5HUAA

Structure of c. glabrata fkbp12-fk506 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
SETIEGGVKIDRLSPGDGKTFPKQGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATLIFDVELLKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida glabrata (strain atcc 2001 / cbs 138 / jcm 3761 / nbrc 0622 / nrrl y-65)
total genus 27
structure length 113
sequence length 113
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5huaA00
3O5EA 1N1AA 2PPPA 2JZVA 2PPNA 4BF8A 1BKFA 2ZQUA 1YATA 4QT2A 2PV3A 4DRQA 2MPHA 1FKJA 1FKRA 1FKTA 3JYJA 3ODKA 1KT0A 5HT1A 1FKBA 2KFWA 2RURA 1D7HA 4IQCA 1QPFA 4DIPA 2XP6A 3NTPA 5BXJA 3KAGA 4LAYA 1NSGA 4JFIA 3FAPA 4C02B 1FKGA 1L1PA 3EY6A 5HW7A 2ZR6A 1ZK6A 1F8AB 1C9HA 2M08A 1T11A 3KAFA 2D9FA 1R9HA 3TC5A 4FN2A 5HWBA 3I6CA 5D75A 2XP4A 2RQSA 2FKEA 4LAWA 5HTGA 1D6OA 2MLYA 2PV1A 4ODKA 5GPGA 4JYSA 4ODRA 1KT1A 5HW8A 1U79A 5HUAA 4TW6A 1F40A 2N87A 3UF8A 1D7IA 2ZQTA 4JFKA 2M1IA 3GPKA 4FAPA 2F21A 5DIUA 3RFWA 3O5LA 3CGNA 4TNSA 2PPOA 2MF9A 5B8IC 3TCZA 1FD9A 3PRDA 4ODPA 1HXVA 2XPBA 4U86A 3IHZA 3O5JA 3O5KA 4J4OA 4ODOA 4G2PA 3UI6A 2MLZA 4R0XA 3PRBA 5HW6A 3UQIA 2LKNA 3O5MA 3KAHA 2FAPA 3LUOA 3NI6A 1M5YA 1YW5A 2MLXA 2VN1A 4U85A 2KR7A 2RUDA 4W9PA 5DIVA 1D7JA 4DT4A 3O5GA 4GIVA 4DRJA 1FAPA 2F2DA 2PV2A 2XP7A 3IKGA 2VCDA 4TX0A 3UQBA 2XP3A 4JFLA 1FKDA 2XPAA 3JXVA 2F4EA 2Q5AA 4GGQA 4ITZA 2XP9A 2XP5A 1FJDA 4O2TA 5HWCA 3MDYB 3O5FA 3H9RB 3KZ7A 4LAXA 2LGOA 2L2SA 1J4IA 3KADA 4DZ2A 3IK8A 1EQ3A 4JFMA 1FKHA 3B7XA 1TCOC 4IPXA 2LPVA 4DRMA 3JYMA 4JFJA 2LJ4A 1FKLA 2XP8A 1QPLA 2Y78A 3CGMA 3KAIA 1Q6IA 3O5PA 1NMVA 2KO7A 2ZR4A 3PA7A 2ITKA 2UZ5A 4DRPA 3IKDA 4TW8A 5DITA 2KGJA 4DRNA 2OFNA 2DG4A 2DG3A 1ROTA 3NRKA 3O5OA 4U84A 2ZQSA 3O5RA 4N19A 5HKGA 3TDBA 3UQAA 1EYMA 2ZQVA 4DRKA 1FKFA 5I98A 2KE0A 4ODNA 4DZ3A 3O5QA 1Y0OA 4QT3A 4DRHA 1FKSA 1P5QA 3KCEA 2M2AA 3KABA 2K8IA 2PBCA 2IF4A 4ODQA 4TW7A 4QIBA 4W9QA 1NMWA 4W9OA 2DG9A 4ODLA 4DH0A 4IQ2A 1BL4A 2RSEA 1JNSA 2RUCA 1FKKA 3UI5A 4DRIA 3UI4A 1JVWA 1QZ2A 4G50A 1ZCNA 4LAVA 4ODMA 1A7XA 1Q1CA 1Q6HA 4MGVA 3WH0A 1JNTA 4DROA 1J6YA 3O5IA 4TYOA 1J4HA 2KI3A 3OOBA 4J4NA 1W26A 1FKIA 1PBKA 2MNTA 3RGCA 3KACA 1B6CA 5J6EA 2ZR5A 1Q6UA 3VAWA 4NNRA 1J4RA 4MSPA 1PINA 2AWGA 2RUQA 3O5DA 1ROUA
chains in the Genus database with same CATH superfamily
3CH9A 2PPPA 1HKJA 4HBOA 4MNLA 2G41A 2PV3A 4DRQA 2MPHA 1E6ZA 1W1PA 2KFWA 4IQCA 1RD6A 3B9DA 4URIA 2XP6A 3NTPA 4ZPTR 2P4VA 4C02B 3WL0A 3EY6A 3ARXA 3B9EA 1ZK6A 2M08A 3FY1A 1R9HA 3TC5A 4P8XA 1HKKA 2RQSA 1SR0A 4WKAA 2EULA 4TW6A 2N87A 1HJXA 4WK9A 4Q7NA 1X6NA 3RFWA 4MNKA 4ODPA 1WB0A 1HXVA 4U86A 5DF0A 3O5KA 2G8ZA 4ODOA 4Z2HA 1EHNA 4R5EA 4QZVB 4W5UA 1KFWA 1LL7A 1XHGA 1EIBA 2FAPA 1HKIA 3NI6A 2MLXA 2RUDA 2F23A 2PN0A 1D7JA 3O5GA 4DRJA 2F2DA 1OWQA 2VCDA 1VF8A 1OGGA 2XP3A 2XPAA 3AS3A 2F4EA 4JFLA 3AQUA 1LG1A 1ZL1A 2XP5A 1ZU8A 3G6MA 3WD3A 2ESCA 3H9RB 3IK8A 4DWSC 1FKHA 1TCOC 4DRMA 5HWBA 3O5PA 1NMVA 4MNJA 5DITA 3NRKA 2ZQSA 1W1VA 3AS2A 3WKZA 3UQAA 3WD0A 4DRKA 4Z2LA 1H0GA 1Y0OA 3KCEA 4TW7A 4QIBA 2FDMA 4IT4A 2RSEA 1FKKA 4HBEA 1E6PA 1OGBA 4Z2GA 4LAVA 1Q1CA 4NSBA 4NZCA 3O5IA 4DWSD 3ALFA 3RGCA 3KACA 4Q22A 1NWSA 1WAWA 1ROUA 1UR8A 4JYSA 2PPNA 2WLYA 1BKFA 2A3AA 1K9TA 3AS0A 4QT2A 1FKJA 1FKRA 3JYJA 3ODKA 5BXJA 3WL1A 4LAYA 3G6LA 4JFIA 1L1PA 1FKGA 5HW7A 1GUVA 1SYTA 1T11A 3KAFA 2DT1A 3ARQA 1XRVA 4IT6A 4LAWA 3EIPA 5HTGA 2MLYA 2DSUA 1F40A 3UF8A 3WD2A 4JFKA 2QF8A 3O5LA 3CGNA 4TNSA 3RM8A 1ZBKA 2MF9A 4ZPVR 3TCZA 3PRDA 2XPBA 3IHZA 3UI6A 4G2PA 2LKNA 5GQBA 3ARUA 2VN1A 4W9PA 1W9VA 3CHCA 5JH8A 2DSWA 1ZBCA 2XP7A 3GTYX 4TX0A 3CHDA 1FKDA 3WQWA 1X6LA 2XP9A 2A3BA 3KZ7A 4JFMA 3B7XA 4IPXA 2LPVA 2LJ4A 5DIVA 4DRPA 2DG4A 3O5OA 4S3KA 3CZ8A 3ARRA 1EYMA 2ZQVA 1FKFA 4DZ3A 2IF4A 4W9QA 1NMWA 4W9OA 4DH0A 4ML4A 1TFVA 1BL4A 1JNSA 2RUCA 3WQVA 2DPEA 1H0IA 3UI4A 1EDQA 3ALGA 3B9AA 1Q6HA 4PTMA 2WK2A 1J4HA 3ARSA 1FKIA 1Q6UA 1HKMA 3BMBA 3O5EA 1N1AA 3BXWA 2ZQUA 1YATA 1ZB5A 4DWSB 1FKTA 1KT0A 2RURA 1QPFA 4DIPA 1HJVA 3FAPA 2IUZA 2O92A 1LL4A 2ZR6A 4L3NA 3WD1A 1W9PA 5D75A 2XP4A 2FKEA 2B31A 2PV1A 5HUAA 1U79A 1D7IA 1JNEA 4MTVA 2M1IA 2F21A 5DIUA 3WD4A 4LGXA 1FD9A 1NWTA 2PI6A 4P8VA 1LJYA 4P8WA 5HW6A 3O5MA 4KQZA 3KAHA 1ITXA 3LUOA 1LG2A 1M5YA 1YW5A 4U85A 4GIVA 1FAPA 2PV2A 3UQBA 1JNDA 3JXVA 2O9OA 1FJDA 4O2TA 5HWCA 4LAXA 4DZ2A 1EQ3A 2AOSA 2DSZA 3JYMA 4JFJA 1FKLA 2XP8A 1QPLA 5HBFA 4P8UA 2ITKA 1NWRA 4TW8A 1NH6A 1CTNA 2OFNA 3PRAA 2B5UB 4U84A 4N19A 1E44A 4ZPWR 4QT3A 1W1TA 2WM0A 3KABA 4ODQA 2YBTA 4MNMA 1GPFA 3ARZA 3UI5A 1JVWA 1QZ2A 1ZCNA 2OLHA 3WH0A 3ARPA 1JNTA 4Z2KA 4TYOA 2DT0A 3OOBA 3ARVA 4J4NA 1W26A 5GPRA 2MNTA 1B6CA 5J6EA 4NNRA 4S3JA 3ARYA 1J4RA 4MSPA 1PINA 1KT1A 2AWGA 2RUQA 3O5DA 3ARWA 5DO2A 2JZVA 4BF8A 3W4RA 1E15A 1ZBWA 1E6NA 4ZS6A 4XAKA 3AS1A 5HT1A 1FKBA 1D7HA 3KAGA 1FFRA 1NSGA 2DT3A 1F8AB 1C9HA 2D9FA 4DWSA 4FN2A 3I6CA 2YBUA 1D6OA 4ODKA 4HARA 3ARTA 5GPGA 4ODRA 5HW8A 1HJWA 3CHFA 2ZQTA 3GPKA 2DT2A 4FAPA 2PPOA 4WIWA 4UDMA 5B8IC 3GU0A 3O5JA 4J4OA 3RM9A 3QOKA 2MLZA 1GRJA 4R0XA 1D2KA 3PRBA 3UQIA 1LL6A 4AY1A 4Z2JA 4MPKA 1LQ0A 1JCHB 3AROA 2KR7A 4DT4A 4WKHA 2WLZA 1IX5A 3IKGA 1E6RA 1E9LA 4ITZA 2Q5AA 2A3CA 4GGQA 3MDYB 3O5FA 4L72B 2LGOA 2L2SA 1J4IA 3KADA 4WKFA 4KR0B 3RMEA 2DSVA 2Y78A 3KAIA 3CGMA 3PA7A 1Q6IA 2ZR4A 2KO7A 2UZ5A 1GOIA 3IKDA 3PR9A 2KGJA 4DRNA 1NWUA 2DG3A 1ROTA 1WNOA 3O5RA 5HKGA 3TDBA 4MAVA 4WJXA 3B8SA 5I98A 2A3EA 2KE0A 4ODNA 3O5QA 4DRHA 1FKSA 1P5QA 3FXYA 2M2AA 4Z2IA 2K8IA 2PBCA 2DG9A 1O6IA 4ODLA 4IQ2A 1ZBVA 3CHEA 3WIJA 4DRIA 3RM4A 5DEZA 4G50A 4ODMA 1A7XA 4DROA 4MGVA 1J6YA 3OA5A 1FFQA 2KI3A 1PBKA 1W9UA 1UR9A 2ZR5A 3VAWA 1W1YA 2ETNA
chains in the Genus database with same CATH topology
3CH9A 2PPPA 1HKJA 4HBOA 4MNLA 2G41A 2PV3A 4DRQA 2MPHA 1E6ZA 1W1PA 2KFWA 4IQCA 1RD6A 3B9DA 4URIA 2XP6A 3NTPA 4ZPTR 4C02B 3WL0A 3EY6A 3ARXA 3B9EA 1ZK6A 2M08A 3FY1A 1R9HA 3TC5A 4P8XA 1HKKA 2RQSA 1SR0A 4WKAA 4TW6A 2N87A 1HJXA 4WK9A 4Q7NA 1X6NA 3RFWA 4MNKA 4ODPA 1WB0A 1HXVA 4U86A 5DF0A 3O5KA 2G8ZA 4ODOA 4Z2HA 1EHNA 4R5EA 4QZVB 4W5UA 1KFWA 1LL7A 1XHGA 1EIBA 2FAPA 1HKIA 3NI6A 2MLXA 2RUDA 1D7JA 3O5GA 4DRJA 2F2DA 1OWQA 2VCDA 1VF8A 1OGGA 2XP3A 2XPAA 3AS3A 2F4EA 4JFLA 3AQUA 1LG1A 1ZL1A 2XP5A 1ZU8A 3G6MA 3WD3A 2ESCA 3H9RB 3IK8A 4DWSC 1FKHA 1TCOC 4DRMA 5HWBA 3O5PA 1NMVA 4MNJA 5DITA 3NRKA 2ZQSA 1W1VA 3AS2A 3WKZA 3UQAA 3WD0A 4DRKA 4Z2LA 1H0GA 1Y0OA 3KCEA 4TW7A 4QIBA 2FDMA 4IT4A 2RSEA 1FKKA 4HBEA 1E6PA 1OGBA 4Z2GA 4LAVA 1Q1CA 4NSBA 4NZCA 3O5IA 4DWSD 3ALFA 3RGCA 3KACA 4Q22A 1NWSA 1WAWA 1ROUA 1UR8A 4JYSA 2PPNA 2WLYA 1BKFA 2A3AA 1K9TA 3AS0A 4QT2A 1FKJA 1FKRA 3JYJA 3ODKA 5BXJA 3WL1A 4LAYA 3G6LA 4JFIA 1L1PA 1FKGA 5HW7A 1GUVA 1SYTA 1T11A 3KAFA 2DT1A 3ARQA 1XRVA 4IT6A 4LAWA 5HTGA 2MLYA 2DSUA 1F40A 3UF8A 3WD2A 4JFKA 2QF8A 3O5LA 3CGNA 4TNSA 3RM8A 1ZBKA 2MF9A 4ZPVR 3TCZA 3PRDA 2XPBA 3IHZA 3UI6A 4G2PA 2LKNA 5GQBA 3ARUA 2VN1A 4W9PA 1W9VA 3CHCA 5JH8A 2DSWA 1ZBCA 2XP7A 4TX0A 3CHDA 1FKDA 3WQWA 1X6LA 2XP9A 2A3BA 3KZ7A 4JFMA 3B7XA 4IPXA 2LPVA 2LJ4A 5DIVA 4DRPA 2DG4A 3O5OA 4S3KA 3CZ8A 3ARRA 1EYMA 2ZQVA 1FKFA 4DZ3A 2IF4A 4W9QA 1NMWA 4W9OA 4DH0A 4ML4A 1TFVA 1BL4A 1JNSA 2RUCA 3WQVA 2DPEA 1H0IA 3UI4A 1EDQA 3ALGA 3B9AA 1Q6HA 4PTMA 2WK2A 1J4HA 3ARSA 1FKIA 1Q6UA 1HKMA 3O5EA 1N1AA 3BXWA 2ZQUA 1YATA 1ZB5A 4DWSB 1FKTA 1KT0A 2RURA 1QPFA 4DIPA 1HJVA 3FAPA 2IUZA 2O92A 1LL4A 2ZR6A 4L3NA 3WD1A 1W9PA 5D75A 2XP4A 2FKEA 2B31A 2PV1A 5HUAA 1U79A 1D7IA 1JNEA 4MTVA 2M1IA 2F21A 5DIUA 3WD4A 4LGXA 1FD9A 1NWTA 2PI6A 4P8VA 1LJYA 4P8WA 5HW6A 3O5MA 4KQZA 3KAHA 1ITXA 3LUOA 1LG2A 1M5YA 1YW5A 4U85A 4GIVA 1FAPA 2PV2A 3UQBA 1JNDA 3JXVA 2O9OA 1FJDA 4O2TA 5HWCA 4LAXA 4DZ2A 1EQ3A 2AOSA 2DSZA 3JYMA 4JFJA 1FKLA 2XP8A 1QPLA 5HBFA 4P8UA 2ITKA 1NWRA 4TW8A 1NH6A 1CTNA 2OFNA 3PRAA 4U84A 4N19A 4ZPWR 4QT3A 1W1TA 2WM0A 3KABA 4ODQA 2YBTA 4MNMA 1GPFA 3ARZA 3UI5A 1JVWA 1QZ2A 1ZCNA 2OLHA 3WH0A 3ARPA 1JNTA 4Z2KA 4TYOA 2DT0A 3OOBA 3ARVA 4J4NA 1W26A 5GPRA 2MNTA 1B6CA 5J6EA 4NNRA 4S3JA 3ARYA 1J4RA 4MSPA 1PINA 1KT1A 2AWGA 2RUQA 3O5DA 3ARWA 5DO2A 2JZVA 4BF8A 3W4RA 1E15A 1ZBWA 1E6NA 4ZS6A 4XAKA 3AS1A 5HT1A 1FKBA 1D7HA 3KAGA 1FFRA 1NSGA 2DT3A 1F8AB 1C9HA 2D9FA 4DWSA 4FN2A 3I6CA 2YBUA 1D6OA 4ODKA 4HARA 3ARTA 5GPGA 4ODRA 5HW8A 1HJWA 3CHFA 2ZQTA 3GPKA 2DT2A 4FAPA 2PPOA 4WIWA 5B8IC 3O5JA 4J4OA 3RM9A 3QOKA 2MLZA 4R0XA 1D2KA 3PRBA 3UQIA 1LL6A 4AY1A 4Z2JA 4MPKA 1LQ0A 3AROA 2KR7A 4DT4A 4WKHA 2WLZA 1IX5A 3IKGA 1E6RA 1E9LA 4ITZA 2Q5AA 2A3CA 4GGQA 3MDYB 3O5FA 4L72B 2LGOA 2L2SA 1J4IA 3KADA 4WKFA 4KR0B 3RMEA 2DSVA 2Y78A 3KAIA 3CGMA 3PA7A 1Q6IA 2ZR4A 2KO7A 2UZ5A 1GOIA 3IKDA 3PR9A 2KGJA 4DRNA 1NWUA 2DG3A 1ROTA 1WNOA 3O5RA 5HKGA 3TDBA 4MAVA 4WJXA 3B8SA 5I98A 2A3EA 2KE0A 4ODNA 3O5QA 4DRHA 1FKSA 1P5QA 3FXYA 2M2AA 4Z2IA 2K8IA 2PBCA 2DG9A 1O6IA 4ODLA 4IQ2A 1ZBVA 3CHEA 3WIJA 4DRIA 3RM4A 5DEZA 4G50A 4ODMA 1A7XA 4DROA 4MGVA 1J6YA 3OA5A 1FFQA 2KI3A 1PBKA 1W9UA 1UR9A 2ZR5A 3VAWA 1W1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5E A;  1N1A A;  2PPP A;  2JZV A;  2PPN A;  4BF8 A;  1BKF A;  2ZQU A;  1YAT A;  4QT2 A;  2PV3 A;  4DRQ A;  2MPH A;  1FKJ A;  1FKR A;  1FKT A;  3JYJ A;  3ODK A;  1KT0 A;  5HT1 A;  1FKB A;  2KFW A;  2RUR A;  1D7H A;  4IQC A;  1QPF A;  4DIP A;  2XP6 A;  3NTP A;  5BXJ A;  3KAG A;  4LAY A;  1NSG A;  4JFI A;  3FAP A;  4C02 B;  1FKG A;  1L1P A;  3EY6 A;  5HW7 A;  2ZR6 A;  1ZK6 A;  1F8A B;  1C9H A;  2M08 A;  1T11 A;  3KAF A;  2D9F A;  1R9H A;  3TC5 A;  4FN2 A;  5HWB A;  3I6C A;  5D75 A;  2XP4 A;  2RQS A;  2FKE A;  4LAW A;  5HTG A;  1D6O A;  2MLY A;  2PV1 A;  4ODK A;  5GPG A;  4JYS A;  4ODR A;  1KT1 A;  5HW8 A;  1U79 A;  5HUA A;  4TW6 A;  1F40 A;  2N87 A;  3UF8 A;  1D7I A;  2ZQT A;  4JFK A;  2M1I A;  3GPK A;  4FAP A;  2F21 A;  5DIU A;  3RFW A;  3O5L A;  3CGN A;  4TNS A;  2PPO A;  2MF9 A;  5B8I C;  3TCZ A;  1FD9 A;  3PRD A;  4ODP A;  1HXV A;  2XPB A;  4U86 A;  3IHZ A;  3O5J A;  3O5K A;  4J4O A;  4ODO A;  4G2P A;  3UI6 A;  2MLZ A;  4R0X A;  3PRB A;  5HW6 A;  3UQI A;  2LKN A;  3O5M A;  3KAH A;  2FAP A;  3LUO A;  3NI6 A;  1M5Y A;  1YW5 A;  2MLX A;  2VN1 A;  4U85 A;  2KR7 A;  2RUD A;  4W9P A;  5DIV A;  1D7J A;  4DT4 A;  3O5G A;  4GIV A;  4DRJ A;  1FAP A;  2F2D A;  2PV2 A;  2XP7 A;  3IKG A;  2VCD A;  4TX0 A;  3UQB A;  2XP3 A;  4JFL A;  1FKD A;  2XPA A;  3JXV A;  2F4E A;  2Q5A A;  4GGQ A;  4ITZ A;  2XP9 A;  2XP5 A;  1FJD A;  4O2T A;  5HWC A;  3MDY B;  3O5F A;  3H9R B;  3KZ7 A;  4LAX A;  2LGO A;  2L2S A;  1J4I A;  3KAD A;  4DZ2 A;  3IK8 A;  1EQ3 A;  4JFM A;  1FKH A;  3B7X A;  1TCO C;  4IPX A;  2LPV A;  4DRM A;  3JYM A;  4JFJ A;  2LJ4 A;  1FKL A;  2XP8 A;  1QPL A;  2Y78 A;  3CGM A;  3KAI A;  1Q6I A;  3O5P A;  1NMV A;  2KO7 A;  2ZR4 A;  3PA7 A;  2ITK A;  2UZ5 A;  4DRP A;  3IKD A;  4TW8 A;  5DIT A;  2KGJ A;  4DRN A;  2OFN A;  2DG4 A;  2DG3 A;  1ROT A;  3NRK A;  3O5O A;  4U84 A;  2ZQS A;  3O5R A;  4N19 A;  5HKG A;  3TDB A;  3UQA A;  1EYM A;  2ZQV A;  4DRK A;  1FKF A;  5I98 A;  2KE0 A;  4ODN A;  4DZ3 A;  3O5Q A;  1Y0O A;  4QT3 A;  4DRH A;  1FKS A;  1P5Q A;  3KCE A;  2M2A A;  3KAB A;  2K8I A;  2PBC A;  2IF4 A;  4ODQ A;  4TW7 A;  4QIB A;  4W9Q A;  1NMW A;  4W9O A;  2DG9 A;  4ODL A;  4DH0 A;  4IQ2 A;  1BL4 A;  2RSE A;  1JNS A;  2RUC A;  1FKK A;  3UI5 A;  4DRI A;  3UI4 A;  1JVW A;  1QZ2 A;  4G50 A;  1ZCN A;  4LAV A;  4ODM A;  1A7X A;  1Q1C A;  1Q6H A;  4MGV A;  3WH0 A;  1JNT A;  4DRO A;  1J6Y A;  3O5I A;  4TYO A;  1J4H A;  2KI3 A;  3OOB A;  4J4N A;  1W26 A;  1FKI A;  1PBK A;  2MNT A;  3RGC A;  3KAC A;  1B6C A;  5J6E A;  2ZR5 A;  1Q6U A;  3VAW A;  4NNR A;  1J4R A;  4MSP A;  1PIN A;  2AWG A;  2RUQ A;  3O5D A;  1ROU A; 
#chains in the Genus database with same CATH topology
 3CH9 A;  2PPP A;  1HKJ A;  4HBO A;  4MNL A;  2G41 A;  2PV3 A;  4DRQ A;  2MPH A;  1E6Z A;  1W1P A;  2KFW A;  4IQC A;  1RD6 A;  3B9D A;  4URI A;  2XP6 A;  3NTP A;  4ZPT R;  2P4V A;  4C02 B;  3WL0 A;  3EY6 A;  3ARX A;  3B9E A;  1ZK6 A;  2M08 A;  3FY1 A;  1R9H A;  3TC5 A;  4P8X A;  1HKK A;  2RQS A;  1SR0 A;  4WKA A;  2EUL A;  4TW6 A;  2N87 A;  1HJX A;  4WK9 A;  4Q7N A;  1X6N A;  3RFW A;  4MNK A;  4ODP A;  1WB0 A;  1HXV A;  4U86 A;  5DF0 A;  3O5K A;  2G8Z A;  4ODO A;  4Z2H A;  1EHN A;  4R5E A;  4QZV B;  4W5U A;  1KFW A;  1LL7 A;  1XHG A;  1EIB A;  2FAP A;  1HKI A;  3NI6 A;  2MLX A;  2RUD A;  2F23 A;  2PN0 A;  1D7J A;  3O5G A;  4DRJ A;  2F2D A;  1OWQ A;  2VCD A;  1VF8 A;  1OGG A;  2XP3 A;  2XPA A;  3AS3 A;  2F4E A;  4JFL A;  3AQU A;  1LG1 A;  1ZL1 A;  2XP5 A;  1ZU8 A;  3G6M A;  3WD3 A;  2ESC A;  3H9R B;  3IK8 A;  4DWS C;  1FKH A;  1TCO C;  4DRM A;  5HWB A;  3O5P A;  1NMV A;  4MNJ A;  5DIT A;  3NRK A;  2ZQS A;  1W1V A;  3AS2 A;  3WKZ A;  3UQA A;  3WD0 A;  4DRK A;  4Z2L A;  1H0G A;  1Y0O A;  3KCE A;  4TW7 A;  4QIB A;  2FDM A;  4IT4 A;  2RSE A;  1FKK A;  4HBE A;  1E6P A;  1OGB A;  4Z2G A;  4LAV A;  1Q1C A;  4NSB A;  4NZC A;  3O5I A;  4DWS D;  3ALF A;  3RGC A;  3KAC A;  4Q22 A;  1NWS A;  1WAW A;  1ROU A;  1UR8 A;  4JYS A;  2PPN A;  2WLY A;  1BKF A;  2A3A A;  1K9T A;  3AS0 A;  4QT2 A;  1FKJ A;  1FKR A;  3JYJ A;  3ODK A;  5BXJ A;  3WL1 A;  4LAY A;  3G6L A;  4JFI A;  1L1P A;  1FKG A;  5HW7 A;  1GUV A;  1SYT A;  1T11 A;  3KAF A;  2DT1 A;  3ARQ A;  1XRV A;  4IT6 A;  4LAW A;  3EIP A;  5HTG A;  2MLY A;  2DSU A;  1F40 A;  3UF8 A;  3WD2 A;  4JFK A;  2QF8 A;  3O5L A;  3CGN A;  4TNS A;  3RM8 A;  1ZBK A;  2MF9 A;  4ZPV R;  3TCZ A;  3PRD A;  2XPB A;  3IHZ A;  3UI6 A;  4G2P A;  2LKN A;  5GQB A;  3ARU A;  2VN1 A;  4W9P A;  1W9V A;  3CHC A;  5JH8 A;  2DSW A;  1ZBC A;  2XP7 A;  3GTY X;  4TX0 A;  3CHD A;  1FKD A;  3WQW A;  1X6L A;  2XP9 A;  2A3B A;  3KZ7 A;  4JFM A;  3B7X A;  4IPX A;  2LPV A;  2LJ4 A;  5DIV A;  4DRP A;  2DG4 A;  3O5O A;  4S3K A;  3CZ8 A;  3ARR A;  1EYM A;  2ZQV A;  1FKF A;  4DZ3 A;  2IF4 A;  4W9Q A;  1NMW A;  4W9O A;  4DH0 A;  4ML4 A;  1TFV A;  1BL4 A;  1JNS A;  2RUC A;  3WQV A;  2DPE A;  1H0I A;  3UI4 A;  1EDQ A;  3ALG A;  3B9A A;  1Q6H A;  4PTM A;  2WK2 A;  1J4H A;  3ARS A;  1FKI A;  1Q6U A;  1HKM A;  3BMB A;  3O5E A;  1N1A A;  3BXW A;  2ZQU A;  1YAT A;  1ZB5 A;  4DWS B;  1FKT A;  1KT0 A;  2RUR A;  1QPF A;  4DIP A;  1HJV A;  3FAP A;  2IUZ A;  2O92 A;  1LL4 A;  2ZR6 A;  4L3N A;  3WD1 A;  1W9P A;  5D75 A;  2XP4 A;  2FKE A;  2B31 A;  2PV1 A;  5HUA A;  1U79 A;  1D7I A;  1JNE A;  4MTV A;  2M1I A;  2F21 A;  5DIU A;  3WD4 A;  4LGX A;  1FD9 A;  1NWT A;  2PI6 A;  4P8V A;  1LJY A;  4P8W A;  5HW6 A;  3O5M A;  4KQZ A;  3KAH A;  1ITX A;  3LUO A;  1LG2 A;  1M5Y A;  1YW5 A;  4U85 A;  4GIV A;  1FAP A;  2PV2 A;  3UQB A;  1JND A;  3JXV A;  2O9O A;  1FJD A;  4O2T A;  5HWC A;  4LAX A;  4DZ2 A;  1EQ3 A;  2AOS A;  2DSZ A;  3JYM A;  4JFJ A;  1FKL A;  2XP8 A;  1QPL A;  5HBF A;  4P8U A;  2ITK A;  1NWR A;  4TW8 A;  1NH6 A;  1CTN A;  2OFN A;  3PRA A;  2B5U B;  4U84 A;  4N19 A;  1E44 A;  4ZPW R;  4QT3 A;  1W1T A;  2WM0 A;  3KAB A;  4ODQ A;  2YBT A;  4MNM A;  1GPF A;  3ARZ A;  3UI5 A;  1JVW A;  1QZ2 A;  1ZCN A;  2OLH A;  3WH0 A;  3ARP A;  1JNT A;  4Z2K A;  4TYO A;  2DT0 A;  3OOB A;  3ARV A;  4J4N A;  1W26 A;  5GPR A;  2MNT A;  1B6C A;  5J6E A;  4NNR A;  4S3J A;  3ARY A;  1J4R A;  4MSP A;  1PIN A;  1KT1 A;  2AWG A;  2RUQ A;  3O5D A;  3ARW A;  5DO2 A;  2JZV A;  4BF8 A;  3W4R A;  1E15 A;  1ZBW A;  1E6N A;  4ZS6 A;  4XAK A;  3AS1 A;  5HT1 A;  1FKB A;  1D7H A;  3KAG A;  1FFR A;  1NSG A;  2DT3 A;  1F8A B;  1C9H A;  2D9F A;  4DWS A;  4FN2 A;  3I6C A;  2YBU A;  1D6O A;  4ODK A;  4HAR A;  3ART A;  5GPG A;  4ODR A;  5HW8 A;  1HJW A;  3CHF A;  2ZQT A;  3GPK A;  2DT2 A;  4FAP A;  2PPO A;  4WIW A;  4UDM A;  5B8I C;  3GU0 A;  3O5J A;  4J4O A;  3RM9 A;  3QOK A;  2MLZ A;  1GRJ A;  4R0X A;  1D2K A;  3PRB A;  3UQI A;  1LL6 A;  4AY1 A;  4Z2J A;  4MPK A;  1LQ0 A;  1JCH B;  3ARO A;  2KR7 A;  4DT4 A;  4WKH A;  2WLZ A;  1IX5 A;  3IKG A;  1E6R A;  1E9L A;  4ITZ A;  2Q5A A;  2A3C A;  4GGQ A;  3MDY B;  3O5F A;  4L72 B;  2LGO A;  2L2S A;  1J4I A;  3KAD A;  4WKF A;  4KR0 B;  3RME A;  2DSV A;  2Y78 A;  3KAI A;  3CGM A;  3PA7 A;  1Q6I A;  2ZR4 A;  2KO7 A;  2UZ5 A;  1GOI A;  3IKD A;  3PR9 A;  2KGJ A;  4DRN A;  1NWU A;  2DG3 A;  1ROT A;  1WNO A;  3O5R A;  5HKG A;  3TDB A;  4MAV A;  4WJX A;  3B8S A;  5I98 A;  2A3E A;  2KE0 A;  4ODN A;  3O5Q A;  4DRH A;  1FKS A;  1P5Q A;  3FXY A;  2M2A A;  4Z2I A;  2K8I A;  2PBC A;  2DG9 A;  1O6I A;  4ODL A;  4IQ2 A;  1ZBV A;  3CHE A;  3WIJ A;  4DRI A;  3RM4 A;  5DEZ A;  4G50 A;  4ODM A;  1A7X A;  4DRO A;  4MGV A;  1J6Y A;  3OA5 A;  1FFQ A;  2KI3 A;  1PBK A;  1W9U A;  1UR9 A;  2ZR5 A;  3VAW A;  1W1Y A;  2ETN A; 
#chains in the Genus database with same CATH homology
 3CH9 A;  2PPP A;  1HKJ A;  4HBO A;  4MNL A;  2G41 A;  2PV3 A;  4DRQ A;  2MPH A;  1E6Z A;  1W1P A;  2KFW A;  4IQC A;  1RD6 A;  3B9D A;  4URI A;  2XP6 A;  3NTP A;  4ZPT R;  4C02 B;  3WL0 A;  3EY6 A;  3ARX A;  3B9E A;  1ZK6 A;  2M08 A;  3FY1 A;  1R9H A;  3TC5 A;  4P8X A;  1HKK A;  2RQS A;  1SR0 A;  4WKA A;  4TW6 A;  2N87 A;  1HJX A;  4WK9 A;  4Q7N A;  1X6N A;  3RFW A;  4MNK A;  4ODP A;  1WB0 A;  1HXV A;  4U86 A;  5DF0 A;  3O5K A;  2G8Z A;  4ODO A;  4Z2H A;  1EHN A;  4R5E A;  4QZV B;  4W5U A;  1KFW A;  1LL7 A;  1XHG A;  1EIB A;  2FAP A;  1HKI A;  3NI6 A;  2MLX A;  2RUD A;  1D7J A;  3O5G A;  4DRJ A;  2F2D A;  1OWQ A;  2VCD A;  1VF8 A;  1OGG A;  2XP3 A;  2XPA A;  3AS3 A;  2F4E A;  4JFL A;  3AQU A;  1LG1 A;  1ZL1 A;  2XP5 A;  1ZU8 A;  3G6M A;  3WD3 A;  2ESC A;  3H9R B;  3IK8 A;  4DWS C;  1FKH A;  1TCO C;  4DRM A;  5HWB A;  3O5P A;  1NMV A;  4MNJ A;  5DIT A;  3NRK A;  2ZQS A;  1W1V A;  3AS2 A;  3WKZ A;  3UQA A;  3WD0 A;  4DRK A;  4Z2L A;  1H0G A;  1Y0O A;  3KCE A;  4TW7 A;  4QIB A;  2FDM A;  4IT4 A;  2RSE A;  1FKK A;  4HBE A;  1E6P A;  1OGB A;  4Z2G A;  4LAV A;  1Q1C A;  4NSB A;  4NZC A;  3O5I A;  4DWS D;  3ALF A;  3RGC A;  3KAC A;  4Q22 A;  1NWS A;  1WAW A;  1ROU A;  1UR8 A;  4JYS A;  2PPN A;  2WLY A;  1BKF A;  2A3A A;  1K9T A;  3AS0 A;  4QT2 A;  1FKJ A;  1FKR A;  3JYJ A;  3ODK A;  5BXJ A;  3WL1 A;  4LAY A;  3G6L A;  4JFI A;  1L1P A;  1FKG A;  5HW7 A;  1GUV A;  1SYT A;  1T11 A;  3KAF A;  2DT1 A;  3ARQ A;  1XRV A;  4IT6 A;  4LAW A;  5HTG A;  2MLY A;  2DSU A;  1F40 A;  3UF8 A;  3WD2 A;  4JFK A;  2QF8 A;  3O5L A;  3CGN A;  4TNS A;  3RM8 A;  1ZBK A;  2MF9 A;  4ZPV R;  3TCZ A;  3PRD A;  2XPB A;  3IHZ A;  3UI6 A;  4G2P A;  2LKN A;  5GQB A;  3ARU A;  2VN1 A;  4W9P A;  1W9V A;  3CHC A;  5JH8 A;  2DSW A;  1ZBC A;  2XP7 A;  4TX0 A;  3CHD A;  1FKD A;  3WQW A;  1X6L A;  2XP9 A;  2A3B A;  3KZ7 A;  4JFM A;  3B7X A;  4IPX A;  2LPV A;  2LJ4 A;  5DIV A;  4DRP A;  2DG4 A;  3O5O A;  4S3K A;  3CZ8 A;  3ARR A;  1EYM A;  2ZQV A;  1FKF A;  4DZ3 A;  2IF4 A;  4W9Q A;  1NMW A;  4W9O A;  4DH0 A;  4ML4 A;  1TFV A;  1BL4 A;  1JNS A;  2RUC A;  3WQV A;  2DPE A;  1H0I A;  3UI4 A;  1EDQ A;  3ALG A;  3B9A A;  1Q6H A;  4PTM A;  2WK2 A;  1J4H A;  3ARS A;  1FKI A;  1Q6U A;  1HKM A;  3O5E A;  1N1A A;  3BXW A;  2ZQU A;  1YAT A;  1ZB5 A;  4DWS B;  1FKT A;  1KT0 A;  2RUR A;  1QPF A;  4DIP A;  1HJV A;  3FAP A;  2IUZ A;  2O92 A;  1LL4 A;  2ZR6 A;  4L3N A;  3WD1 A;  1W9P A;  5D75 A;  2XP4 A;  2FKE A;  2B31 A;  2PV1 A;  5HUA A;  1U79 A;  1D7I A;  1JNE A;  4MTV A;  2M1I A;  2F21 A;  5DIU A;  3WD4 A;  4LGX A;  1FD9 A;  1NWT A;  2PI6 A;  4P8V A;  1LJY A;  4P8W A;  5HW6 A;  3O5M A;  4KQZ A;  3KAH A;  1ITX A;  3LUO A;  1LG2 A;  1M5Y A;  1YW5 A;  4U85 A;  4GIV A;  1FAP A;  2PV2 A;  3UQB A;  1JND A;  3JXV A;  2O9O A;  1FJD A;  4O2T A;  5HWC A;  4LAX A;  4DZ2 A;  1EQ3 A;  2AOS A;  2DSZ A;  3JYM A;  4JFJ A;  1FKL A;  2XP8 A;  1QPL A;  5HBF A;  4P8U A;  2ITK A;  1NWR A;  4TW8 A;  1NH6 A;  1CTN A;  2OFN A;  3PRA A;  4U84 A;  4N19 A;  4ZPW R;  4QT3 A;  1W1T A;  2WM0 A;  3KAB A;  4ODQ A;  2YBT A;  4MNM A;  1GPF A;  3ARZ A;  3UI5 A;  1JVW A;  1QZ2 A;  1ZCN A;  2OLH A;  3WH0 A;  3ARP A;  1JNT A;  4Z2K A;  4TYO A;  2DT0 A;  3OOB A;  3ARV A;  4J4N A;  1W26 A;  5GPR A;  2MNT A;  1B6C A;  5J6E A;  4NNR A;  4S3J A;  3ARY A;  1J4R A;  4MSP A;  1PIN A;  1KT1 A;  2AWG A;  2RUQ A;  3O5D A;  3ARW A;  5DO2 A;  2JZV A;  4BF8 A;  3W4R A;  1E15 A;  1ZBW A;  1E6N A;  4ZS6 A;  4XAK A;  3AS1 A;  5HT1 A;  1FKB A;  1D7H A;  3KAG A;  1FFR A;  1NSG A;  2DT3 A;  1F8A B;  1C9H A;  2D9F A;  4DWS A;  4FN2 A;  3I6C A;  2YBU A;  1D6O A;  4ODK A;  4HAR A;  3ART A;  5GPG A;  4ODR A;  5HW8 A;  1HJW A;  3CHF A;  2ZQT A;  3GPK A;  2DT2 A;  4FAP A;  2PPO A;  4WIW A;  5B8I C;  3O5J A;  4J4O A;  3RM9 A;  3QOK A;  2MLZ A;  4R0X A;  1D2K A;  3PRB A;  3UQI A;  1LL6 A;  4AY1 A;  4Z2J A;  4MPK A;  1LQ0 A;  3ARO A;  2KR7 A;  4DT4 A;  4WKH A;  2WLZ A;  1IX5 A;  3IKG A;  1E6R A;  1E9L A;  4ITZ A;  2Q5A A;  2A3C A;  4GGQ A;  3MDY B;  3O5F A;  4L72 B;  2LGO A;  2L2S A;  1J4I A;  3KAD A;  4WKF A;  4KR0 B;  3RME A;  2DSV A;  2Y78 A;  3KAI A;  3CGM A;  3PA7 A;  1Q6I A;  2ZR4 A;  2KO7 A;  2UZ5 A;  1GOI A;  3IKD A;  3PR9 A;  2KGJ A;  4DRN A;  1NWU A;  2DG3 A;  1ROT A;  1WNO A;  3O5R A;  5HKG A;  3TDB A;  4MAV A;  4WJX A;  3B8S A;  5I98 A;  2A3E A;  2KE0 A;  4ODN A;  3O5Q A;  4DRH A;  1FKS A;  1P5Q A;  3FXY A;  2M2A A;  4Z2I A;  2K8I A;  2PBC A;  2DG9 A;  1O6I A;  4ODL A;  4IQ2 A;  1ZBV A;  3CHE A;  3WIJ A;  4DRI A;  3RM4 A;  5DEZ A;  4G50 A;  4ODM A;  1A7X A;  4DRO A;  4MGV A;  1J6Y A;  3OA5 A;  1FFQ A;  2KI3 A;  1PBK A;  1W9U A;  1UR9 A;  2ZR5 A;  3VAW A;  1W1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...