5HW7A

Candida albicans fkbp12 apo protein in p21212 space group
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
122
structure length
122
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVNGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
total genus 28
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hw7A00
2IF4A 1Q6IA 2M08A 3KABA 4QT3A 3PRBA 3UI5A 5DIVA 3UF8A 1Y0OA 1FD9A 1FKRA 2RUDA 1FKBA 3VAWA 2L2SA 2N87A 4JYSA 1KT0A 2DG9A 2ZQTA 4ODOA 5DITA 4DROA 4IQ2A 3GPKA 3UQIA 4DRNA 4U84A 1QPLA 4DT4A 4DRJA 4DZ3A 1FKFA 2RQSA 1A7XA 2VN1A 1FKDA 4O2TA 3TDBA 3NRKA 1FKSA 2ZR4A 3JYJA 3O5OA 4JFMA 4QT2A 2ZQVA 1NMWA 5HKGA 1J4RA 2FKEA 1W26A 2XP4A 4ODPA 1FJDA 2M2AA 1F40A 3O5EA 5HW6A 1D7IA 4JFJA 4DRQA 1BL4A 1ROUA 4FN2A 2F21A 3RGCA 3PA7A 1J6YA 2KE0A 4DRMA 1EQ3A 2KR7A 1EYMA 4U85A 2DG4A 4BF8A 2LKNA 3KADA 5HW8A 4TYOA 1QZ2A 4DZ2A 3O5IA 1BKFA 1Q1CA 3IK8A 3B7XA 4G50A 1PINA 2RUCA 3H9RB 4DH0A 3I6CA 1YW5A 2VCDA 1FAPA 3OOBA 3UI6A 4DRKA 2ZR5A 4ODKA 1C9HA 1ZCNA 3CGNA 3KAGA 5GPGA 2LJ4A 4TNSA 2RSEA 1JVWA 1YATA 2Q5AA 3IHZA 3KAHA 2KI3A 1D7JA 3NTPA 2PPNA 4DRIA 1JNSA 4C02B 4IPXA 4IQCA 3CGMA 5D75A 4DRHA 1FKTA 2XP7A 1ZK6A 3KZ7A 2UZ5A 3FAPA 4GIVA 1L1PA 1FKKA 5HWBA 3EY6A 2PBCA 2ITKA 3O5KA 1FKJA 3O5MA 4U86A 4W9PA 2XP8A 2KFWA 3KAIA 3TC5A 3O5GA 2LPVA 1HXVA 1P5QA 3O5PA 4TW6A 4ODMA 4LAWA 3KACA 5HWCA 3TCZA 1Q6HA 4LAVA 1PBKA 4GGQA 3KCEA 1B6CA 2MPHA 2DG3A 4QIBA 1JNTA 1M5YA 4G2PA 4JFKA 2MLZA 2PV3A 2PV2A 1N1AA 4JFIA 4R0XA 1KT1A 2KO7A 2LGOA 2OFNA 2XP5A 1J4IA 2MF9A 1J4HA 2MLYA 4W9OA 1Q6UA 4TW8A 2ZQUA 4MGVA 5B8IC 2XP9A 1NSGA 3PRDA 2ZR6A 4DIPA 2XP6A 3LUOA 3UQAA 3JYMA 5I98A 3O5JA 2FAPA 4TW7A 3O5LA 4N19A 2PPOA 1FKGA 3WH0A 5HTGA 3O5DA 2MLXA 3UQBA 4J4OA 2D9FA 1R9HA 2PV1A 1FKHA 5HT1A 3KAFA 1D7HA 2Y78A 3O5QA 2F4EA 2MNTA 1D6OA 4W9QA 5J6EA 5HUAA 2RURA 2JZVA 3O5FA 4MSPA 4JFLA 4ODQA 4LAXA 4FAPA 4NNRA 2XPAA 4J4NA 4ODNA 1ROTA 4ITZA 2M1IA 4ODRA 3MDYB 3NI6A 2RUQA 4ODLA 3RFWA 2XPBA 4TX0A 2XP3A 1TCOC 1T11A 4DRPA 5BXJA 1F8AB 5HW7A 2KGJA 2PPPA 1FKIA 4LAYA 2F2DA 3JXVA 1QPFA 2K8IA 2ZQSA 5DIUA 3UI4A 3IKGA 3O5RA 1NMVA 3IKDA 1FKLA 1U79A 3ODKA 2AWGA
chains in the Genus database with same CATH superfamily
3RM9A 2M08A 3PRBA 1Y0OA 4IT6A 3VAWA 2L2SA 4DROA 2ZQTA 3GPKA 3CHDA 4DRJA 1HJVA 3TDBA 3WL1A 4WJXA 1ZU8A 1NWUA 2ZR4A 4W5UA 4QT2A 5HKGA 2ZQVA 1NMWA 1J4RA 5GQBA 3FY1A 3O5EA 3WIJA 2DSVA 1GUVA 4FN2A 4DRMA 3RMEA 1JNEA 2DG4A 5HW8A 4TYOA 1QZ2A 3CH9A 3O5IA 1BKFA 1Q1CA 4G50A 2P4VA 3I6CA 3ALFA 3OA5A 3OOBA 3UI6A 1ZCNA 5GPGA 2QF8A 1LL4A 3WD1A 4DRIA 2KI3A 2ETNA 4ZPWR 3ALGA 4C02B 3CGMA 4DRHA 1EDQA 5DO2A 2XP7A 2UZ5A 3FAPA 4ML4A 1K9TA 2PBCA 3O5MA 1W9PA 3TC5A 2XP8A 1IX5A 4Z2KA 1W1PA 4LAWA 3KACA 4LAVA 3KCEA 1ZBWA 5DF0A 1JNTA 1M5YA 4LGXA 2PV3A 3WL0A 1XHGA 1LL7A 1WAWA 2MF9A 3ARUA 1J4HA 1OGBA 1Q6UA 5DEZA 2XP9A 2WLZA 4DIPA 5I98A 3WH0A 3UQBA 3O5DA 2AOSA 1R9HA 4WKHA 1FKHA 1CTNA 2Y78A 3O5QA 5J6EA 2RURA 1KFWA 4ODQA 2WK2A 4QZVB 4LAXA 4NNRA 2XPAA 4J4NA 2O92A 3AS2A 1LG1A 3RFWA 1O6IA 2XPBA 4DRPA 1T11A 2O9OA 4DWSD 2YBTA 3ARZA 2F2DA 1FKLA 5DIUA 1NMVA 4N19A 1ZB5A 2MLYA 4MAVA 3WD0A 4ZPTR 1FKBA 2N87A 5HW6A 4DRNA 4ODOA 5DITA 1W1TA 1UR8A 3G6LA 1E6NA 2RQSA 1RD6A 2VN1A 1W9VA 1HKMA 3FXYA 1FKSA 3GTYX 3JYJA 3O5OA 4WK9A 5HBFA 2XP4A 4ODPA 1FJDA 4DRQA 2WLYA 2F21A 3PA7A 1J6YA 4S3JA 4HBOA 4U85A 1ZBVA 3KADA 2G8ZA 1ZBKA 4DH0A 1YW5A 1FAPA 4DRKA 4ODKA 1HKJA 3AS0A 1E6RA 1D7JA 2PPNA 1JNSA 4IPXA 5D75A 4P8UA 1ZK6A 1E9LA 1W1VA 4GIVA 1L1PA 3G6MA 4R5EA 5HWBA 3O5KA 4ZS6A 3GU0A 2B31A 3KAIA 5GPRA 3O5GA 2LPVA 4HARA 1HXVA 1P5QA 4P8WA 4TW6A 4AY1A 4ODMA 3TCZA 4PTMA 5JH8A 1B6CA 2MPHA 4JFKA 4L3NA 4R0XA 3CHCA 4URIA 2OFNA 2XP5A 1J4IA 3CZ8A 4XAKA 1SYTA 4TW8A 5B8IC 1NSGA 2ZR6A 2XP6A 3LUOA 4UDMA 3UQAA 3EIPA 1LJYA 4J4OA 3KAFA 1D7HA 2MNTA 1WB0A 4FAPA 4Q22A 1ROTA 4ITZA 2M1IA 1NH6A 4Q7NA 3MDYB 3NI6A 3PRAA 2DSZA 5BXJA 1X6NA 1FKIA 2G41A 4MTVA 1QPFA 2K8IA 2OLHA 3UI4A 3WD2A 1U79A 3ODKA 2AWGA 3KABA 4QT3A 1W1YA 5DIVA 3UF8A 1FKRA 1FD9A 1UR9A 1KT0A 2DG9A 4MPKA 4DT4A 1QPLA 2PI6A 4DZ3A 1FKFA 1NWRA 4O2TA 1ZL1A 4Z2JA 1W26A 2M2AA 1F40A 3ARRA 1D7IA 4MNKA 1BL4A 1HJXA 2A3EA 1EQ3A 2KE0A 2EULA 2LKNA 3RM4A 2DT0A 4MNMA 3WD4A 4DWSB 4DZ2A 3B9AA 3B7XA 3H9RB 3PR9A 1HKKA 1LG2A 1C9HA 1TFVA 1E44A 3KAGA 2LJ4A 3ARTA 2RSEA 1JVWA 3IHZA 3NTPA 1JNDA 3QOKA 3W4RA 1FKTA 2WM0A 3EY6A 5HUAA 4W9PA 1FKJA 1E6ZA 2KFWA 3AROA 2DSWA 3O5PA 1EHNA 4P8VA 1Q6HA 4GGQA 1W9UA 2DG3A 1LQ0A 4G2PA 4QIBA 3ARQA 4MNJA 2MLZA 3ARWA 4Z2GA 2PV2A 4JFIA 1KT1A 2LGOA 3RM8A 4W9OA 2IUZA 4DWSC 4S3KA 3PRDA 1GRJA 4ZPVR 2DT3A 4TW7A 2FAPA 3O5LA 4L72B 2PPOA 1FKGA 4HBEA 3WQWA 1GOIA 1VF8A 5HT1A 2F4EA 1D6OA 4P8XA 3O5FA 3AS3A 4JFLA 2ESCA 2PN0A 3WKZA 2YBUA 4ODNA 4ODRA 2DSUA 2RUQA 3ARPA 4ODLA 2A3BA 3B9EA 1TCOC 1SR0A 5HW7A 2KGJA 4LAYA 4Z2HA 1H0IA 2ZQSA 3CHFA 1FFRA 1LL6A 3O5RA 1GPFA 2IF4A 1Q6IA 3UI5A 4NZCA 1H0GA 2RUDA 4JYSA 4IQ2A 3UQIA 4U84A 1EIBA 1E6PA 1A7XA 1FKDA 4KR0B 3NRKA 2DT1A 4MNLA 4JFMA 2FKEA 4JFJA 4WIWA 4DWSA 1ROUA 2F23A 3AQUA 2DT2A 3BXWA 3RGCA 3ARSA 2KR7A 1EYMA 1ZBCA 4BF8A 1NWSA 1ITXA 1OGGA 3IK8A 1PINA 2RUCA 3AS1A 2VCDA 2DPEA 1E15A 2ZR5A 3WQVA 3ARYA 3CGNA 4TNSA 1YATA 2Q5AA 4Z2IA 3KAHA 4IQCA 3ARVA 3KZ7A 1D2KA 1FKKA 2A3AA 2ITKA 2A3CA 1HKIA 4U86A 4WKAA 4NSBA 5HWCA 1PBKA 3B8SA 4IT4A 1N1AA 1NWTA 2KO7A 4Z2LA 3BMBA 2B5UB 2ZQUA 4MGVA 3JYMA 3O5JA 3B9DA 5HTGA 2MLXA 2D9FA 1HJWA 1FFQA 1XRVA 4W9QA 2JZVA 4MSPA 1WNOA 4KQZA 3ARXA 3CHEA 1JCHB 2FDMA 3WD3A 4TX0A 2XP3A 1X6LA 1F8AB 4WKFA 2PPPA 1OWQA 3IKGA 3IKDA 3JXVA 2PV1A
chains in the Genus database with same CATH topology
3RM9A 2M08A 3PRBA 1Y0OA 4IT6A 3VAWA 2L2SA 4DROA 2ZQTA 3GPKA 3CHDA 4DRJA 1HJVA 3TDBA 3WL1A 4WJXA 1ZU8A 1NWUA 2ZR4A 4W5UA 4QT2A 5HKGA 2ZQVA 1NMWA 1J4RA 5GQBA 3FY1A 3O5EA 3WIJA 2DSVA 1GUVA 4FN2A 4DRMA 3RMEA 1JNEA 2DG4A 5HW8A 4TYOA 1QZ2A 3CH9A 3O5IA 1BKFA 1Q1CA 4G50A 3I6CA 3ALFA 3OA5A 3OOBA 3UI6A 1ZCNA 5GPGA 2QF8A 1LL4A 3WD1A 4DRIA 2KI3A 4ZPWR 3ALGA 4C02B 3CGMA 4DRHA 1EDQA 5DO2A 2XP7A 2UZ5A 3FAPA 4ML4A 1K9TA 2PBCA 3O5MA 1W9PA 3TC5A 2XP8A 1IX5A 4Z2KA 1W1PA 4LAWA 3KACA 4LAVA 3KCEA 1ZBWA 5DF0A 1JNTA 1M5YA 4LGXA 2PV3A 3WL0A 1XHGA 1LL7A 1WAWA 2MF9A 3ARUA 1J4HA 1OGBA 1Q6UA 5DEZA 2XP9A 2WLZA 4DIPA 5I98A 3WH0A 3UQBA 3O5DA 2AOSA 1R9HA 4WKHA 1FKHA 1CTNA 2Y78A 3O5QA 5J6EA 2RURA 1KFWA 4ODQA 2WK2A 4QZVB 4LAXA 4NNRA 2XPAA 4J4NA 2O92A 3AS2A 1LG1A 3RFWA 1O6IA 2XPBA 4DRPA 1T11A 2O9OA 4DWSD 2YBTA 3ARZA 2F2DA 1FKLA 5DIUA 1NMVA 4N19A 1ZB5A 2MLYA 4MAVA 3WD0A 4ZPTR 1FKBA 2N87A 5HW6A 4DRNA 4ODOA 5DITA 1W1TA 1UR8A 3G6LA 1E6NA 2RQSA 1RD6A 2VN1A 1W9VA 1HKMA 3FXYA 1FKSA 3JYJA 3O5OA 4WK9A 5HBFA 2XP4A 4ODPA 1FJDA 4DRQA 2WLYA 2F21A 3PA7A 1J6YA 4S3JA 4HBOA 4U85A 1ZBVA 3KADA 2G8ZA 1ZBKA 4DH0A 1YW5A 1FAPA 4DRKA 4ODKA 1HKJA 3AS0A 1E6RA 1D7JA 2PPNA 1JNSA 4IPXA 5D75A 4P8UA 1ZK6A 1E9LA 1W1VA 4GIVA 1L1PA 3G6MA 4R5EA 5HWBA 3O5KA 4ZS6A 2B31A 3KAIA 5GPRA 3O5GA 2LPVA 4HARA 1HXVA 1P5QA 4P8WA 4TW6A 4AY1A 4ODMA 3TCZA 4PTMA 5JH8A 1B6CA 2MPHA 4JFKA 4L3NA 4R0XA 3CHCA 4URIA 2OFNA 2XP5A 1J4IA 3CZ8A 4XAKA 1SYTA 4TW8A 5B8IC 1NSGA 2ZR6A 2XP6A 3LUOA 3UQAA 1LJYA 4J4OA 3KAFA 1D7HA 2MNTA 1WB0A 4FAPA 4Q22A 1ROTA 4ITZA 2M1IA 1NH6A 4Q7NA 3MDYB 3NI6A 3PRAA 2DSZA 5BXJA 1X6NA 1FKIA 2G41A 4MTVA 1QPFA 2K8IA 2OLHA 3UI4A 3WD2A 1U79A 3ODKA 2AWGA 3KABA 4QT3A 1W1YA 5DIVA 3UF8A 1FKRA 1FD9A 1UR9A 1KT0A 2DG9A 4MPKA 4DT4A 1QPLA 2PI6A 4DZ3A 1FKFA 1NWRA 4O2TA 1ZL1A 4Z2JA 1W26A 2M2AA 1F40A 3ARRA 1D7IA 4MNKA 1BL4A 1HJXA 2A3EA 1EQ3A 2KE0A 2LKNA 3RM4A 2DT0A 4MNMA 3WD4A 4DWSB 4DZ2A 3B9AA 3B7XA 3H9RB 3PR9A 1HKKA 1LG2A 1C9HA 1TFVA 3KAGA 2LJ4A 3ARTA 2RSEA 1JVWA 3IHZA 3NTPA 1JNDA 3QOKA 3W4RA 1FKTA 2WM0A 3EY6A 5HUAA 4W9PA 1FKJA 1E6ZA 2KFWA 3AROA 2DSWA 3O5PA 1EHNA 4P8VA 1Q6HA 4GGQA 1W9UA 2DG3A 1LQ0A 4G2PA 4QIBA 3ARQA 4MNJA 2MLZA 3ARWA 4Z2GA 2PV2A 4JFIA 1KT1A 2LGOA 3RM8A 4W9OA 2IUZA 4DWSC 4S3KA 3PRDA 4ZPVR 2DT3A 4TW7A 2FAPA 3O5LA 4L72B 2PPOA 1FKGA 4HBEA 3WQWA 1GOIA 1VF8A 5HT1A 2F4EA 1D6OA 4P8XA 3O5FA 3AS3A 4JFLA 2ESCA 3WKZA 2YBUA 4ODNA 4ODRA 2DSUA 2RUQA 3ARPA 4ODLA 2A3BA 3B9EA 1TCOC 1SR0A 5HW7A 2KGJA 4LAYA 4Z2HA 1H0IA 2ZQSA 3CHFA 1FFRA 1LL6A 3O5RA 1GPFA 2IF4A 1Q6IA 3UI5A 4NZCA 1H0GA 2RUDA 4JYSA 4IQ2A 3UQIA 4U84A 1EIBA 1E6PA 1A7XA 1FKDA 4KR0B 3NRKA 2DT1A 4MNLA 4JFMA 2FKEA 4JFJA 4WIWA 4DWSA 1ROUA 3AQUA 3RGCA 2DT2A 3BXWA 3ARSA 2KR7A 1EYMA 1ZBCA 4BF8A 1NWSA 1ITXA 1OGGA 3IK8A 1PINA 2RUCA 3AS1A 2VCDA 2DPEA 1E15A 2ZR5A 3WQVA 3ARYA 3CGNA 4TNSA 1YATA 2Q5AA 4Z2IA 3KAHA 4IQCA 3ARVA 3KZ7A 1D2KA 1FKKA 2A3AA 2ITKA 2A3CA 1HKIA 4U86A 4WKAA 4NSBA 5HWCA 1PBKA 3B8SA 4IT4A 1N1AA 1NWTA 2KO7A 4Z2LA 2ZQUA 4MGVA 3JYMA 3O5JA 3B9DA 5HTGA 2MLXA 2D9FA 1HJWA 1FFQA 1XRVA 4W9QA 2JZVA 4MSPA 1WNOA 4KQZA 3ARXA 3CHEA 2FDMA 3WD3A 4TX0A 2XP3A 1X6LA 1F8AB 4WKFA 2PPPA 1OWQA 3IKGA 3IKDA 3JXVA 2PV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IF4 A;  1Q6I A;  2M08 A;  3KAB A;  4QT3 A;  3PRB A;  3UI5 A;  5DIV A;  3UF8 A;  1Y0O A;  1FD9 A;  1FKR A;  2RUD A;  1FKB A;  3VAW A;  2L2S A;  2N87 A;  4JYS A;  1KT0 A;  2DG9 A;  2ZQT A;  4ODO A;  5DIT A;  4DRO A;  4IQ2 A;  3GPK A;  3UQI A;  4DRN A;  4U84 A;  1QPL A;  4DT4 A;  4DRJ A;  4DZ3 A;  1FKF A;  2RQS A;  1A7X A;  2VN1 A;  1FKD A;  4O2T A;  3TDB A;  3NRK A;  1FKS A;  2ZR4 A;  3JYJ A;  3O5O A;  4JFM A;  4QT2 A;  2ZQV A;  1NMW A;  5HKG A;  1J4R A;  2FKE A;  1W26 A;  2XP4 A;  4ODP A;  1FJD A;  2M2A A;  1F40 A;  3O5E A;  5HW6 A;  1D7I A;  4JFJ A;  4DRQ A;  1BL4 A;  1ROU A;  4FN2 A;  2F21 A;  3RGC A;  3PA7 A;  1J6Y A;  2KE0 A;  4DRM A;  1EQ3 A;  2KR7 A;  1EYM A;  4U85 A;  2DG4 A;  4BF8 A;  2LKN A;  3KAD A;  5HW8 A;  4TYO A;  1QZ2 A;  4DZ2 A;  3O5I A;  1BKF A;  1Q1C A;  3IK8 A;  3B7X A;  4G50 A;  1PIN A;  2RUC A;  3H9R B;  4DH0 A;  3I6C A;  1YW5 A;  2VCD A;  1FAP A;  3OOB A;  3UI6 A;  4DRK A;  2ZR5 A;  4ODK A;  1C9H A;  1ZCN A;  3CGN A;  3KAG A;  5GPG A;  2LJ4 A;  4TNS A;  2RSE A;  1JVW A;  1YAT A;  2Q5A A;  3IHZ A;  3KAH A;  2KI3 A;  1D7J A;  3NTP A;  2PPN A;  4DRI A;  1JNS A;  4C02 B;  4IPX A;  4IQC A;  3CGM A;  5D75 A;  4DRH A;  1FKT A;  2XP7 A;  1ZK6 A;  3KZ7 A;  2UZ5 A;  3FAP A;  4GIV A;  1L1P A;  1FKK A;  5HWB A;  3EY6 A;  2PBC A;  2ITK A;  3O5K A;  1FKJ A;  3O5M A;  4U86 A;  4W9P A;  2XP8 A;  2KFW A;  3KAI A;  3TC5 A;  3O5G A;  2LPV A;  1HXV A;  1P5Q A;  3O5P A;  4TW6 A;  4ODM A;  4LAW A;  3KAC A;  5HWC A;  3TCZ A;  1Q6H A;  4LAV A;  1PBK A;  4GGQ A;  3KCE A;  1B6C A;  2MPH A;  2DG3 A;  4QIB A;  1JNT A;  1M5Y A;  4G2P A;  4JFK A;  2MLZ A;  2PV3 A;  2PV2 A;  1N1A A;  4JFI A;  4R0X A;  1KT1 A;  2KO7 A;  2LGO A;  2OFN A;  2XP5 A;  1J4I A;  2MF9 A;  1J4H A;  2MLY A;  4W9O A;  1Q6U A;  4TW8 A;  2ZQU A;  4MGV A;  5B8I C;  2XP9 A;  1NSG A;  3PRD A;  2ZR6 A;  4DIP A;  2XP6 A;  3LUO A;  3UQA A;  3JYM A;  5I98 A;  3O5J A;  2FAP A;  4TW7 A;  3O5L A;  4N19 A;  2PPO A;  1FKG A;  3WH0 A;  5HTG A;  3O5D A;  2MLX A;  3UQB A;  4J4O A;  2D9F A;  1R9H A;  2PV1 A;  1FKH A;  5HT1 A;  3KAF A;  1D7H A;  2Y78 A;  3O5Q A;  2F4E A;  2MNT A;  1D6O A;  4W9Q A;  5J6E A;  5HUA A;  2RUR A;  2JZV A;  3O5F A;  4MSP A;  4JFL A;  4ODQ A;  4LAX A;  4FAP A;  4NNR A;  2XPA A;  4J4N A;  4ODN A;  1ROT A;  4ITZ A;  2M1I A;  4ODR A;  3MDY B;  3NI6 A;  2RUQ A;  4ODL A;  3RFW A;  2XPB A;  4TX0 A;  2XP3 A;  1TCO C;  1T11 A;  4DRP A;  5BXJ A;  1F8A B;  5HW7 A;  2KGJ A;  2PPP A;  1FKI A;  4LAY A;  2F2D A;  3JXV A;  1QPF A;  2K8I A;  2ZQS A;  5DIU A;  3UI4 A;  3IKG A;  3O5R A;  1NMV A;  3IKD A;  1FKL A;  1U79 A;  3ODK A;  2AWG A; 
#chains in the Genus database with same CATH topology
 3RM9 A;  2M08 A;  3PRB A;  1Y0O A;  4IT6 A;  3VAW A;  2L2S A;  4DRO A;  2ZQT A;  3GPK A;  3CHD A;  4DRJ A;  1HJV A;  3TDB A;  3WL1 A;  4WJX A;  1ZU8 A;  1NWU A;  2ZR4 A;  4W5U A;  4QT2 A;  5HKG A;  2ZQV A;  1NMW A;  1J4R A;  5GQB A;  3FY1 A;  3O5E A;  3WIJ A;  2DSV A;  1GUV A;  4FN2 A;  4DRM A;  3RME A;  1JNE A;  2DG4 A;  5HW8 A;  4TYO A;  1QZ2 A;  3CH9 A;  3O5I A;  1BKF A;  1Q1C A;  4G50 A;  2P4V A;  3I6C A;  3ALF A;  3OA5 A;  3OOB A;  3UI6 A;  1ZCN A;  5GPG A;  2QF8 A;  1LL4 A;  3WD1 A;  4DRI A;  2KI3 A;  2ETN A;  4ZPW R;  3ALG A;  4C02 B;  3CGM A;  4DRH A;  1EDQ A;  5DO2 A;  2XP7 A;  2UZ5 A;  3FAP A;  4ML4 A;  1K9T A;  2PBC A;  3O5M A;  1W9P A;  3TC5 A;  2XP8 A;  1IX5 A;  4Z2K A;  1W1P A;  4LAW A;  3KAC A;  4LAV A;  3KCE A;  1ZBW A;  5DF0 A;  1JNT A;  1M5Y A;  4LGX A;  2PV3 A;  3WL0 A;  1XHG A;  1LL7 A;  1WAW A;  2MF9 A;  3ARU A;  1J4H A;  1OGB A;  1Q6U A;  5DEZ A;  2XP9 A;  2WLZ A;  4DIP A;  5I98 A;  3WH0 A;  3UQB A;  3O5D A;  2AOS A;  1R9H A;  4WKH A;  1FKH A;  1CTN A;  2Y78 A;  3O5Q A;  5J6E A;  2RUR A;  1KFW A;  4ODQ A;  2WK2 A;  4QZV B;  4LAX A;  4NNR A;  2XPA A;  4J4N A;  2O92 A;  3AS2 A;  1LG1 A;  3RFW A;  1O6I A;  2XPB A;  4DRP A;  1T11 A;  2O9O A;  4DWS D;  2YBT A;  3ARZ A;  2F2D A;  1FKL A;  5DIU A;  1NMV A;  4N19 A;  1ZB5 A;  2MLY A;  4MAV A;  3WD0 A;  4ZPT R;  1FKB A;  2N87 A;  5HW6 A;  4DRN A;  4ODO A;  5DIT A;  1W1T A;  1UR8 A;  3G6L A;  1E6N A;  2RQS A;  1RD6 A;  2VN1 A;  1W9V A;  1HKM A;  3FXY A;  1FKS A;  3GTY X;  3JYJ A;  3O5O A;  4WK9 A;  5HBF A;  2XP4 A;  4ODP A;  1FJD A;  4DRQ A;  2WLY A;  2F21 A;  3PA7 A;  1J6Y A;  4S3J A;  4HBO A;  4U85 A;  1ZBV A;  3KAD A;  2G8Z A;  1ZBK A;  4DH0 A;  1YW5 A;  1FAP A;  4DRK A;  4ODK A;  1HKJ A;  3AS0 A;  1E6R A;  1D7J A;  2PPN A;  1JNS A;  4IPX A;  5D75 A;  4P8U A;  1ZK6 A;  1E9L A;  1W1V A;  4GIV A;  1L1P A;  3G6M A;  4R5E A;  5HWB A;  3O5K A;  4ZS6 A;  3GU0 A;  2B31 A;  3KAI A;  5GPR A;  3O5G A;  2LPV A;  4HAR A;  1HXV A;  1P5Q A;  4P8W A;  4TW6 A;  4AY1 A;  4ODM A;  3TCZ A;  4PTM A;  5JH8 A;  1B6C A;  2MPH A;  4JFK A;  4L3N A;  4R0X A;  3CHC A;  4URI A;  2OFN A;  2XP5 A;  1J4I A;  3CZ8 A;  4XAK A;  1SYT A;  4TW8 A;  5B8I C;  1NSG A;  2ZR6 A;  2XP6 A;  3LUO A;  4UDM A;  3UQA A;  3EIP A;  1LJY A;  4J4O A;  3KAF A;  1D7H A;  2MNT A;  1WB0 A;  4FAP A;  4Q22 A;  1ROT A;  4ITZ A;  2M1I A;  1NH6 A;  4Q7N A;  3MDY B;  3NI6 A;  3PRA A;  2DSZ A;  5BXJ A;  1X6N A;  1FKI A;  2G41 A;  4MTV A;  1QPF A;  2K8I A;  2OLH A;  3UI4 A;  3WD2 A;  1U79 A;  3ODK A;  2AWG A;  3KAB A;  4QT3 A;  1W1Y A;  5DIV A;  3UF8 A;  1FKR A;  1FD9 A;  1UR9 A;  1KT0 A;  2DG9 A;  4MPK A;  4DT4 A;  1QPL A;  2PI6 A;  4DZ3 A;  1FKF A;  1NWR A;  4O2T A;  1ZL1 A;  4Z2J A;  1W26 A;  2M2A A;  1F40 A;  3ARR A;  1D7I A;  4MNK A;  1BL4 A;  1HJX A;  2A3E A;  1EQ3 A;  2KE0 A;  2EUL A;  2LKN A;  3RM4 A;  2DT0 A;  4MNM A;  3WD4 A;  4DWS B;  4DZ2 A;  3B9A A;  3B7X A;  3H9R B;  3PR9 A;  1HKK A;  1LG2 A;  1C9H A;  1TFV A;  1E44 A;  3KAG A;  2LJ4 A;  3ART A;  2RSE A;  1JVW A;  3IHZ A;  3NTP A;  1JND A;  3QOK A;  3W4R A;  1FKT A;  2WM0 A;  3EY6 A;  5HUA A;  4W9P A;  1FKJ A;  1E6Z A;  2KFW A;  3ARO A;  2DSW A;  3O5P A;  1EHN A;  4P8V A;  1Q6H A;  4GGQ A;  1W9U A;  2DG3 A;  1LQ0 A;  4G2P A;  4QIB A;  3ARQ A;  4MNJ A;  2MLZ A;  3ARW A;  4Z2G A;  2PV2 A;  4JFI A;  1KT1 A;  2LGO A;  3RM8 A;  4W9O A;  2IUZ A;  4DWS C;  4S3K A;  3PRD A;  1GRJ A;  4ZPV R;  2DT3 A;  4TW7 A;  2FAP A;  3O5L A;  4L72 B;  2PPO A;  1FKG A;  4HBE A;  3WQW A;  1GOI A;  1VF8 A;  5HT1 A;  2F4E A;  1D6O A;  4P8X A;  3O5F A;  3AS3 A;  4JFL A;  2ESC A;  2PN0 A;  3WKZ A;  2YBU A;  4ODN A;  4ODR A;  2DSU A;  2RUQ A;  3ARP A;  4ODL A;  2A3B A;  3B9E A;  1TCO C;  1SR0 A;  5HW7 A;  2KGJ A;  4LAY A;  4Z2H A;  1H0I A;  2ZQS A;  3CHF A;  1FFR A;  1LL6 A;  3O5R A;  1GPF A;  2IF4 A;  1Q6I A;  3UI5 A;  4NZC A;  1H0G A;  2RUD A;  4JYS A;  4IQ2 A;  3UQI A;  4U84 A;  1EIB A;  1E6P A;  1A7X A;  1FKD A;  4KR0 B;  3NRK A;  2DT1 A;  4MNL A;  4JFM A;  2FKE A;  4JFJ A;  4WIW A;  4DWS A;  1ROU A;  2F23 A;  3AQU A;  2DT2 A;  3BXW A;  3RGC A;  3ARS A;  2KR7 A;  1EYM A;  1ZBC A;  4BF8 A;  1NWS A;  1ITX A;  1OGG A;  3IK8 A;  1PIN A;  2RUC A;  3AS1 A;  2VCD A;  2DPE A;  1E15 A;  2ZR5 A;  3WQV A;  3ARY A;  3CGN A;  4TNS A;  1YAT A;  2Q5A A;  4Z2I A;  3KAH A;  4IQC A;  3ARV A;  3KZ7 A;  1D2K A;  1FKK A;  2A3A A;  2ITK A;  2A3C A;  1HKI A;  4U86 A;  4WKA A;  4NSB A;  5HWC A;  1PBK A;  3B8S A;  4IT4 A;  1N1A A;  1NWT A;  2KO7 A;  4Z2L A;  3BMB A;  2B5U B;  2ZQU A;  4MGV A;  3JYM A;  3O5J A;  3B9D A;  5HTG A;  2MLX A;  2D9F A;  1HJW A;  1FFQ A;  1XRV A;  4W9Q A;  2JZV A;  4MSP A;  1WNO A;  4KQZ A;  3ARX A;  3CHE A;  1JCH B;  2FDM A;  3WD3 A;  4TX0 A;  2XP3 A;  1X6L A;  1F8A B;  4WKF A;  2PPP A;  1OWQ A;  3IKG A;  3IKD A;  3JXV A;  2PV1 A; 
#chains in the Genus database with same CATH homology
 3RM9 A;  2M08 A;  3PRB A;  1Y0O A;  4IT6 A;  3VAW A;  2L2S A;  4DRO A;  2ZQT A;  3GPK A;  3CHD A;  4DRJ A;  1HJV A;  3TDB A;  3WL1 A;  4WJX A;  1ZU8 A;  1NWU A;  2ZR4 A;  4W5U A;  4QT2 A;  5HKG A;  2ZQV A;  1NMW A;  1J4R A;  5GQB A;  3FY1 A;  3O5E A;  3WIJ A;  2DSV A;  1GUV A;  4FN2 A;  4DRM A;  3RME A;  1JNE A;  2DG4 A;  5HW8 A;  4TYO A;  1QZ2 A;  3CH9 A;  3O5I A;  1BKF A;  1Q1C A;  4G50 A;  3I6C A;  3ALF A;  3OA5 A;  3OOB A;  3UI6 A;  1ZCN A;  5GPG A;  2QF8 A;  1LL4 A;  3WD1 A;  4DRI A;  2KI3 A;  4ZPW R;  3ALG A;  4C02 B;  3CGM A;  4DRH A;  1EDQ A;  5DO2 A;  2XP7 A;  2UZ5 A;  3FAP A;  4ML4 A;  1K9T A;  2PBC A;  3O5M A;  1W9P A;  3TC5 A;  2XP8 A;  1IX5 A;  4Z2K A;  1W1P A;  4LAW A;  3KAC A;  4LAV A;  3KCE A;  1ZBW A;  5DF0 A;  1JNT A;  1M5Y A;  4LGX A;  2PV3 A;  3WL0 A;  1XHG A;  1LL7 A;  1WAW A;  2MF9 A;  3ARU A;  1J4H A;  1OGB A;  1Q6U A;  5DEZ A;  2XP9 A;  2WLZ A;  4DIP A;  5I98 A;  3WH0 A;  3UQB A;  3O5D A;  2AOS A;  1R9H A;  4WKH A;  1FKH A;  1CTN A;  2Y78 A;  3O5Q A;  5J6E A;  2RUR A;  1KFW A;  4ODQ A;  2WK2 A;  4QZV B;  4LAX A;  4NNR A;  2XPA A;  4J4N A;  2O92 A;  3AS2 A;  1LG1 A;  3RFW A;  1O6I A;  2XPB A;  4DRP A;  1T11 A;  2O9O A;  4DWS D;  2YBT A;  3ARZ A;  2F2D A;  1FKL A;  5DIU A;  1NMV A;  4N19 A;  1ZB5 A;  2MLY A;  4MAV A;  3WD0 A;  4ZPT R;  1FKB A;  2N87 A;  5HW6 A;  4DRN A;  4ODO A;  5DIT A;  1W1T A;  1UR8 A;  3G6L A;  1E6N A;  2RQS A;  1RD6 A;  2VN1 A;  1W9V A;  1HKM A;  3FXY A;  1FKS A;  3JYJ A;  3O5O A;  4WK9 A;  5HBF A;  2XP4 A;  4ODP A;  1FJD A;  4DRQ A;  2WLY A;  2F21 A;  3PA7 A;  1J6Y A;  4S3J A;  4HBO A;  4U85 A;  1ZBV A;  3KAD A;  2G8Z A;  1ZBK A;  4DH0 A;  1YW5 A;  1FAP A;  4DRK A;  4ODK A;  1HKJ A;  3AS0 A;  1E6R A;  1D7J A;  2PPN A;  1JNS A;  4IPX A;  5D75 A;  4P8U A;  1ZK6 A;  1E9L A;  1W1V A;  4GIV A;  1L1P A;  3G6M A;  4R5E A;  5HWB A;  3O5K A;  4ZS6 A;  2B31 A;  3KAI A;  5GPR A;  3O5G A;  2LPV A;  4HAR A;  1HXV A;  1P5Q A;  4P8W A;  4TW6 A;  4AY1 A;  4ODM A;  3TCZ A;  4PTM A;  5JH8 A;  1B6C A;  2MPH A;  4JFK A;  4L3N A;  4R0X A;  3CHC A;  4URI A;  2OFN A;  2XP5 A;  1J4I A;  3CZ8 A;  4XAK A;  1SYT A;  4TW8 A;  5B8I C;  1NSG A;  2ZR6 A;  2XP6 A;  3LUO A;  3UQA A;  1LJY A;  4J4O A;  3KAF A;  1D7H A;  2MNT A;  1WB0 A;  4FAP A;  4Q22 A;  1ROT A;  4ITZ A;  2M1I A;  1NH6 A;  4Q7N A;  3MDY B;  3NI6 A;  3PRA A;  2DSZ A;  5BXJ A;  1X6N A;  1FKI A;  2G41 A;  4MTV A;  1QPF A;  2K8I A;  2OLH A;  3UI4 A;  3WD2 A;  1U79 A;  3ODK A;  2AWG A;  3KAB A;  4QT3 A;  1W1Y A;  5DIV A;  3UF8 A;  1FKR A;  1FD9 A;  1UR9 A;  1KT0 A;  2DG9 A;  4MPK A;  4DT4 A;  1QPL A;  2PI6 A;  4DZ3 A;  1FKF A;  1NWR A;  4O2T A;  1ZL1 A;  4Z2J A;  1W26 A;  2M2A A;  1F40 A;  3ARR A;  1D7I A;  4MNK A;  1BL4 A;  1HJX A;  2A3E A;  1EQ3 A;  2KE0 A;  2LKN A;  3RM4 A;  2DT0 A;  4MNM A;  3WD4 A;  4DWS B;  4DZ2 A;  3B9A A;  3B7X A;  3H9R B;  3PR9 A;  1HKK A;  1LG2 A;  1C9H A;  1TFV A;  3KAG A;  2LJ4 A;  3ART A;  2RSE A;  1JVW A;  3IHZ A;  3NTP A;  1JND A;  3QOK A;  3W4R A;  1FKT A;  2WM0 A;  3EY6 A;  5HUA A;  4W9P A;  1FKJ A;  1E6Z A;  2KFW A;  3ARO A;  2DSW A;  3O5P A;  1EHN A;  4P8V A;  1Q6H A;  4GGQ A;  1W9U A;  2DG3 A;  1LQ0 A;  4G2P A;  4QIB A;  3ARQ A;  4MNJ A;  2MLZ A;  3ARW A;  4Z2G A;  2PV2 A;  4JFI A;  1KT1 A;  2LGO A;  3RM8 A;  4W9O A;  2IUZ A;  4DWS C;  4S3K A;  3PRD A;  4ZPV R;  2DT3 A;  4TW7 A;  2FAP A;  3O5L A;  4L72 B;  2PPO A;  1FKG A;  4HBE A;  3WQW A;  1GOI A;  1VF8 A;  5HT1 A;  2F4E A;  1D6O A;  4P8X A;  3O5F A;  3AS3 A;  4JFL A;  2ESC A;  3WKZ A;  2YBU A;  4ODN A;  4ODR A;  2DSU A;  2RUQ A;  3ARP A;  4ODL A;  2A3B A;  3B9E A;  1TCO C;  1SR0 A;  5HW7 A;  2KGJ A;  4LAY A;  4Z2H A;  1H0I A;  2ZQS A;  3CHF A;  1FFR A;  1LL6 A;  3O5R A;  1GPF A;  2IF4 A;  1Q6I A;  3UI5 A;  4NZC A;  1H0G A;  2RUD A;  4JYS A;  4IQ2 A;  3UQI A;  4U84 A;  1EIB A;  1E6P A;  1A7X A;  1FKD A;  4KR0 B;  3NRK A;  2DT1 A;  4MNL A;  4JFM A;  2FKE A;  4JFJ A;  4WIW A;  4DWS A;  1ROU A;  3AQU A;  3RGC A;  2DT2 A;  3BXW A;  3ARS A;  2KR7 A;  1EYM A;  1ZBC A;  4BF8 A;  1NWS A;  1ITX A;  1OGG A;  3IK8 A;  1PIN A;  2RUC A;  3AS1 A;  2VCD A;  2DPE A;  1E15 A;  2ZR5 A;  3WQV A;  3ARY A;  3CGN A;  4TNS A;  1YAT A;  2Q5A A;  4Z2I A;  3KAH A;  4IQC A;  3ARV A;  3KZ7 A;  1D2K A;  1FKK A;  2A3A A;  2ITK A;  2A3C A;  1HKI A;  4U86 A;  4WKA A;  4NSB A;  5HWC A;  1PBK A;  3B8S A;  4IT4 A;  1N1A A;  1NWT A;  2KO7 A;  4Z2L A;  2ZQU A;  4MGV A;  3JYM A;  3O5J A;  3B9D A;  5HTG A;  2MLX A;  2D9F A;  1HJW A;  1FFQ A;  1XRV A;  4W9Q A;  2JZV A;  4MSP A;  1WNO A;  4KQZ A;  3ARX A;  3CHE A;  2FDM A;  3WD3 A;  4TX0 A;  2XP3 A;  1X6L A;  1F8A B;  4WKF A;  2PPP A;  1OWQ A;  3IKG A;  3IKD A;  3JXV A;  2PV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...