5HWBA

Aspergillus fumigatus fkbp12 apo protein in p212121 space group
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
MGVTKELKSPGNGVDFPKKGDFVTIHYTGRLTDGSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPPVIPGNSTLIFEVELLGINNKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
total genus 27
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hwbA00
1FKDA 2ZQUA 5HKGA 2VN1A 4DRNA 2Q5AA 1D7HA 4TYOA 4QIBA 5I98A 4ODQA 4LAXA 1ROTA 1YATA 1ZK6A 1PBKA 4JFLA 2F2DA 4MGVA 3JXVA 3KADA 4ODOA 4U85A 4DRKA 4DZ3A 2M08A 4ODRA 5HT1A 4W9OA 3IHZA 1B6CA 2KI3A 1P5QA 1Y0OA 3KABA 3O5IA 1JNTA 4IQCA 1Q6UA 2ZQTA 3IKGA 4G50A 4J4OA 4ITZA 2PPNA 2MLXA 3KAHA 2PV1A 3O5LA 2XP9A 2M2AA 4JFIA 4DH0A 4TW6A 1R9HA 2XPAA 4O2TA 3NTPA 4TW8A 4JFMA 2DG9A 2XP4A 3TC5A 1NSGA 4DRIA 5HTGA 1F8AB 1D6OA 2RSEA 2OFNA 2ZR6A 2XPBA 3JYMA 3KACA 4QT3A 5GPGA 4DRQA 3TCZA 2F4EA 2XP7A 3JYJA 4ODLA 4U86A 4W9PA 1FAPA 3CGMA 3O5RA 3UQAA 3B7XA 4ODKA 2RUQA 1C9HA 2DG3A 4TNSA 2D9FA 1Q6HA 2MF9A 3IK8A 1FKRA 3UI6A 2KE0A 1NMWA 2F21A 2MNTA 4TW7A 4J4NA 3RFWA 1U79A 1KT1A 3KAIA 3RGCA 4LAYA 3CGNA 1YW5A 2N87A 3KAFA 2KR7A 2LGOA 2VCDA 4ODPA 4QT2A 3NI6A 1PINA 4IPXA 1ZCNA 1FJDA 3GPKA 1QPLA 1JNSA 1BKFA 4IQ2A 1Q1CA 2ZR4A 5DIVA 1FKGA 2ZQSA 2K8IA 2PPOA 3O5QA 4DRJA 4FAPA 2KFWA 3MDYB 5DIUA 2JZVA 1J6YA 1FKTA 1FKSA 3O5DA 3VAWA 5D75A 3O5GA 2MLZA 1FD9A 4LAVA 2IF4A 2ITKA 2Y78A 3KCEA 2ZR5A 5DITA 2PV2A 3O5PA 1W26A 1QPFA 1FKIA 1ROUA 4N19A 2FAPA 4GIVA 4G2PA 1FKLA 4JFJA 2LKNA 1J4IA 1JVWA 4JYSA 1TCOC 3FAPA 4GGQA 4R0XA 2PPPA 2UZ5A 2XP3A 4ODNA 4DROA 5B8IC 2MLYA 5HWBA 5HUAA 3KAGA 1FKBA 4JFKA 1FKHA 1J4HA 2ZQVA 3IKDA 3ODKA 1BL4A 3UF8A 3UQIA 5BXJA 1HXVA 5HWCA 4ODMA 1FKJA 2M1IA 1EQ3A 4BF8A 3PA7A 4U84A 2RUCA 4DIPA 5HW7A 4LAWA 1NMVA 2LPVA 2MPHA 3UI4A 2XP8A 4MSPA 4FN2A 4DRHA 2XP6A 3I6CA 3OOBA 4C02B 4DZ2A 1FKKA 1KT0A 2LJ4A 1QZ2A 1T11A 2XP5A 4DT4A 3O5EA 1M5YA 5HW6A 2KGJA 2RQSA 3PRDA 2L2SA 3LUOA 2KO7A 2AWGA 2FKEA 5J6EA 1FKFA 2DG4A 3EY6A 3O5FA 3O5KA 3UI5A 1L1PA 4DRMA 5HW8A 2RURA 3O5MA 2PV3A 4DRPA 3UQBA 3KZ7A 1Q6IA 3WH0A 1J4RA 2PBCA 3H9RB 4W9QA 1D7IA 1EYMA 3NRKA 3PRBA 1F40A 4TX0A 4NNRA 3TDBA 2RUDA 3O5OA 1A7XA 1D7JA 3O5JA 1N1AA
chains in the Genus database with same CATH superfamily
3W4RA 1FFQA 2VN1A 2WK2A 4IT6A 2PI6A 4LAXA 4JFLA 4DRKA 1W1VA 3IHZA 1P5QA 4IQCA 3IKGA 4J4OA 4ITZA 3KAHA 2PV1A 4P8WA 1NWUA 4JFMA 2DG9A 1NSGA 1HJWA 3KACA 1F8AB 1D6OA 1EHNA 3JYMA 2XPBA 4DWSB 2XP7A 3JYJA 3CGMA 3O5RA 4KQZA 3B7XA 2RUQA 1C9HA 4TNSA 1Q6HA 3IK8A 1VF8A 3WIJA 3WD2A 2KE0A 1NMWA 2F21A 3RFWA 4J4NA 1U79A 3ARVA 5DO2A 3KAIA 3RGCA 3CGNA 2N87A 3KAFA 4ODPA 3NI6A 2DSWA 4IPXA 2WM0A 1BKFA 4IQ2A 1LG1A 3ARUA 2ZR4A 1FKGA 2ZQSA 1NWRA 4FAPA 2KFWA 4W5UA 1J6YA 1FKTA 3WL1A 2PN0A 2ZR5A 1HKJA 1W26A 1EDQA 3CHDA 4N19A 4GIVA 4G2PA 1J4IA 2WLZA 3PRAA 4HARA 4JYSA 2PPPA 1GPFA 2XP3A 4WKAA 2B5UB 4DROA 1FKBA 1J4HA 3ARWA 5BXJA 3WD4A 3UQIA 3ARQA 5HWCA 2FDMA 4BF8A 4MNLA 4LAWA 3UI4A 2XP8A 4DRHA 3I6CA 1LJYA 1O6IA 2L2SA 2KO7A 3AS2A 5J6EA 3AS0A 3ALGA 4DRPA 1LL4A 2QF8A 4Z2HA 4NZCA 3NRKA 4TX0A 1HJXA 1KFWA 4URIA 1A7XA 4WIWA 5DEZA 1FKDA 2ZQUA 5HKGA 2YBUA 2Q5AA 4TYOA 4QIBA 4ODQA 4S3KA 4ZPTR 1YATA 1ZK6A 4ODOA 1ZBWA 2F2DA 3JXVA 4KR0B 2M08A 4ODRA 4WKFA 1B6CA 1W9UA 2ZQTA 1OGBA 1W1PA 2PPNA 2MLXA 1W1TA 1JNDA 4TW6A 4Q22A 1R9HA 2XPAA 3ARZA 4TW8A 2XP4A 3TC5A 5I98A 2RSEA 2ZR6A 5GPGA 3TCZA 4ODLA 4ZPWR 3CHCA 2DG3A 3B9EA 4PTMA 2YBTA 1D2KA 1FKRA 3UI6A 3GTYX 2ESCA 4TW7A 2LGOA 4L72B 1HJVA 1JNSA 2K8IA 1LG2A 4MNMA 2JZVA 1FKSA 2WLYA 3O5DA 4P8VA 2AOSA 3O5GA 3VAWA 3GU0A 4HBEA 4LAVA 2Y78A 3KCEA 2PV2A 2B31A 1QPFA 2DSZA 1ZBKA 4P8UA 1FKLA 1WAWA 4GGQA 4R0XA 3RM4A 5GQBA 4DWSA 3FY1A 2P4VA 5HWBA 3ARPA 4JFKA 3IKDA 1HXVA 1X6LA 1SR0A 1FKJA 2M1IA 1EQ3A 1NMVA 3AS3A 2MPHA 1WB0A 4ZS6A 4FN2A 2A3EA 2XP6A 2OLHA 1ZL1A 1T11A 3CZ8A 1FFRA 1RD6A 3ARSA 3B9DA 5HW6A 1X6NA 2KGJA 3PRDA 3QOKA 4MPKA 3LUOA 2DG4A 4Z2JA 3AS1A 3BXWA 3UI5A 1L1PA 5HW8A 1H0IA 1GOIA 1Q6IA 3KZ7A 3WH0A 4W9QA 4NNRA 1D7JA 1N1AA 2G41A 4HBOA 1D7HA 2O92A 1ROTA 4Q7NA 1PBKA 1FJDA 4DZ3A 1E6RA 4XAKA 5JH8A 4W9OA 4DWSC 3KABA 3O5IA 1Q6UA 3CHEA 3B8SA 2DT2A 4G50A 2A3BA 3O5LA 2M2AA 4JFIA 3RM8A 4QZVB 3WD1A 1SYTA 4LGXA 1HKMA 3WQWA 2OFNA 4DRQA 1W9VA 2F4EA 4W9PA 4U86A 1FAPA 3EIPA 4ODKA 1E15A 2ETNA 3WQVA 1ZB5A 2MNTA 4LAYA 3BMBA 2DT0A 1PINA 2IUZA 1QPLA 1GRJA 1K9TA 2O9OA 1OWQA 5DIVA 4DRJA 1E9LA 5D75A 1FD9A 1LL7A 5DITA 3O5PA 3FXYA 4ZPVR 1NH6A 1JCHB 4JFJA 3ARXA 4P8XA 1TCOC 3FAPA 4Z2IA 1E44A 1OGGA 2DSUA 2A3CA 4ODNA 4R5EA 5B8IC 2MLYA 1FKHA 3ARTA 3UF8A 3ODKA 1BL4A 3ALFA 3WD0A 4ODMA 1XHGA 3PR9A 3PA7A 4U84A 4NSBA 4DIPA 1ZBCA 3G6LA 3OOBA 1W1YA 4C02B 1FKKA 1KT0A 2XP5A 4Z2LA 5GPRA 2RQSA 2AWGA 2FKEA 4WK9A 4IT4A 1ZBVA 3O5KA 3AQUA 2PV3A 2PBCA 3H9RB 1WNOA 1EYMA 3PRBA 1ITXA 3TDBA 2RUDA 3O5OA 3O5JA 4DRNA 1EIBA 3WL0A 4AY1A 4MGVA 3KADA 4U85A 5DF0A 3AROA 5HT1A 2KI3A 1Y0OA 1JNTA 2EULA 2A3AA 4MNKA 4DH0A 2XP9A 1H0GA 4Z2GA 4O2TA 1HKIA 3NTPA 2DT3A 2DT1A 5HTGA 4DRIA 4QT3A 4DWSD 2DPEA 1LQ0A 3UQAA 2D9FA 2MF9A 1NWSA 1E6PA 1KT1A 3WD3A 1YW5A 3B9AA 4QT2A 2KR7A 2VCDA 1LL6A 1CTNA 1ZCNA 3WKZA 3GPKA 4UDMA 1Q1CA 4WJXA 2PPOA 3O5QA 3G6MA 3MDYB 4ML4A 5DIUA 4MAVA 1E6NA 2MLZA 2IF4A 2ITKA 1FKIA 1ROUA 4MTVA 2FAPA 4Z2KA 2LKNA 1JVWA 2DSVA 1XRVA 1NWTA 1TFVA 2UZ5A 3CHFA 1IX5A 3ARRA 1GUVA 3KAGA 5HUAA 2ZQVA 4MNJA 3ARYA 3RMEA 2F23A 3RM9A 5HW7A 2RUCA 2LPVA 4WKHA 4MSPA 1ZU8A 4DZ2A 2LJ4A 1QZ2A 4DT4A 3O5EA 1M5YA 1FKFA 5HBFA 3EY6A 3O5FA 1W9PA 3CH9A 1HKKA 4DRMA 1UR8A 2RURA 3O5MA 3UQBA 1UR9A 1E6ZA 2G8ZA 1J4RA 4L3NA 1D7IA 4S3JA 1F40A 1JNEA 3OA5A
chains in the Genus database with same CATH topology
3W4RA 1FFQA 2VN1A 2WK2A 4IT6A 2PI6A 4LAXA 4JFLA 4DRKA 1W1VA 3IHZA 1P5QA 4IQCA 3IKGA 4J4OA 4ITZA 3KAHA 2PV1A 4P8WA 1NWUA 4JFMA 2DG9A 1NSGA 1HJWA 3KACA 1F8AB 1D6OA 1EHNA 3JYMA 2XPBA 4DWSB 2XP7A 3JYJA 3CGMA 3O5RA 4KQZA 3B7XA 2RUQA 1C9HA 4TNSA 1Q6HA 3IK8A 1VF8A 3WIJA 3WD2A 2KE0A 1NMWA 2F21A 3RFWA 4J4NA 1U79A 3ARVA 5DO2A 3KAIA 3RGCA 3CGNA 2N87A 3KAFA 4ODPA 3NI6A 2DSWA 4IPXA 2WM0A 1BKFA 4IQ2A 1LG1A 3ARUA 2ZR4A 1FKGA 2ZQSA 1NWRA 4FAPA 2KFWA 4W5UA 1J6YA 1FKTA 3WL1A 2ZR5A 1HKJA 1W26A 1EDQA 3CHDA 4N19A 4GIVA 4G2PA 1J4IA 2WLZA 3PRAA 4HARA 4JYSA 2PPPA 1GPFA 2XP3A 4WKAA 4DROA 1FKBA 1J4HA 3ARWA 5BXJA 3WD4A 3UQIA 3ARQA 5HWCA 2FDMA 4BF8A 4MNLA 4LAWA 3UI4A 2XP8A 4DRHA 3I6CA 1LJYA 1O6IA 2L2SA 2KO7A 3AS2A 5J6EA 3AS0A 3ALGA 4DRPA 1LL4A 2QF8A 4Z2HA 4NZCA 3NRKA 4TX0A 1HJXA 1KFWA 4URIA 1A7XA 4WIWA 5DEZA 1FKDA 2ZQUA 5HKGA 2YBUA 2Q5AA 4TYOA 4QIBA 4ODQA 4S3KA 4ZPTR 1YATA 1ZK6A 4ODOA 1ZBWA 2F2DA 3JXVA 4KR0B 2M08A 4ODRA 4WKFA 1B6CA 1W9UA 2ZQTA 1OGBA 1W1PA 2PPNA 2MLXA 1W1TA 1JNDA 4TW6A 4Q22A 1R9HA 2XPAA 3ARZA 4TW8A 2XP4A 3TC5A 5I98A 2RSEA 2ZR6A 5GPGA 3TCZA 4ODLA 4ZPWR 3CHCA 2DG3A 3B9EA 4PTMA 2YBTA 1D2KA 1FKRA 3UI6A 2ESCA 4TW7A 2LGOA 4L72B 1HJVA 1JNSA 2K8IA 1LG2A 4MNMA 2JZVA 1FKSA 2WLYA 3O5DA 4P8VA 2AOSA 3O5GA 3VAWA 4HBEA 4LAVA 2Y78A 3KCEA 2PV2A 2B31A 1QPFA 2DSZA 1ZBKA 4P8UA 1FKLA 1WAWA 4GGQA 4R0XA 3RM4A 5GQBA 4DWSA 3FY1A 5HWBA 3ARPA 4JFKA 3IKDA 1HXVA 1X6LA 1SR0A 1FKJA 2M1IA 1EQ3A 1NMVA 3AS3A 2MPHA 1WB0A 4ZS6A 4FN2A 2A3EA 2XP6A 2OLHA 1ZL1A 1T11A 3CZ8A 1FFRA 1RD6A 3ARSA 3B9DA 5HW6A 1X6NA 2KGJA 3PRDA 3QOKA 4MPKA 3LUOA 2DG4A 4Z2JA 3AS1A 3BXWA 3UI5A 1L1PA 5HW8A 1H0IA 1GOIA 1Q6IA 3KZ7A 3WH0A 4W9QA 4NNRA 1D7JA 1N1AA 2G41A 4HBOA 1D7HA 2O92A 1ROTA 4Q7NA 1PBKA 1FJDA 4DZ3A 1E6RA 4XAKA 5JH8A 4W9OA 4DWSC 3KABA 3O5IA 1Q6UA 3CHEA 3B8SA 2DT2A 4G50A 2A3BA 3O5LA 2M2AA 4JFIA 3RM8A 4QZVB 3WD1A 1SYTA 4LGXA 1HKMA 3WQWA 2OFNA 4DRQA 1W9VA 2F4EA 4W9PA 4U86A 1FAPA 4ODKA 1E15A 3WQVA 1ZB5A 2MNTA 4LAYA 2DT0A 1PINA 2IUZA 1QPLA 1K9TA 2O9OA 1OWQA 5DIVA 4DRJA 1E9LA 5D75A 1FD9A 1LL7A 5DITA 3O5PA 3FXYA 4ZPVR 1NH6A 4JFJA 3ARXA 4P8XA 1TCOC 3FAPA 4Z2IA 1OGGA 2DSUA 2A3CA 4ODNA 4R5EA 5B8IC 2MLYA 1FKHA 3ARTA 3UF8A 3ODKA 1BL4A 3ALFA 3WD0A 4ODMA 1XHGA 3PR9A 3PA7A 4U84A 4NSBA 4DIPA 1ZBCA 3G6LA 3OOBA 1W1YA 4C02B 1FKKA 1KT0A 2XP5A 4Z2LA 5GPRA 2RQSA 2AWGA 2FKEA 4WK9A 4IT4A 1ZBVA 3O5KA 3AQUA 2PV3A 2PBCA 3H9RB 1WNOA 1EYMA 3PRBA 1ITXA 3TDBA 2RUDA 3O5OA 3O5JA 4DRNA 1EIBA 3WL0A 4AY1A 4MGVA 3KADA 4U85A 5DF0A 3AROA 5HT1A 2KI3A 1Y0OA 1JNTA 2A3AA 4MNKA 4DH0A 2XP9A 1H0GA 4Z2GA 4O2TA 1HKIA 3NTPA 2DT3A 2DT1A 5HTGA 4DRIA 4QT3A 4DWSD 2DPEA 1LQ0A 3UQAA 2D9FA 2MF9A 1NWSA 1E6PA 1KT1A 3WD3A 1YW5A 3B9AA 4QT2A 2KR7A 2VCDA 1LL6A 1CTNA 1ZCNA 3WKZA 3GPKA 1Q1CA 4WJXA 2PPOA 3O5QA 3G6MA 3MDYB 4ML4A 5DIUA 4MAVA 1E6NA 2MLZA 2IF4A 2ITKA 1FKIA 1ROUA 4MTVA 2FAPA 4Z2KA 2LKNA 1JVWA 2DSVA 1XRVA 1NWTA 1TFVA 2UZ5A 3CHFA 1IX5A 3ARRA 1GUVA 3KAGA 5HUAA 2ZQVA 4MNJA 3ARYA 3RMEA 3RM9A 5HW7A 2RUCA 2LPVA 4WKHA 4MSPA 1ZU8A 4DZ2A 2LJ4A 1QZ2A 4DT4A 3O5EA 1M5YA 1FKFA 5HBFA 3EY6A 3O5FA 1W9PA 3CH9A 1HKKA 4DRMA 1UR8A 2RURA 3O5MA 3UQBA 1UR9A 1E6ZA 2G8ZA 1J4RA 4L3NA 1D7IA 4S3JA 1F40A 1JNEA 3OA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKD A;  2ZQU A;  5HKG A;  2VN1 A;  4DRN A;  2Q5A A;  1D7H A;  4TYO A;  4QIB A;  5I98 A;  4ODQ A;  4LAX A;  1ROT A;  1YAT A;  1ZK6 A;  1PBK A;  4JFL A;  2F2D A;  4MGV A;  3JXV A;  3KAD A;  4ODO A;  4U85 A;  4DRK A;  4DZ3 A;  2M08 A;  4ODR A;  5HT1 A;  4W9O A;  3IHZ A;  1B6C A;  2KI3 A;  1P5Q A;  1Y0O A;  3KAB A;  3O5I A;  1JNT A;  4IQC A;  1Q6U A;  2ZQT A;  3IKG A;  4G50 A;  4J4O A;  4ITZ A;  2PPN A;  2MLX A;  3KAH A;  2PV1 A;  3O5L A;  2XP9 A;  2M2A A;  4JFI A;  4DH0 A;  4TW6 A;  1R9H A;  2XPA A;  4O2T A;  3NTP A;  4TW8 A;  4JFM A;  2DG9 A;  2XP4 A;  3TC5 A;  1NSG A;  4DRI A;  5HTG A;  1F8A B;  1D6O A;  2RSE A;  2OFN A;  2ZR6 A;  2XPB A;  3JYM A;  3KAC A;  4QT3 A;  5GPG A;  4DRQ A;  3TCZ A;  2F4E A;  2XP7 A;  3JYJ A;  4ODL A;  4U86 A;  4W9P A;  1FAP A;  3CGM A;  3O5R A;  3UQA A;  3B7X A;  4ODK A;  2RUQ A;  1C9H A;  2DG3 A;  4TNS A;  2D9F A;  1Q6H A;  2MF9 A;  3IK8 A;  1FKR A;  3UI6 A;  2KE0 A;  1NMW A;  2F21 A;  2MNT A;  4TW7 A;  4J4N A;  3RFW A;  1U79 A;  1KT1 A;  3KAI A;  3RGC A;  4LAY A;  3CGN A;  1YW5 A;  2N87 A;  3KAF A;  2KR7 A;  2LGO A;  2VCD A;  4ODP A;  4QT2 A;  3NI6 A;  1PIN A;  4IPX A;  1ZCN A;  1FJD A;  3GPK A;  1QPL A;  1JNS A;  1BKF A;  4IQ2 A;  1Q1C A;  2ZR4 A;  5DIV A;  1FKG A;  2ZQS A;  2K8I A;  2PPO A;  3O5Q A;  4DRJ A;  4FAP A;  2KFW A;  3MDY B;  5DIU A;  2JZV A;  1J6Y A;  1FKT A;  1FKS A;  3O5D A;  3VAW A;  5D75 A;  3O5G A;  2MLZ A;  1FD9 A;  4LAV A;  2IF4 A;  2ITK A;  2Y78 A;  3KCE A;  2ZR5 A;  5DIT A;  2PV2 A;  3O5P A;  1W26 A;  1QPF A;  1FKI A;  1ROU A;  4N19 A;  2FAP A;  4GIV A;  4G2P A;  1FKL A;  4JFJ A;  2LKN A;  1J4I A;  1JVW A;  4JYS A;  1TCO C;  3FAP A;  4GGQ A;  4R0X A;  2PPP A;  2UZ5 A;  2XP3 A;  4ODN A;  4DRO A;  5B8I C;  2MLY A;  5HWB A;  5HUA A;  3KAG A;  1FKB A;  4JFK A;  1FKH A;  1J4H A;  2ZQV A;  3IKD A;  3ODK A;  1BL4 A;  3UF8 A;  3UQI A;  5BXJ A;  1HXV A;  5HWC A;  4ODM A;  1FKJ A;  2M1I A;  1EQ3 A;  4BF8 A;  3PA7 A;  4U84 A;  2RUC A;  4DIP A;  5HW7 A;  4LAW A;  1NMV A;  2LPV A;  2MPH A;  3UI4 A;  2XP8 A;  4MSP A;  4FN2 A;  4DRH A;  2XP6 A;  3I6C A;  3OOB A;  4C02 B;  4DZ2 A;  1FKK A;  1KT0 A;  2LJ4 A;  1QZ2 A;  1T11 A;  2XP5 A;  4DT4 A;  3O5E A;  1M5Y A;  5HW6 A;  2KGJ A;  2RQS A;  3PRD A;  2L2S A;  3LUO A;  2KO7 A;  2AWG A;  2FKE A;  5J6E A;  1FKF A;  2DG4 A;  3EY6 A;  3O5F A;  3O5K A;  3UI5 A;  1L1P A;  4DRM A;  5HW8 A;  2RUR A;  3O5M A;  2PV3 A;  4DRP A;  3UQB A;  3KZ7 A;  1Q6I A;  3WH0 A;  1J4R A;  2PBC A;  3H9R B;  4W9Q A;  1D7I A;  1EYM A;  3NRK A;  3PRB A;  1F40 A;  4TX0 A;  4NNR A;  3TDB A;  2RUD A;  3O5O A;  1A7X A;  1D7J A;  3O5J A;  1N1A A; 
#chains in the Genus database with same CATH topology
 3W4R A;  1FFQ A;  2VN1 A;  2WK2 A;  4IT6 A;  2PI6 A;  4LAX A;  4JFL A;  4DRK A;  1W1V A;  3IHZ A;  1P5Q A;  4IQC A;  3IKG A;  4J4O A;  4ITZ A;  3KAH A;  2PV1 A;  4P8W A;  1NWU A;  4JFM A;  2DG9 A;  1NSG A;  1HJW A;  3KAC A;  1F8A B;  1D6O A;  1EHN A;  3JYM A;  2XPB A;  4DWS B;  2XP7 A;  3JYJ A;  3CGM A;  3O5R A;  4KQZ A;  3B7X A;  2RUQ A;  1C9H A;  4TNS A;  1Q6H A;  3IK8 A;  1VF8 A;  3WIJ A;  3WD2 A;  2KE0 A;  1NMW A;  2F21 A;  3RFW A;  4J4N A;  1U79 A;  3ARV A;  5DO2 A;  3KAI A;  3RGC A;  3CGN A;  2N87 A;  3KAF A;  4ODP A;  3NI6 A;  2DSW A;  4IPX A;  2WM0 A;  1BKF A;  4IQ2 A;  1LG1 A;  3ARU A;  2ZR4 A;  1FKG A;  2ZQS A;  1NWR A;  4FAP A;  2KFW A;  4W5U A;  1J6Y A;  1FKT A;  3WL1 A;  2PN0 A;  2ZR5 A;  1HKJ A;  1W26 A;  1EDQ A;  3CHD A;  4N19 A;  4GIV A;  4G2P A;  1J4I A;  2WLZ A;  3PRA A;  4HAR A;  4JYS A;  2PPP A;  1GPF A;  2XP3 A;  4WKA A;  2B5U B;  4DRO A;  1FKB A;  1J4H A;  3ARW A;  5BXJ A;  3WD4 A;  3UQI A;  3ARQ A;  5HWC A;  2FDM A;  4BF8 A;  4MNL A;  4LAW A;  3UI4 A;  2XP8 A;  4DRH A;  3I6C A;  1LJY A;  1O6I A;  2L2S A;  2KO7 A;  3AS2 A;  5J6E A;  3AS0 A;  3ALG A;  4DRP A;  1LL4 A;  2QF8 A;  4Z2H A;  4NZC A;  3NRK A;  4TX0 A;  1HJX A;  1KFW A;  4URI A;  1A7X A;  4WIW A;  5DEZ A;  1FKD A;  2ZQU A;  5HKG A;  2YBU A;  2Q5A A;  4TYO A;  4QIB A;  4ODQ A;  4S3K A;  4ZPT R;  1YAT A;  1ZK6 A;  4ODO A;  1ZBW A;  2F2D A;  3JXV A;  4KR0 B;  2M08 A;  4ODR A;  4WKF A;  1B6C A;  1W9U A;  2ZQT A;  1OGB A;  1W1P A;  2PPN A;  2MLX A;  1W1T A;  1JND A;  4TW6 A;  4Q22 A;  1R9H A;  2XPA A;  3ARZ A;  4TW8 A;  2XP4 A;  3TC5 A;  5I98 A;  2RSE A;  2ZR6 A;  5GPG A;  3TCZ A;  4ODL A;  4ZPW R;  3CHC A;  2DG3 A;  3B9E A;  4PTM A;  2YBT A;  1D2K A;  1FKR A;  3UI6 A;  3GTY X;  2ESC A;  4TW7 A;  2LGO A;  4L72 B;  1HJV A;  1JNS A;  2K8I A;  1LG2 A;  4MNM A;  2JZV A;  1FKS A;  2WLY A;  3O5D A;  4P8V A;  2AOS A;  3O5G A;  3VAW A;  3GU0 A;  4HBE A;  4LAV A;  2Y78 A;  3KCE A;  2PV2 A;  2B31 A;  1QPF A;  2DSZ A;  1ZBK A;  4P8U A;  1FKL A;  1WAW A;  4GGQ A;  4R0X A;  3RM4 A;  5GQB A;  4DWS A;  3FY1 A;  2P4V A;  5HWB A;  3ARP A;  4JFK A;  3IKD A;  1HXV A;  1X6L A;  1SR0 A;  1FKJ A;  2M1I A;  1EQ3 A;  1NMV A;  3AS3 A;  2MPH A;  1WB0 A;  4ZS6 A;  4FN2 A;  2A3E A;  2XP6 A;  2OLH A;  1ZL1 A;  1T11 A;  3CZ8 A;  1FFR A;  1RD6 A;  3ARS A;  3B9D A;  5HW6 A;  1X6N A;  2KGJ A;  3PRD A;  3QOK A;  4MPK A;  3LUO A;  2DG4 A;  4Z2J A;  3AS1 A;  3BXW A;  3UI5 A;  1L1P A;  5HW8 A;  1H0I A;  1GOI A;  1Q6I A;  3KZ7 A;  3WH0 A;  4W9Q A;  4NNR A;  1D7J A;  1N1A A;  2G41 A;  4HBO A;  1D7H A;  2O92 A;  1ROT A;  4Q7N A;  1PBK A;  1FJD A;  4DZ3 A;  1E6R A;  4XAK A;  5JH8 A;  4W9O A;  4DWS C;  3KAB A;  3O5I A;  1Q6U A;  3CHE A;  3B8S A;  2DT2 A;  4G50 A;  2A3B A;  3O5L A;  2M2A A;  4JFI A;  3RM8 A;  4QZV B;  3WD1 A;  1SYT A;  4LGX A;  1HKM A;  3WQW A;  2OFN A;  4DRQ A;  1W9V A;  2F4E A;  4W9P A;  4U86 A;  1FAP A;  3EIP A;  4ODK A;  1E15 A;  2ETN A;  3WQV A;  1ZB5 A;  2MNT A;  4LAY A;  3BMB A;  2DT0 A;  1PIN A;  2IUZ A;  1QPL A;  1GRJ A;  1K9T A;  2O9O A;  1OWQ A;  5DIV A;  4DRJ A;  1E9L A;  5D75 A;  1FD9 A;  1LL7 A;  5DIT A;  3O5P A;  3FXY A;  4ZPV R;  1NH6 A;  1JCH B;  4JFJ A;  3ARX A;  4P8X A;  1TCO C;  3FAP A;  4Z2I A;  1E44 A;  1OGG A;  2DSU A;  2A3C A;  4ODN A;  4R5E A;  5B8I C;  2MLY A;  1FKH A;  3ART A;  3UF8 A;  3ODK A;  1BL4 A;  3ALF A;  3WD0 A;  4ODM A;  1XHG A;  3PR9 A;  3PA7 A;  4U84 A;  4NSB A;  4DIP A;  1ZBC A;  3G6L A;  3OOB A;  1W1Y A;  4C02 B;  1FKK A;  1KT0 A;  2XP5 A;  4Z2L A;  5GPR A;  2RQS A;  2AWG A;  2FKE A;  4WK9 A;  4IT4 A;  1ZBV A;  3O5K A;  3AQU A;  2PV3 A;  2PBC A;  3H9R B;  1WNO A;  1EYM A;  3PRB A;  1ITX A;  3TDB A;  2RUD A;  3O5O A;  3O5J A;  4DRN A;  1EIB A;  3WL0 A;  4AY1 A;  4MGV A;  3KAD A;  4U85 A;  5DF0 A;  3ARO A;  5HT1 A;  2KI3 A;  1Y0O A;  1JNT A;  2EUL A;  2A3A A;  4MNK A;  4DH0 A;  2XP9 A;  1H0G A;  4Z2G A;  4O2T A;  1HKI A;  3NTP A;  2DT3 A;  2DT1 A;  5HTG A;  4DRI A;  4QT3 A;  4DWS D;  2DPE A;  1LQ0 A;  3UQA A;  2D9F A;  2MF9 A;  1NWS A;  1E6P A;  1KT1 A;  3WD3 A;  1YW5 A;  3B9A A;  4QT2 A;  2KR7 A;  2VCD A;  1LL6 A;  1CTN A;  1ZCN A;  3WKZ A;  3GPK A;  4UDM A;  1Q1C A;  4WJX A;  2PPO A;  3O5Q A;  3G6M A;  3MDY B;  4ML4 A;  5DIU A;  4MAV A;  1E6N A;  2MLZ A;  2IF4 A;  2ITK A;  1FKI A;  1ROU A;  4MTV A;  2FAP A;  4Z2K A;  2LKN A;  1JVW A;  2DSV A;  1XRV A;  1NWT A;  1TFV A;  2UZ5 A;  3CHF A;  1IX5 A;  3ARR A;  1GUV A;  3KAG A;  5HUA A;  2ZQV A;  4MNJ A;  3ARY A;  3RME A;  2F23 A;  3RM9 A;  5HW7 A;  2RUC A;  2LPV A;  4WKH A;  4MSP A;  1ZU8 A;  4DZ2 A;  2LJ4 A;  1QZ2 A;  4DT4 A;  3O5E A;  1M5Y A;  1FKF A;  5HBF A;  3EY6 A;  3O5F A;  1W9P A;  3CH9 A;  1HKK A;  4DRM A;  1UR8 A;  2RUR A;  3O5M A;  3UQB A;  1UR9 A;  1E6Z A;  2G8Z A;  1J4R A;  4L3N A;  1D7I A;  4S3J A;  1F40 A;  1JNE A;  3OA5 A; 
#chains in the Genus database with same CATH homology
 3W4R A;  1FFQ A;  2VN1 A;  2WK2 A;  4IT6 A;  2PI6 A;  4LAX A;  4JFL A;  4DRK A;  1W1V A;  3IHZ A;  1P5Q A;  4IQC A;  3IKG A;  4J4O A;  4ITZ A;  3KAH A;  2PV1 A;  4P8W A;  1NWU A;  4JFM A;  2DG9 A;  1NSG A;  1HJW A;  3KAC A;  1F8A B;  1D6O A;  1EHN A;  3JYM A;  2XPB A;  4DWS B;  2XP7 A;  3JYJ A;  3CGM A;  3O5R A;  4KQZ A;  3B7X A;  2RUQ A;  1C9H A;  4TNS A;  1Q6H A;  3IK8 A;  1VF8 A;  3WIJ A;  3WD2 A;  2KE0 A;  1NMW A;  2F21 A;  3RFW A;  4J4N A;  1U79 A;  3ARV A;  5DO2 A;  3KAI A;  3RGC A;  3CGN A;  2N87 A;  3KAF A;  4ODP A;  3NI6 A;  2DSW A;  4IPX A;  2WM0 A;  1BKF A;  4IQ2 A;  1LG1 A;  3ARU A;  2ZR4 A;  1FKG A;  2ZQS A;  1NWR A;  4FAP A;  2KFW A;  4W5U A;  1J6Y A;  1FKT A;  3WL1 A;  2ZR5 A;  1HKJ A;  1W26 A;  1EDQ A;  3CHD A;  4N19 A;  4GIV A;  4G2P A;  1J4I A;  2WLZ A;  3PRA A;  4HAR A;  4JYS A;  2PPP A;  1GPF A;  2XP3 A;  4WKA A;  4DRO A;  1FKB A;  1J4H A;  3ARW A;  5BXJ A;  3WD4 A;  3UQI A;  3ARQ A;  5HWC A;  2FDM A;  4BF8 A;  4MNL A;  4LAW A;  3UI4 A;  2XP8 A;  4DRH A;  3I6C A;  1LJY A;  1O6I A;  2L2S A;  2KO7 A;  3AS2 A;  5J6E A;  3AS0 A;  3ALG A;  4DRP A;  1LL4 A;  2QF8 A;  4Z2H A;  4NZC A;  3NRK A;  4TX0 A;  1HJX A;  1KFW A;  4URI A;  1A7X A;  4WIW A;  5DEZ A;  1FKD A;  2ZQU A;  5HKG A;  2YBU A;  2Q5A A;  4TYO A;  4QIB A;  4ODQ A;  4S3K A;  4ZPT R;  1YAT A;  1ZK6 A;  4ODO A;  1ZBW A;  2F2D A;  3JXV A;  4KR0 B;  2M08 A;  4ODR A;  4WKF A;  1B6C A;  1W9U A;  2ZQT A;  1OGB A;  1W1P A;  2PPN A;  2MLX A;  1W1T A;  1JND A;  4TW6 A;  4Q22 A;  1R9H A;  2XPA A;  3ARZ A;  4TW8 A;  2XP4 A;  3TC5 A;  5I98 A;  2RSE A;  2ZR6 A;  5GPG A;  3TCZ A;  4ODL A;  4ZPW R;  3CHC A;  2DG3 A;  3B9E A;  4PTM A;  2YBT A;  1D2K A;  1FKR A;  3UI6 A;  2ESC A;  4TW7 A;  2LGO A;  4L72 B;  1HJV A;  1JNS A;  2K8I A;  1LG2 A;  4MNM A;  2JZV A;  1FKS A;  2WLY A;  3O5D A;  4P8V A;  2AOS A;  3O5G A;  3VAW A;  4HBE A;  4LAV A;  2Y78 A;  3KCE A;  2PV2 A;  2B31 A;  1QPF A;  2DSZ A;  1ZBK A;  4P8U A;  1FKL A;  1WAW A;  4GGQ A;  4R0X A;  3RM4 A;  5GQB A;  4DWS A;  3FY1 A;  5HWB A;  3ARP A;  4JFK A;  3IKD A;  1HXV A;  1X6L A;  1SR0 A;  1FKJ A;  2M1I A;  1EQ3 A;  1NMV A;  3AS3 A;  2MPH A;  1WB0 A;  4ZS6 A;  4FN2 A;  2A3E A;  2XP6 A;  2OLH A;  1ZL1 A;  1T11 A;  3CZ8 A;  1FFR A;  1RD6 A;  3ARS A;  3B9D A;  5HW6 A;  1X6N A;  2KGJ A;  3PRD A;  3QOK A;  4MPK A;  3LUO A;  2DG4 A;  4Z2J A;  3AS1 A;  3BXW A;  3UI5 A;  1L1P A;  5HW8 A;  1H0I A;  1GOI A;  1Q6I A;  3KZ7 A;  3WH0 A;  4W9Q A;  4NNR A;  1D7J A;  1N1A A;  2G41 A;  4HBO A;  1D7H A;  2O92 A;  1ROT A;  4Q7N A;  1PBK A;  1FJD A;  4DZ3 A;  1E6R A;  4XAK A;  5JH8 A;  4W9O A;  4DWS C;  3KAB A;  3O5I A;  1Q6U A;  3CHE A;  3B8S A;  2DT2 A;  4G50 A;  2A3B A;  3O5L A;  2M2A A;  4JFI A;  3RM8 A;  4QZV B;  3WD1 A;  1SYT A;  4LGX A;  1HKM A;  3WQW A;  2OFN A;  4DRQ A;  1W9V A;  2F4E A;  4W9P A;  4U86 A;  1FAP A;  4ODK A;  1E15 A;  3WQV A;  1ZB5 A;  2MNT A;  4LAY A;  2DT0 A;  1PIN A;  2IUZ A;  1QPL A;  1K9T A;  2O9O A;  1OWQ A;  5DIV A;  4DRJ A;  1E9L A;  5D75 A;  1FD9 A;  1LL7 A;  5DIT A;  3O5P A;  3FXY A;  4ZPV R;  1NH6 A;  4JFJ A;  3ARX A;  4P8X A;  1TCO C;  3FAP A;  4Z2I A;  1OGG A;  2DSU A;  2A3C A;  4ODN A;  4R5E A;  5B8I C;  2MLY A;  1FKH A;  3ART A;  3UF8 A;  3ODK A;  1BL4 A;  3ALF A;  3WD0 A;  4ODM A;  1XHG A;  3PR9 A;  3PA7 A;  4U84 A;  4NSB A;  4DIP A;  1ZBC A;  3G6L A;  3OOB A;  1W1Y A;  4C02 B;  1FKK A;  1KT0 A;  2XP5 A;  4Z2L A;  5GPR A;  2RQS A;  2AWG A;  2FKE A;  4WK9 A;  4IT4 A;  1ZBV A;  3O5K A;  3AQU A;  2PV3 A;  2PBC A;  3H9R B;  1WNO A;  1EYM A;  3PRB A;  1ITX A;  3TDB A;  2RUD A;  3O5O A;  3O5J A;  4DRN A;  1EIB A;  3WL0 A;  4AY1 A;  4MGV A;  3KAD A;  4U85 A;  5DF0 A;  3ARO A;  5HT1 A;  2KI3 A;  1Y0O A;  1JNT A;  2A3A A;  4MNK A;  4DH0 A;  2XP9 A;  1H0G A;  4Z2G A;  4O2T A;  1HKI A;  3NTP A;  2DT3 A;  2DT1 A;  5HTG A;  4DRI A;  4QT3 A;  4DWS D;  2DPE A;  1LQ0 A;  3UQA A;  2D9F A;  2MF9 A;  1NWS A;  1E6P A;  1KT1 A;  3WD3 A;  1YW5 A;  3B9A A;  4QT2 A;  2KR7 A;  2VCD A;  1LL6 A;  1CTN A;  1ZCN A;  3WKZ A;  3GPK A;  1Q1C A;  4WJX A;  2PPO A;  3O5Q A;  3G6M A;  3MDY B;  4ML4 A;  5DIU A;  4MAV A;  1E6N A;  2MLZ A;  2IF4 A;  2ITK A;  1FKI A;  1ROU A;  4MTV A;  2FAP A;  4Z2K A;  2LKN A;  1JVW A;  2DSV A;  1XRV A;  1NWT A;  1TFV A;  2UZ5 A;  3CHF A;  1IX5 A;  3ARR A;  1GUV A;  3KAG A;  5HUA A;  2ZQV A;  4MNJ A;  3ARY A;  3RME A;  3RM9 A;  5HW7 A;  2RUC A;  2LPV A;  4WKH A;  4MSP A;  1ZU8 A;  4DZ2 A;  2LJ4 A;  1QZ2 A;  4DT4 A;  3O5E A;  1M5Y A;  1FKF A;  5HBF A;  3EY6 A;  3O5F A;  1W9P A;  3CH9 A;  1HKK A;  4DRM A;  1UR8 A;  2RUR A;  3O5M A;  3UQB A;  1UR9 A;  1E6Z A;  2G8Z A;  1J4R A;  4L3N A;  1D7I A;  4S3J A;  1F40 A;  1JNE A;  3OA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...