5HW6A

Candida albicans fkbp12 apo protein in c2 space group
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
120
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
total genus 25
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hw6A00
1J4IA 1FKTA 2KR7A 2F4EA 4LAWA 1PINA 4ODPA 1J4HA 2DG4A 2XPBA 2ZQSA 4JYSA 2L2SA 3PRBA 3O5DA 1C9HA 2RURA 2PV3A 3KZ7A 2PV1A 2RUCA 2N87A 2XP6A 2LKNA 4DRIA 1FKHA 1BL4A 3PA7A 4JFKA 4ODLA 4DRQA 3O5MA 1J6YA 1F8AB 4ODNA 2RSEA 1QPFA 1EQ3A 3IKDA 2XP4A 1D7IA 2KI3A 2XPAA 4U84A 4C02B 3CGNA 5I98A 3JXVA 3ODKA 4QT3A 2LPVA 5HWCA 4W9QA 4DRNA 1W26A 4GGQA 3GPKA 1FD9A 2MLXA 5HW6A 3O5FA 4FN2A 1YATA 2M2AA 1NMVA 4IQCA 1F40A 1FKRA 1FAPA 2F2DA 1ZK6A 2JZVA 3I6CA 2XP9A 4DZ2A 1Q1CA 3KADA 3WH0A 4W9PA 4QIBA 5HW7A 4R0XA 4DRPA 3O5EA 2DG9A 2LJ4A 3JYMA 4ODKA 1ROUA 2PV2A 1T11A 1Y0OA 1J4RA 3O5QA 5DIUA 2XP3A 3UF8A 3UQIA 4N19A 4DT4A 5HTGA 4DIPA 3KAFA 4G50A 1FJDA 4NNRA 2MPHA 4TW8A 2RQSA 4ODMA 2MLYA 1JNTA 5GPGA 2F21A 2XP8A 1D7JA 1Q6IA 2KO7A 4GIVA 1FKFA 1FKGA 2Q5AA 2VCDA 2ZQTA 2ZQVA 1FKBA 1R9HA 2DG3A 1M5YA 1NMWA 2KGJA 4JFIA 4DRJA 3IKGA 3EY6A 1FKSA 3OOBA 2MNTA 3O5PA 4BF8A 4U85A 3TCZA 2MLZA 2D9FA 3O5RA 3UI5A 1HXVA 2PBCA 2FKEA 1JVWA 1A7XA 4DZ3A 3UQBA 4ODOA 2PPNA 2Y78A 1PBKA 4TW6A 2K8IA 1QZ2A 2FAPA 3KAHA 3KAIA 1KT1A 1QPLA 3O5OA 1ROTA 3KAGA 4G2PA 4IPXA 4JFMA 4TX0A 4DROA 4MGVA 1L1PA 4LAXA 1FKIA 2KFWA 2ZR4A 5BXJA 1JNSA 1YW5A 2M1IA 4TYOA 3KCEA 4U86A 3VAWA 1D6OA 1Q6HA 2XP7A 3FAPA 3RFWA 4DRHA 2UZ5A 2LGOA 3KABA 3MDYB 1FKKA 3B7XA 4ODQA 4J4NA 4ITZA 4JFLA 4O2TA 3O5KA 4DH0A 3TC5A 2IF4A 3O5LA 1B6CA 1FKLA 2PPPA 3UI6A 5HKGA 3IHZA 5HT1A 3O5GA 4LAVA 4ODRA 4J4OA 3UQAA 5HW8A 3IK8A 2MF9A 1FKDA 2KE0A 3NTPA 1U79A 4MSPA 3TDBA 2RUDA 2ZR6A 4TW7A 5D75A 3CGMA 5DITA 5HWBA 3H9RB 1EYMA 3O5JA 1N1AA 2OFNA 4IQ2A 1BKFA 3RGCA 1KT0A 2XP5A 2ZQUA 3PRDA 1Q6UA 3LUOA 4DRKA 4LAYA 2ZR5A 3O5IA 4FAPA 2ITKA 1NSGA 2PPOA 5B8IC 5J6EA 5DIVA 2RUQA 1TCOC 1ZCNA 4DRMA 4TNSA 3KACA 4QT2A 3JYJA 3NRKA 4JFJA 5HUAA 1FKJA 1P5QA 3UI4A 1D7HA 2M08A 2AWGA 4W9OA 2VN1A 3NI6A
chains in the Genus database with same CATH superfamily
3CHCA 4DWSC 1JNEA 2PV3A 2PV1A 4DRQA 3PA7A 4ODLA 1VF8A 3O5MA 4MAVA 2G41A 1QPFA 1EQ3A 2KI3A 4U84A 3B9DA 2AOSA 4QT3A 1LL4A 4W9QA 4DRNA 3PR9A 3WKZA 4P8VA 1FD9A 1NWRA 2MLXA 2PI6A 2A3EA 1F40A 1FAPA 1Q1CA 3WH0A 4QIBA 4DRPA 3ARQA 1OWQA 2LJ4A 1ROUA 1T11A 3UF8A 3UQIA 4DIPA 3WIJA 3ARXA 1JNTA 2A3AA 1FKBA 1ZBWA 3RM4A 1W9PA 1M5YA 1NMWA 2KGJA 4JFIA 1GPFA 1NWSA 2A3CA 2FKEA 1A7XA 4TW6A 2DT1A 2Y78A 1QZ2A 3AS1A 1HJWA 3KAIA 4G2PA 1X6LA 3O5OA 4Z2HA 3AS3A 4JFMA 4MGVA 1NH6A 3GU0A 3AS0A 5GQBA 3FAPA 2EULA 3B9AA 3RFWA 4DRHA 3W4RA 2LGOA 3KABA 3AS2A 3MDYB 1HKMA 1FKKA 4J4NA 3RM9A 2DSWA 3FXYA 3O5KA 4DH0A 3TC5A 4AY1A 3PRAA 5HKGA 2PPPA 3UI6A 3IHZA 4LAVA 3UQAA 5DF0A 4XAKA 1WAWA 1W9UA 1U79A 4MSPA 4TW7A 5DITA 4ML4A 3H9RB 1WB0A 2OLHA 5JH8A 2OFNA 3RGCA 1FFRA 3LUOA 4DRKA 3O5IA 2ITKA 3ARPA 4MTVA 2IUZA 3JYJA 3UI4A 2M08A 4URIA 3NI6A 1J4IA 4MNLA 4HBOA 2KR7A 1J4HA 4JYSA 4L3NA 3PRBA 2WK2A 3KZ7A 2N87A 2XP6A 4ZPTR 2LKNA 4JFKA 4ODNA 2RSEA 5GPRA 1HJXA 5I98A 4C02B 1IX5A 1W26A 4KQZA 3GPKA 3ARUA 1E44A 1ZBKA 2ESCA 1YATA 4IQCA 1FKRA 2F2DA 1LG1A 2XP9A 2DSZA 1RD6A 4R0XA 4ODKA 1NWTA 2XP3A 1ITXA 4N19A 4ODMA 1FKFA 2ZQTA 2ZQVA 1W1VA 3ARVA 2DPEA 2B5UB 4BF8A 4U85A 3GTYX 2D9FA 3UI5A 1HXVA 2PBCA 2FAPA 1H0IA 3KAHA 1QPLA 1ROTA 4IPXA 4TX0A 1E15A 1LL7A 5DO2A 1OGGA 4LAXA 2ETNA 1HKKA 1HKIA 2M1IA 4TYOA 1E9LA 4JFLA 4O2TA 3OA5A 2FDMA 3ARRA 2IF4A 1B6CA 1FKLA 4QZVB 1XHGA 1ZB5A 4J4OA 4ODRA 4ZPWR 2A3BA 3ALFA 2KE0A 4WKFA 3G6LA 2ZR6A 1EDQA 3CGMA 3O5JA 3WQVA 3RM8A 4FAPA 1SR0A 1W1PA 4HARA 5B8IC 2PPOA 5J6EA 4Z2JA 1TCOC 1ZCNA 1HJVA 3ARSA 4Z2IA 4JFJA 4WKAA 2AWGA 4ZS6A 2VN1A 1KFWA 1FKTA 4ODPA 3WL1A 2ZQSA 2XPBA 1E6PA 1C9HA 4Z2KA 4DRIA 1FKHA 2DT3A 3B9EA 3ARTA 1UR8A 3IKDA 2XP4A 1D7IA 5DEZA 3CGNA 3JXVA 3ODKA 4GGQA 2DSVA 4S3JA 2G8ZA 3B8SA 5HW6A 1CTNA 4IT4A 1EIBA 2JZVA 1ZK6A 3I6CA 4P8XA 4DZ2A 1HKJA 2F23A 3O5EA 2DG9A 4L72B 4DT4A 4Z2GA 3O5QA 5HTGA 2QF8A 3RMEA 4S3KA 2MLYA 2F21A 1D7JA 1Q6IA 2KO7A 4NSBA 3EIPA 2B31A 1TFVA 3WD1A 2Q5AA 2YBTA 1R9HA 3WQWA 1LJYA 2DG3A 3IKGA 4Z2LA 1FKSA 4KR0B 2WLYA 1GRJA 2MNTA 3ALGA 2PPNA 1PBKA 1LG2A 1X6NA 2K8IA 1KT1A 3CZ8A 1JNDA 1D2KA 1FKIA 2KFWA 4ZPVR 2ZR4A 5BXJA 2PN0A 4R5EA 1D6OA 1LQ0A 1NWUA 1Q6HA 4ODQA 3BMBA 1E6ZA 4PTMA 5HW8A 3IK8A 1ZL1A 4MNKA 1FKDA 3TDBA 1EYMA 3ARYA 3CHFA 4IQ2A 1SYTA 1LL6A 1BKFA 2P4VA 1KT0A 2XP5A 4UDMA 1Q6UA 4LAYA 2ZR5A 4LGXA 1NSGA 5DIVA 1W1TA 1H0GA 3FY1A 4DRMA 2O92A 4TNSA 4QT2A 3NRKA 1D7HA 3AQUA 1GUVA 2F4EA 4LAWA 3WD0A 1PINA 2DG4A 2L2SA 1ZU8A 3O5DA 2RURA 1ZBVA 2RUCA 1BL4A 1J6YA 4P8UA 1F8AB 4DWSB 2DSUA 1XRVA 2WLZA 4IT6A 1GOIA 3QOKA 2XPAA 3WD2A 4Q22A 1L1PA 2O9OA 5HWCA 2LPVA 3O5FA 4FN2A 2DT2A 2M2AA 1NMVA 1FFQA 1ZBCA 3CHEA 3KADA 4NZCA 4W9PA 5HW7A 1K9TA 3WD3A 3JYMA 1E6RA 2PV2A 5DIUA 1Y0OA 4MNJA 1J4RA 1O6IA 1FJDA 1OGBA 3KAFA 4G50A 4MNMA 4WIWA 4NNRA 5HBFA 2MPHA 4TW8A 2RQSA 5GPGA 2XP8A 4GIVA 4DWSD 1WNOA 1FKGA 2VCDA 4Q7NA 4DRJA 3EY6A 3OOBA 2YBUA 3O5PA 3TCZA 2MLZA 3O5RA 4WJXA 4WKHA 1JVWA 4DZ3A 3UQBA 4ODOA 4DWSA 4MPKA 3KAGA 4DROA 2WM0A 1JNSA 1YW5A 3KCEA 4U86A 3VAWA 2XP7A 2UZ5A 3ARZA 1E6NA 4HBEA 3B7XA 4ITZA 3CH9A 1UR9A 3O5LA 4P8WA 3WL0A 5HT1A 3O5GA 3G6MA 3ARWA 2MF9A 3NTPA 3WD4A 1W1YA 1EHNA 2RUDA 5HWBA 5D75A 3BXWA 1N1AA 2ZQUA 3CHDA 3PRDA 1JCHB 2RUQA 3KACA 4W5UA 2DT0A 5HUAA 1FKJA 1P5QA 4WK9A 4W9OA 3AROA 1W9VA
chains in the Genus database with same CATH topology
3CHCA 4DWSC 1JNEA 2PV3A 2PV1A 4DRQA 3PA7A 4ODLA 1VF8A 3O5MA 4MAVA 2G41A 1QPFA 1EQ3A 2KI3A 4U84A 3B9DA 2AOSA 4QT3A 1LL4A 4W9QA 4DRNA 3PR9A 3WKZA 4P8VA 1FD9A 1NWRA 2MLXA 2PI6A 2A3EA 1F40A 1FAPA 1Q1CA 3WH0A 4QIBA 4DRPA 3ARQA 1OWQA 2LJ4A 1ROUA 1T11A 3UF8A 3UQIA 4DIPA 3WIJA 3ARXA 1JNTA 2A3AA 1FKBA 1ZBWA 3RM4A 1W9PA 1M5YA 1NMWA 2KGJA 4JFIA 1GPFA 1NWSA 2A3CA 2FKEA 1A7XA 4TW6A 2DT1A 2Y78A 1QZ2A 3AS1A 1HJWA 3KAIA 4G2PA 1X6LA 3O5OA 4Z2HA 3AS3A 4JFMA 4MGVA 1NH6A 3AS0A 5GQBA 3FAPA 3B9AA 3RFWA 4DRHA 3W4RA 2LGOA 3KABA 3AS2A 3MDYB 1HKMA 1FKKA 4J4NA 3RM9A 2DSWA 3FXYA 3O5KA 4DH0A 3TC5A 4AY1A 3PRAA 5HKGA 2PPPA 3UI6A 3IHZA 4LAVA 3UQAA 5DF0A 4XAKA 1WAWA 1W9UA 1U79A 4MSPA 4TW7A 5DITA 4ML4A 3H9RB 1WB0A 2OLHA 5JH8A 2OFNA 3RGCA 1FFRA 3LUOA 4DRKA 3O5IA 2ITKA 3ARPA 4MTVA 2IUZA 3JYJA 3UI4A 2M08A 4URIA 3NI6A 1J4IA 4MNLA 4HBOA 2KR7A 1J4HA 4JYSA 4L3NA 3PRBA 2WK2A 3KZ7A 2N87A 2XP6A 4ZPTR 2LKNA 4JFKA 4ODNA 2RSEA 5GPRA 1HJXA 5I98A 4C02B 1IX5A 1W26A 4KQZA 3GPKA 3ARUA 1ZBKA 2ESCA 1YATA 4IQCA 1FKRA 2F2DA 1LG1A 2XP9A 2DSZA 1RD6A 4R0XA 4ODKA 1NWTA 2XP3A 1ITXA 4N19A 4ODMA 1FKFA 2ZQTA 2ZQVA 1W1VA 3ARVA 2DPEA 4BF8A 4U85A 2D9FA 3UI5A 1HXVA 2PBCA 2FAPA 1H0IA 3KAHA 1QPLA 1ROTA 4IPXA 4TX0A 1E15A 1LL7A 5DO2A 1OGGA 4LAXA 1HKKA 1HKIA 2M1IA 4TYOA 1E9LA 4JFLA 4O2TA 3OA5A 2FDMA 3ARRA 2IF4A 1B6CA 1FKLA 4QZVB 1XHGA 1ZB5A 4J4OA 4ODRA 4ZPWR 2A3BA 3ALFA 2KE0A 4WKFA 3G6LA 2ZR6A 1EDQA 3CGMA 3O5JA 3WQVA 3RM8A 4FAPA 1SR0A 1W1PA 4HARA 5B8IC 2PPOA 5J6EA 4Z2JA 1TCOC 1ZCNA 1HJVA 3ARSA 4Z2IA 4JFJA 4WKAA 2AWGA 4ZS6A 2VN1A 1KFWA 1FKTA 4ODPA 3WL1A 2ZQSA 2XPBA 1E6PA 1C9HA 4Z2KA 4DRIA 1FKHA 2DT3A 3B9EA 3ARTA 1UR8A 3IKDA 2XP4A 1D7IA 5DEZA 3CGNA 3JXVA 3ODKA 4GGQA 2DSVA 4S3JA 2G8ZA 3B8SA 5HW6A 1CTNA 4IT4A 1EIBA 2JZVA 1ZK6A 3I6CA 4P8XA 4DZ2A 1HKJA 3O5EA 2DG9A 4L72B 4DT4A 4Z2GA 3O5QA 5HTGA 2QF8A 3RMEA 4S3KA 2MLYA 2F21A 1D7JA 1Q6IA 2KO7A 4NSBA 2B31A 1TFVA 3WD1A 2Q5AA 2YBTA 1R9HA 3WQWA 1LJYA 2DG3A 3IKGA 4Z2LA 1FKSA 4KR0B 2WLYA 2MNTA 3ALGA 2PPNA 1PBKA 1LG2A 1X6NA 2K8IA 1KT1A 3CZ8A 1JNDA 1D2KA 1FKIA 2KFWA 4ZPVR 2ZR4A 5BXJA 4R5EA 1D6OA 1LQ0A 1NWUA 1Q6HA 4ODQA 1E6ZA 4PTMA 5HW8A 3IK8A 1ZL1A 4MNKA 1FKDA 3TDBA 1EYMA 3ARYA 3CHFA 4IQ2A 1SYTA 1LL6A 1BKFA 1KT0A 2XP5A 1Q6UA 4LAYA 2ZR5A 4LGXA 1NSGA 5DIVA 1W1TA 1H0GA 3FY1A 4DRMA 2O92A 4TNSA 4QT2A 3NRKA 1D7HA 3AQUA 1GUVA 2F4EA 4LAWA 3WD0A 1PINA 2DG4A 2L2SA 1ZU8A 3O5DA 2RURA 1ZBVA 2RUCA 1BL4A 1J6YA 4P8UA 1F8AB 4DWSB 2DSUA 1XRVA 2WLZA 4IT6A 1GOIA 3QOKA 2XPAA 3WD2A 4Q22A 1L1PA 2O9OA 5HWCA 2LPVA 3O5FA 4FN2A 2DT2A 2M2AA 1NMVA 1FFQA 1ZBCA 3CHEA 3KADA 4NZCA 4W9PA 5HW7A 1K9TA 3WD3A 3JYMA 1E6RA 2PV2A 5DIUA 1Y0OA 4MNJA 1J4RA 1O6IA 1FJDA 1OGBA 3KAFA 4G50A 4MNMA 4WIWA 4NNRA 5HBFA 2MPHA 4TW8A 2RQSA 5GPGA 2XP8A 4GIVA 4DWSD 1WNOA 1FKGA 2VCDA 4Q7NA 4DRJA 3EY6A 3OOBA 2YBUA 3O5PA 3TCZA 2MLZA 3O5RA 4WJXA 4WKHA 1JVWA 4DZ3A 3UQBA 4ODOA 4DWSA 4MPKA 3KAGA 4DROA 2WM0A 1JNSA 1YW5A 3KCEA 4U86A 3VAWA 2XP7A 2UZ5A 3ARZA 1E6NA 4HBEA 3B7XA 4ITZA 3CH9A 1UR9A 3O5LA 4P8WA 3WL0A 5HT1A 3O5GA 3G6MA 3ARWA 2MF9A 3NTPA 3WD4A 1W1YA 1EHNA 2RUDA 5HWBA 5D75A 3BXWA 1N1AA 2ZQUA 3CHDA 3PRDA 2RUQA 3KACA 4W5UA 2DT0A 5HUAA 1FKJA 1P5QA 4WK9A 4W9OA 3AROA 1W9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J4I A;  1FKT A;  2KR7 A;  2F4E A;  4LAW A;  1PIN A;  4ODP A;  1J4H A;  2DG4 A;  2XPB A;  2ZQS A;  4JYS A;  2L2S A;  3PRB A;  3O5D A;  1C9H A;  2RUR A;  2PV3 A;  3KZ7 A;  2PV1 A;  2RUC A;  2N87 A;  2XP6 A;  2LKN A;  4DRI A;  1FKH A;  1BL4 A;  3PA7 A;  4JFK A;  4ODL A;  4DRQ A;  3O5M A;  1J6Y A;  1F8A B;  4ODN A;  2RSE A;  1QPF A;  1EQ3 A;  3IKD A;  2XP4 A;  1D7I A;  2KI3 A;  2XPA A;  4U84 A;  4C02 B;  3CGN A;  5I98 A;  3JXV A;  3ODK A;  4QT3 A;  2LPV A;  5HWC A;  4W9Q A;  4DRN A;  1W26 A;  4GGQ A;  3GPK A;  1FD9 A;  2MLX A;  5HW6 A;  3O5F A;  4FN2 A;  1YAT A;  2M2A A;  1NMV A;  4IQC A;  1F40 A;  1FKR A;  1FAP A;  2F2D A;  1ZK6 A;  2JZV A;  3I6C A;  2XP9 A;  4DZ2 A;  1Q1C A;  3KAD A;  3WH0 A;  4W9P A;  4QIB A;  5HW7 A;  4R0X A;  4DRP A;  3O5E A;  2DG9 A;  2LJ4 A;  3JYM A;  4ODK A;  1ROU A;  2PV2 A;  1T11 A;  1Y0O A;  1J4R A;  3O5Q A;  5DIU A;  2XP3 A;  3UF8 A;  3UQI A;  4N19 A;  4DT4 A;  5HTG A;  4DIP A;  3KAF A;  4G50 A;  1FJD A;  4NNR A;  2MPH A;  4TW8 A;  2RQS A;  4ODM A;  2MLY A;  1JNT A;  5GPG A;  2F21 A;  2XP8 A;  1D7J A;  1Q6I A;  2KO7 A;  4GIV A;  1FKF A;  1FKG A;  2Q5A A;  2VCD A;  2ZQT A;  2ZQV A;  1FKB A;  1R9H A;  2DG3 A;  1M5Y A;  1NMW A;  2KGJ A;  4JFI A;  4DRJ A;  3IKG A;  3EY6 A;  1FKS A;  3OOB A;  2MNT A;  3O5P A;  4BF8 A;  4U85 A;  3TCZ A;  2MLZ A;  2D9F A;  3O5R A;  3UI5 A;  1HXV A;  2PBC A;  2FKE A;  1JVW A;  1A7X A;  4DZ3 A;  3UQB A;  4ODO A;  2PPN A;  2Y78 A;  1PBK A;  4TW6 A;  2K8I A;  1QZ2 A;  2FAP A;  3KAH A;  3KAI A;  1KT1 A;  1QPL A;  3O5O A;  1ROT A;  3KAG A;  4G2P A;  4IPX A;  4JFM A;  4TX0 A;  4DRO A;  4MGV A;  1L1P A;  4LAX A;  1FKI A;  2KFW A;  2ZR4 A;  5BXJ A;  1JNS A;  1YW5 A;  2M1I A;  4TYO A;  3KCE A;  4U86 A;  3VAW A;  1D6O A;  1Q6H A;  2XP7 A;  3FAP A;  3RFW A;  4DRH A;  2UZ5 A;  2LGO A;  3KAB A;  3MDY B;  1FKK A;  3B7X A;  4ODQ A;  4J4N A;  4ITZ A;  4JFL A;  4O2T A;  3O5K A;  4DH0 A;  3TC5 A;  2IF4 A;  3O5L A;  1B6C A;  1FKL A;  2PPP A;  3UI6 A;  5HKG A;  3IHZ A;  5HT1 A;  3O5G A;  4LAV A;  4ODR A;  4J4O A;  3UQA A;  5HW8 A;  3IK8 A;  2MF9 A;  1FKD A;  2KE0 A;  3NTP A;  1U79 A;  4MSP A;  3TDB A;  2RUD A;  2ZR6 A;  4TW7 A;  5D75 A;  3CGM A;  5DIT A;  5HWB A;  3H9R B;  1EYM A;  3O5J A;  1N1A A;  2OFN A;  4IQ2 A;  1BKF A;  3RGC A;  1KT0 A;  2XP5 A;  2ZQU A;  3PRD A;  1Q6U A;  3LUO A;  4DRK A;  4LAY A;  2ZR5 A;  3O5I A;  4FAP A;  2ITK A;  1NSG A;  2PPO A;  5B8I C;  5J6E A;  5DIV A;  2RUQ A;  1TCO C;  1ZCN A;  4DRM A;  4TNS A;  3KAC A;  4QT2 A;  3JYJ A;  3NRK A;  4JFJ A;  5HUA A;  1FKJ A;  1P5Q A;  3UI4 A;  1D7H A;  2M08 A;  2AWG A;  4W9O A;  2VN1 A;  3NI6 A; 
#chains in the Genus database with same CATH topology
 3CHC A;  4DWS C;  1JNE A;  2PV3 A;  2PV1 A;  4DRQ A;  3PA7 A;  4ODL A;  1VF8 A;  3O5M A;  4MAV A;  2G41 A;  1QPF A;  1EQ3 A;  2KI3 A;  4U84 A;  3B9D A;  2AOS A;  4QT3 A;  1LL4 A;  4W9Q A;  4DRN A;  3PR9 A;  3WKZ A;  4P8V A;  1FD9 A;  1NWR A;  2MLX A;  2PI6 A;  2A3E A;  1F40 A;  1FAP A;  1Q1C A;  3WH0 A;  4QIB A;  4DRP A;  3ARQ A;  1OWQ A;  2LJ4 A;  1ROU A;  1T11 A;  3UF8 A;  3UQI A;  4DIP A;  3WIJ A;  3ARX A;  1JNT A;  2A3A A;  1FKB A;  1ZBW A;  3RM4 A;  1W9P A;  1M5Y A;  1NMW A;  2KGJ A;  4JFI A;  1GPF A;  1NWS A;  2A3C A;  2FKE A;  1A7X A;  4TW6 A;  2DT1 A;  2Y78 A;  1QZ2 A;  3AS1 A;  1HJW A;  3KAI A;  4G2P A;  1X6L A;  3O5O A;  4Z2H A;  3AS3 A;  4JFM A;  4MGV A;  1NH6 A;  3GU0 A;  3AS0 A;  5GQB A;  3FAP A;  2EUL A;  3B9A A;  3RFW A;  4DRH A;  3W4R A;  2LGO A;  3KAB A;  3AS2 A;  3MDY B;  1HKM A;  1FKK A;  4J4N A;  3RM9 A;  2DSW A;  3FXY A;  3O5K A;  4DH0 A;  3TC5 A;  4AY1 A;  3PRA A;  5HKG A;  2PPP A;  3UI6 A;  3IHZ A;  4LAV A;  3UQA A;  5DF0 A;  4XAK A;  1WAW A;  1W9U A;  1U79 A;  4MSP A;  4TW7 A;  5DIT A;  4ML4 A;  3H9R B;  1WB0 A;  2OLH A;  5JH8 A;  2OFN A;  3RGC A;  1FFR A;  3LUO A;  4DRK A;  3O5I A;  2ITK A;  3ARP A;  4MTV A;  2IUZ A;  3JYJ A;  3UI4 A;  2M08 A;  4URI A;  3NI6 A;  1J4I A;  4MNL A;  4HBO A;  2KR7 A;  1J4H A;  4JYS A;  4L3N A;  3PRB A;  2WK2 A;  3KZ7 A;  2N87 A;  2XP6 A;  4ZPT R;  2LKN A;  4JFK A;  4ODN A;  2RSE A;  5GPR A;  1HJX A;  5I98 A;  4C02 B;  1IX5 A;  1W26 A;  4KQZ A;  3GPK A;  3ARU A;  1E44 A;  1ZBK A;  2ESC A;  1YAT A;  4IQC A;  1FKR A;  2F2D A;  1LG1 A;  2XP9 A;  2DSZ A;  1RD6 A;  4R0X A;  4ODK A;  1NWT A;  2XP3 A;  1ITX A;  4N19 A;  4ODM A;  1FKF A;  2ZQT A;  2ZQV A;  1W1V A;  3ARV A;  2DPE A;  2B5U B;  4BF8 A;  4U85 A;  3GTY X;  2D9F A;  3UI5 A;  1HXV A;  2PBC A;  2FAP A;  1H0I A;  3KAH A;  1QPL A;  1ROT A;  4IPX A;  4TX0 A;  1E15 A;  1LL7 A;  5DO2 A;  1OGG A;  4LAX A;  2ETN A;  1HKK A;  1HKI A;  2M1I A;  4TYO A;  1E9L A;  4JFL A;  4O2T A;  3OA5 A;  2FDM A;  3ARR A;  2IF4 A;  1B6C A;  1FKL A;  4QZV B;  1XHG A;  1ZB5 A;  4J4O A;  4ODR A;  4ZPW R;  2A3B A;  3ALF A;  2KE0 A;  4WKF A;  3G6L A;  2ZR6 A;  1EDQ A;  3CGM A;  3O5J A;  3WQV A;  3RM8 A;  4FAP A;  1SR0 A;  1W1P A;  4HAR A;  5B8I C;  2PPO A;  5J6E A;  4Z2J A;  1TCO C;  1ZCN A;  1HJV A;  3ARS A;  4Z2I A;  4JFJ A;  4WKA A;  2AWG A;  4ZS6 A;  2VN1 A;  1KFW A;  1FKT A;  4ODP A;  3WL1 A;  2ZQS A;  2XPB A;  1E6P A;  1C9H A;  4Z2K A;  4DRI A;  1FKH A;  2DT3 A;  3B9E A;  3ART A;  1UR8 A;  3IKD A;  2XP4 A;  1D7I A;  5DEZ A;  3CGN A;  3JXV A;  3ODK A;  4GGQ A;  2DSV A;  4S3J A;  2G8Z A;  3B8S A;  5HW6 A;  1CTN A;  4IT4 A;  1EIB A;  2JZV A;  1ZK6 A;  3I6C A;  4P8X A;  4DZ2 A;  1HKJ A;  2F23 A;  3O5E A;  2DG9 A;  4L72 B;  4DT4 A;  4Z2G A;  3O5Q A;  5HTG A;  2QF8 A;  3RME A;  4S3K A;  2MLY A;  2F21 A;  1D7J A;  1Q6I A;  2KO7 A;  4NSB A;  3EIP A;  2B31 A;  1TFV A;  3WD1 A;  2Q5A A;  2YBT A;  1R9H A;  3WQW A;  1LJY A;  2DG3 A;  3IKG A;  4Z2L A;  1FKS A;  4KR0 B;  2WLY A;  1GRJ A;  2MNT A;  3ALG A;  2PPN A;  1PBK A;  1LG2 A;  1X6N A;  2K8I A;  1KT1 A;  3CZ8 A;  1JND A;  1D2K A;  1FKI A;  2KFW A;  4ZPV R;  2ZR4 A;  5BXJ A;  2PN0 A;  4R5E A;  1D6O A;  1LQ0 A;  1NWU A;  1Q6H A;  4ODQ A;  3BMB A;  1E6Z A;  4PTM A;  5HW8 A;  3IK8 A;  1ZL1 A;  4MNK A;  1FKD A;  3TDB A;  1EYM A;  3ARY A;  3CHF A;  4IQ2 A;  1SYT A;  1LL6 A;  1BKF A;  2P4V A;  1KT0 A;  2XP5 A;  4UDM A;  1Q6U A;  4LAY A;  2ZR5 A;  4LGX A;  1NSG A;  5DIV A;  1W1T A;  1H0G A;  3FY1 A;  4DRM A;  2O92 A;  4TNS A;  4QT2 A;  3NRK A;  1D7H A;  3AQU A;  1GUV A;  2F4E A;  4LAW A;  3WD0 A;  1PIN A;  2DG4 A;  2L2S A;  1ZU8 A;  3O5D A;  2RUR A;  1ZBV A;  2RUC A;  1BL4 A;  1J6Y A;  4P8U A;  1F8A B;  4DWS B;  2DSU A;  1XRV A;  2WLZ A;  4IT6 A;  1GOI A;  3QOK A;  2XPA A;  3WD2 A;  4Q22 A;  1L1P A;  2O9O A;  5HWC A;  2LPV A;  3O5F A;  4FN2 A;  2DT2 A;  2M2A A;  1NMV A;  1FFQ A;  1ZBC A;  3CHE A;  3KAD A;  4NZC A;  4W9P A;  5HW7 A;  1K9T A;  3WD3 A;  3JYM A;  1E6R A;  2PV2 A;  5DIU A;  1Y0O A;  4MNJ A;  1J4R A;  1O6I A;  1FJD A;  1OGB A;  3KAF A;  4G50 A;  4MNM A;  4WIW A;  4NNR A;  5HBF A;  2MPH A;  4TW8 A;  2RQS A;  5GPG A;  2XP8 A;  4GIV A;  4DWS D;  1WNO A;  1FKG A;  2VCD A;  4Q7N A;  4DRJ A;  3EY6 A;  3OOB A;  2YBU A;  3O5P A;  3TCZ A;  2MLZ A;  3O5R A;  4WJX A;  4WKH A;  1JVW A;  4DZ3 A;  3UQB A;  4ODO A;  4DWS A;  4MPK A;  3KAG A;  4DRO A;  2WM0 A;  1JNS A;  1YW5 A;  3KCE A;  4U86 A;  3VAW A;  2XP7 A;  2UZ5 A;  3ARZ A;  1E6N A;  4HBE A;  3B7X A;  4ITZ A;  3CH9 A;  1UR9 A;  3O5L A;  4P8W A;  3WL0 A;  5HT1 A;  3O5G A;  3G6M A;  3ARW A;  2MF9 A;  3NTP A;  3WD4 A;  1W1Y A;  1EHN A;  2RUD A;  5HWB A;  5D75 A;  3BXW A;  1N1A A;  2ZQU A;  3CHD A;  3PRD A;  1JCH B;  2RUQ A;  3KAC A;  4W5U A;  2DT0 A;  5HUA A;  1FKJ A;  1P5Q A;  4WK9 A;  4W9O A;  3ARO A;  1W9V A; 
#chains in the Genus database with same CATH homology
 3CHC A;  4DWS C;  1JNE A;  2PV3 A;  2PV1 A;  4DRQ A;  3PA7 A;  4ODL A;  1VF8 A;  3O5M A;  4MAV A;  2G41 A;  1QPF A;  1EQ3 A;  2KI3 A;  4U84 A;  3B9D A;  2AOS A;  4QT3 A;  1LL4 A;  4W9Q A;  4DRN A;  3PR9 A;  3WKZ A;  4P8V A;  1FD9 A;  1NWR A;  2MLX A;  2PI6 A;  2A3E A;  1F40 A;  1FAP A;  1Q1C A;  3WH0 A;  4QIB A;  4DRP A;  3ARQ A;  1OWQ A;  2LJ4 A;  1ROU A;  1T11 A;  3UF8 A;  3UQI A;  4DIP A;  3WIJ A;  3ARX A;  1JNT A;  2A3A A;  1FKB A;  1ZBW A;  3RM4 A;  1W9P A;  1M5Y A;  1NMW A;  2KGJ A;  4JFI A;  1GPF A;  1NWS A;  2A3C A;  2FKE A;  1A7X A;  4TW6 A;  2DT1 A;  2Y78 A;  1QZ2 A;  3AS1 A;  1HJW A;  3KAI A;  4G2P A;  1X6L A;  3O5O A;  4Z2H A;  3AS3 A;  4JFM A;  4MGV A;  1NH6 A;  3AS0 A;  5GQB A;  3FAP A;  3B9A A;  3RFW A;  4DRH A;  3W4R A;  2LGO A;  3KAB A;  3AS2 A;  3MDY B;  1HKM A;  1FKK A;  4J4N A;  3RM9 A;  2DSW A;  3FXY A;  3O5K A;  4DH0 A;  3TC5 A;  4AY1 A;  3PRA A;  5HKG A;  2PPP A;  3UI6 A;  3IHZ A;  4LAV A;  3UQA A;  5DF0 A;  4XAK A;  1WAW A;  1W9U A;  1U79 A;  4MSP A;  4TW7 A;  5DIT A;  4ML4 A;  3H9R B;  1WB0 A;  2OLH A;  5JH8 A;  2OFN A;  3RGC A;  1FFR A;  3LUO A;  4DRK A;  3O5I A;  2ITK A;  3ARP A;  4MTV A;  2IUZ A;  3JYJ A;  3UI4 A;  2M08 A;  4URI A;  3NI6 A;  1J4I A;  4MNL A;  4HBO A;  2KR7 A;  1J4H A;  4JYS A;  4L3N A;  3PRB A;  2WK2 A;  3KZ7 A;  2N87 A;  2XP6 A;  4ZPT R;  2LKN A;  4JFK A;  4ODN A;  2RSE A;  5GPR A;  1HJX A;  5I98 A;  4C02 B;  1IX5 A;  1W26 A;  4KQZ A;  3GPK A;  3ARU A;  1ZBK A;  2ESC A;  1YAT A;  4IQC A;  1FKR A;  2F2D A;  1LG1 A;  2XP9 A;  2DSZ A;  1RD6 A;  4R0X A;  4ODK A;  1NWT A;  2XP3 A;  1ITX A;  4N19 A;  4ODM A;  1FKF A;  2ZQT A;  2ZQV A;  1W1V A;  3ARV A;  2DPE A;  4BF8 A;  4U85 A;  2D9F A;  3UI5 A;  1HXV A;  2PBC A;  2FAP A;  1H0I A;  3KAH A;  1QPL A;  1ROT A;  4IPX A;  4TX0 A;  1E15 A;  1LL7 A;  5DO2 A;  1OGG A;  4LAX A;  1HKK A;  1HKI A;  2M1I A;  4TYO A;  1E9L A;  4JFL A;  4O2T A;  3OA5 A;  2FDM A;  3ARR A;  2IF4 A;  1B6C A;  1FKL A;  4QZV B;  1XHG A;  1ZB5 A;  4J4O A;  4ODR A;  4ZPW R;  2A3B A;  3ALF A;  2KE0 A;  4WKF A;  3G6L A;  2ZR6 A;  1EDQ A;  3CGM A;  3O5J A;  3WQV A;  3RM8 A;  4FAP A;  1SR0 A;  1W1P A;  4HAR A;  5B8I C;  2PPO A;  5J6E A;  4Z2J A;  1TCO C;  1ZCN A;  1HJV A;  3ARS A;  4Z2I A;  4JFJ A;  4WKA A;  2AWG A;  4ZS6 A;  2VN1 A;  1KFW A;  1FKT A;  4ODP A;  3WL1 A;  2ZQS A;  2XPB A;  1E6P A;  1C9H A;  4Z2K A;  4DRI A;  1FKH A;  2DT3 A;  3B9E A;  3ART A;  1UR8 A;  3IKD A;  2XP4 A;  1D7I A;  5DEZ A;  3CGN A;  3JXV A;  3ODK A;  4GGQ A;  2DSV A;  4S3J A;  2G8Z A;  3B8S A;  5HW6 A;  1CTN A;  4IT4 A;  1EIB A;  2JZV A;  1ZK6 A;  3I6C A;  4P8X A;  4DZ2 A;  1HKJ A;  3O5E A;  2DG9 A;  4L72 B;  4DT4 A;  4Z2G A;  3O5Q A;  5HTG A;  2QF8 A;  3RME A;  4S3K A;  2MLY A;  2F21 A;  1D7J A;  1Q6I A;  2KO7 A;  4NSB A;  2B31 A;  1TFV A;  3WD1 A;  2Q5A A;  2YBT A;  1R9H A;  3WQW A;  1LJY A;  2DG3 A;  3IKG A;  4Z2L A;  1FKS A;  4KR0 B;  2WLY A;  2MNT A;  3ALG A;  2PPN A;  1PBK A;  1LG2 A;  1X6N A;  2K8I A;  1KT1 A;  3CZ8 A;  1JND A;  1D2K A;  1FKI A;  2KFW A;  4ZPV R;  2ZR4 A;  5BXJ A;  4R5E A;  1D6O A;  1LQ0 A;  1NWU A;  1Q6H A;  4ODQ A;  1E6Z A;  4PTM A;  5HW8 A;  3IK8 A;  1ZL1 A;  4MNK A;  1FKD A;  3TDB A;  1EYM A;  3ARY A;  3CHF A;  4IQ2 A;  1SYT A;  1LL6 A;  1BKF A;  1KT0 A;  2XP5 A;  1Q6U A;  4LAY A;  2ZR5 A;  4LGX A;  1NSG A;  5DIV A;  1W1T A;  1H0G A;  3FY1 A;  4DRM A;  2O92 A;  4TNS A;  4QT2 A;  3NRK A;  1D7H A;  3AQU A;  1GUV A;  2F4E A;  4LAW A;  3WD0 A;  1PIN A;  2DG4 A;  2L2S A;  1ZU8 A;  3O5D A;  2RUR A;  1ZBV A;  2RUC A;  1BL4 A;  1J6Y A;  4P8U A;  1F8A B;  4DWS B;  2DSU A;  1XRV A;  2WLZ A;  4IT6 A;  1GOI A;  3QOK A;  2XPA A;  3WD2 A;  4Q22 A;  1L1P A;  2O9O A;  5HWC A;  2LPV A;  3O5F A;  4FN2 A;  2DT2 A;  2M2A A;  1NMV A;  1FFQ A;  1ZBC A;  3CHE A;  3KAD A;  4NZC A;  4W9P A;  5HW7 A;  1K9T A;  3WD3 A;  3JYM A;  1E6R A;  2PV2 A;  5DIU A;  1Y0O A;  4MNJ A;  1J4R A;  1O6I A;  1FJD A;  1OGB A;  3KAF A;  4G50 A;  4MNM A;  4WIW A;  4NNR A;  5HBF A;  2MPH A;  4TW8 A;  2RQS A;  5GPG A;  2XP8 A;  4GIV A;  4DWS D;  1WNO A;  1FKG A;  2VCD A;  4Q7N A;  4DRJ A;  3EY6 A;  3OOB A;  2YBU A;  3O5P A;  3TCZ A;  2MLZ A;  3O5R A;  4WJX A;  4WKH A;  1JVW A;  4DZ3 A;  3UQB A;  4ODO A;  4DWS A;  4MPK A;  3KAG A;  4DRO A;  2WM0 A;  1JNS A;  1YW5 A;  3KCE A;  4U86 A;  3VAW A;  2XP7 A;  2UZ5 A;  3ARZ A;  1E6N A;  4HBE A;  3B7X A;  4ITZ A;  3CH9 A;  1UR9 A;  3O5L A;  4P8W A;  3WL0 A;  5HT1 A;  3O5G A;  3G6M A;  3ARW A;  2MF9 A;  3NTP A;  3WD4 A;  1W1Y A;  1EHN A;  2RUD A;  5HWB A;  5D75 A;  3BXW A;  1N1A A;  2ZQU A;  3CHD A;  3PRD A;  2RUQ A;  3KAC A;  4W5U A;  2DT0 A;  5HUA A;  1FKJ A;  1P5Q A;  4WK9 A;  4W9O A;  3ARO A;  1W9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...