5HUAA

Structure of c. glabrata fkbp12-fk506 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
SETIEGGVKIDRLSPGDGKTFPKQGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATLIFDVELLKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida glabrata (strain atcc 2001 / cbs 138 / jcm 3761 / nbrc 0622 / nrrl y-65)
molecule tags Isomerase
molecule keywords FK506-binding protein 1
total genus 27
structure length 113
sequence length 113
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5huaA00
2RQSA 4O2TA 4ODLA 4ODRA 1J6YA 5HUAA 4QIBA 2PPOA 2ZR4A 2LPVA 2RUCA 2RUQA 4U85A 1JNSA 3IKGA 5B8IC 1TCOC 4DRMA 1A7XA 1D7JA 4LAVA 4JFLA 1ROUA 2AWGA 1NMVA 1C9HA 4ODOA 1FD9A 4MSPA 2JZVA 2ZQTA 1FKDA 4G50A 2LGOA 2XP5A 4R0XA 3IKDA 4ODMA 4TNSA 3O5QA 3CGMA 2XP6A 3PRBA 2L2SA 1Q1CA 3VAWA 1HXVA 4TW8A 4LAYA 3WH0A 2FKEA 3KAFA 2MLZA 3KABA 2DG4A 3OOBA 4ODPA 2XPAA 2KGJA 2MNTA 3FAPA 3O5GA 2RURA 3I6CA 3JXVA 1ZK6A 3UI5A 3PA7A 1QPFA 3NRKA 1U79A 3EY6A 1D7IA 2ZR5A 4DRIA 5HWBA 4ITZA 1QZ2A 2PV1A 1KT1A 4JYSA 2KR7A 2PPPA 5DIVA 1BL4A 1FKGA 4FN2A 2XPBA 2UZ5A 3KACA 1ROTA 5I98A 1T11A 2KO7A 2F21A 3O5LA 4TX0A 1F40A 3JYJA 4JFIA 2K8IA 4N19A 5HT1A 3KAHA 1YATA 2MLXA 3CGNA 3O5KA 4U86A 3IHZA 1FKJA 2PBCA 2ZQUA 4LAXA 1KT0A 5HKGA 1P5QA 2XP9A 4DRHA 3IK8A 4J4NA 5BXJA 3O5OA 1FAPA 2ITKA 4G2PA 1J4RA 4IPXA 2F2DA 4BF8A 2M1IA 2VCDA 5HW7A 4DIPA 2D9FA 1W26A 5D75A 1EYMA 5HTGA 3UI6A 4FAPA 2KFWA 1NSGA 2ZQSA 3PRDA 4DT4A 1D7HA 2F4EA 2M08A 1FKTA 4IQ2A 3O5EA 2RSEA 4GIVA 2OFNA 5GPGA 3NTPA 4QT2A 1FKSA 4DRPA 1B6CA 2PPNA 1Q6IA 4W9OA 3NI6A 4J4OA 3GPKA 3RFWA 2KE0A 4DZ2A 2LKNA 4W9QA 3UQBA 2IF4A 2KI3A 3KAGA 3UI4A 3UQIA 1FKHA 3KADA 4DZ3A 4JFJA 3H9RB 3O5FA 3TC5A 2XP7A 3B7XA 2XP3A 1Q6UA 2VN1A 3O5IA 4IQCA 3MDYB 1FKIA 2N87A 2Y78A 2MPHA 1ZCNA 2ZR6A 3KZ7A 2ZQVA 1N1AA 1YW5A 4ODNA 4DRNA 2XP4A 2DG3A 1J4HA 1JNTA 3ODKA 2Q5AA 4QT3A 1L1PA 5DITA 1F8AB 4DRJA 2M2AA 3JYMA 1PBKA 2PV3A 3RGCA 1PINA 5HW6A 2PV2A 4DROA 3O5RA 3O5DA 1FKLA 1D6OA 2FAPA 3UF8A 1QPLA 2LJ4A 4DH0A 4DRKA 2DG9A 3KAIA 1FKKA 2RUDA 1Q6HA 3O5MA 4U84A 1Y0OA 2MF9A 4W9PA 3UQAA 1M5YA 1FKFA 5HWCA 4MGVA 1FJDA 4TW7A 2MLYA 3KCEA 4GGQA 2XP8A 1EQ3A 4TYOA 4JFMA 4LAWA 1J4IA 3TDBA 1BKFA 4ODQA 1R9HA 4NNRA 3O5PA 4TW6A 3O5JA 1JVWA 4ODKA 5J6EA 5DIUA 4DRQA 1FKRA 1FKBA 1NMWA 5HW8A 4JFKA 4C02B 3TCZA 3LUOA
chains in the Genus database with same CATH superfamily
4O2TA 1HKIA 4ODRA 2RUQA 1E44A 1A7XA 2DSZA 1IX5A 1ROUA 1C9HA 4L72B 1H0GA 2ZQTA 2LGOA 4ODMA 2B31A 3WKZA 2G8ZA 3PRBA 4W5UA 3ALGA 1EHNA 2A3AA 3KABA 1VF8A 5DO2A 3FAPA 3FY1A 3QOKA 1KFWA 5HWBA 1QZ2A 4JYSA 5I98A 2P4VA 3O5LA 2F21A 4N19A 2K8IA 1WB0A 3AROA 1FKJA 1E9LA 2ZQUA 1E15A 4DRHA 1TFVA 3O5OA 4IPXA 4BF8A 1JNDA 3ARQA 4QZVB 3OA5A 4DIPA 5HTGA 4KR0B 4FAPA 2KFWA 1HJVA 2IUZA 3CHEA 3NTPA 4QT2A 1GUVA 4P8XA 1B6CA 4Z2KA 1LQ0A 4Z2LA 2LKNA 3KAGA 4DZ3A 3TC5A 1FKIA 4ZPWR 1XRVA 1ZCNA 1N1AA 3AS1A 2XP4A 2O92A 1J4HA 1E6NA 3ODKA 1GOIA 4QT3A 1JNEA 2M2AA 5HW6A 2PV2A 4P8UA 4DROA 1OGGA 3O5RA 3UF8A 1D2KA 3CHDA 4DH0A 4UDMA 1LG1A 1Q6HA 2O9OA 5HWCA 4TW7A 2ETNA 1EQ3A 2XP8A 3ARZA 4JFMA 3TDBA 1JVWA 4DRQA 1FKBA 2EULA 4Z2HA 4C02B 2G41A 4ZS6A 4ZPTR 4WKFA 5HUAA 2LPVA 4U85A 3IKGA 2F23A 3WL1A 4LAVA 1LG2A 1FD9A 3G6LA 2WLYA 2DT3A 2JZVA 2DSWA 3EIPA 3CHFA 1FKDA 1ZBVA 5HBFA 2L2SA 1NWTA 1X6NA 4TW8A 3ARYA 4LAYA 1CTNA 4ZPVR 4DWSB 3RM8A 4WJXA 4Z2GA 4PTMA 2MLZA 3OOBA 1LL6A 2XPAA 3O5GA 2RURA 1UR9A 3PA7A 1D7IA 4DWSC 4DRIA 4URIA 5DEZA 2WLZA 2WM0A 1NH6A 1T11A 2KO7A 4TX0A 3JYJA 3WD1A 1YATA 3IHZA 4IT6A 5HKGA 1NWRA 1P5QA 1J4RA 1W1TA 2F2DA 2M1IA 2VCDA 2D9FA 1W26A 5D75A 3PRDA 1NSGA 4DT4A 4AY1A 1FKTA 4P8WA 4S3JA 3RM9A 4GIVA 4DRPA 1FKSA 2DT1A 3RFWA 3GPKA 3CHCA 2KE0A 4DZ2A 1LL7A 2IF4A 3UQIA 2DPEA 3KADA 1HKJA 4JFJA 3H9RB 4R5EA 2XP7A 1K9TA 2XP3A 2VN1A 3CZ8A 2N87A 2Y78A 2MPHA 2ZR6A 3WD2A 2ZQVA 1OWQA 1ZB5A 1JNTA 5DITA 1F8AB 3B8SA 2PN0A 3ARXA 4MPKA 5JH8A 1D6OA 1QPLA 1Y0OA 3UQAA 2YBUA 1FJDA 4WKAA 2MLYA 3B9EA 4GGQA 1SR0A 4ODQA 3O5PA 4TW6A 4MNMA 1W9UA 2RQSA 4ODLA 2WK2A 1J6YA 2PPOA 2ZR4A 1JNSA 3ARRA 1ZU8A 4WK9A 1NWSA 3WIJA 1TCOC 1UR8A 4JFLA 4P8VA 2AWGA 4ODOA 4MSPA 1H0IA 4G50A 4R0XA 2XP5A 4TNSA 1E6ZA 3ARVA 1Q1CA 1GRJA 3WQVA 3RM4A 3WH0A 1GPFA 2FKEA 3KAFA 4ODPA 2FDMA 2MNTA 3I6CA 3JXVA 4WKHA 1ZK6A 3UI5A 3NRKA 1U79A 1ZBWA 2ZR5A 1O6IA 4ITZA 2PV1A 1KT1A 4LGXA 2KR7A 2PPPA 3AS3A 1BL4A 3ARTA 5DIVA 2UZ5A 1ROTA 1E6RA 4JFIA 4Z2JA 1FFRA 3KAHA 1W1PA 3CGNA 3O5KA 4LAXA 3GTYX 3IK8A 4J4NA 2OLHA 1FAPA 2ITKA 3AQUA 1EYMA 3UI6A 2ZQSA 1D7HA 1W1YA 4ML4A 2M08A 4MNJA 4MAVA 1Q6IA 3NI6A 4J4OA 2A3EA 2QF8A 4NSBA 1FFQA 3UQBA 1E6PA 3ALFA 3O5FA 5DF0A 1Q6UA 3O5IA 1W1VA 5GPRA 4DRNA 2DG3A 4XAKA 4Z2IA 4DRJA 1NWUA 1PBKA 3RGCA 4NZCA 3O5DA 3AS2A 4Q7NA 4DWSD 3KAIA 1FKKA 2RUDA 4U84A 4MGVA 3KCEA 1J4IA 4IT4A 1BKFA 1R9HA 4HBOA 1ZL1A 3ARPA 3BXWA 4NNRA 5DIUA 1NMWA 1HKMA 3WD4A 4MNKA 4QIBA 1W9VA 2RUCA 1HKKA 4MTVA 2YBTA 5B8IC 4DRMA 1D7JA 3W4RA 2DT2A 1NMVA 3PRAA 1SYTA 4KQZA 2AOSA 3WD0A 3IKDA 4Q22A 3O5QA 3CGMA 2XP6A 3VAWA 1HXVA 4HBEA 2DG4A 1ITXA 2KGJA 3WQWA 4L3NA 1QPFA 1XHGA 3EY6A 4MNLA 1FKGA 4FN2A 1JCHB 2XPBA 3WL0A 3KACA 4DWSA 3G6MA 5GQBA 1F40A 5HT1A 2ESCA 2MLXA 4U86A 3B9DA 2PBCA 1KT0A 2XP9A 1HJXA 4HARA 1WAWA 5BXJA 4G2PA 4S3KA 5HW7A 3BMBA 2F4EA 4IQ2A 3O5EA 2RSEA 2OFNA 5GPGA 2PPNA 4W9OA 3RMEA 1EIBA 1WNOA 4W9QA 2KI3A 3UI4A 1FKHA 3PR9A 3B7XA 4IQCA 3GU0A 3MDYB 2A3CA 1W9PA 1ZBCA 3KZ7A 3FXYA 3WD3A 1YW5A 2A3BA 3CH9A 4ODNA 1EDQA 1LJYA 2Q5AA 1L1PA 3ARUA 1RD6A 3JYMA 1X6LA 2PV3A 1PINA 1OGBA 3B9AA 1FKLA 2FAPA 2B5UB 2LJ4A 4DRKA 2DG9A 4WIWA 3O5MA 2MF9A 4W9PA 1M5YA 1FKFA 2DSUA 4TYOA 4LAWA 1ZBKA 1LL4A 3ARWA 3O5JA 4ODKA 5J6EA 1HJWA 2DSVA 2DT0A 3ARSA 1FKRA 2PI6A 5HW8A 4JFKA 3TCZA 3AS0A 3LUOA
chains in the Genus database with same CATH topology
4O2TA 1HKIA 4ODRA 2RUQA 1A7XA 2DSZA 1IX5A 1ROUA 1C9HA 4L72B 1H0GA 2ZQTA 2LGOA 4ODMA 2B31A 3WKZA 2G8ZA 3PRBA 4W5UA 3ALGA 1EHNA 2A3AA 3KABA 1VF8A 5DO2A 3FAPA 3FY1A 3QOKA 1KFWA 5HWBA 1QZ2A 4JYSA 5I98A 3O5LA 2F21A 4N19A 2K8IA 1WB0A 3AROA 1FKJA 1E9LA 2ZQUA 1E15A 4DRHA 1TFVA 3O5OA 4IPXA 4BF8A 1JNDA 3ARQA 4QZVB 3OA5A 4DIPA 5HTGA 4KR0B 4FAPA 2KFWA 1HJVA 2IUZA 3CHEA 3NTPA 4QT2A 1GUVA 4P8XA 1B6CA 4Z2KA 1LQ0A 4Z2LA 2LKNA 3KAGA 4DZ3A 3TC5A 1FKIA 4ZPWR 1XRVA 1ZCNA 1N1AA 3AS1A 2XP4A 2O92A 1J4HA 1E6NA 3ODKA 1GOIA 4QT3A 1JNEA 2M2AA 5HW6A 2PV2A 4P8UA 4DROA 1OGGA 3O5RA 3UF8A 1D2KA 3CHDA 4DH0A 1LG1A 1Q6HA 2O9OA 5HWCA 4TW7A 1EQ3A 2XP8A 3ARZA 4JFMA 3TDBA 1JVWA 4DRQA 1FKBA 4Z2HA 4C02B 2G41A 4ZS6A 4ZPTR 4WKFA 5HUAA 2LPVA 4U85A 3IKGA 3WL1A 4LAVA 1LG2A 1FD9A 3G6LA 2WLYA 2DT3A 2JZVA 2DSWA 3CHFA 1FKDA 1ZBVA 5HBFA 2L2SA 1NWTA 1X6NA 4TW8A 3ARYA 4LAYA 1CTNA 4ZPVR 4DWSB 3RM8A 4WJXA 4Z2GA 4PTMA 2MLZA 3OOBA 1LL6A 2XPAA 3O5GA 2RURA 1UR9A 3PA7A 1D7IA 4DWSC 4DRIA 4URIA 5DEZA 2WLZA 2WM0A 1NH6A 1T11A 2KO7A 4TX0A 3JYJA 3WD1A 1YATA 3IHZA 4IT6A 5HKGA 1NWRA 1P5QA 1J4RA 1W1TA 2F2DA 2M1IA 2VCDA 2D9FA 1W26A 5D75A 3PRDA 1NSGA 4DT4A 4AY1A 1FKTA 4P8WA 4S3JA 3RM9A 4GIVA 4DRPA 1FKSA 2DT1A 3RFWA 3GPKA 3CHCA 2KE0A 4DZ2A 1LL7A 2IF4A 3UQIA 2DPEA 3KADA 1HKJA 4JFJA 3H9RB 4R5EA 2XP7A 1K9TA 2XP3A 2VN1A 3CZ8A 2N87A 2Y78A 2MPHA 2ZR6A 3WD2A 2ZQVA 1OWQA 1ZB5A 1JNTA 5DITA 1F8AB 3B8SA 3ARXA 4MPKA 5JH8A 1D6OA 1QPLA 1Y0OA 3UQAA 2YBUA 1FJDA 4WKAA 2MLYA 3B9EA 4GGQA 1SR0A 4ODQA 3O5PA 4TW6A 4MNMA 1W9UA 2RQSA 4ODLA 2WK2A 1J6YA 2PPOA 2ZR4A 1JNSA 3ARRA 1ZU8A 4WK9A 1NWSA 3WIJA 1TCOC 1UR8A 4JFLA 4P8VA 2AWGA 4ODOA 4MSPA 1H0IA 4G50A 4R0XA 2XP5A 4TNSA 1E6ZA 3ARVA 1Q1CA 3WQVA 3RM4A 3WH0A 1GPFA 2FKEA 3KAFA 4ODPA 2FDMA 2MNTA 3I6CA 3JXVA 4WKHA 1ZK6A 3UI5A 3NRKA 1U79A 1ZBWA 2ZR5A 1O6IA 4ITZA 2PV1A 1KT1A 4LGXA 2KR7A 2PPPA 3AS3A 1BL4A 3ARTA 5DIVA 2UZ5A 1ROTA 1E6RA 4JFIA 4Z2JA 1FFRA 3KAHA 1W1PA 3CGNA 3O5KA 4LAXA 3IK8A 4J4NA 2OLHA 1FAPA 2ITKA 3AQUA 1EYMA 3UI6A 2ZQSA 1D7HA 1W1YA 4ML4A 2M08A 4MNJA 4MAVA 1Q6IA 3NI6A 4J4OA 2A3EA 2QF8A 4NSBA 1FFQA 3UQBA 1E6PA 3ALFA 3O5FA 5DF0A 1Q6UA 3O5IA 1W1VA 5GPRA 4DRNA 2DG3A 4XAKA 4Z2IA 4DRJA 1NWUA 1PBKA 3RGCA 4NZCA 3O5DA 3AS2A 4Q7NA 4DWSD 3KAIA 1FKKA 2RUDA 4U84A 4MGVA 3KCEA 1J4IA 4IT4A 1BKFA 1R9HA 4HBOA 1ZL1A 3ARPA 3BXWA 4NNRA 5DIUA 1NMWA 1HKMA 3WD4A 4MNKA 4QIBA 1W9VA 2RUCA 1HKKA 4MTVA 2YBTA 5B8IC 4DRMA 1D7JA 3W4RA 2DT2A 1NMVA 3PRAA 1SYTA 4KQZA 2AOSA 3WD0A 3IKDA 4Q22A 3O5QA 3CGMA 2XP6A 3VAWA 1HXVA 4HBEA 2DG4A 1ITXA 2KGJA 3WQWA 4L3NA 1QPFA 1XHGA 3EY6A 4MNLA 1FKGA 4FN2A 3WL0A 2XPBA 3KACA 4DWSA 3G6MA 5GQBA 1F40A 5HT1A 2ESCA 2MLXA 4U86A 3B9DA 2PBCA 1KT0A 2XP9A 1HJXA 4HARA 1WAWA 5BXJA 4G2PA 4S3KA 5HW7A 2F4EA 4IQ2A 3O5EA 2RSEA 2OFNA 5GPGA 2PPNA 4W9OA 3RMEA 1EIBA 1WNOA 4W9QA 2KI3A 3UI4A 1FKHA 3PR9A 4IQCA 3B7XA 3MDYB 2A3CA 1W9PA 1ZBCA 3KZ7A 3FXYA 3WD3A 1YW5A 2A3BA 3CH9A 4ODNA 1EDQA 1LJYA 2Q5AA 1L1PA 3ARUA 1RD6A 3JYMA 1X6LA 2PV3A 1PINA 1OGBA 3B9AA 1FKLA 2FAPA 2LJ4A 4DRKA 2DG9A 4WIWA 3O5MA 2MF9A 4W9PA 1M5YA 1FKFA 2DSUA 4TYOA 4LAWA 1ZBKA 1LL4A 3ARWA 3O5JA 4ODKA 5J6EA 1HJWA 2DSVA 2DT0A 3ARSA 1FKRA 2PI6A 5HW8A 4JFKA 3TCZA 3AS0A 3LUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQS A;  4O2T A;  4ODL A;  4ODR A;  1J6Y A;  5HUA A;  4QIB A;  2PPO A;  2ZR4 A;  2LPV A;  2RUC A;  2RUQ A;  4U85 A;  1JNS A;  3IKG A;  5B8I C;  1TCO C;  4DRM A;  1A7X A;  1D7J A;  4LAV A;  4JFL A;  1ROU A;  2AWG A;  1NMV A;  1C9H A;  4ODO A;  1FD9 A;  4MSP A;  2JZV A;  2ZQT A;  1FKD A;  4G50 A;  2LGO A;  2XP5 A;  4R0X A;  3IKD A;  4ODM A;  4TNS A;  3O5Q A;  3CGM A;  2XP6 A;  3PRB A;  2L2S A;  1Q1C A;  3VAW A;  1HXV A;  4TW8 A;  4LAY A;  3WH0 A;  2FKE A;  3KAF A;  2MLZ A;  3KAB A;  2DG4 A;  3OOB A;  4ODP A;  2XPA A;  2KGJ A;  2MNT A;  3FAP A;  3O5G A;  2RUR A;  3I6C A;  3JXV A;  1ZK6 A;  3UI5 A;  3PA7 A;  1QPF A;  3NRK A;  1U79 A;  3EY6 A;  1D7I A;  2ZR5 A;  4DRI A;  5HWB A;  4ITZ A;  1QZ2 A;  2PV1 A;  1KT1 A;  4JYS A;  2KR7 A;  2PPP A;  5DIV A;  1BL4 A;  1FKG A;  4FN2 A;  2XPB A;  2UZ5 A;  3KAC A;  1ROT A;  5I98 A;  1T11 A;  2KO7 A;  2F21 A;  3O5L A;  4TX0 A;  1F40 A;  3JYJ A;  4JFI A;  2K8I A;  4N19 A;  5HT1 A;  3KAH A;  1YAT A;  2MLX A;  3CGN A;  3O5K A;  4U86 A;  3IHZ A;  1FKJ A;  2PBC A;  2ZQU A;  4LAX A;  1KT0 A;  5HKG A;  1P5Q A;  2XP9 A;  4DRH A;  3IK8 A;  4J4N A;  5BXJ A;  3O5O A;  1FAP A;  2ITK A;  4G2P A;  1J4R A;  4IPX A;  2F2D A;  4BF8 A;  2M1I A;  2VCD A;  5HW7 A;  4DIP A;  2D9F A;  1W26 A;  5D75 A;  1EYM A;  5HTG A;  3UI6 A;  4FAP A;  2KFW A;  1NSG A;  2ZQS A;  3PRD A;  4DT4 A;  1D7H A;  2F4E A;  2M08 A;  1FKT A;  4IQ2 A;  3O5E A;  2RSE A;  4GIV A;  2OFN A;  5GPG A;  3NTP A;  4QT2 A;  1FKS A;  4DRP A;  1B6C A;  2PPN A;  1Q6I A;  4W9O A;  3NI6 A;  4J4O A;  3GPK A;  3RFW A;  2KE0 A;  4DZ2 A;  2LKN A;  4W9Q A;  3UQB A;  2IF4 A;  2KI3 A;  3KAG A;  3UI4 A;  3UQI A;  1FKH A;  3KAD A;  4DZ3 A;  4JFJ A;  3H9R B;  3O5F A;  3TC5 A;  2XP7 A;  3B7X A;  2XP3 A;  1Q6U A;  2VN1 A;  3O5I A;  4IQC A;  3MDY B;  1FKI A;  2N87 A;  2Y78 A;  2MPH A;  1ZCN A;  2ZR6 A;  3KZ7 A;  2ZQV A;  1N1A A;  1YW5 A;  4ODN A;  4DRN A;  2XP4 A;  2DG3 A;  1J4H A;  1JNT A;  3ODK A;  2Q5A A;  4QT3 A;  1L1P A;  5DIT A;  1F8A B;  4DRJ A;  2M2A A;  3JYM A;  1PBK A;  2PV3 A;  3RGC A;  1PIN A;  5HW6 A;  2PV2 A;  4DRO A;  3O5R A;  3O5D A;  1FKL A;  1D6O A;  2FAP A;  3UF8 A;  1QPL A;  2LJ4 A;  4DH0 A;  4DRK A;  2DG9 A;  3KAI A;  1FKK A;  2RUD A;  1Q6H A;  3O5M A;  4U84 A;  1Y0O A;  2MF9 A;  4W9P A;  3UQA A;  1M5Y A;  1FKF A;  5HWC A;  4MGV A;  1FJD A;  4TW7 A;  2MLY A;  3KCE A;  4GGQ A;  2XP8 A;  1EQ3 A;  4TYO A;  4JFM A;  4LAW A;  1J4I A;  3TDB A;  1BKF A;  4ODQ A;  1R9H A;  4NNR A;  3O5P A;  4TW6 A;  3O5J A;  1JVW A;  4ODK A;  5J6E A;  5DIU A;  4DRQ A;  1FKR A;  1FKB A;  1NMW A;  5HW8 A;  4JFK A;  4C02 B;  3TCZ A;  3LUO A; 
#chains in the Genus database with same CATH topology
 4O2T A;  1HKI A;  4ODR A;  2RUQ A;  1E44 A;  1A7X A;  2DSZ A;  1IX5 A;  1ROU A;  1C9H A;  4L72 B;  1H0G A;  2ZQT A;  2LGO A;  4ODM A;  2B31 A;  3WKZ A;  2G8Z A;  3PRB A;  4W5U A;  3ALG A;  1EHN A;  2A3A A;  3KAB A;  1VF8 A;  5DO2 A;  3FAP A;  3FY1 A;  3QOK A;  1KFW A;  5HWB A;  1QZ2 A;  4JYS A;  5I98 A;  2P4V A;  3O5L A;  2F21 A;  4N19 A;  2K8I A;  1WB0 A;  3ARO A;  1FKJ A;  1E9L A;  2ZQU A;  1E15 A;  4DRH A;  1TFV A;  3O5O A;  4IPX A;  4BF8 A;  1JND A;  3ARQ A;  4QZV B;  3OA5 A;  4DIP A;  5HTG A;  4KR0 B;  4FAP A;  2KFW A;  1HJV A;  2IUZ A;  3CHE A;  3NTP A;  4QT2 A;  1GUV A;  4P8X A;  1B6C A;  4Z2K A;  1LQ0 A;  4Z2L A;  2LKN A;  3KAG A;  4DZ3 A;  3TC5 A;  1FKI A;  4ZPW R;  1XRV A;  1ZCN A;  1N1A A;  3AS1 A;  2XP4 A;  2O92 A;  1J4H A;  1E6N A;  3ODK A;  1GOI A;  4QT3 A;  1JNE A;  2M2A A;  5HW6 A;  2PV2 A;  4P8U A;  4DRO A;  1OGG A;  3O5R A;  3UF8 A;  1D2K A;  3CHD A;  4DH0 A;  4UDM A;  1LG1 A;  1Q6H A;  2O9O A;  5HWC A;  4TW7 A;  2ETN A;  1EQ3 A;  2XP8 A;  3ARZ A;  4JFM A;  3TDB A;  1JVW A;  4DRQ A;  1FKB A;  2EUL A;  4Z2H A;  4C02 B;  2G41 A;  4ZS6 A;  4ZPT R;  4WKF A;  5HUA A;  2LPV A;  4U85 A;  3IKG A;  2F23 A;  3WL1 A;  4LAV A;  1LG2 A;  1FD9 A;  3G6L A;  2WLY A;  2DT3 A;  2JZV A;  2DSW A;  3EIP A;  3CHF A;  1FKD A;  1ZBV A;  5HBF A;  2L2S A;  1NWT A;  1X6N A;  4TW8 A;  3ARY A;  4LAY A;  1CTN A;  4ZPV R;  4DWS B;  3RM8 A;  4WJX A;  4Z2G A;  4PTM A;  2MLZ A;  3OOB A;  1LL6 A;  2XPA A;  3O5G A;  2RUR A;  1UR9 A;  3PA7 A;  1D7I A;  4DWS C;  4DRI A;  4URI A;  5DEZ A;  2WLZ A;  2WM0 A;  1NH6 A;  1T11 A;  2KO7 A;  4TX0 A;  3JYJ A;  3WD1 A;  1YAT A;  3IHZ A;  4IT6 A;  5HKG A;  1NWR A;  1P5Q A;  1J4R A;  1W1T A;  2F2D A;  2M1I A;  2VCD A;  2D9F A;  1W26 A;  5D75 A;  3PRD A;  1NSG A;  4DT4 A;  4AY1 A;  1FKT A;  4P8W A;  4S3J A;  3RM9 A;  4GIV A;  4DRP A;  1FKS A;  2DT1 A;  3RFW A;  3GPK A;  3CHC A;  2KE0 A;  4DZ2 A;  1LL7 A;  2IF4 A;  3UQI A;  2DPE A;  3KAD A;  1HKJ A;  4JFJ A;  3H9R B;  4R5E A;  2XP7 A;  1K9T A;  2XP3 A;  2VN1 A;  3CZ8 A;  2N87 A;  2Y78 A;  2MPH A;  2ZR6 A;  3WD2 A;  2ZQV A;  1OWQ A;  1ZB5 A;  1JNT A;  5DIT A;  1F8A B;  3B8S A;  2PN0 A;  3ARX A;  4MPK A;  5JH8 A;  1D6O A;  1QPL A;  1Y0O A;  3UQA A;  2YBU A;  1FJD A;  4WKA A;  2MLY A;  3B9E A;  4GGQ A;  1SR0 A;  4ODQ A;  3O5P A;  4TW6 A;  4MNM A;  1W9U A;  2RQS A;  4ODL A;  2WK2 A;  1J6Y A;  2PPO A;  2ZR4 A;  1JNS A;  3ARR A;  1ZU8 A;  4WK9 A;  1NWS A;  3WIJ A;  1TCO C;  1UR8 A;  4JFL A;  4P8V A;  2AWG A;  4ODO A;  4MSP A;  1H0I A;  4G50 A;  4R0X A;  2XP5 A;  4TNS A;  1E6Z A;  3ARV A;  1Q1C A;  1GRJ A;  3WQV A;  3RM4 A;  3WH0 A;  1GPF A;  2FKE A;  3KAF A;  4ODP A;  2FDM A;  2MNT A;  3I6C A;  3JXV A;  4WKH A;  1ZK6 A;  3UI5 A;  3NRK A;  1U79 A;  1ZBW A;  2ZR5 A;  1O6I A;  4ITZ A;  2PV1 A;  1KT1 A;  4LGX A;  2KR7 A;  2PPP A;  3AS3 A;  1BL4 A;  3ART A;  5DIV A;  2UZ5 A;  1ROT A;  1E6R A;  4JFI A;  4Z2J A;  1FFR A;  3KAH A;  1W1P A;  3CGN A;  3O5K A;  4LAX A;  3GTY X;  3IK8 A;  4J4N A;  2OLH A;  1FAP A;  2ITK A;  3AQU A;  1EYM A;  3UI6 A;  2ZQS A;  1D7H A;  1W1Y A;  4ML4 A;  2M08 A;  4MNJ A;  4MAV A;  1Q6I A;  3NI6 A;  4J4O A;  2A3E A;  2QF8 A;  4NSB A;  1FFQ A;  3UQB A;  1E6P A;  3ALF A;  3O5F A;  5DF0 A;  1Q6U A;  3O5I A;  1W1V A;  5GPR A;  4DRN A;  2DG3 A;  4XAK A;  4Z2I A;  4DRJ A;  1NWU A;  1PBK A;  3RGC A;  4NZC A;  3O5D A;  3AS2 A;  4Q7N A;  4DWS D;  3KAI A;  1FKK A;  2RUD A;  4U84 A;  4MGV A;  3KCE A;  1J4I A;  4IT4 A;  1BKF A;  1R9H A;  4HBO A;  1ZL1 A;  3ARP A;  3BXW A;  4NNR A;  5DIU A;  1NMW A;  1HKM A;  3WD4 A;  4MNK A;  4QIB A;  1W9V A;  2RUC A;  1HKK A;  4MTV A;  2YBT A;  5B8I C;  4DRM A;  1D7J A;  3W4R A;  2DT2 A;  1NMV A;  3PRA A;  1SYT A;  4KQZ A;  2AOS A;  3WD0 A;  3IKD A;  4Q22 A;  3O5Q A;  3CGM A;  2XP6 A;  3VAW A;  1HXV A;  4HBE A;  2DG4 A;  1ITX A;  2KGJ A;  3WQW A;  4L3N A;  1QPF A;  1XHG A;  3EY6 A;  4MNL A;  1FKG A;  4FN2 A;  1JCH B;  2XPB A;  3WL0 A;  3KAC A;  4DWS A;  3G6M A;  5GQB A;  1F40 A;  5HT1 A;  2ESC A;  2MLX A;  4U86 A;  3B9D A;  2PBC A;  1KT0 A;  2XP9 A;  1HJX A;  4HAR A;  1WAW A;  5BXJ A;  4G2P A;  4S3K A;  5HW7 A;  3BMB A;  2F4E A;  4IQ2 A;  3O5E A;  2RSE A;  2OFN A;  5GPG A;  2PPN A;  4W9O A;  3RME A;  1EIB A;  1WNO A;  4W9Q A;  2KI3 A;  3UI4 A;  1FKH A;  3PR9 A;  3B7X A;  4IQC A;  3GU0 A;  3MDY B;  2A3C A;  1W9P A;  1ZBC A;  3KZ7 A;  3FXY A;  3WD3 A;  1YW5 A;  2A3B A;  3CH9 A;  4ODN A;  1EDQ A;  1LJY A;  2Q5A A;  1L1P A;  3ARU A;  1RD6 A;  3JYM A;  1X6L A;  2PV3 A;  1PIN A;  1OGB A;  3B9A A;  1FKL A;  2FAP A;  2B5U B;  2LJ4 A;  4DRK A;  2DG9 A;  4WIW A;  3O5M A;  2MF9 A;  4W9P A;  1M5Y A;  1FKF A;  2DSU A;  4TYO A;  4LAW A;  1ZBK A;  1LL4 A;  3ARW A;  3O5J A;  4ODK A;  5J6E A;  1HJW A;  2DSV A;  2DT0 A;  3ARS A;  1FKR A;  2PI6 A;  5HW8 A;  4JFK A;  3TCZ A;  3AS0 A;  3LUO A; 
#chains in the Genus database with same CATH homology
 4O2T A;  1HKI A;  4ODR A;  2RUQ A;  1A7X A;  2DSZ A;  1IX5 A;  1ROU A;  1C9H A;  4L72 B;  1H0G A;  2ZQT A;  2LGO A;  4ODM A;  2B31 A;  3WKZ A;  2G8Z A;  3PRB A;  4W5U A;  3ALG A;  1EHN A;  2A3A A;  3KAB A;  1VF8 A;  5DO2 A;  3FAP A;  3FY1 A;  3QOK A;  1KFW A;  5HWB A;  1QZ2 A;  4JYS A;  5I98 A;  3O5L A;  2F21 A;  4N19 A;  2K8I A;  1WB0 A;  3ARO A;  1FKJ A;  1E9L A;  2ZQU A;  1E15 A;  4DRH A;  1TFV A;  3O5O A;  4IPX A;  4BF8 A;  1JND A;  3ARQ A;  4QZV B;  3OA5 A;  4DIP A;  5HTG A;  4KR0 B;  4FAP A;  2KFW A;  1HJV A;  2IUZ A;  3CHE A;  3NTP A;  4QT2 A;  1GUV A;  4P8X A;  1B6C A;  4Z2K A;  1LQ0 A;  4Z2L A;  2LKN A;  3KAG A;  4DZ3 A;  3TC5 A;  1FKI A;  4ZPW R;  1XRV A;  1ZCN A;  1N1A A;  3AS1 A;  2XP4 A;  2O92 A;  1J4H A;  1E6N A;  3ODK A;  1GOI A;  4QT3 A;  1JNE A;  2M2A A;  5HW6 A;  2PV2 A;  4P8U A;  4DRO A;  1OGG A;  3O5R A;  3UF8 A;  1D2K A;  3CHD A;  4DH0 A;  1LG1 A;  1Q6H A;  2O9O A;  5HWC A;  4TW7 A;  1EQ3 A;  2XP8 A;  3ARZ A;  4JFM A;  3TDB A;  1JVW A;  4DRQ A;  1FKB A;  4Z2H A;  4C02 B;  2G41 A;  4ZS6 A;  4ZPT R;  4WKF A;  5HUA A;  2LPV A;  4U85 A;  3IKG A;  3WL1 A;  4LAV A;  1LG2 A;  1FD9 A;  3G6L A;  2WLY A;  2DT3 A;  2JZV A;  2DSW A;  3CHF A;  1FKD A;  1ZBV A;  5HBF A;  2L2S A;  1NWT A;  1X6N A;  4TW8 A;  3ARY A;  4LAY A;  1CTN A;  4ZPV R;  4DWS B;  3RM8 A;  4WJX A;  4Z2G A;  4PTM A;  2MLZ A;  3OOB A;  1LL6 A;  2XPA A;  3O5G A;  2RUR A;  1UR9 A;  3PA7 A;  1D7I A;  4DWS C;  4DRI A;  4URI A;  5DEZ A;  2WLZ A;  2WM0 A;  1NH6 A;  1T11 A;  2KO7 A;  4TX0 A;  3JYJ A;  3WD1 A;  1YAT A;  3IHZ A;  4IT6 A;  5HKG A;  1NWR A;  1P5Q A;  1J4R A;  1W1T A;  2F2D A;  2M1I A;  2VCD A;  2D9F A;  1W26 A;  5D75 A;  3PRD A;  1NSG A;  4DT4 A;  4AY1 A;  1FKT A;  4P8W A;  4S3J A;  3RM9 A;  4GIV A;  4DRP A;  1FKS A;  2DT1 A;  3RFW A;  3GPK A;  3CHC A;  2KE0 A;  4DZ2 A;  1LL7 A;  2IF4 A;  3UQI A;  2DPE A;  3KAD A;  1HKJ A;  4JFJ A;  3H9R B;  4R5E A;  2XP7 A;  1K9T A;  2XP3 A;  2VN1 A;  3CZ8 A;  2N87 A;  2Y78 A;  2MPH A;  2ZR6 A;  3WD2 A;  2ZQV A;  1OWQ A;  1ZB5 A;  1JNT A;  5DIT A;  1F8A B;  3B8S A;  3ARX A;  4MPK A;  5JH8 A;  1D6O A;  1QPL A;  1Y0O A;  3UQA A;  2YBU A;  1FJD A;  4WKA A;  2MLY A;  3B9E A;  4GGQ A;  1SR0 A;  4ODQ A;  3O5P A;  4TW6 A;  4MNM A;  1W9U A;  2RQS A;  4ODL A;  2WK2 A;  1J6Y A;  2PPO A;  2ZR4 A;  1JNS A;  3ARR A;  1ZU8 A;  4WK9 A;  1NWS A;  3WIJ A;  1TCO C;  1UR8 A;  4JFL A;  4P8V A;  2AWG A;  4ODO A;  4MSP A;  1H0I A;  4G50 A;  4R0X A;  2XP5 A;  4TNS A;  1E6Z A;  3ARV A;  1Q1C A;  3WQV A;  3RM4 A;  3WH0 A;  1GPF A;  2FKE A;  3KAF A;  4ODP A;  2FDM A;  2MNT A;  3I6C A;  3JXV A;  4WKH A;  1ZK6 A;  3UI5 A;  3NRK A;  1U79 A;  1ZBW A;  2ZR5 A;  1O6I A;  4ITZ A;  2PV1 A;  1KT1 A;  4LGX A;  2KR7 A;  2PPP A;  3AS3 A;  1BL4 A;  3ART A;  5DIV A;  2UZ5 A;  1ROT A;  1E6R A;  4JFI A;  4Z2J A;  1FFR A;  3KAH A;  1W1P A;  3CGN A;  3O5K A;  4LAX A;  3IK8 A;  4J4N A;  2OLH A;  1FAP A;  2ITK A;  3AQU A;  1EYM A;  3UI6 A;  2ZQS A;  1D7H A;  1W1Y A;  4ML4 A;  2M08 A;  4MNJ A;  4MAV A;  1Q6I A;  3NI6 A;  4J4O A;  2A3E A;  2QF8 A;  4NSB A;  1FFQ A;  3UQB A;  1E6P A;  3ALF A;  3O5F A;  5DF0 A;  1Q6U A;  3O5I A;  1W1V A;  5GPR A;  4DRN A;  2DG3 A;  4XAK A;  4Z2I A;  4DRJ A;  1NWU A;  1PBK A;  3RGC A;  4NZC A;  3O5D A;  3AS2 A;  4Q7N A;  4DWS D;  3KAI A;  1FKK A;  2RUD A;  4U84 A;  4MGV A;  3KCE A;  1J4I A;  4IT4 A;  1BKF A;  1R9H A;  4HBO A;  1ZL1 A;  3ARP A;  3BXW A;  4NNR A;  5DIU A;  1NMW A;  1HKM A;  3WD4 A;  4MNK A;  4QIB A;  1W9V A;  2RUC A;  1HKK A;  4MTV A;  2YBT A;  5B8I C;  4DRM A;  1D7J A;  3W4R A;  2DT2 A;  1NMV A;  3PRA A;  1SYT A;  4KQZ A;  2AOS A;  3WD0 A;  3IKD A;  4Q22 A;  3O5Q A;  3CGM A;  2XP6 A;  3VAW A;  1HXV A;  4HBE A;  2DG4 A;  1ITX A;  2KGJ A;  3WQW A;  4L3N A;  1QPF A;  1XHG A;  3EY6 A;  4MNL A;  1FKG A;  4FN2 A;  3WL0 A;  2XPB A;  3KAC A;  4DWS A;  3G6M A;  5GQB A;  1F40 A;  5HT1 A;  2ESC A;  2MLX A;  4U86 A;  3B9D A;  2PBC A;  1KT0 A;  2XP9 A;  1HJX A;  4HAR A;  1WAW A;  5BXJ A;  4G2P A;  4S3K A;  5HW7 A;  2F4E A;  4IQ2 A;  3O5E A;  2RSE A;  2OFN A;  5GPG A;  2PPN A;  4W9O A;  3RME A;  1EIB A;  1WNO A;  4W9Q A;  2KI3 A;  3UI4 A;  1FKH A;  3PR9 A;  4IQC A;  3B7X A;  3MDY B;  2A3C A;  1W9P A;  1ZBC A;  3KZ7 A;  3FXY A;  3WD3 A;  1YW5 A;  2A3B A;  3CH9 A;  4ODN A;  1EDQ A;  1LJY A;  2Q5A A;  1L1P A;  3ARU A;  1RD6 A;  3JYM A;  1X6L A;  2PV3 A;  1PIN A;  1OGB A;  3B9A A;  1FKL A;  2FAP A;  2LJ4 A;  4DRK A;  2DG9 A;  4WIW A;  3O5M A;  2MF9 A;  4W9P A;  1M5Y A;  1FKF A;  2DSU A;  4TYO A;  4LAW A;  1ZBK A;  1LL4 A;  3ARW A;  3O5J A;  4ODK A;  5J6E A;  1HJW A;  2DSV A;  2DT0 A;  3ARS A;  1FKR A;  2PI6 A;  5HW8 A;  4JFK A;  3TCZ A;  3AS0 A;  3LUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...