  2YBT A;  2XP6 A;  3ODK A;  1NWT A;  2DPE A;  2MPH A;  4HBO A;  1ROU A;  4FN2 A;  4DRN A;  4LAW A;  3IKG A;  2XPB A;  1H0I A;  2RUQ A;  1NMV A;  4NNR A;  2PV1 A;  1P5Q A;  1YAT A;  4WIW A;  5DF0 A;  2KI3 A;  4MNK A;  3VAW A;  2B31 A;  1LL6 A;  1NH6 A;  1J4R A;  4Z2I A;  3B8S A;  3CHF A;  5HBF A;  3CH9 A;  2KO7 A;  3WKZ A;  3UI6 A;  3ARS A;  4MNM A;  3JYM A;  1E6N A;  4QT2 A;  3JXV A;  3CZ8 A;  4S3J A;  4ODR A;  5HT1 A;  3UQB A;  3PRB A;  1TCO C;  3AS0 A;  3O5P A;  4G50 A;  2VN1 A;  2N87 A;  4KQZ A;  3TC5 A;  5BXJ A;  4JFI A;  4WJX A;  1OWQ A;  4Z2J A;  5JH8 A;  3TDB A;  4ITZ A;  4HBE A;  2DSW A;  1FKD A;  1ZBW A;  4QIB A;  2DSZ A;  3KZ7 A;  2MNT A;  1EDQ A;  1LG1 A;  1W9P A;  2DT3 A;  2UZ5 A;  3ARQ A;  1FKK A;  1ZBC A;  4DT4 A;  1HKK A;  3CHE A;  4TW7 A;  1Q6I A;  3WH0 A;  3FAP A;  4DRJ A;  5D75 A;  1RD6 A;  3G6L A;  4DRQ A;  1ROT A;  4DRK A;  2WK2 A;  1FJD A;  4L3N A;  3RME A;  1J6Y A;  1KT0 A;  1OGB A;  1F40 A;  2RUC A;  4Z2K A;  3UI4 A;  3KCE A;  4TNS A;  5DEZ A;  1XHG A;  1JNE A;  3WD1 A;  3O5L A;  2LJ4 A;  2WLZ A;  4DZ3 A;  4TW6 A;  1Y0O A;  4AY1 A;  1ZBK A;  2ZQV A;  3WD4 A;  5GPG A;  2DT0 A;  4ML4 A;  3BXW A;  1LL4 A;  2ZR4 A;  4G2P A;  4WKF A;  1FKT A;  3I6C A;  2PPP A;  1LQ0 A;  2ESC A;  1JNS A;  2A3C A;  4URI A;  4Z2L A;  4Z2H A;  2FAP A;  2FDM A;  4IQ2 A;  4NZC A;  2DG9 A;  2IUZ A;  3MDY B;  3ARZ A;  2OFN A;  3RFW A;  1ZB5 A;  2MLZ A;  4IT4 A;  3LUO A;  4QZV B;  3ARO A;  5HTG A;  1LL7 A;  2AOS A;  3O5F A;  4U86 A;  1PIN A;  3O5M A;  1LJY A;  3RM4 A;  3ARW A;  4J4N A;  4DRP A;  4DIP A;  1HKJ A;  3AQU A;  4Z2G A;  5HKG A;  1GOI A;  3ARY A;  4W5U A;  3O5R A;  1ZBV A;  3AS2 A;  1GPF A;  2XP5 A;  4LGX A;  1W9V A;  4P8W A;  3WIJ A;  1HKM A;  2XP8 A;  3OA5 A;  3G6M A;  2XP7 A;  1FFQ A;  3O5K A;  4TW8 A;  5B8I C;  1R9H A;  2MLY A;  1FD9 A;  4MPK A;  1E15 A;  3NI6 A;  2PV3 A;  2QF8 A;  1IX5 A;  1FKF A;  4DWS C;  1Q1C A;  3ALG A;  3KAD A;  1FAP A;  2M2A A;  2LPV A;  1CTN A;  2Y78 A;  1ZCN A;  1Q6U A;  4HAR A;  1EYM A;  2DSU A;  4XAK A;  4IT6 A;  2M1I A;  3IKD A;  1FKH A;  1W26 A;  1WNO A;  1X6L A;  1YW5 A;  1VF8 A;  1FKI A;  1NWR A;  1KT1 A;  1HXV A;  1FKR A;  4JFM A;  4IQC A;  1D6O A;  1UR9 A;  1ZK6 A;  4NSB A;  3KAB A;  2RUD A;  3FY1 A;  1E6Z A;  1WB0 A;  4DWS D;  3PA7 A;  3B7X A;  5HWB A;  1W1V A;  4KR0 B;  3B9E A;  2MLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...