5HTGA

Structure of apo p1 form of candida albicans fkbp12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
122
structure length
122
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVNGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
total genus 27
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5htgA00
2ZQUA 4TNSA 2L2SA 3I6CA 1T11A 3PA7A 4DRJA 2LJ4A 3KAGA 1Y0OA 4IPXA 4ODKA 4DRIA 1U79A 5HW6A 1FKIA 2K8IA 5HW7A 1JNSA 1HXVA 2FAPA 2M1IA 2OFNA 4J4OA 4G50A 4W9PA 1D7JA 4TW8A 2XPAA 4U85A 4DZ2A 2PV2A 2XP8A 4BF8A 3ODKA 1QZ2A 2MLXA 2DG4A 4DRKA 5GPGA 1NMWA 2PBCA 2RUDA 2KR7A 2JZVA 3O5GA 1J4RA 3KCEA 4JFIA 1QPLA 2MLYA 1D7HA 1KT0A 2F21A 4IQ2A 2Y78A 4R0XA 4LAYA 2D9FA 1W26A 2LKNA 2KGJA 3MDYB 3IKDA 1P5QA 2KI3A 4ODOA 2ZQSA 4QT2A 4DRQA 1QPFA 2VN1A 4JFLA 4MGVA 4DH0A 4LAVA 1F40A 4LAWA 5DIVA 5BXJA 1D6OA 3UF8A 2F4EA 3FAPA 1FKGA 2Q5AA 1FKBA 2ZR6A 4JFMA 4JYSA 1PINA 3JXVA 3NTPA 1R9HA 3O5JA 3O5PA 4N19A 1ROUA 4LAXA 5D75A 2KO7A 2MLZA 4DROA 4GGQA 1TCOC 2RUCA 2XP5A 3LUOA 1FJDA 4QT3A 3EY6A 2MF9A 2DG3A 2VCDA 3UI4A 1FKKA 1Q6HA 3KABA 1NSGA 2LPVA 4IQCA 2PV3A 3IKGA 5B8IC 1ROTA 2KFWA 3O5RA 3VAWA 4DIPA 3O5KA 2F2DA 4DZ3A 2MPHA 2XP9A 3UQBA 1A7XA 3KZ7A 3TDBA 1BKFA 1Q1CA 3KADA 1NMVA 2RURA 1FKSA 3UI5A 3JYMA 5HW8A 1FD9A 2XPBA 4DRHA 1J4HA 3H9RB 1FKRA 3KACA 4ODMA 3IHZA 4O2TA 3O5OA 5DIUA 4TW6A 3UQIA 1ZK6A 4JFJA 1JVWA 2XP6A 2DG9A 4GIVA 3OOBA 3NRKA 5HUAA 2PV1A 3O5MA 4TYOA 5J6EA 3KAIA 4QIBA 4U86A 4ODLA 3NI6A 4DRMA 4DRPA 1Q6UA 3O5DA 1YW5A 4ODNA 3RFWA 1EQ3A 1C9HA 2PPOA 5HKGA 4ODRA 2ZQVA 4MSPA 1KT1A 4W9OA 1BL4A 3UQAA 1J6YA 5HT1A 4TX0A 3RGCA 4C02B 2RUQA 4FAPA 4J4NA 5HWCA 1FKLA 3KAHA 4W9QA 1B6CA 1FKJA 1D7IA 3PRBA 2AWGA 4JFKA 2M2AA 1JNTA 2XP7A 1M5YA 2N87A 1F8AB 3O5LA 2XP3A 2ITKA 3O5IA 3WH0A 1L1PA 1FKDA 1Q6IA 2ZR5A 3O5EA 1N1AA 2LGOA 5I98A 3KAFA 2FKEA 2M08A 4FN2A 4DT4A 5HWBA 3O5FA 3GPKA 1FKTA 3PRDA 4NNRA 2KE0A 2XP4A 4G2PA 1ZCNA 2MNTA 5DITA 2UZ5A 4DRNA 2ZQTA 1J4IA 3CGNA 3UI6A 3O5QA 4ITZA 2RSEA 3B7XA 1FKFA 4ODQA 1YATA 1EYMA 2RQSA 1FKHA 2ZR4A 1PBKA 3CGMA 4ODPA 3TC5A 4U84A 5HTGA 2PPPA 2IF4A 3TCZA 3JYJA 4TW7A 2PPNA 3IK8A 1FAPA
chains in the Genus database with same CATH superfamily
2L2SA 2QF8A 1RD6A 2LJ4A 3AS0A 1Y0OA 1KFWA 1FFRA 3KAGA 4DRIA 1JNSA 2PN0A 2OFNA 2XPAA 3WD4A 4BF8A 4DRKA 4DWSA 3ARZA 2DG4A 3TCZA 2JZVA 2A3AA 1J4RA 4R0XA 4IQ2A 2Y78A 3OA5A 2LKNA 2FDMA 3MDYB 3WL1A 4ZS6A 4DRQA 4QT2A 2VN1A 4DH0A 2A3CA 5DIVA 2F4EA 2Q5AA 1FKBA 2ZR6A 4JYSA 1PINA 3JXVA 3NTPA 1NWUA 1O6IA 1R9HA 3ARSA 1W1VA 4N19A 4URIA 4DROA 3WQWA 1E9LA 1TCOC 2XP5A 1WNOA 4S3JA 3UI4A 1FKKA 5JH8A 3KABA 3BXWA 1NSGA 2DSUA 3WIJA 2KFWA 3B9AA 1E6PA 3O5KA 4KR0B 4DZ3A 2XP9A 1A7XA 3TDBA 2WK2A 1BKFA 4MNKA 3KADA 4AY1A 4HBOA 1FD9A 4WK9A 4DRHA 1FKRA 4HARA 4O2TA 3AROA 1E6ZA 3ARVA 4ZPTR 3O5MA 5J6EA 4ODLA 1YW5A 1IX5A 4ODRA 1E44A 1E6NA 3RGCA 1UR8A 1B6CA 1JNTA 2B5UB 1M5YA 3WH0A 2O9OA 1Q6IA 1FFQA 2DT0A 3RM8A 1W9VA 4DT4A 5HWBA 3PRDA 2G41A 1ZCNA 1GUVA 3CGNA 1YATA 1ZB5A 3CGMA 1GPFA 2IF4A 4G2PA 2XP3A 2ZQUA 1T11A 2WLYA 1HXVA 4Q7NA 3QOKA 1ZL1A 2XP8A 3ODKA 2RUDA 3O5GA 2KR7A 3ARQA 1QPLA 2MLYA 2F21A 1KT0A 4LAYA 1SYTA 1CTNA 2IUZA 2KGJA 2KI3A 3WD0A 2O92A 5HBFA 1D6OA 1NWRA 3FAPA 1VF8A 1FKGA 3GTYX 3O5PA 4LAXA 2KO7A 1HKMA 3LUOA 3WQVA 4QT3A 2DG3A 1Q6HA 1NWSA 1LL4A 4IQCA 2PV3A 3IKGA 3O5RA 2MPHA 1Q1CA 2DSWA 4L3NA 3EIPA 3ALFA 1FKSA 1XHGA 3JYMA 1X6NA 3O5OA 4JFJA 4GIVA 2DG9A 3OOBA 2DT2A 4P8WA 2PV1A 4TYOA 1E6RA 4U86A 3B9EA 1HKIA 1Q6UA 4ODNA 3RFWA 1C9HA 2PPOA 5HKGA 4WKFA 1LJYA 1KT1A 4W9OA 1J6YA 4IT6A 4MPKA 3RM9A 4C02B 2RUQA 4KQZA 1FKLA 3KAHA 4W9QA 4NZCA 2G8ZA 4JFKA 2M2AA 4QZVB 2ITKA 3O5IA 3CHDA 4Z2LA 2ZR5A 3O5EA 1W9PA 3KAFA 1E15A 2WM0A 4NNRA 3GPKA 2XP4A 4Z2IA 5DITA 2UZ5A 1WAWA 2ZQTA 2A3BA 4ITZA 3ARTA 3CHFA 3WD2A 4Z2GA 1FKHA 2ZR4A 3BMBA 4U84A 1JCHB 5HTGA 3JYJA 4TW7A 3IK8A 1LQ0A 4Q22A 4PTMA 3I6CA 4DRJA 5HW6A 4ODKA 4IPXA 5HW7A 4J4OA 4TW8A 4U85A 1NMWA 2PBCA 3KCEA 3UF8A 2OLHA 2D9FA 1W26A 1HKKA 4ZPVR 3CHEA 4ODOA 2ZQSA 4Z2JA 4MGVA 4DWSB 1F40A 4LAWA 5BXJA 1OGBA 4JFMA 3AS3A 1ROUA 5D75A 3ARRA 4GGQA 2DT1A 3ARPA 1FJDA 2DT3A 3ALGA 3EY6A 4Z2HA 2VCDA 1W9UA 3FY1A 1HKJA 2LPVA 5B8IC 1ROTA 4MAVA 4DIPA 2ETNA 2F2DA 3ARYA 3UQBA 1ZBCA 2PI6A 1NMVA 2RURA 2WLZA 3UI5A 5HW8A 2XPBA 1H0GA 3IHZA 4TW6A 2A3EA 3NRKA 4P8XA 1NWTA 2EULA 3KAIA 4QIBA 2YBTA 3NI6A 4MNLA 3WL0A 3G6LA 3O5DA 4DWSD 1JNDA 4MSPA 1BL4A 3UQAA 3GU0A 1W1TA 4ML4A 4FAPA 1XRVA 2AWGA 2XP7A 1F8AB 3WKZA 4W5UA 4L72B 1W1YA 1L1PA 5I98A 2FKEA 2M08A 3O5FA 3G6MA 4MTVA 4DWSC 2MNTA 4R5EA 1J4IA 3O5QA 4P8VA 1HJWA 3B7XA 4ODQA 1UR9A 2RQSA 3WD1A 1PBKA 1EHNA 4ODPA 3ARUA 2PPPA 3CHCA 4ZPWR 4TNSA 4WKHA 1D2KA 3PA7A 5DO2A 1HJXA 1U79A 1FKIA 2K8IA 3AS2A 1ZBVA 2FAPA 3CZ8A 2M1IA 4W9PA 4WKAA 4G50A 1D7JA 4DZ2A 2PV2A 4IT4A 1QZ2A 2MLXA 5GPGA 3RM4A 4JFIA 4DRNA 1D7HA 4TX0A 1SR0A 4LGXA 3W4RA 3IKDA 1P5QA 2ESCA 5GPRA 1QPFA 1H0IA 4JFLA 4MNJA 4LAVA 3ARWA 3PRAA 3O5JA 1EDQA 4WIWA 3ARXA 4NSBA 2MLZA 2RUCA 2AOSA 2DSZA 1WB0A 1EIBA 2MF9A 3AS1A 2DSVA 1HJVA 2B31A 2F23A 3VAWA 5DF0A 3KZ7A 4S3KA 4HBEA 5GQBA 1J4HA 1K9TA 3H9RB 3KACA 4ODMA 5DIUA 3B9DA 3UQIA 1LL7A 1ZK6A 4MNMA 1JNEA 4WJXA 1JVWA 2XP6A 5HUAA 3B8SA 1OWQA 4DRMA 4DRPA 1EQ3A 1ZBWA 1TFVA 1LG2A 4P8UA 2ZQVA 1LL6A 5HT1A 1GOIA 4J4NA 5HWCA 2DPEA 1GRJA 1FKJA 1D7IA 3RMEA 2YBUA 3PRBA 4XAKA 4UDMA 2N87A 3O5LA 2P4VA 5DEZA 3FXYA 1FKDA 1ZU8A 3WD3A 1N1AA 2LGOA 4FN2A 1OGGA 1W1PA 1FKTA 4Z2KA 1ZBKA 2KE0A 3CH9A 1NH6A 3PR9A 3UI6A 3AQUA 2RSEA 1X6LA 1FKFA 1EYMA 1ITXA 3TC5A 1LG1A 2PPNA 1FAPA
chains in the Genus database with same CATH topology
2L2SA 2QF8A 1RD6A 2LJ4A 3AS0A 1Y0OA 1KFWA 1FFRA 3KAGA 4DRIA 1JNSA 2OFNA 2XPAA 3WD4A 4BF8A 4DRKA 4DWSA 3ARZA 2DG4A 3TCZA 2JZVA 2A3AA 1J4RA 4R0XA 4IQ2A 2Y78A 3OA5A 2LKNA 2FDMA 3MDYB 3WL1A 4ZS6A 4DRQA 4QT2A 2VN1A 4DH0A 2A3CA 5DIVA 2F4EA 2Q5AA 1FKBA 2ZR6A 4JYSA 1PINA 3JXVA 3NTPA 1NWUA 1O6IA 1R9HA 3ARSA 1W1VA 4N19A 4URIA 4DROA 3WQWA 1E9LA 1TCOC 2XP5A 1WNOA 4S3JA 3UI4A 1FKKA 5JH8A 3KABA 3BXWA 1NSGA 2DSUA 3WIJA 2KFWA 3B9AA 1E6PA 3O5KA 4KR0B 4DZ3A 2XP9A 1A7XA 3TDBA 2WK2A 1BKFA 4MNKA 3KADA 4AY1A 4HBOA 1FD9A 4WK9A 4DRHA 1FKRA 4HARA 4O2TA 3AROA 1E6ZA 3ARVA 4ZPTR 3O5MA 5J6EA 4ODLA 1YW5A 1IX5A 4ODRA 1E6NA 3RGCA 1UR8A 1B6CA 1JNTA 1M5YA 3WH0A 2O9OA 1Q6IA 1FFQA 2DT0A 3RM8A 1W9VA 4DT4A 5HWBA 3PRDA 2G41A 1ZCNA 1GUVA 3CGNA 1YATA 1ZB5A 3CGMA 1GPFA 2IF4A 4G2PA 2XP3A 2ZQUA 1T11A 2WLYA 1HXVA 4Q7NA 3QOKA 1ZL1A 2XP8A 3ODKA 2RUDA 3O5GA 2KR7A 3ARQA 1QPLA 2MLYA 2F21A 1KT0A 4LAYA 1SYTA 1CTNA 2IUZA 2KGJA 2KI3A 3WD0A 2O92A 5HBFA 1D6OA 1NWRA 3FAPA 1VF8A 1FKGA 3O5PA 4LAXA 2KO7A 1HKMA 3LUOA 3WQVA 4QT3A 2DG3A 1Q6HA 1NWSA 1LL4A 4IQCA 2PV3A 3IKGA 3O5RA 2MPHA 1Q1CA 2DSWA 4L3NA 3ALFA 1FKSA 1XHGA 3JYMA 1X6NA 3O5OA 4JFJA 4GIVA 2DG9A 3OOBA 2DT2A 4P8WA 2PV1A 4TYOA 1E6RA 4U86A 3B9EA 1HKIA 1Q6UA 4ODNA 3RFWA 1C9HA 2PPOA 5HKGA 4WKFA 1LJYA 1KT1A 4W9OA 1J6YA 4IT6A 4MPKA 3RM9A 4C02B 2RUQA 4KQZA 1FKLA 3KAHA 4W9QA 4NZCA 2G8ZA 4JFKA 2M2AA 4QZVB 2ITKA 3O5IA 3CHDA 4Z2LA 2ZR5A 3O5EA 1W9PA 3KAFA 1E15A 2WM0A 4NNRA 3GPKA 2XP4A 4Z2IA 5DITA 2UZ5A 1WAWA 2ZQTA 2A3BA 4ITZA 3ARTA 3CHFA 3WD2A 4Z2GA 1FKHA 2ZR4A 4U84A 5HTGA 3JYJA 4TW7A 3IK8A 1LQ0A 4Q22A 4PTMA 3I6CA 4DRJA 5HW6A 4ODKA 4IPXA 5HW7A 4J4OA 4TW8A 4U85A 1NMWA 2PBCA 3KCEA 3UF8A 2OLHA 2D9FA 1W26A 1HKKA 4ZPVR 3CHEA 4ODOA 2ZQSA 4Z2JA 4MGVA 4DWSB 1F40A 4LAWA 5BXJA 1OGBA 4JFMA 3AS3A 1ROUA 5D75A 3ARRA 4GGQA 2DT1A 3ARPA 1FJDA 2DT3A 3ALGA 3EY6A 4Z2HA 2VCDA 1W9UA 3FY1A 1HKJA 2LPVA 5B8IC 1ROTA 4MAVA 4DIPA 3ARYA 2F2DA 3UQBA 1ZBCA 2PI6A 1NMVA 2RURA 2WLZA 3UI5A 5HW8A 2XPBA 1H0GA 3IHZA 4TW6A 2A3EA 3NRKA 4P8XA 1NWTA 3KAIA 4QIBA 2YBTA 3NI6A 4MNLA 3WL0A 3G6LA 3O5DA 4DWSD 1JNDA 4MSPA 1BL4A 3UQAA 1W1TA 4ML4A 4FAPA 1XRVA 2AWGA 2XP7A 1F8AB 3WKZA 4W5UA 4L72B 1W1YA 1L1PA 5I98A 2FKEA 2M08A 3O5FA 3G6MA 4MTVA 4DWSC 2MNTA 4R5EA 1J4IA 3O5QA 4P8VA 1HJWA 3B7XA 4ODQA 1UR9A 2RQSA 3WD1A 1PBKA 1EHNA 4ODPA 3ARUA 2PPPA 3CHCA 4ZPWR 4TNSA 4WKHA 1D2KA 3PA7A 5DO2A 1HJXA 1U79A 1FKIA 2K8IA 3AS2A 1ZBVA 2FAPA 3CZ8A 2M1IA 4W9PA 4WKAA 4G50A 1D7JA 4DZ2A 2PV2A 4IT4A 1QZ2A 2MLXA 5GPGA 3RM4A 4JFIA 4DRNA 1D7HA 4TX0A 1SR0A 4LGXA 3W4RA 3IKDA 1P5QA 2ESCA 5GPRA 1QPFA 1H0IA 4JFLA 4MNJA 4LAVA 3ARWA 3PRAA 3O5JA 1EDQA 4WIWA 3ARXA 4NSBA 2MLZA 2RUCA 2AOSA 2DSZA 1WB0A 1EIBA 2MF9A 3AS1A 2DSVA 1HJVA 2B31A 3VAWA 5DF0A 3KZ7A 4S3KA 4HBEA 5GQBA 1J4HA 1K9TA 3H9RB 3KACA 4ODMA 5DIUA 3B9DA 3UQIA 1LL7A 1ZK6A 4MNMA 1JNEA 4WJXA 1JVWA 2XP6A 5HUAA 3B8SA 1OWQA 4DRMA 4DRPA 1EQ3A 1ZBWA 1TFVA 1LG2A 4P8UA 2ZQVA 1LL6A 5HT1A 1GOIA 4J4NA 5HWCA 2DPEA 1FKJA 1D7IA 3RMEA 2YBUA 3PRBA 4XAKA 2N87A 3O5LA 5DEZA 3FXYA 1FKDA 1ZU8A 3WD3A 1N1AA 2LGOA 4FN2A 1OGGA 1W1PA 1FKTA 4Z2KA 1ZBKA 2KE0A 3CH9A 1NH6A 3PR9A 3UI6A 3AQUA 2RSEA 1X6LA 1FKFA 1EYMA 1ITXA 3TC5A 1LG1A 2PPNA 1FAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQU A;  4TNS A;  2L2S A;  3I6C A;  1T11 A;  3PA7 A;  4DRJ A;  2LJ4 A;  3KAG A;  1Y0O A;  4IPX A;  4ODK A;  4DRI A;  1U79 A;  5HW6 A;  1FKI A;  2K8I A;  5HW7 A;  1JNS A;  1HXV A;  2FAP A;  2M1I A;  2OFN A;  4J4O A;  4G50 A;  4W9P A;  1D7J A;  4TW8 A;  2XPA A;  4U85 A;  4DZ2 A;  2PV2 A;  2XP8 A;  4BF8 A;  3ODK A;  1QZ2 A;  2MLX A;  2DG4 A;  4DRK A;  5GPG A;  1NMW A;  2PBC A;  2RUD A;  2KR7 A;  2JZV A;  3O5G A;  1J4R A;  3KCE A;  4JFI A;  1QPL A;  2MLY A;  1D7H A;  1KT0 A;  2F21 A;  4IQ2 A;  2Y78 A;  4R0X A;  4LAY A;  2D9F A;  1W26 A;  2LKN A;  2KGJ A;  3MDY B;  3IKD A;  1P5Q A;  2KI3 A;  4ODO A;  2ZQS A;  4QT2 A;  4DRQ A;  1QPF A;  2VN1 A;  4JFL A;  4MGV A;  4DH0 A;  4LAV A;  1F40 A;  4LAW A;  5DIV A;  5BXJ A;  1D6O A;  3UF8 A;  2F4E A;  3FAP A;  1FKG A;  2Q5A A;  1FKB A;  2ZR6 A;  4JFM A;  4JYS A;  1PIN A;  3JXV A;  3NTP A;  1R9H A;  3O5J A;  3O5P A;  4N19 A;  1ROU A;  4LAX A;  5D75 A;  2KO7 A;  2MLZ A;  4DRO A;  4GGQ A;  1TCO C;  2RUC A;  2XP5 A;  3LUO A;  1FJD A;  4QT3 A;  3EY6 A;  2MF9 A;  2DG3 A;  2VCD A;  3UI4 A;  1FKK A;  1Q6H A;  3KAB A;  1NSG A;  2LPV A;  4IQC A;  2PV3 A;  3IKG A;  5B8I C;  1ROT A;  2KFW A;  3O5R A;  3VAW A;  4DIP A;  3O5K A;  2F2D A;  4DZ3 A;  2MPH A;  2XP9 A;  3UQB A;  1A7X A;  3KZ7 A;  3TDB A;  1BKF A;  1Q1C A;  3KAD A;  1NMV A;  2RUR A;  1FKS A;  3UI5 A;  3JYM A;  5HW8 A;  1FD9 A;  2XPB A;  4DRH A;  1J4H A;  3H9R B;  1FKR A;  3KAC A;  4ODM A;  3IHZ A;  4O2T A;  3O5O A;  5DIU A;  4TW6 A;  3UQI A;  1ZK6 A;  4JFJ A;  1JVW A;  2XP6 A;  2DG9 A;  4GIV A;  3OOB A;  3NRK A;  5HUA A;  2PV1 A;  3O5M A;  4TYO A;  5J6E A;  3KAI A;  4QIB A;  4U86 A;  4ODL A;  3NI6 A;  4DRM A;  4DRP A;  1Q6U A;  3O5D A;  1YW5 A;  4ODN A;  3RFW A;  1EQ3 A;  1C9H A;  2PPO A;  5HKG A;  4ODR A;  2ZQV A;  4MSP A;  1KT1 A;  4W9O A;  1BL4 A;  3UQA A;  1J6Y A;  5HT1 A;  4TX0 A;  3RGC A;  4C02 B;  2RUQ A;  4FAP A;  4J4N A;  5HWC A;  1FKL A;  3KAH A;  4W9Q A;  1B6C A;  1FKJ A;  1D7I A;  3PRB A;  2AWG A;  4JFK A;  2M2A A;  1JNT A;  2XP7 A;  1M5Y A;  2N87 A;  1F8A B;  3O5L A;  2XP3 A;  2ITK A;  3O5I A;  3WH0 A;  1L1P A;  1FKD A;  1Q6I A;  2ZR5 A;  3O5E A;  1N1A A;  2LGO A;  5I98 A;  3KAF A;  2FKE A;  2M08 A;  4FN2 A;  4DT4 A;  5HWB A;  3O5F A;  3GPK A;  1FKT A;  3PRD A;  4NNR A;  2KE0 A;  2XP4 A;  4G2P A;  1ZCN A;  2MNT A;  5DIT A;  2UZ5 A;  4DRN A;  2ZQT A;  1J4I A;  3CGN A;  3UI6 A;  3O5Q A;  4ITZ A;  2RSE A;  3B7X A;  1FKF A;  4ODQ A;  1YAT A;  1EYM A;  2RQS A;  1FKH A;  2ZR4 A;  1PBK A;  3CGM A;  4ODP A;  3TC5 A;  4U84 A;  5HTG A;  2PPP A;  2IF4 A;  3TCZ A;  3JYJ A;  4TW7 A;  2PPN A;  3IK8 A;  1FAP A; 
#chains in the Genus database with same CATH topology
 2L2S A;  2QF8 A;  1RD6 A;  2LJ4 A;  3AS0 A;  1Y0O A;  1KFW A;  1FFR A;  3KAG A;  4DRI A;  1JNS A;  2PN0 A;  2OFN A;  2XPA A;  3WD4 A;  4BF8 A;  4DRK A;  4DWS A;  3ARZ A;  2DG4 A;  3TCZ A;  2JZV A;  2A3A A;  1J4R A;  4R0X A;  4IQ2 A;  2Y78 A;  3OA5 A;  2LKN A;  2FDM A;  3MDY B;  3WL1 A;  4ZS6 A;  4DRQ A;  4QT2 A;  2VN1 A;  4DH0 A;  2A3C A;  5DIV A;  2F4E A;  2Q5A A;  1FKB A;  2ZR6 A;  4JYS A;  1PIN A;  3JXV A;  3NTP A;  1NWU A;  1O6I A;  1R9H A;  3ARS A;  1W1V A;  4N19 A;  4URI A;  4DRO A;  3WQW A;  1E9L A;  1TCO C;  2XP5 A;  1WNO A;  4S3J A;  3UI4 A;  1FKK A;  5JH8 A;  3KAB A;  3BXW A;  1NSG A;  2DSU A;  3WIJ A;  2KFW A;  3B9A A;  1E6P A;  3O5K A;  4KR0 B;  4DZ3 A;  2XP9 A;  1A7X A;  3TDB A;  2WK2 A;  1BKF A;  4MNK A;  3KAD A;  4AY1 A;  4HBO A;  1FD9 A;  4WK9 A;  4DRH A;  1FKR A;  4HAR A;  4O2T A;  3ARO A;  1E6Z A;  3ARV A;  4ZPT R;  3O5M A;  5J6E A;  4ODL A;  1YW5 A;  1IX5 A;  4ODR A;  1E44 A;  1E6N A;  3RGC A;  1UR8 A;  1B6C A;  1JNT A;  2B5U B;  1M5Y A;  3WH0 A;  2O9O A;  1Q6I A;  1FFQ A;  2DT0 A;  3RM8 A;  1W9V A;  4DT4 A;  5HWB A;  3PRD A;  2G41 A;  1ZCN A;  1GUV A;  3CGN A;  1YAT A;  1ZB5 A;  3CGM A;  1GPF A;  2IF4 A;  4G2P A;  2XP3 A;  2ZQU A;  1T11 A;  2WLY A;  1HXV A;  4Q7N A;  3QOK A;  1ZL1 A;  2XP8 A;  3ODK A;  2RUD A;  3O5G A;  2KR7 A;  3ARQ A;  1QPL A;  2MLY A;  2F21 A;  1KT0 A;  4LAY A;  1SYT A;  1CTN A;  2IUZ A;  2KGJ A;  2KI3 A;  3WD0 A;  2O92 A;  5HBF A;  1D6O A;  1NWR A;  3FAP A;  1VF8 A;  1FKG A;  3GTY X;  3O5P A;  4LAX A;  2KO7 A;  1HKM A;  3LUO A;  3WQV A;  4QT3 A;  2DG3 A;  1Q6H A;  1NWS A;  1LL4 A;  4IQC A;  2PV3 A;  3IKG A;  3O5R A;  2MPH A;  1Q1C A;  2DSW A;  4L3N A;  3EIP A;  3ALF A;  1FKS A;  1XHG A;  3JYM A;  1X6N A;  3O5O A;  4JFJ A;  4GIV A;  2DG9 A;  3OOB A;  2DT2 A;  4P8W A;  2PV1 A;  4TYO A;  1E6R A;  4U86 A;  3B9E A;  1HKI A;  1Q6U A;  4ODN A;  3RFW A;  1C9H A;  2PPO A;  5HKG A;  4WKF A;  1LJY A;  1KT1 A;  4W9O A;  1J6Y A;  4IT6 A;  4MPK A;  3RM9 A;  4C02 B;  2RUQ A;  4KQZ A;  1FKL A;  3KAH A;  4W9Q A;  4NZC A;  2G8Z A;  4JFK A;  2M2A A;  4QZV B;  2ITK A;  3O5I A;  3CHD A;  4Z2L A;  2ZR5 A;  3O5E A;  1W9P A;  3KAF A;  1E15 A;  2WM0 A;  4NNR A;  3GPK A;  2XP4 A;  4Z2I A;  5DIT A;  2UZ5 A;  1WAW A;  2ZQT A;  2A3B A;  4ITZ A;  3ART A;  3CHF A;  3WD2 A;  4Z2G A;  1FKH A;  2ZR4 A;  3BMB A;  4U84 A;  1JCH B;  5HTG A;  3JYJ A;  4TW7 A;  3IK8 A;  1LQ0 A;  4Q22 A;  4PTM A;  3I6C A;  4DRJ A;  5HW6 A;  4ODK A;  4IPX A;  5HW7 A;  4J4O A;  4TW8 A;  4U85 A;  1NMW A;  2PBC A;  3KCE A;  3UF8 A;  2OLH A;  2D9F A;  1W26 A;  1HKK A;  4ZPV R;  3CHE A;  4ODO A;  2ZQS A;  4Z2J A;  4MGV A;  4DWS B;  1F40 A;  4LAW A;  5BXJ A;  1OGB A;  4JFM A;  3AS3 A;  1ROU A;  5D75 A;  3ARR A;  4GGQ A;  2DT1 A;  3ARP A;  1FJD A;  2DT3 A;  3ALG A;  3EY6 A;  4Z2H A;  2VCD A;  1W9U A;  3FY1 A;  1HKJ A;  2LPV A;  5B8I C;  1ROT A;  4MAV A;  4DIP A;  2ETN A;  2F2D A;  3ARY A;  3UQB A;  1ZBC A;  2PI6 A;  1NMV A;  2RUR A;  2WLZ A;  3UI5 A;  5HW8 A;  2XPB A;  1H0G A;  3IHZ A;  4TW6 A;  2A3E A;  3NRK A;  4P8X A;  1NWT A;  2EUL A;  3KAI A;  4QIB A;  2YBT A;  3NI6 A;  4MNL A;  3WL0 A;  3G6L A;  3O5D A;  4DWS D;  1JND A;  4MSP A;  1BL4 A;  3UQA A;  3GU0 A;  1W1T A;  4ML4 A;  4FAP A;  1XRV A;  2AWG A;  2XP7 A;  1F8A B;  3WKZ A;  4W5U A;  4L72 B;  1W1Y A;  1L1P A;  5I98 A;  2FKE A;  2M08 A;  3O5F A;  3G6M A;  4MTV A;  4DWS C;  2MNT A;  4R5E A;  1J4I A;  3O5Q A;  4P8V A;  1HJW A;  3B7X A;  4ODQ A;  1UR9 A;  2RQS A;  3WD1 A;  1PBK A;  1EHN A;  4ODP A;  3ARU A;  2PPP A;  3CHC A;  4ZPW R;  4TNS A;  4WKH A;  1D2K A;  3PA7 A;  5DO2 A;  1HJX A;  1U79 A;  1FKI A;  2K8I A;  3AS2 A;  1ZBV A;  2FAP A;  3CZ8 A;  2M1I A;  4W9P A;  4WKA A;  4G50 A;  1D7J A;  4DZ2 A;  2PV2 A;  4IT4 A;  1QZ2 A;  2MLX A;  5GPG A;  3RM4 A;  4JFI A;  4DRN A;  1D7H A;  4TX0 A;  1SR0 A;  4LGX A;  3W4R A;  3IKD A;  1P5Q A;  2ESC A;  5GPR A;  1QPF A;  1H0I A;  4JFL A;  4MNJ A;  4LAV A;  3ARW A;  3PRA A;  3O5J A;  1EDQ A;  4WIW A;  3ARX A;  4NSB A;  2MLZ A;  2RUC A;  2AOS A;  2DSZ A;  1WB0 A;  1EIB A;  2MF9 A;  3AS1 A;  2DSV A;  1HJV A;  2B31 A;  2F23 A;  3VAW A;  5DF0 A;  3KZ7 A;  4S3K A;  4HBE A;  5GQB A;  1J4H A;  1K9T A;  3H9R B;  3KAC A;  4ODM A;  5DIU A;  3B9D A;  3UQI A;  1LL7 A;  1ZK6 A;  4MNM A;  1JNE A;  4WJX A;  1JVW A;  2XP6 A;  5HUA A;  3B8S A;  1OWQ A;  4DRM A;  4DRP A;  1EQ3 A;  1ZBW A;  1TFV A;  1LG2 A;  4P8U A;  2ZQV A;  1LL6 A;  5HT1 A;  1GOI A;  4J4N A;  5HWC A;  2DPE A;  1GRJ A;  1FKJ A;  1D7I A;  3RME A;  2YBU A;  3PRB A;  4XAK A;  4UDM A;  2N87 A;  3O5L A;  2P4V A;  5DEZ A;  3FXY A;  1FKD A;  1ZU8 A;  3WD3 A;  1N1A A;  2LGO A;  4FN2 A;  1OGG A;  1W1P A;  1FKT A;  4Z2K A;  1ZBK A;  2KE0 A;  3CH9 A;  1NH6 A;  3PR9 A;  3UI6 A;  3AQU A;  2RSE A;  1X6L A;  1FKF A;  1EYM A;  1ITX A;  3TC5 A;  1LG1 A;  2PPN A;  1FAP A; 
#chains in the Genus database with same CATH homology
 2L2S A;  2QF8 A;  1RD6 A;  2LJ4 A;  3AS0 A;  1Y0O A;  1KFW A;  1FFR A;  3KAG A;  4DRI A;  1JNS A;  2OFN A;  2XPA A;  3WD4 A;  4BF8 A;  4DRK A;  4DWS A;  3ARZ A;  2DG4 A;  3TCZ A;  2JZV A;  2A3A A;  1J4R A;  4R0X A;  4IQ2 A;  2Y78 A;  3OA5 A;  2LKN A;  2FDM A;  3MDY B;  3WL1 A;  4ZS6 A;  4DRQ A;  4QT2 A;  2VN1 A;  4DH0 A;  2A3C A;  5DIV A;  2F4E A;  2Q5A A;  1FKB A;  2ZR6 A;  4JYS A;  1PIN A;  3JXV A;  3NTP A;  1NWU A;  1O6I A;  1R9H A;  3ARS A;  1W1V A;  4N19 A;  4URI A;  4DRO A;  3WQW A;  1E9L A;  1TCO C;  2XP5 A;  1WNO A;  4S3J A;  3UI4 A;  1FKK A;  5JH8 A;  3KAB A;  3BXW A;  1NSG A;  2DSU A;  3WIJ A;  2KFW A;  3B9A A;  1E6P A;  3O5K A;  4KR0 B;  4DZ3 A;  2XP9 A;  1A7X A;  3TDB A;  2WK2 A;  1BKF A;  4MNK A;  3KAD A;  4AY1 A;  4HBO A;  1FD9 A;  4WK9 A;  4DRH A;  1FKR A;  4HAR A;  4O2T A;  3ARO A;  1E6Z A;  3ARV A;  4ZPT R;  3O5M A;  5J6E A;  4ODL A;  1YW5 A;  1IX5 A;  4ODR A;  1E6N A;  3RGC A;  1UR8 A;  1B6C A;  1JNT A;  1M5Y A;  3WH0 A;  2O9O A;  1Q6I A;  1FFQ A;  2DT0 A;  3RM8 A;  1W9V A;  4DT4 A;  5HWB A;  3PRD A;  2G41 A;  1ZCN A;  1GUV A;  3CGN A;  1YAT A;  1ZB5 A;  3CGM A;  1GPF A;  2IF4 A;  4G2P A;  2XP3 A;  2ZQU A;  1T11 A;  2WLY A;  1HXV A;  4Q7N A;  3QOK A;  1ZL1 A;  2XP8 A;  3ODK A;  2RUD A;  3O5G A;  2KR7 A;  3ARQ A;  1QPL A;  2MLY A;  2F21 A;  1KT0 A;  4LAY A;  1SYT A;  1CTN A;  2IUZ A;  2KGJ A;  2KI3 A;  3WD0 A;  2O92 A;  5HBF A;  1D6O A;  1NWR A;  3FAP A;  1VF8 A;  1FKG A;  3O5P A;  4LAX A;  2KO7 A;  1HKM A;  3LUO A;  3WQV A;  4QT3 A;  2DG3 A;  1Q6H A;  1NWS A;  1LL4 A;  4IQC A;  2PV3 A;  3IKG A;  3O5R A;  2MPH A;  1Q1C A;  2DSW A;  4L3N A;  3ALF A;  1FKS A;  1XHG A;  3JYM A;  1X6N A;  3O5O A;  4JFJ A;  4GIV A;  2DG9 A;  3OOB A;  2DT2 A;  4P8W A;  2PV1 A;  4TYO A;  1E6R A;  4U86 A;  3B9E A;  1HKI A;  1Q6U A;  4ODN A;  3RFW A;  1C9H A;  2PPO A;  5HKG A;  4WKF A;  1LJY A;  1KT1 A;  4W9O A;  1J6Y A;  4IT6 A;  4MPK A;  3RM9 A;  4C02 B;  2RUQ A;  4KQZ A;  1FKL A;  3KAH A;  4W9Q A;  4NZC A;  2G8Z A;  4JFK A;  2M2A A;  4QZV B;  2ITK A;  3O5I A;  3CHD A;  4Z2L A;  2ZR5 A;  3O5E A;  1W9P A;  3KAF A;  1E15 A;  2WM0 A;  4NNR A;  3GPK A;  2XP4 A;  4Z2I A;  5DIT A;  2UZ5 A;  1WAW A;  2ZQT A;  2A3B A;  4ITZ A;  3ART A;  3CHF A;  3WD2 A;  4Z2G A;  1FKH A;  2ZR4 A;  4U84 A;  5HTG A;  3JYJ A;  4TW7 A;  3IK8 A;  1LQ0 A;  4Q22 A;  4PTM A;  3I6C A;  4DRJ A;  5HW6 A;  4ODK A;  4IPX A;  5HW7 A;  4J4O A;  4TW8 A;  4U85 A;  1NMW A;  2PBC A;  3KCE A;  3UF8 A;  2OLH A;  2D9F A;  1W26 A;  1HKK A;  4ZPV R;  3CHE A;  4ODO A;  2ZQS A;  4Z2J A;  4MGV A;  4DWS B;  1F40 A;  4LAW A;  5BXJ A;  1OGB A;  4JFM A;  3AS3 A;  1ROU A;  5D75 A;  3ARR A;  4GGQ A;  2DT1 A;  3ARP A;  1FJD A;  2DT3 A;  3ALG A;  3EY6 A;  4Z2H A;  2VCD A;  1W9U A;  3FY1 A;  1HKJ A;  2LPV A;  5B8I C;  1ROT A;  4MAV A;  4DIP A;  3ARY A;  2F2D A;  3UQB A;  1ZBC A;  2PI6 A;  1NMV A;  2RUR A;  2WLZ A;  3UI5 A;  5HW8 A;  2XPB A;  1H0G A;  3IHZ A;  4TW6 A;  2A3E A;  3NRK A;  4P8X A;  1NWT A;  3KAI A;  4QIB A;  2YBT A;  3NI6 A;  4MNL A;  3WL0 A;  3G6L A;  3O5D A;  4DWS D;  1JND A;  4MSP A;  1BL4 A;  3UQA A;  1W1T A;  4ML4 A;  4FAP A;  1XRV A;  2AWG A;  2XP7 A;  1F8A B;  3WKZ A;  4W5U A;  4L72 B;  1W1Y A;  1L1P A;  5I98 A;  2FKE A;  2M08 A;  3O5F A;  3G6M A;  4MTV A;  4DWS C;  2MNT A;  4R5E A;  1J4I A;  3O5Q A;  4P8V A;  1HJW A;  3B7X A;  4ODQ A;  1UR9 A;  2RQS A;  3WD1 A;  1PBK A;  1EHN A;  4ODP A;  3ARU A;  2PPP A;  3CHC A;  4ZPW R;  4TNS A;  4WKH A;  1D2K A;  3PA7 A;  5DO2 A;  1HJX A;  1U79 A;  1FKI A;  2K8I A;  3AS2 A;  1ZBV A;  2FAP A;  3CZ8 A;  2M1I A;  4W9P A;  4WKA A;  4G50 A;  1D7J A;  4DZ2 A;  2PV2 A;  4IT4 A;  1QZ2 A;  2MLX A;  5GPG A;  3RM4 A;  4JFI A;  4DRN A;  1D7H A;  4TX0 A;  1SR0 A;  4LGX A;  3W4R A;  3IKD A;  1P5Q A;  2ESC A;  5GPR A;  1QPF A;  1H0I A;  4JFL A;  4MNJ A;  4LAV A;  3ARW A;  3PRA A;  3O5J A;  1EDQ A;  4WIW A;  3ARX A;  4NSB A;  2MLZ A;  2RUC A;  2AOS A;  2DSZ A;  1WB0 A;  1EIB A;  2MF9 A;  3AS1 A;  2DSV A;  1HJV A;  2B31 A;  3VAW A;  5DF0 A;  3KZ7 A;  4S3K A;  4HBE A;  5GQB A;  1J4H A;  1K9T A;  3H9R B;  3KAC A;  4ODM A;  5DIU A;  3B9D A;  3UQI A;  1LL7 A;  1ZK6 A;  4MNM A;  1JNE A;  4WJX A;  1JVW A;  2XP6 A;  5HUA A;  3B8S A;  1OWQ A;  4DRM A;  4DRP A;  1EQ3 A;  1ZBW A;  1TFV A;  1LG2 A;  4P8U A;  2ZQV A;  1LL6 A;  5HT1 A;  1GOI A;  4J4N A;  5HWC A;  2DPE A;  1FKJ A;  1D7I A;  3RME A;  2YBU A;  3PRB A;  4XAK A;  2N87 A;  3O5L A;  5DEZ A;  3FXY A;  1FKD A;  1ZU8 A;  3WD3 A;  1N1A A;  2LGO A;  4FN2 A;  1OGG A;  1W1P A;  1FKT A;  4Z2K A;  1ZBK A;  2KE0 A;  3CH9 A;  1NH6 A;  3PR9 A;  3UI6 A;  3AQU A;  2RSE A;  1X6L A;  1FKF A;  1EYM A;  1ITX A;  3TC5 A;  1LG1 A;  2PPN A;  1FAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...