5HW8A

Candida albicans fkbp12 p104g protein bound with fk506 in c2 space group
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
120
Chain Sequence
LPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPGIIGPNETLVFEVELLGVNGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
total genus 25
structure length 120
sequence length 120
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hw8A00
2JZVA 2RQSA 2VCDA 5HW6A 1KT0A 2MF9A 4G2PA 4GIVA 4DIPA 1J6YA 1FKBA 1W26A 3PRBA 4TX0A 3VAWA 4LAWA 3TCZA 5I98A 2F2DA 1NSGA 3ODKA 4JFMA 2RSEA 4DH0A 2XP3A 2OFNA 2N87A 2XP5A 3O5JA 2KO7A 1J4IA 2MLXA 3O5RA 1Q6HA 4NNRA 4U86A 3GPKA 2XPAA 1ZK6A 2UZ5A 5HT1A 4FAPA 4DRHA 3JYJA 1ROUA 4QT3A 1FKSA 4ODKA 3PA7A 1EQ3A 4TW6A 2MNTA 2VN1A 3KAIA 1D7HA 4DRPA 2XP8A 1P5QA 2MLZA 1NMVA 2RURA 3EY6A 3UQAA 1L1PA 2AWGA 2F4EA 4JFKA 1R9HA 5GPGA 2PV2A 4LAYA 1F40A 4ODNA 2ITKA 3KCEA 5HKGA 2MPHA 4W9OA 2ZQTA 1ROTA 1U79A 3I6CA 4JYSA 1J4HA 4J4NA 3TDBA 1FKJA 1FKTA 4ITZA 1HXVA 1Q1CA 4ODOA 3O5LA 3KAFA 2DG4A 5J6EA 4IPXA 2ZR4A 1FKKA 2PPPA 3JYMA 3WH0A 2IF4A 4QT2A 2PPOA 4W9QA 1QPLA 3LUOA 2KGJA 3KACA 3NI6A 4N19A 1F8AB 2KE0A 2LJ4A 2XP6A 1T11A 4IQ2A 4J4OA 4ODRA 4DROA 5HTGA 2ZR5A 4QIBA 1M5YA 3KAGA 2D9FA 4ODMA 3O5KA 1FKDA 1JNSA 2ZR6A 4DZ2A 1D7IA 2XP4A 1YW5A 2LGOA 1PBKA 2M08A 2MLYA 3KZ7A 1N1AA 2DG9A 2RUQA 3IKDA 1ZCNA 2K8IA 2Q5AA 3PRDA 1TCOC 3H9RB 3O5IA 5HWBA 4G50A 1FD9A 3KAHA 3KADA 4ODQA 1KT1A 1FJDA 5D75A 1QPFA 4IQCA 4O2TA 3O5FA 1C9HA 5BXJA 4TW8A 2ZQVA 1D7JA 2F21A 5HWCA 4JFJA 3O5MA 4U85A 2KFWA 3O5GA 4DT4A 1EYMA 4DZ3A 2Y78A 4JFLA 4MGVA 1FAPA 5HW8A 1QZ2A 1D6OA 1FKLA 1YATA 2KR7A 2PBCA 3OOBA 4DRNA 3O5DA 1Q6UA 1PINA 5HUAA 1A7XA 1Y0OA 2LPVA 1FKGA 3IK8A 4W9PA 4DRKA 3B7XA 3NRKA 2LKNA 2DG3A 2PPNA 3O5QA 2FAPA 4LAXA 4TNSA 4C02B 1Q6IA 4DRIA 5DIUA 2PV1A 2ZQUA 3RFWA 2PV3A 2L2SA 4DRJA 1B6CA 1NMWA 3IHZA 3NTPA 4DRMA 3FAPA 4MSPA 3UQBA 4BF8A 3MDYB 2RUCA 4ODPA 3UI5A 1JNTA 4R0XA 3UI4A 4U84A 1FKIA 2XP7A 4JFIA 4ODLA 3JXVA 2RUDA 1FKHA 2ZQSA 4TYOA 5DITA 1FKFA 2M2AA 3KABA 3O5PA 4LAVA 4TW7A 2KI3A 3UQIA 5HW7A 3UF8A 3UI6A 3O5OA 1BL4A 5DIVA 3CGMA 1BKFA 5B8IC 3RGCA 2FKEA 2XP9A 1J4RA 3IKGA 3TC5A 1FKRA 1JVWA 4GGQA 2M1IA 3O5EA 4FN2A 3CGNA 2XPBA 4DRQA
chains in the Genus database with same CATH superfamily
2JZVA 1H0IA 3B9AA 4Z2IA 1E15A 1FKBA 3PRBA 3VAWA 5I98A 3ALGA 1NSGA 3ODKA 4DH0A 4P8XA 3ARWA 2N87A 2A3AA 3O5RA 2YBTA 4U86A 2XPAA 4FAPA 3CHCA 1ROUA 1WB0A 3RM9A 1JNEA 2MLZA 2O9OA 1L1PA 2ITKA 1O6IA 4W9OA 1W1TA 3TDBA 1ZBCA 2DPEA 1HXVA 1Q1CA 1OWQA 3KAFA 2DG4A 5J6EA 2A3EA 2P4VA 3KACA 1E9LA 1GUVA 4N19A 5HTGA 2KE0A 4ZPWR 1T11A 4J4OA 3CHDA 1NH6A 1EHNA 4ODMA 1FKDA 1SR0A 2XP4A 4MNJA 1N1AA 3O5IA 1HJWA 3B8SA 4L3NA 4L72B 4JFJA 2IUZA 4DT4A 4WKHA 4JFLA 1YATA 2PBCA 2KR7A 4IT6A 1UR9A 1VF8A 1A7XA 3IK8A 4W9PA 3B7XA 4HBEA 3AS2A 2FAPA 4HBOA 4LAXA 4C02B 1Q6IA 2PV1A 4P8VA 1JNDA 3IHZA 1JCHB 3UQBA 3ARVA 2RUCA 3RM8A 1ZL1A 3UI5A 1JNTA 3UI4A 1XHGA 4U84A 1EIBA 2RUDA 1ITXA 4TYOA 2YBUA 3KABA 3UQIA 2KI3A 3G6MA 1HJVA 4Q7NA 3UI6A 5HW7A 5JH8A 5DIVA 3CGMA 1BKFA 2FKEA 1J4RA 3TC5A 1W9UA 3ARSA 4FN2A 2RQSA 1J6YA 3AROA 4G2PA 1W26A 1ZB5A 4TX0A 4QZVB 4Z2JA 3ARUA 2F2DA 4PTMA 4JFMA 2RSEA 4DWSC 1GOIA 3O5JA 3WQVA 2MLXA 4LGXA 3GPKA 3AS3A 2UZ5A 5HT1A 2A3CA 2ETNA 4WKFA 3WD4A 3KAIA 4DRPA 3B9EA 1P5QA 1NMVA 3EY6A 1E44A 2AWGA 2DSVA 1R9HA 4LAYA 1F40A 3PRAA 3KCEA 1SYTA 4URIA 2ZQTA 1ROTA 1U79A 1E6RA 4J4NA 1LQ0A 1LG1A 3ARPA 4ITZA 1IX5A 4MNLA 4NSBA 2ZR4A 1HJXA 1FKKA 5GPRA 4W5UA 3WH0A 2PPOA 4W9QA 3ARYA 1F8AB 4ODRA 2PN0A 2XP6A 3ARZA 4IQ2A 5DEZA 4HARA 1NWUA 2ZR6A 4DZ2A 2LGOA 1PBKA 2MLYA 2RUQA 2K8IA 3PRDA 1TCOC 1NWSA 3H9RB 5HWBA 1ZBVA 1WAWA 4G50A 3CHEA 3KAHA 4ODQA 1KT1A 4WIWA 3AS0A 1C9HA 4TW8A 1D7JA 2F21A 5HWCA 3GTYX 4P8UA 1FFQA 3WIJA 3EIPA 4P8WA 4Z2KA 2B31A 2EULA 1QZ2A 2DT3A 4DRNA 1LL7A 1Q6UA 1PINA 5HUAA 4NZCA 1UR8A 3O5QA 4DRIA 5DIUA 3RFWA 2PV3A 2WM0A 3FXYA 2DSWA 4ODPA 5HBFA 2XP7A 3WL1A 3JXVA 3B9DA 2ZQSA 3GU0A 4LAVA 3UF8A 3PR9A 1X6NA 2XP9A 2WLYA 2DSUA 2M1IA 1CTNA 4ZPVR 1NWRA 4DRQA 2VCDA 5HW6A 1KT0A 2MF9A 3WD3A 1W9PA 3QOKA 4LAWA 4AY1A 3ALFA 3W4RA 4Q22A 4ZS6A 1HKJA 2XP3A 4MNKA 5DO2A 1KFWA 1J4IA 3BXWA 3ARTA 1ZK6A 4KR0B 4ODKA 3PA7A 4TW6A 3RMEA 4WJXA 2MNTA 4ML4A 4S3JA 1D7HA 2XP8A 3WKZA 2RURA 2A3BA 2ESCA 3UQAA 5GPGA 2PV2A 3WD1A 2WK2A 4ODNA 4MTVA 1HKKA 4DWSB 4JYSA 1J4HA 1FKTA 1ZBWA 4ODOA 3JYMA 3WL0A 2KGJA 3NI6A 3OA5A 2F23A 4DROA 1W1YA 2ZR5A 4QIBA 1M5YA 3KAGA 2DSZA 1YW5A 3KZ7A 2DG9A 1ZCNA 3ARRA 1FD9A 1E6ZA 3WD2A 3KADA 2DT1A 1FJDA 1WNOA 4DWSA 2ZQVA 4U85A 3O5GA 1EYMA 2Y78A 4IT4A 4MGVA 1FAPA 3ARXA 4XAKA 2FDMA 1ZBKA 4Z2HA 1FFRA 1HKIA 1FKGA 3BMBA 4MAVA 3NRKA 2OLHA 2PI6A 2PPNA 4DRJA 2L2SA 3AS1A 1OGBA 1GRJA 3FAPA 4MSPA 3MDYB 3AQUA 4Z2GA 2AOSA 2G41A 3G6LA 4S3KA 1W9VA 1FKIA 4ODLA 4Z2LA 1D2KA 1FKFA 2O92A 3O5OA 5B8IC 4KQZA 3RGCA 1FKRA 3IKGA 4GGQA 3O5EA 3CGNA 2XPBA 5BXJA 1H0GA 4GIVA 2G8ZA 4DIPA 1GPFA 3CZ8A 3TCZA 3WD0A 2OFNA 4UDMA 2XP5A 2KO7A 1LL4A 1Q6HA 4NNRA 4DRHA 3JYJA 4QT3A 1FKSA 1E6NA 1EQ3A 2QF8A 1X6LA 1LL6A 2VN1A 1K9TA 1TFVA 2F4EA 4JFKA 2WLZA 1W1VA 4MPKA 1HKMA 1XRVA 2MPHA 5HKGA 3I6CA 1LG2A 1EDQA 1FKJA 1LJYA 3O5LA 4IPXA 3CH9A 1E6PA 4ZPTR 2PPPA 1OGGA 2IF4A 3ARQA 4QT2A 1QPLA 4DWSD 3LUOA 2LJ4A 1RD6A 4WK9A 2D9FA 3O5KA 1W1PA 1JNSA 1D7IA 2M08A 3IKDA 2Q5AA 3CHFA 4WKAA 1ZU8A 5D75A 1QPFA 4IQCA 4O2TA 3O5FA 3O5MA 2KFWA 1NWTA 4DZ3A 3FY1A 5HW8A 1D6OA 1FKLA 3OOBA 3O5DA 1Y0OA 2LPVA 4DRKA 2LKNA 2DG3A 4MNMA 4TNSA 5GQBA 2ZQUA 1B6CA 1NMWA 3NTPA 4DRMA 2B5UB 4BF8A 4R0XA 2DT2A 4JFIA 4R5EA 3WQWA 1FKHA 5DITA 2M2AA 3O5PA 3RM4A 5DF0A 4TW7A 2DT0A 1BL4A 1JVWA
chains in the Genus database with same CATH topology
2JZVA 1H0IA 3B9AA 4Z2IA 1E15A 1FKBA 3PRBA 3VAWA 5I98A 3ALGA 1NSGA 3ODKA 4DH0A 4P8XA 3ARWA 2N87A 2A3AA 3O5RA 2YBTA 4U86A 2XPAA 4FAPA 3CHCA 1ROUA 1WB0A 3RM9A 1JNEA 2MLZA 2O9OA 1L1PA 2ITKA 1O6IA 4W9OA 1W1TA 3TDBA 1ZBCA 2DPEA 1HXVA 1Q1CA 1OWQA 3KAFA 2DG4A 5J6EA 2A3EA 3KACA 1E9LA 1GUVA 4N19A 5HTGA 2KE0A 4ZPWR 1T11A 4J4OA 3CHDA 1NH6A 1EHNA 4ODMA 1FKDA 1SR0A 2XP4A 4MNJA 1N1AA 3O5IA 1HJWA 3B8SA 4L3NA 4L72B 4JFJA 2IUZA 4DT4A 4WKHA 4JFLA 1YATA 2PBCA 2KR7A 4IT6A 1UR9A 1VF8A 1A7XA 3IK8A 4W9PA 3B7XA 4HBEA 3AS2A 2FAPA 4HBOA 4LAXA 4C02B 1Q6IA 2PV1A 4P8VA 1JNDA 3IHZA 3UQBA 3ARVA 2RUCA 3RM8A 1ZL1A 3UI5A 1JNTA 3UI4A 1XHGA 4U84A 1EIBA 2RUDA 1ITXA 4TYOA 2YBUA 3KABA 3UQIA 2KI3A 3G6MA 1HJVA 4Q7NA 3UI6A 5HW7A 5JH8A 5DIVA 3CGMA 1BKFA 2FKEA 1J4RA 3TC5A 1W9UA 3ARSA 4FN2A 2RQSA 1J6YA 3AROA 4G2PA 1W26A 1ZB5A 4TX0A 4QZVB 4Z2JA 3ARUA 2F2DA 4PTMA 4JFMA 2RSEA 4DWSC 1GOIA 3O5JA 3WQVA 2MLXA 4LGXA 3GPKA 3AS3A 2UZ5A 5HT1A 2A3CA 4WKFA 3WD4A 3KAIA 4DRPA 3B9EA 1P5QA 1NMVA 3EY6A 2AWGA 2DSVA 1R9HA 4LAYA 1F40A 3PRAA 3KCEA 1SYTA 4URIA 2ZQTA 1ROTA 1U79A 1E6RA 4J4NA 1LQ0A 1LG1A 3ARPA 4ITZA 1IX5A 4MNLA 4NSBA 2ZR4A 1HJXA 1FKKA 5GPRA 4W5UA 3WH0A 2PPOA 4W9QA 3ARYA 1F8AB 4ODRA 4IQ2A 2XP6A 3ARZA 5DEZA 4HARA 1NWUA 2ZR6A 4DZ2A 2LGOA 1PBKA 2MLYA 2RUQA 2K8IA 3PRDA 1TCOC 1NWSA 3H9RB 5HWBA 1ZBVA 1WAWA 4G50A 3CHEA 3KAHA 4ODQA 1KT1A 4WIWA 3AS0A 1C9HA 4TW8A 1D7JA 2F21A 5HWCA 4P8UA 1FFQA 3WIJA 4P8WA 4Z2KA 2B31A 1QZ2A 2DT3A 4DRNA 1LL7A 1Q6UA 1PINA 5HUAA 4NZCA 1UR8A 3O5QA 4DRIA 5DIUA 3RFWA 2PV3A 2WM0A 3FXYA 2DSWA 4ODPA 5HBFA 2XP7A 3WL1A 3JXVA 3B9DA 2ZQSA 4LAVA 3UF8A 3PR9A 1X6NA 2XP9A 2WLYA 2DSUA 2M1IA 1CTNA 4ZPVR 1NWRA 4DRQA 2VCDA 5HW6A 1KT0A 2MF9A 3WD3A 1W9PA 3QOKA 4LAWA 4AY1A 3ALFA 3W4RA 4Q22A 4ZS6A 1HKJA 2XP3A 4MNKA 5DO2A 1KFWA 1J4IA 3BXWA 3ARTA 1ZK6A 4KR0B 4ODKA 3PA7A 4TW6A 3RMEA 4WJXA 2MNTA 4ML4A 4S3JA 1D7HA 2XP8A 3WKZA 2RURA 2A3BA 2ESCA 3UQAA 5GPGA 2PV2A 3WD1A 2WK2A 4ODNA 4MTVA 1HKKA 4DWSB 4JYSA 1J4HA 1FKTA 1ZBWA 4ODOA 3JYMA 3WL0A 2KGJA 3NI6A 3OA5A 4DROA 1W1YA 2ZR5A 4QIBA 1M5YA 3KAGA 2DSZA 1YW5A 3KZ7A 2DG9A 1ZCNA 3ARRA 1FD9A 1E6ZA 3WD2A 3KADA 2DT1A 1FJDA 1WNOA 4DWSA 2ZQVA 4U85A 3O5GA 1EYMA 2Y78A 4IT4A 4MGVA 1FAPA 3ARXA 4XAKA 2FDMA 1ZBKA 4Z2HA 1FFRA 1HKIA 1FKGA 4MAVA 3NRKA 2OLHA 2PI6A 2PPNA 4DRJA 2L2SA 3AS1A 1OGBA 3FAPA 4MSPA 3MDYB 3AQUA 4Z2GA 2AOSA 2G41A 3G6LA 4S3KA 1W9VA 1FKIA 4ODLA 4Z2LA 1D2KA 1FKFA 2O92A 3O5OA 5B8IC 4KQZA 3RGCA 1FKRA 3IKGA 4GGQA 3O5EA 3CGNA 2XPBA 5BXJA 1H0GA 4GIVA 2G8ZA 4DIPA 1GPFA 3CZ8A 3TCZA 3WD0A 2OFNA 2XP5A 2KO7A 1LL4A 1Q6HA 4NNRA 4DRHA 3JYJA 4QT3A 1FKSA 1E6NA 1EQ3A 2QF8A 1X6LA 1LL6A 2VN1A 1K9TA 1TFVA 2F4EA 4JFKA 2WLZA 1W1VA 4MPKA 1HKMA 1XRVA 2MPHA 5HKGA 3I6CA 1LG2A 1EDQA 1FKJA 1LJYA 3O5LA 4IPXA 3CH9A 1E6PA 4ZPTR 2PPPA 1OGGA 2IF4A 3ARQA 4QT2A 1QPLA 4DWSD 3LUOA 2LJ4A 1RD6A 4WK9A 2D9FA 3O5KA 1W1PA 1JNSA 1D7IA 2M08A 3IKDA 2Q5AA 3CHFA 4WKAA 1ZU8A 5D75A 1QPFA 4IQCA 4O2TA 3O5FA 3O5MA 2KFWA 1NWTA 4DZ3A 3FY1A 5HW8A 1D6OA 1FKLA 3OOBA 3O5DA 1Y0OA 2LPVA 4DRKA 2LKNA 2DG3A 4MNMA 4TNSA 5GQBA 2ZQUA 1B6CA 1NMWA 3NTPA 4DRMA 4BF8A 4R0XA 2DT2A 4JFIA 4R5EA 3WQWA 1FKHA 5DITA 2M2AA 3O5PA 3RM4A 5DF0A 4TW7A 2DT0A 1BL4A 1JVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZV A;  2RQS A;  2VCD A;  5HW6 A;  1KT0 A;  2MF9 A;  4G2P A;  4GIV A;  4DIP A;  1J6Y A;  1FKB A;  1W26 A;  3PRB A;  4TX0 A;  3VAW A;  4LAW A;  3TCZ A;  5I98 A;  2F2D A;  1NSG A;  3ODK A;  4JFM A;  2RSE A;  4DH0 A;  2XP3 A;  2OFN A;  2N87 A;  2XP5 A;  3O5J A;  2KO7 A;  1J4I A;  2MLX A;  3O5R A;  1Q6H A;  4NNR A;  4U86 A;  3GPK A;  2XPA A;  1ZK6 A;  2UZ5 A;  5HT1 A;  4FAP A;  4DRH A;  3JYJ A;  1ROU A;  4QT3 A;  1FKS A;  4ODK A;  3PA7 A;  1EQ3 A;  4TW6 A;  2MNT A;  2VN1 A;  3KAI A;  1D7H A;  4DRP A;  2XP8 A;  1P5Q A;  2MLZ A;  1NMV A;  2RUR A;  3EY6 A;  3UQA A;  1L1P A;  2AWG A;  2F4E A;  4JFK A;  1R9H A;  5GPG A;  2PV2 A;  4LAY A;  1F40 A;  4ODN A;  2ITK A;  3KCE A;  5HKG A;  2MPH A;  4W9O A;  2ZQT A;  1ROT A;  1U79 A;  3I6C A;  4JYS A;  1J4H A;  4J4N A;  3TDB A;  1FKJ A;  1FKT A;  4ITZ A;  1HXV A;  1Q1C A;  4ODO A;  3O5L A;  3KAF A;  2DG4 A;  5J6E A;  4IPX A;  2ZR4 A;  1FKK A;  2PPP A;  3JYM A;  3WH0 A;  2IF4 A;  4QT2 A;  2PPO A;  4W9Q A;  1QPL A;  3LUO A;  2KGJ A;  3KAC A;  3NI6 A;  4N19 A;  1F8A B;  2KE0 A;  2LJ4 A;  2XP6 A;  1T11 A;  4IQ2 A;  4J4O A;  4ODR A;  4DRO A;  5HTG A;  2ZR5 A;  4QIB A;  1M5Y A;  3KAG A;  2D9F A;  4ODM A;  3O5K A;  1FKD A;  1JNS A;  2ZR6 A;  4DZ2 A;  1D7I A;  2XP4 A;  1YW5 A;  2LGO A;  1PBK A;  2M08 A;  2MLY A;  3KZ7 A;  1N1A A;  2DG9 A;  2RUQ A;  3IKD A;  1ZCN A;  2K8I A;  2Q5A A;  3PRD A;  1TCO C;  3H9R B;  3O5I A;  5HWB A;  4G50 A;  1FD9 A;  3KAH A;  3KAD A;  4ODQ A;  1KT1 A;  1FJD A;  5D75 A;  1QPF A;  4IQC A;  4O2T A;  3O5F A;  1C9H A;  5BXJ A;  4TW8 A;  2ZQV A;  1D7J A;  2F21 A;  5HWC A;  4JFJ A;  3O5M A;  4U85 A;  2KFW A;  3O5G A;  4DT4 A;  1EYM A;  4DZ3 A;  2Y78 A;  4JFL A;  4MGV A;  1FAP A;  5HW8 A;  1QZ2 A;  1D6O A;  1FKL A;  1YAT A;  2KR7 A;  2PBC A;  3OOB A;  4DRN A;  3O5D A;  1Q6U A;  1PIN A;  5HUA A;  1A7X A;  1Y0O A;  2LPV A;  1FKG A;  3IK8 A;  4W9P A;  4DRK A;  3B7X A;  3NRK A;  2LKN A;  2DG3 A;  2PPN A;  3O5Q A;  2FAP A;  4LAX A;  4TNS A;  4C02 B;  1Q6I A;  4DRI A;  5DIU A;  2PV1 A;  2ZQU A;  3RFW A;  2PV3 A;  2L2S A;  4DRJ A;  1B6C A;  1NMW A;  3IHZ A;  3NTP A;  4DRM A;  3FAP A;  4MSP A;  3UQB A;  4BF8 A;  3MDY B;  2RUC A;  4ODP A;  3UI5 A;  1JNT A;  4R0X A;  3UI4 A;  4U84 A;  1FKI A;  2XP7 A;  4JFI A;  4ODL A;  3JXV A;  2RUD A;  1FKH A;  2ZQS A;  4TYO A;  5DIT A;  1FKF A;  2M2A A;  3KAB A;  3O5P A;  4LAV A;  4TW7 A;  2KI3 A;  3UQI A;  5HW7 A;  3UF8 A;  3UI6 A;  3O5O A;  1BL4 A;  5DIV A;  3CGM A;  1BKF A;  5B8I C;  3RGC A;  2FKE A;  2XP9 A;  1J4R A;  3IKG A;  3TC5 A;  1FKR A;  1JVW A;  4GGQ A;  2M1I A;  3O5E A;  4FN2 A;  3CGN A;  2XPB A;  4DRQ A; 
#chains in the Genus database with same CATH topology
 2JZV A;  1H0I A;  3B9A A;  4Z2I A;  1E15 A;  1FKB A;  3PRB A;  3VAW A;  5I98 A;  3ALG A;  1NSG A;  3ODK A;  4DH0 A;  4P8X A;  3ARW A;  2N87 A;  2A3A A;  3O5R A;  2YBT A;  4U86 A;  2XPA A;  4FAP A;  3CHC A;  1ROU A;  1WB0 A;  3RM9 A;  1JNE A;  2MLZ A;  2O9O A;  1L1P A;  2ITK A;  1O6I A;  4W9O A;  1W1T A;  3TDB A;  1ZBC A;  2DPE A;  1HXV A;  1Q1C A;  1OWQ A;  3KAF A;  2DG4 A;  5J6E A;  2A3E A;  2P4V A;  3KAC A;  1E9L A;  1GUV A;  4N19 A;  5HTG A;  2KE0 A;  4ZPW R;  1T11 A;  4J4O A;  3CHD A;  1NH6 A;  1EHN A;  4ODM A;  1FKD A;  1SR0 A;  2XP4 A;  4MNJ A;  1N1A A;  3O5I A;  1HJW A;  3B8S A;  4L3N A;  4L72 B;  4JFJ A;  2IUZ A;  4DT4 A;  4WKH A;  4JFL A;  1YAT A;  2PBC A;  2KR7 A;  4IT6 A;  1UR9 A;  1VF8 A;  1A7X A;  3IK8 A;  4W9P A;  3B7X A;  4HBE A;  3AS2 A;  2FAP A;  4HBO A;  4LAX A;  4C02 B;  1Q6I A;  2PV1 A;  4P8V A;  1JND A;  3IHZ A;  1JCH B;  3UQB A;  3ARV A;  2RUC A;  3RM8 A;  1ZL1 A;  3UI5 A;  1JNT A;  3UI4 A;  1XHG A;  4U84 A;  1EIB A;  2RUD A;  1ITX A;  4TYO A;  2YBU A;  3KAB A;  3UQI A;  2KI3 A;  3G6M A;  1HJV A;  4Q7N A;  3UI6 A;  5HW7 A;  5JH8 A;  5DIV A;  3CGM A;  1BKF A;  2FKE A;  1J4R A;  3TC5 A;  1W9U A;  3ARS A;  4FN2 A;  2RQS A;  1J6Y A;  3ARO A;  4G2P A;  1W26 A;  1ZB5 A;  4TX0 A;  4QZV B;  4Z2J A;  3ARU A;  2F2D A;  4PTM A;  4JFM A;  2RSE A;  4DWS C;  1GOI A;  3O5J A;  3WQV A;  2MLX A;  4LGX A;  3GPK A;  3AS3 A;  2UZ5 A;  5HT1 A;  2A3C A;  2ETN A;  4WKF A;  3WD4 A;  3KAI A;  4DRP A;  3B9E A;  1P5Q A;  1NMV A;  3EY6 A;  1E44 A;  2AWG A;  2DSV A;  1R9H A;  4LAY A;  1F40 A;  3PRA A;  3KCE A;  1SYT A;  4URI A;  2ZQT A;  1ROT A;  1U79 A;  1E6R A;  4J4N A;  1LQ0 A;  1LG1 A;  3ARP A;  4ITZ A;  1IX5 A;  4MNL A;  4NSB A;  2ZR4 A;  1HJX A;  1FKK A;  5GPR A;  4W5U A;  3WH0 A;  2PPO A;  4W9Q A;  3ARY A;  1F8A B;  4ODR A;  2PN0 A;  2XP6 A;  3ARZ A;  4IQ2 A;  5DEZ A;  4HAR A;  1NWU A;  2ZR6 A;  4DZ2 A;  2LGO A;  1PBK A;  2MLY A;  2RUQ A;  2K8I A;  3PRD A;  1TCO C;  1NWS A;  3H9R B;  5HWB A;  1ZBV A;  1WAW A;  4G50 A;  3CHE A;  3KAH A;  4ODQ A;  1KT1 A;  4WIW A;  3AS0 A;  1C9H A;  4TW8 A;  1D7J A;  2F21 A;  5HWC A;  3GTY X;  4P8U A;  1FFQ A;  3WIJ A;  3EIP A;  4P8W A;  4Z2K A;  2B31 A;  2EUL A;  1QZ2 A;  2DT3 A;  4DRN A;  1LL7 A;  1Q6U A;  1PIN A;  5HUA A;  4NZC A;  1UR8 A;  3O5Q A;  4DRI A;  5DIU A;  3RFW A;  2PV3 A;  2WM0 A;  3FXY A;  2DSW A;  4ODP A;  5HBF A;  2XP7 A;  3WL1 A;  3JXV A;  3B9D A;  2ZQS A;  3GU0 A;  4LAV A;  3UF8 A;  3PR9 A;  1X6N A;  2XP9 A;  2WLY A;  2DSU A;  2M1I A;  1CTN A;  4ZPV R;  1NWR A;  4DRQ A;  2VCD A;  5HW6 A;  1KT0 A;  2MF9 A;  3WD3 A;  1W9P A;  3QOK A;  4LAW A;  4AY1 A;  3ALF A;  3W4R A;  4Q22 A;  4ZS6 A;  1HKJ A;  2XP3 A;  4MNK A;  5DO2 A;  1KFW A;  1J4I A;  3BXW A;  3ART A;  1ZK6 A;  4KR0 B;  4ODK A;  3PA7 A;  4TW6 A;  3RME A;  4WJX A;  2MNT A;  4ML4 A;  4S3J A;  1D7H A;  2XP8 A;  3WKZ A;  2RUR A;  2A3B A;  2ESC A;  3UQA A;  5GPG A;  2PV2 A;  3WD1 A;  2WK2 A;  4ODN A;  4MTV A;  1HKK A;  4DWS B;  4JYS A;  1J4H A;  1FKT A;  1ZBW A;  4ODO A;  3JYM A;  3WL0 A;  2KGJ A;  3NI6 A;  3OA5 A;  2F23 A;  4DRO A;  1W1Y A;  2ZR5 A;  4QIB A;  1M5Y A;  3KAG A;  2DSZ A;  1YW5 A;  3KZ7 A;  2DG9 A;  1ZCN A;  3ARR A;  1FD9 A;  1E6Z A;  3WD2 A;  3KAD A;  2DT1 A;  1FJD A;  1WNO A;  4DWS A;  2ZQV A;  4U85 A;  3O5G A;  1EYM A;  2Y78 A;  4IT4 A;  4MGV A;  1FAP A;  3ARX A;  4XAK A;  2FDM A;  1ZBK A;  4Z2H A;  1FFR A;  1HKI A;  1FKG A;  3BMB A;  4MAV A;  3NRK A;  2OLH A;  2PI6 A;  2PPN A;  4DRJ A;  2L2S A;  3AS1 A;  1OGB A;  1GRJ A;  3FAP A;  4MSP A;  3MDY B;  3AQU A;  4Z2G A;  2AOS A;  2G41 A;  3G6L A;  4S3K A;  1W9V A;  1FKI A;  4ODL A;  4Z2L A;  1D2K A;  1FKF A;  2O92 A;  3O5O A;  5B8I C;  4KQZ A;  3RGC A;  1FKR A;  3IKG A;  4GGQ A;  3O5E A;  3CGN A;  2XPB A;  5BXJ A;  1H0G A;  4GIV A;  2G8Z A;  4DIP A;  1GPF A;  3CZ8 A;  3TCZ A;  3WD0 A;  2OFN A;  4UDM A;  2XP5 A;  2KO7 A;  1LL4 A;  1Q6H A;  4NNR A;  4DRH A;  3JYJ A;  4QT3 A;  1FKS A;  1E6N A;  1EQ3 A;  2QF8 A;  1X6L A;  1LL6 A;  2VN1 A;  1K9T A;  1TFV A;  2F4E A;  4JFK A;  2WLZ A;  1W1V A;  4MPK A;  1HKM A;  1XRV A;  2MPH A;  5HKG A;  3I6C A;  1LG2 A;  1EDQ A;  1FKJ A;  1LJY A;  3O5L A;  4IPX A;  3CH9 A;  1E6P A;  4ZPT R;  2PPP A;  1OGG A;  2IF4 A;  3ARQ A;  4QT2 A;  1QPL A;  4DWS D;  3LUO A;  2LJ4 A;  1RD6 A;  4WK9 A;  2D9F A;  3O5K A;  1W1P A;  1JNS A;  1D7I A;  2M08 A;  3IKD A;  2Q5A A;  3CHF A;  4WKA A;  1ZU8 A;  5D75 A;  1QPF A;  4IQC A;  4O2T A;  3O5F A;  3O5M A;  2KFW A;  1NWT A;  4DZ3 A;  3FY1 A;  5HW8 A;  1D6O A;  1FKL A;  3OOB A;  3O5D A;  1Y0O A;  2LPV A;  4DRK A;  2LKN A;  2DG3 A;  4MNM A;  4TNS A;  5GQB A;  2ZQU A;  1B6C A;  1NMW A;  3NTP A;  4DRM A;  2B5U B;  4BF8 A;  4R0X A;  2DT2 A;  4JFI A;  4R5E A;  3WQW A;  1FKH A;  5DIT A;  2M2A A;  3O5P A;  3RM4 A;  5DF0 A;  4TW7 A;  2DT0 A;  1BL4 A;  1JVW A; 
#chains in the Genus database with same CATH homology
 2JZV A;  1H0I A;  3B9A A;  4Z2I A;  1E15 A;  1FKB A;  3PRB A;  3VAW A;  5I98 A;  3ALG A;  1NSG A;  3ODK A;  4DH0 A;  4P8X A;  3ARW A;  2N87 A;  2A3A A;  3O5R A;  2YBT A;  4U86 A;  2XPA A;  4FAP A;  3CHC A;  1ROU A;  1WB0 A;  3RM9 A;  1JNE A;  2MLZ A;  2O9O A;  1L1P A;  2ITK A;  1O6I A;  4W9O A;  1W1T A;  3TDB A;  1ZBC A;  2DPE A;  1HXV A;  1Q1C A;  1OWQ A;  3KAF A;  2DG4 A;  5J6E A;  2A3E A;  3KAC A;  1E9L A;  1GUV A;  4N19 A;  5HTG A;  2KE0 A;  4ZPW R;  1T11 A;  4J4O A;  3CHD A;  1NH6 A;  1EHN A;  4ODM A;  1FKD A;  1SR0 A;  2XP4 A;  4MNJ A;  1N1A A;  3O5I A;  1HJW A;  3B8S A;  4L3N A;  4L72 B;  4JFJ A;  2IUZ A;  4DT4 A;  4WKH A;  4JFL A;  1YAT A;  2PBC A;  2KR7 A;  4IT6 A;  1UR9 A;  1VF8 A;  1A7X A;  3IK8 A;  4W9P A;  3B7X A;  4HBE A;  3AS2 A;  2FAP A;  4HBO A;  4LAX A;  4C02 B;  1Q6I A;  2PV1 A;  4P8V A;  1JND A;  3IHZ A;  3UQB A;  3ARV A;  2RUC A;  3RM8 A;  1ZL1 A;  3UI5 A;  1JNT A;  3UI4 A;  1XHG A;  4U84 A;  1EIB A;  2RUD A;  1ITX A;  4TYO A;  2YBU A;  3KAB A;  3UQI A;  2KI3 A;  3G6M A;  1HJV A;  4Q7N A;  3UI6 A;  5HW7 A;  5JH8 A;  5DIV A;  3CGM A;  1BKF A;  2FKE A;  1J4R A;  3TC5 A;  1W9U A;  3ARS A;  4FN2 A;  2RQS A;  1J6Y A;  3ARO A;  4G2P A;  1W26 A;  1ZB5 A;  4TX0 A;  4QZV B;  4Z2J A;  3ARU A;  2F2D A;  4PTM A;  4JFM A;  2RSE A;  4DWS C;  1GOI A;  3O5J A;  3WQV A;  2MLX A;  4LGX A;  3GPK A;  3AS3 A;  2UZ5 A;  5HT1 A;  2A3C A;  4WKF A;  3WD4 A;  3KAI A;  4DRP A;  3B9E A;  1P5Q A;  1NMV A;  3EY6 A;  2AWG A;  2DSV A;  1R9H A;  4LAY A;  1F40 A;  3PRA A;  3KCE A;  1SYT A;  4URI A;  2ZQT A;  1ROT A;  1U79 A;  1E6R A;  4J4N A;  1LQ0 A;  1LG1 A;  3ARP A;  4ITZ A;  1IX5 A;  4MNL A;  4NSB A;  2ZR4 A;  1HJX A;  1FKK A;  5GPR A;  4W5U A;  3WH0 A;  2PPO A;  4W9Q A;  3ARY A;  1F8A B;  4ODR A;  4IQ2 A;  2XP6 A;  3ARZ A;  5DEZ A;  4HAR A;  1NWU A;  2ZR6 A;  4DZ2 A;  2LGO A;  1PBK A;  2MLY A;  2RUQ A;  2K8I A;  3PRD A;  1TCO C;  1NWS A;  3H9R B;  5HWB A;  1ZBV A;  1WAW A;  4G50 A;  3CHE A;  3KAH A;  4ODQ A;  1KT1 A;  4WIW A;  3AS0 A;  1C9H A;  4TW8 A;  1D7J A;  2F21 A;  5HWC A;  4P8U A;  1FFQ A;  3WIJ A;  4P8W A;  4Z2K A;  2B31 A;  1QZ2 A;  2DT3 A;  4DRN A;  1LL7 A;  1Q6U A;  1PIN A;  5HUA A;  4NZC A;  1UR8 A;  3O5Q A;  4DRI A;  5DIU A;  3RFW A;  2PV3 A;  2WM0 A;  3FXY A;  2DSW A;  4ODP A;  5HBF A;  2XP7 A;  3WL1 A;  3JXV A;  3B9D A;  2ZQS A;  4LAV A;  3UF8 A;  3PR9 A;  1X6N A;  2XP9 A;  2WLY A;  2DSU A;  2M1I A;  1CTN A;  4ZPV R;  1NWR A;  4DRQ A;  2VCD A;  5HW6 A;  1KT0 A;  2MF9 A;  3WD3 A;  1W9P A;  3QOK A;  4LAW A;  4AY1 A;  3ALF A;  3W4R A;  4Q22 A;  4ZS6 A;  1HKJ A;  2XP3 A;  4MNK A;  5DO2 A;  1KFW A;  1J4I A;  3BXW A;  3ART A;  1ZK6 A;  4KR0 B;  4ODK A;  3PA7 A;  4TW6 A;  3RME A;  4WJX A;  2MNT A;  4ML4 A;  4S3J A;  1D7H A;  2XP8 A;  3WKZ A;  2RUR A;  2A3B A;  2ESC A;  3UQA A;  5GPG A;  2PV2 A;  3WD1 A;  2WK2 A;  4ODN A;  4MTV A;  1HKK A;  4DWS B;  4JYS A;  1J4H A;  1FKT A;  1ZBW A;  4ODO A;  3JYM A;  3WL0 A;  2KGJ A;  3NI6 A;  3OA5 A;  4DRO A;  1W1Y A;  2ZR5 A;  4QIB A;  1M5Y A;  3KAG A;  2DSZ A;  1YW5 A;  3KZ7 A;  2DG9 A;  1ZCN A;  3ARR A;  1FD9 A;  1E6Z A;  3WD2 A;  3KAD A;  2DT1 A;  1FJD A;  1WNO A;  4DWS A;  2ZQV A;  4U85 A;  3O5G A;  1EYM A;  2Y78 A;  4IT4 A;  4MGV A;  1FAP A;  3ARX A;  4XAK A;  2FDM A;  1ZBK A;  4Z2H A;  1FFR A;  1HKI A;  1FKG A;  4MAV A;  3NRK A;  2OLH A;  2PI6 A;  2PPN A;  4DRJ A;  2L2S A;  3AS1 A;  1OGB A;  3FAP A;  4MSP A;  3MDY B;  3AQU A;  4Z2G A;  2AOS A;  2G41 A;  3G6L A;  4S3K A;  1W9V A;  1FKI A;  4ODL A;  4Z2L A;  1D2K A;  1FKF A;  2O92 A;  3O5O A;  5B8I C;  4KQZ A;  3RGC A;  1FKR A;  3IKG A;  4GGQ A;  3O5E A;  3CGN A;  2XPB A;  5BXJ A;  1H0G A;  4GIV A;  2G8Z A;  4DIP A;  1GPF A;  3CZ8 A;  3TCZ A;  3WD0 A;  2OFN A;  2XP5 A;  2KO7 A;  1LL4 A;  1Q6H A;  4NNR A;  4DRH A;  3JYJ A;  4QT3 A;  1FKS A;  1E6N A;  1EQ3 A;  2QF8 A;  1X6L A;  1LL6 A;  2VN1 A;  1K9T A;  1TFV A;  2F4E A;  4JFK A;  2WLZ A;  1W1V A;  4MPK A;  1HKM A;  1XRV A;  2MPH A;  5HKG A;  3I6C A;  1LG2 A;  1EDQ A;  1FKJ A;  1LJY A;  3O5L A;  4IPX A;  3CH9 A;  1E6P A;  4ZPT R;  2PPP A;  1OGG A;  2IF4 A;  3ARQ A;  4QT2 A;  1QPL A;  4DWS D;  3LUO A;  2LJ4 A;  1RD6 A;  4WK9 A;  2D9F A;  3O5K A;  1W1P A;  1JNS A;  1D7I A;  2M08 A;  3IKD A;  2Q5A A;  3CHF A;  4WKA A;  1ZU8 A;  5D75 A;  1QPF A;  4IQC A;  4O2T A;  3O5F A;  3O5M A;  2KFW A;  1NWT A;  4DZ3 A;  3FY1 A;  5HW8 A;  1D6O A;  1FKL A;  3OOB A;  3O5D A;  1Y0O A;  2LPV A;  4DRK A;  2LKN A;  2DG3 A;  4MNM A;  4TNS A;  5GQB A;  2ZQU A;  1B6C A;  1NMW A;  3NTP A;  4DRM A;  4BF8 A;  4R0X A;  2DT2 A;  4JFI A;  4R5E A;  3WQW A;  1FKH A;  5DIT A;  2M2A A;  3O5P A;  3RM4 A;  5DF0 A;  4TW7 A;  2DT0 A;  1BL4 A;  1JVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...