5HWCA

Aspergillus fumigatus fkbp12 p90g protein bound with fk506 in p212121 space group
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
HMGVTKELKSPGNGVDFPKKGDFVTIHYTGRLTDGSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPGVIPGNSTLIFEVELLGINNKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
total genus 30
structure length 113
sequence length 113
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hwcA00
4DZ3A 1C9HA 5DIVA 4TW6A 1N1AA 4ODRA 4C02B 3O5RA 2VN1A 2M1IA 4ODMA 1ROUA 1Y0OA 3O5FA 4TX0A 3O5QA 4TYOA 3O5OA 2DG9A 3O5EA 2RSEA 1D7JA 2Y78A 2KGJA 2PV2A 5B8IC 1NMVA 4BF8A 4U84A 4G50A 1M5YA 3FAPA 2DG3A 4N19A 2LKNA 1PINA 1NSGA 4QT3A 3CGMA 1J4IA 1ZK6A 3O5GA 3OOBA 2XP4A 2XP6A 2L2SA 1U79A 1J4RA 2ZQTA 3VAWA 4JFJA 2F4EA 4DRNA 1FKSA 1J6YA 2D9FA 2M2AA 2ZR4A 3KZ7A 1FKJA 1FKRA 1FKDA 2RUCA 4MGVA 3TC5A 1BKFA 5HW6A 4IQ2A 1FJDA 4QT2A 3NI6A 3GPKA 4DZ2A 1QPFA 1FKTA 3O5DA 4LAWA 3RGCA 4DH0A 3JXVA 2PV1A 4GGQA 2XP5A 5D75A 3KAGA 4ITZA 3TDBA 5BXJA 1ZCNA 4QIBA 5HW8A 3UI6A 2PV3A 3NTPA 3IHZA 3H9RB 4O2TA 4DRQA 3O5KA 1JVWA 3KABA 4JFMA 4DRPA 1YATA 1W26A 3UQIA 3MDYB 3PRDA 1D7HA 1FKKA 3PA7A 5GPGA 2LGOA 2ZR6A 5DITA 4FAPA 4TNSA 2RQSA 3IKGA 4JFIA 1FKIA 1QZ2A 3JYMA 4U85A 4W9OA 4W9QA 1FKBA 3JYJA 4JFKA 3UI4A 1A7XA 1FKFA 3O5IA 5HWCA 4DIPA 4MSPA 5HUAA 2AWGA 5HWBA 3O5MA 1FD9A 4J4OA 3UQAA 2XP8A 4LAVA 2KI3A 1F8AB 4DT4A 1FKHA 3RFWA 4DRMA 1YW5A 4ODKA 4R0XA 2FAPA 1F40A 4ODOA 5HKGA 3TCZA 4ODPA 1B6CA 3CGNA 4NNRA 2KFWA 2M08A 3O5LA 3EY6A 1FAPA 2JZVA 2LJ4A 2XP3A 5HW7A 2KO7A 4DRIA 4TW7A 3KAIA 2MLYA 2MF9A 3UQBA 5HT1A 2LPVA 3UF8A 3KAHA 2ZQUA 1FKLA 4IQCA 4ODNA 3B7XA 2ZQSA 2FKEA 2PPPA 2ZQVA 1R9HA 3PRBA 2F2DA 4J4NA 1KT1A 3LUOA 1T11A 4JFLA 5DIUA 3KADA 1J4HA 4FN2A 4GIVA 4JYSA 1EYMA 1Q6IA 1P5QA 3NRKA 4LAXA 4DROA 2MNTA 2XP7A 1D6OA 2MLZA 1NMWA 1PBKA 2ZR5A 4LAYA 4U86A 4DRJA 2MLXA 2DG4A 2PBCA 2XP9A 2RURA 2PPOA 2MPHA 2RUQA 3KCEA 3O5PA 4W9PA 1HXVA 1FKGA 2PPNA 1EQ3A 2ITKA 2RUDA 3KACA 1JNTA 1BL4A 2F21A 3I6CA 3WH0A 3IKDA 4DRHA 2IF4A 2OFNA 4IPXA 1QPLA 4ODLA 5J6EA 3O5JA 4G2PA 1Q6HA 1Q6UA 1Q1CA 1TCOC 2N87A 2VCDA 2KR7A 4TW8A 3IK8A 5I98A 2XPBA 1D7IA 3UI5A 1JNSA 4DRKA 2KE0A 2K8IA 3KAFA 3ODKA 1KT0A 5HTGA 2Q5AA 4ODQA 2XPAA 2UZ5A 1ROTA 1L1PA
chains in the Genus database with same CATH superfamily
3WD0A 1OWQA 3AS0A 4DZ3A 3CH9A 4C02B 4R5EA 3O5RA 5JH8A 1SYTA 4TYOA 2DG9A 2RSEA 1D7JA 2IUZA 1ZU8A 3QOKA 3WD3A 1W9UA 4U84A 1HKIA 1ZBCA 2LKNA 1NSGA 2WLZA 4QT3A 3CGMA 3ARYA 2DT2A 2DSZA 4Z2KA 1J6YA 2F23A 1FFRA 1O6IA 5GQBA 1FKDA 4MGVA 4DWSA 1FKTA 4W5UA 3FXYA 5HW8A 3AS2A 3UI6A 3IHZA 4JFMA 1YATA 3MDYB 3CHCA 3PA7A 5GPGA 2ZR6A 1QZ2A 4U85A 5DF0A 4W9OA 1XRVA 4W9QA 3JYJA 1H0GA 1LL6A 4JFKA 2WK2A 3UI4A 3O5IA 2DSUA 5HUAA 2AWGA 5HWBA 3O5MA 3UQAA 2KI3A 4QZVB 1F40A 1HJWA 1E6RA 3CGNA 4NNRA 2KFWA 2ETNA 3O5LA 2LJ4A 4P8UA 4DRIA 4TW7A 1HKKA 1W1VA 3UF8A 4ODNA 4LGXA 3ARVA 2A3EA 2ZQVA 1R9HA 4Q22A 4FN2A 4JYSA 1IX5A 1P5QA 3CHEA 2ZR5A 4LAYA 2MLXA 2RURA 3B9EA 4Q7NA 2RUQA 1BL4A 2F21A 3IKDA 4ODLA 1HJVA 3B9DA 4G2PA 1Q6HA 3WD2A 1Q1CA 2VCDA 3ARSA 4NSBA 3AROA 3IK8A 4Z2LA 1D2KA 1FFQA 2K8IA 2PN0A 4UDMA 2FDMA 2WM0A 1HKJA 1C9HA 4TW6A 4ODRA 3RM8A 4HBEA 2O9OA 4ML4A 3O5EA 4ZPTR 2KGJA 1JCHB 2PV2A 3AQUA 4IT4A 3ARWA 1K9TA 1NMVA 3ALFA 2EULA 3FAPA 2DG3A 4DWSB 1ZK6A 1OGBA 3OOBA 4ZPWR 2ZQTA 4URIA 3VAWA 5DO2A 4DRNA 1GUVA 4WJXA 1SR0A 2M2AA 4WK9A 1FKRA 3EIPA 1E44A 3NI6A 3GPKA 4DZ2A 5HWCA 3O5DA 4DH0A 2PV1A 2XP5A 4Z2JA 3PR9A 3TDBA 5BXJA 2DPEA 3WL1A 2PV3A 3NTPA 4S3JA 3H9RB 3ARTA 3O5KA 1W26A 3BXWA 3PRDA 1WNOA 4TNSA 2RQSA 4JFIA 1FKIA 3JYMA 1W9VA 1TFVA 1FD9A 4J4OA 4P8VA 4L72B 3WIJA 4LAVA 5GPRA 3RFWA 4ODKA 4R0XA 2FAPA 3G6MA 3TCZA 1E6NA 4WKAA 2XP3A 3AS1A 3KAIA 2MF9A 5HT1A 4DWSD 1FKLA 3PRBA 3WD1A 4J4NA 4MNKA 1LG2A 1T11A 5DIUA 4WKFA 3RMEA 1EYMA 1Q6IA 1LG1A 2DSWA 4DROA 4MPKA 1W1PA 1D6OA 1PBKA 4MNMA 1ZBWA 2A3CA 3GTYX 1EHNA 4KR0B 3ARQA 2PPOA 2MPHA 3O5PA 4W9PA 5DEZA 1EQ3A 4PTMA 2IF4A 4Z2GA 4IPXA 1LL7A 1E9LA 3O5JA 1Q6UA 1TCOC 2KR7A 3AS3A 2XPBA 5HBFA 2B31A 1KT0A 2Q5AA 2XPAA 2YBTA 1XHGA 2VN1A 1LJYA 2M1IA 4ODMA 1ROUA 1NWUA 1W9PA 4TX0A 4Z2HA 3O5QA 3O5OA 3ARXA 2G41A 1E6ZA 1M5YA 1PINA 3B8SA 1E15A 3CHDA 2XP4A 2XP6A 1ZL1A 1U79A 2WLYA 4JFJA 2F4EA 1FKSA 1UR8A 2D9FA 2ZR4A 3KZ7A 1HJXA 4ZS6A 5HW6A 3TC5A 4AY1A 4QT2A 1QPFA 3PRAA 4GGQA 1ZCNA 4QIBA 3WD4A 1ZB5A 1JVWA 4DRPA 3UQIA 1FKKA 2QF8A 1WAWA 2LGOA 3IKGA 3WKZA 4S3KA 2B5UB 1FKFA 2AOSA 4DIPA 4MNJA 1NH6A 1F8AB 2ESCA 4MNLA 4DRMA 1YW5A 4XAKA 2DSVA 2A3AA 4ODOA 5HKGA 4ODPA 3WL0A 2M08A 3EY6A 1FAPA 5HW7A 2MLYA 3RM4A 1JNDA 2LPVA 3KAHA 2ZQUA 4Z2IA 3B9AA 1GOIA 3WQVA 2F2DA 4JFLA 1J4HA 1ZBVA 4LAXA 3NRKA 2MNTA 3FY1A 2MLZA 1NMWA 4U86A 4DRJA 1UR9A 3W4RA 2DT3A 2XP9A 3KCEA 1NWSA 4P8XA 1FKGA 2ITKA 1X6NA 3WH0A 3ARZA 4L3NA 1QPLA 5J6EA 2N87A 4WIWA 1D7IA 1RD6A 3UI5A 2KE0A 3ODKA 5HTGA 4ODQA 1ZBKA 2UZ5A 2L2SA 1L1PA 2P4VA 5DIVA 4NZCA 1N1AA 3OA5A 1ITXA 1Y0OA 2G8ZA 3O5FA 4KQZA 1GPFA 2Y78A 3ARPA 5B8IC 2DT0A 3WQWA 4BF8A 4G50A 4N19A 1J4IA 2PI6A 3CHFA 3O5GA 1J4RA 3RM9A 4ZPVR 4WKHA 1OGGA 4HARA 2YBUA 1KFWA 1JNEA 1FKJA 3CZ8A 4HBOA 2RUCA 1BKFA 1EDQA 4IQ2A 1FJDA 4LAWA 3RGCA 3JXVA 5D75A 3KAGA 4ITZA 1GRJA 2A3BA 3GU0A 4O2TA 4DRQA 3KABA 1CTNA 1D7HA 4MTVA 4IT6A 5DITA 4FAPA 2OLHA 1FKBA 1A7XA 4MSPA 1W1YA 2XP8A 1WB0A 4DT4A 1FKHA 1NWTA 1VF8A 1B6CA 2JZVA 2DT1A 2KO7A 3UQBA 1LQ0A 1NWRA 4IQCA 4P8WA 3BMBA 3B7XA 2ZQSA 2FKEA 2PPPA 3ARRA 4DWSC 1KT1A 3LUOA 3KADA 4GIVA 2O92A 1HKMA 2XP7A 1E6PA 2DG4A 1LL4A 2PBCA 3ALGA 1HXVA 2PPNA 2RUDA 3KACA 1JNTA 1W1TA 3I6CA 1EIBA 4DRHA 2OFNA 3ARUA 3G6LA 4MAVA 4TW8A 5I98A 1X6LA 1JNSA 4DRKA 3KAFA 1ROTA 1H0IA
chains in the Genus database with same CATH topology
3WD0A 1OWQA 3AS0A 4DZ3A 3CH9A 4C02B 4R5EA 3O5RA 5JH8A 1SYTA 4TYOA 2DG9A 2RSEA 1D7JA 2IUZA 1ZU8A 3QOKA 3WD3A 1W9UA 4U84A 1HKIA 1ZBCA 2LKNA 1NSGA 2WLZA 4QT3A 3CGMA 3ARYA 2DT2A 2DSZA 4Z2KA 1J6YA 1FFRA 1O6IA 5GQBA 1FKDA 4MGVA 4DWSA 1FKTA 4W5UA 3FXYA 5HW8A 3AS2A 3UI6A 3IHZA 4JFMA 1YATA 3MDYB 3CHCA 3PA7A 5GPGA 2ZR6A 1QZ2A 4U85A 5DF0A 4W9OA 1XRVA 4W9QA 3JYJA 1H0GA 1LL6A 4JFKA 2WK2A 3UI4A 3O5IA 2DSUA 5HUAA 2AWGA 5HWBA 3O5MA 3UQAA 2KI3A 4QZVB 1F40A 1HJWA 1E6RA 3CGNA 4NNRA 2KFWA 3O5LA 2LJ4A 4P8UA 4DRIA 4TW7A 1HKKA 1W1VA 3UF8A 4ODNA 4LGXA 3ARVA 2A3EA 2ZQVA 1R9HA 4Q22A 4FN2A 4JYSA 1IX5A 1P5QA 3CHEA 2ZR5A 4LAYA 2MLXA 2RURA 3B9EA 4Q7NA 2RUQA 1BL4A 2F21A 3IKDA 4ODLA 1HJVA 3B9DA 4G2PA 1Q6HA 3WD2A 1Q1CA 2VCDA 3ARSA 4NSBA 3AROA 3IK8A 4Z2LA 1D2KA 1FFQA 2K8IA 2FDMA 2WM0A 1HKJA 1C9HA 4TW6A 4ODRA 3RM8A 4HBEA 2O9OA 4ML4A 3O5EA 4ZPTR 2KGJA 2PV2A 3AQUA 4IT4A 3ARWA 1K9TA 1NMVA 3ALFA 3FAPA 2DG3A 4DWSB 1ZK6A 1OGBA 3OOBA 4ZPWR 2ZQTA 4URIA 3VAWA 5DO2A 4DRNA 1GUVA 4WJXA 1SR0A 2M2AA 4WK9A 1FKRA 3NI6A 3GPKA 4DZ2A 5HWCA 3O5DA 4DH0A 2PV1A 2XP5A 4Z2JA 3PR9A 3TDBA 5BXJA 2DPEA 3WL1A 2PV3A 3NTPA 4S3JA 3H9RB 3ARTA 3O5KA 1W26A 3BXWA 3PRDA 1WNOA 4TNSA 2RQSA 4JFIA 1FKIA 3JYMA 1W9VA 1TFVA 1FD9A 4J4OA 4P8VA 4L72B 3WIJA 4LAVA 5GPRA 3RFWA 4ODKA 4R0XA 2FAPA 3G6MA 3TCZA 1E6NA 4WKAA 2XP3A 3AS1A 3KAIA 2MF9A 5HT1A 4DWSD 1FKLA 3PRBA 3WD1A 4J4NA 4MNKA 1LG2A 1T11A 5DIUA 4WKFA 3RMEA 1EYMA 1Q6IA 1LG1A 2DSWA 4DROA 4MPKA 1W1PA 1D6OA 1PBKA 4MNMA 1ZBWA 2A3CA 4KR0B 1EHNA 3ARQA 2PPOA 2MPHA 3O5PA 4W9PA 5DEZA 1EQ3A 4PTMA 2IF4A 4Z2GA 4IPXA 1LL7A 1E9LA 3O5JA 1Q6UA 1TCOC 2KR7A 3AS3A 2XPBA 5HBFA 2B31A 1KT0A 2Q5AA 2XPAA 2YBTA 1XHGA 2VN1A 1LJYA 2M1IA 4ODMA 1ROUA 1NWUA 1W9PA 4TX0A 4Z2HA 3O5QA 3O5OA 3ARXA 2G41A 1E6ZA 1M5YA 1PINA 3B8SA 1E15A 3CHDA 2XP4A 2XP6A 1ZL1A 1U79A 2WLYA 4JFJA 2F4EA 1FKSA 1UR8A 2D9FA 2ZR4A 3KZ7A 1HJXA 4ZS6A 5HW6A 3TC5A 4AY1A 4QT2A 1QPFA 3PRAA 4GGQA 1ZCNA 4QIBA 3WD4A 1ZB5A 1JVWA 4DRPA 3UQIA 1FKKA 2QF8A 1WAWA 2LGOA 3IKGA 3WKZA 4S3KA 1FKFA 2AOSA 4DIPA 4MNJA 1NH6A 1F8AB 2ESCA 4MNLA 4DRMA 1YW5A 4XAKA 2DSVA 2A3AA 4ODOA 5HKGA 4ODPA 3WL0A 2M08A 3EY6A 1FAPA 5HW7A 2MLYA 3RM4A 1JNDA 2LPVA 3KAHA 2ZQUA 4Z2IA 3B9AA 1GOIA 3WQVA 2F2DA 4JFLA 1J4HA 1ZBVA 4LAXA 3NRKA 2MNTA 3FY1A 2MLZA 1NMWA 4U86A 4DRJA 1UR9A 3W4RA 2DT3A 2XP9A 3KCEA 1NWSA 4P8XA 1FKGA 2ITKA 1X6NA 3WH0A 3ARZA 4L3NA 1QPLA 5J6EA 2N87A 4WIWA 1D7IA 1RD6A 3UI5A 2KE0A 3ODKA 5HTGA 4ODQA 1ZBKA 2UZ5A 2L2SA 1L1PA 5DIVA 4NZCA 1N1AA 3OA5A 1ITXA 1Y0OA 2G8ZA 3O5FA 4KQZA 1GPFA 2Y78A 3ARPA 5B8IC 2DT0A 3WQWA 4BF8A 4G50A 4N19A 1J4IA 2PI6A 3CHFA 3O5GA 1J4RA 3RM9A 4ZPVR 4WKHA 1OGGA 4HARA 2YBUA 1KFWA 1JNEA 1FKJA 3CZ8A 4HBOA 2RUCA 1BKFA 1EDQA 4IQ2A 1FJDA 4LAWA 3RGCA 3JXVA 5D75A 3KAGA 4ITZA 2A3BA 4O2TA 4DRQA 3KABA 1CTNA 1D7HA 4MTVA 4IT6A 5DITA 4FAPA 2OLHA 1FKBA 1A7XA 4MSPA 1W1YA 2XP8A 1WB0A 4DT4A 1FKHA 1NWTA 1VF8A 1B6CA 2JZVA 2DT1A 2KO7A 3UQBA 1LQ0A 1NWRA 4IQCA 4P8WA 3B7XA 2ZQSA 2FKEA 2PPPA 3ARRA 4DWSC 1KT1A 3LUOA 3KADA 4GIVA 2O92A 1HKMA 2XP7A 1E6PA 2DG4A 1LL4A 2PBCA 3ALGA 1HXVA 2PPNA 2RUDA 3KACA 1JNTA 1W1TA 3I6CA 1EIBA 4DRHA 2OFNA 3ARUA 3G6LA 4MAVA 4TW8A 5I98A 1X6LA 1JNSA 4DRKA 3KAFA 1ROTA 1H0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DZ3 A;  1C9H A;  5DIV A;  4TW6 A;  1N1A A;  4ODR A;  4C02 B;  3O5R A;  2VN1 A;  2M1I A;  4ODM A;  1ROU A;  1Y0O A;  3O5F A;  4TX0 A;  3O5Q A;  4TYO A;  3O5O A;  2DG9 A;  3O5E A;  2RSE A;  1D7J A;  2Y78 A;  2KGJ A;  2PV2 A;  5B8I C;  1NMV A;  4BF8 A;  4U84 A;  4G50 A;  1M5Y A;  3FAP A;  2DG3 A;  4N19 A;  2LKN A;  1PIN A;  1NSG A;  4QT3 A;  3CGM A;  1J4I A;  1ZK6 A;  3O5G A;  3OOB A;  2XP4 A;  2XP6 A;  2L2S A;  1U79 A;  1J4R A;  2ZQT A;  3VAW A;  4JFJ A;  2F4E A;  4DRN A;  1FKS A;  1J6Y A;  2D9F A;  2M2A A;  2ZR4 A;  3KZ7 A;  1FKJ A;  1FKR A;  1FKD A;  2RUC A;  4MGV A;  3TC5 A;  1BKF A;  5HW6 A;  4IQ2 A;  1FJD A;  4QT2 A;  3NI6 A;  3GPK A;  4DZ2 A;  1QPF A;  1FKT A;  3O5D A;  4LAW A;  3RGC A;  4DH0 A;  3JXV A;  2PV1 A;  4GGQ A;  2XP5 A;  5D75 A;  3KAG A;  4ITZ A;  3TDB A;  5BXJ A;  1ZCN A;  4QIB A;  5HW8 A;  3UI6 A;  2PV3 A;  3NTP A;  3IHZ A;  3H9R B;  4O2T A;  4DRQ A;  3O5K A;  1JVW A;  3KAB A;  4JFM A;  4DRP A;  1YAT A;  1W26 A;  3UQI A;  3MDY B;  3PRD A;  1D7H A;  1FKK A;  3PA7 A;  5GPG A;  2LGO A;  2ZR6 A;  5DIT A;  4FAP A;  4TNS A;  2RQS A;  3IKG A;  4JFI A;  1FKI A;  1QZ2 A;  3JYM A;  4U85 A;  4W9O A;  4W9Q A;  1FKB A;  3JYJ A;  4JFK A;  3UI4 A;  1A7X A;  1FKF A;  3O5I A;  5HWC A;  4DIP A;  4MSP A;  5HUA A;  2AWG A;  5HWB A;  3O5M A;  1FD9 A;  4J4O A;  3UQA A;  2XP8 A;  4LAV A;  2KI3 A;  1F8A B;  4DT4 A;  1FKH A;  3RFW A;  4DRM A;  1YW5 A;  4ODK A;  4R0X A;  2FAP A;  1F40 A;  4ODO A;  5HKG A;  3TCZ A;  4ODP A;  1B6C A;  3CGN A;  4NNR A;  2KFW A;  2M08 A;  3O5L A;  3EY6 A;  1FAP A;  2JZV A;  2LJ4 A;  2XP3 A;  5HW7 A;  2KO7 A;  4DRI A;  4TW7 A;  3KAI A;  2MLY A;  2MF9 A;  3UQB A;  5HT1 A;  2LPV A;  3UF8 A;  3KAH A;  2ZQU A;  1FKL A;  4IQC A;  4ODN A;  3B7X A;  2ZQS A;  2FKE A;  2PPP A;  2ZQV A;  1R9H A;  3PRB A;  2F2D A;  4J4N A;  1KT1 A;  3LUO A;  1T11 A;  4JFL A;  5DIU A;  3KAD A;  1J4H A;  4FN2 A;  4GIV A;  4JYS A;  1EYM A;  1Q6I A;  1P5Q A;  3NRK A;  4LAX A;  4DRO A;  2MNT A;  2XP7 A;  1D6O A;  2MLZ A;  1NMW A;  1PBK A;  2ZR5 A;  4LAY A;  4U86 A;  4DRJ A;  2MLX A;  2DG4 A;  2PBC A;  2XP9 A;  2RUR A;  2PPO A;  2MPH A;  2RUQ A;  3KCE A;  3O5P A;  4W9P A;  1HXV A;  1FKG A;  2PPN A;  1EQ3 A;  2ITK A;  2RUD A;  3KAC A;  1JNT A;  1BL4 A;  2F21 A;  3I6C A;  3WH0 A;  3IKD A;  4DRH A;  2IF4 A;  2OFN A;  4IPX A;  1QPL A;  4ODL A;  5J6E A;  3O5J A;  4G2P A;  1Q6H A;  1Q6U A;  1Q1C A;  1TCO C;  2N87 A;  2VCD A;  2KR7 A;  4TW8 A;  3IK8 A;  5I98 A;  2XPB A;  1D7I A;  3UI5 A;  1JNS A;  4DRK A;  2KE0 A;  2K8I A;  3KAF A;  3ODK A;  1KT0 A;  5HTG A;  2Q5A A;  4ODQ A;  2XPA A;  2UZ5 A;  1ROT A;  1L1P A; 
#chains in the Genus database with same CATH topology
 3WD0 A;  1OWQ A;  3AS0 A;  4DZ3 A;  3CH9 A;  4C02 B;  4R5E A;  3O5R A;  5JH8 A;  1SYT A;  4TYO A;  2DG9 A;  2RSE A;  1D7J A;  2IUZ A;  1ZU8 A;  3QOK A;  3WD3 A;  1W9U A;  4U84 A;  1HKI A;  1ZBC A;  2LKN A;  1NSG A;  2WLZ A;  4QT3 A;  3CGM A;  3ARY A;  2DT2 A;  2DSZ A;  4Z2K A;  1J6Y A;  2F23 A;  1FFR A;  1O6I A;  5GQB A;  1FKD A;  4MGV A;  4DWS A;  1FKT A;  4W5U A;  3FXY A;  5HW8 A;  3AS2 A;  3UI6 A;  3IHZ A;  4JFM A;  1YAT A;  3MDY B;  3CHC A;  3PA7 A;  5GPG A;  2ZR6 A;  1QZ2 A;  4U85 A;  5DF0 A;  4W9O A;  1XRV A;  4W9Q A;  3JYJ A;  1H0G A;  1LL6 A;  4JFK A;  2WK2 A;  3UI4 A;  3O5I A;  2DSU A;  5HUA A;  2AWG A;  5HWB A;  3O5M A;  3UQA A;  2KI3 A;  4QZV B;  1F40 A;  1HJW A;  1E6R A;  3CGN A;  4NNR A;  2KFW A;  2ETN A;  3O5L A;  2LJ4 A;  4P8U A;  4DRI A;  4TW7 A;  1HKK A;  1W1V A;  3UF8 A;  4ODN A;  4LGX A;  3ARV A;  2A3E A;  2ZQV A;  1R9H A;  4Q22 A;  4FN2 A;  4JYS A;  1IX5 A;  1P5Q A;  3CHE A;  2ZR5 A;  4LAY A;  2MLX A;  2RUR A;  3B9E A;  4Q7N A;  2RUQ A;  1BL4 A;  2F21 A;  3IKD A;  4ODL A;  1HJV A;  3B9D A;  4G2P A;  1Q6H A;  3WD2 A;  1Q1C A;  2VCD A;  3ARS A;  4NSB A;  3ARO A;  3IK8 A;  4Z2L A;  1D2K A;  1FFQ A;  2K8I A;  2PN0 A;  4UDM A;  2FDM A;  2WM0 A;  1HKJ A;  1C9H A;  4TW6 A;  4ODR A;  3RM8 A;  4HBE A;  2O9O A;  4ML4 A;  3O5E A;  4ZPT R;  2KGJ A;  1JCH B;  2PV2 A;  3AQU A;  4IT4 A;  3ARW A;  1K9T A;  1NMV A;  3ALF A;  2EUL A;  3FAP A;  2DG3 A;  4DWS B;  1ZK6 A;  1OGB A;  3OOB A;  4ZPW R;  2ZQT A;  4URI A;  3VAW A;  5DO2 A;  4DRN A;  1GUV A;  4WJX A;  1SR0 A;  2M2A A;  4WK9 A;  1FKR A;  3EIP A;  1E44 A;  3NI6 A;  3GPK A;  4DZ2 A;  5HWC A;  3O5D A;  4DH0 A;  2PV1 A;  2XP5 A;  4Z2J A;  3PR9 A;  3TDB A;  5BXJ A;  2DPE A;  3WL1 A;  2PV3 A;  3NTP A;  4S3J A;  3H9R B;  3ART A;  3O5K A;  1W26 A;  3BXW A;  3PRD A;  1WNO A;  4TNS A;  2RQS A;  4JFI A;  1FKI A;  3JYM A;  1W9V A;  1TFV A;  1FD9 A;  4J4O A;  4P8V A;  4L72 B;  3WIJ A;  4LAV A;  5GPR A;  3RFW A;  4ODK A;  4R0X A;  2FAP A;  3G6M A;  3TCZ A;  1E6N A;  4WKA A;  2XP3 A;  3AS1 A;  3KAI A;  2MF9 A;  5HT1 A;  4DWS D;  1FKL A;  3PRB A;  3WD1 A;  4J4N A;  4MNK A;  1LG2 A;  1T11 A;  5DIU A;  4WKF A;  3RME A;  1EYM A;  1Q6I A;  1LG1 A;  2DSW A;  4DRO A;  4MPK A;  1W1P A;  1D6O A;  1PBK A;  4MNM A;  1ZBW A;  2A3C A;  3GTY X;  1EHN A;  4KR0 B;  3ARQ A;  2PPO A;  2MPH A;  3O5P A;  4W9P A;  5DEZ A;  1EQ3 A;  4PTM A;  2IF4 A;  4Z2G A;  4IPX A;  1LL7 A;  1E9L A;  3O5J A;  1Q6U A;  1TCO C;  2KR7 A;  3AS3 A;  2XPB A;  5HBF A;  2B31 A;  1KT0 A;  2Q5A A;  2XPA A;  2YBT A;  1XHG A;  2VN1 A;  1LJY A;  2M1I A;  4ODM A;  1ROU A;  1NWU A;  1W9P A;  4TX0 A;  4Z2H A;  3O5Q A;  3O5O A;  3ARX A;  2G41 A;  1E6Z A;  1M5Y A;  1PIN A;  3B8S A;  1E15 A;  3CHD A;  2XP4 A;  2XP6 A;  1ZL1 A;  1U79 A;  2WLY A;  4JFJ A;  2F4E A;  1FKS A;  1UR8 A;  2D9F A;  2ZR4 A;  3KZ7 A;  1HJX A;  4ZS6 A;  5HW6 A;  3TC5 A;  4AY1 A;  4QT2 A;  1QPF A;  3PRA A;  4GGQ A;  1ZCN A;  4QIB A;  3WD4 A;  1ZB5 A;  1JVW A;  4DRP A;  3UQI A;  1FKK A;  2QF8 A;  1WAW A;  2LGO A;  3IKG A;  3WKZ A;  4S3K A;  2B5U B;  1FKF A;  2AOS A;  4DIP A;  4MNJ A;  1NH6 A;  1F8A B;  2ESC A;  4MNL A;  4DRM A;  1YW5 A;  4XAK A;  2DSV A;  2A3A A;  4ODO A;  5HKG A;  4ODP A;  3WL0 A;  2M08 A;  3EY6 A;  1FAP A;  5HW7 A;  2MLY A;  3RM4 A;  1JND A;  2LPV A;  3KAH A;  2ZQU A;  4Z2I A;  3B9A A;  1GOI A;  3WQV A;  2F2D A;  4JFL A;  1J4H A;  1ZBV A;  4LAX A;  3NRK A;  2MNT A;  3FY1 A;  2MLZ A;  1NMW A;  4U86 A;  4DRJ A;  1UR9 A;  3W4R A;  2DT3 A;  2XP9 A;  3KCE A;  1NWS A;  4P8X A;  1FKG A;  2ITK A;  1X6N A;  3WH0 A;  3ARZ A;  4L3N A;  1QPL A;  5J6E A;  2N87 A;  4WIW A;  1D7I A;  1RD6 A;  3UI5 A;  2KE0 A;  3ODK A;  5HTG A;  4ODQ A;  1ZBK A;  2UZ5 A;  2L2S A;  1L1P A;  2P4V A;  5DIV A;  4NZC A;  1N1A A;  3OA5 A;  1ITX A;  1Y0O A;  2G8Z A;  3O5F A;  4KQZ A;  1GPF A;  2Y78 A;  3ARP A;  5B8I C;  2DT0 A;  3WQW A;  4BF8 A;  4G50 A;  4N19 A;  1J4I A;  2PI6 A;  3CHF A;  3O5G A;  1J4R A;  3RM9 A;  4ZPV R;  4WKH A;  1OGG A;  4HAR A;  2YBU A;  1KFW A;  1JNE A;  1FKJ A;  3CZ8 A;  4HBO A;  2RUC A;  1BKF A;  1EDQ A;  4IQ2 A;  1FJD A;  4LAW A;  3RGC A;  3JXV A;  5D75 A;  3KAG A;  4ITZ A;  1GRJ A;  2A3B A;  3GU0 A;  4O2T A;  4DRQ A;  3KAB A;  1CTN A;  1D7H A;  4MTV A;  4IT6 A;  5DIT A;  4FAP A;  2OLH A;  1FKB A;  1A7X A;  4MSP A;  1W1Y A;  2XP8 A;  1WB0 A;  4DT4 A;  1FKH A;  1NWT A;  1VF8 A;  1B6C A;  2JZV A;  2DT1 A;  2KO7 A;  3UQB A;  1LQ0 A;  1NWR A;  4IQC A;  4P8W A;  3BMB A;  3B7X A;  2ZQS A;  2FKE A;  2PPP A;  3ARR A;  4DWS C;  1KT1 A;  3LUO A;  3KAD A;  4GIV A;  2O92 A;  1HKM A;  2XP7 A;  1E6P A;  2DG4 A;  1LL4 A;  2PBC A;  3ALG A;  1HXV A;  2PPN A;  2RUD A;  3KAC A;  1JNT A;  1W1T A;  3I6C A;  1EIB A;  4DRH A;  2OFN A;  3ARU A;  3G6L A;  4MAV A;  4TW8 A;  5I98 A;  1X6L A;  1JNS A;  4DRK A;  3KAF A;  1ROT A;  1H0I A; 
#chains in the Genus database with same CATH homology
 3WD0 A;  1OWQ A;  3AS0 A;  4DZ3 A;  3CH9 A;  4C02 B;  4R5E A;  3O5R A;  5JH8 A;  1SYT A;  4TYO A;  2DG9 A;  2RSE A;  1D7J A;  2IUZ A;  1ZU8 A;  3QOK A;  3WD3 A;  1W9U A;  4U84 A;  1HKI A;  1ZBC A;  2LKN A;  1NSG A;  2WLZ A;  4QT3 A;  3CGM A;  3ARY A;  2DT2 A;  2DSZ A;  4Z2K A;  1J6Y A;  1FFR A;  1O6I A;  5GQB A;  1FKD A;  4MGV A;  4DWS A;  1FKT A;  4W5U A;  3FXY A;  5HW8 A;  3AS2 A;  3UI6 A;  3IHZ A;  4JFM A;  1YAT A;  3MDY B;  3CHC A;  3PA7 A;  5GPG A;  2ZR6 A;  1QZ2 A;  4U85 A;  5DF0 A;  4W9O A;  1XRV A;  4W9Q A;  3JYJ A;  1H0G A;  1LL6 A;  4JFK A;  2WK2 A;  3UI4 A;  3O5I A;  2DSU A;  5HUA A;  2AWG A;  5HWB A;  3O5M A;  3UQA A;  2KI3 A;  4QZV B;  1F40 A;  1HJW A;  1E6R A;  3CGN A;  4NNR A;  2KFW A;  3O5L A;  2LJ4 A;  4P8U A;  4DRI A;  4TW7 A;  1HKK A;  1W1V A;  3UF8 A;  4ODN A;  4LGX A;  3ARV A;  2A3E A;  2ZQV A;  1R9H A;  4Q22 A;  4FN2 A;  4JYS A;  1IX5 A;  1P5Q A;  3CHE A;  2ZR5 A;  4LAY A;  2MLX A;  2RUR A;  3B9E A;  4Q7N A;  2RUQ A;  1BL4 A;  2F21 A;  3IKD A;  4ODL A;  1HJV A;  3B9D A;  4G2P A;  1Q6H A;  3WD2 A;  1Q1C A;  2VCD A;  3ARS A;  4NSB A;  3ARO A;  3IK8 A;  4Z2L A;  1D2K A;  1FFQ A;  2K8I A;  2FDM A;  2WM0 A;  1HKJ A;  1C9H A;  4TW6 A;  4ODR A;  3RM8 A;  4HBE A;  2O9O A;  4ML4 A;  3O5E A;  4ZPT R;  2KGJ A;  2PV2 A;  3AQU A;  4IT4 A;  3ARW A;  1K9T A;  1NMV A;  3ALF A;  3FAP A;  2DG3 A;  4DWS B;  1ZK6 A;  1OGB A;  3OOB A;  4ZPW R;  2ZQT A;  4URI A;  3VAW A;  5DO2 A;  4DRN A;  1GUV A;  4WJX A;  1SR0 A;  2M2A A;  4WK9 A;  1FKR A;  3NI6 A;  3GPK A;  4DZ2 A;  5HWC A;  3O5D A;  4DH0 A;  2PV1 A;  2XP5 A;  4Z2J A;  3PR9 A;  3TDB A;  5BXJ A;  2DPE A;  3WL1 A;  2PV3 A;  3NTP A;  4S3J A;  3H9R B;  3ART A;  3O5K A;  1W26 A;  3BXW A;  3PRD A;  1WNO A;  4TNS A;  2RQS A;  4JFI A;  1FKI A;  3JYM A;  1W9V A;  1TFV A;  1FD9 A;  4J4O A;  4P8V A;  4L72 B;  3WIJ A;  4LAV A;  5GPR A;  3RFW A;  4ODK A;  4R0X A;  2FAP A;  3G6M A;  3TCZ A;  1E6N A;  4WKA A;  2XP3 A;  3AS1 A;  3KAI A;  2MF9 A;  5HT1 A;  4DWS D;  1FKL A;  3PRB A;  3WD1 A;  4J4N A;  4MNK A;  1LG2 A;  1T11 A;  5DIU A;  4WKF A;  3RME A;  1EYM A;  1Q6I A;  1LG1 A;  2DSW A;  4DRO A;  4MPK A;  1W1P A;  1D6O A;  1PBK A;  4MNM A;  1ZBW A;  2A3C A;  4KR0 B;  1EHN A;  3ARQ A;  2PPO A;  2MPH A;  3O5P A;  4W9P A;  5DEZ A;  1EQ3 A;  4PTM A;  2IF4 A;  4Z2G A;  4IPX A;  1LL7 A;  1E9L A;  3O5J A;  1Q6U A;  1TCO C;  2KR7 A;  3AS3 A;  2XPB A;  5HBF A;  2B31 A;  1KT0 A;  2Q5A A;  2XPA A;  2YBT A;  1XHG A;  2VN1 A;  1LJY A;  2M1I A;  4ODM A;  1ROU A;  1NWU A;  1W9P A;  4TX0 A;  4Z2H A;  3O5Q A;  3O5O A;  3ARX A;  2G41 A;  1E6Z A;  1M5Y A;  1PIN A;  3B8S A;  1E15 A;  3CHD A;  2XP4 A;  2XP6 A;  1ZL1 A;  1U79 A;  2WLY A;  4JFJ A;  2F4E A;  1FKS A;  1UR8 A;  2D9F A;  2ZR4 A;  3KZ7 A;  1HJX A;  4ZS6 A;  5HW6 A;  3TC5 A;  4AY1 A;  4QT2 A;  1QPF A;  3PRA A;  4GGQ A;  1ZCN A;  4QIB A;  3WD4 A;  1ZB5 A;  1JVW A;  4DRP A;  3UQI A;  1FKK A;  2QF8 A;  1WAW A;  2LGO A;  3IKG A;  3WKZ A;  4S3K A;  1FKF A;  2AOS A;  4DIP A;  4MNJ A;  1NH6 A;  1F8A B;  2ESC A;  4MNL A;  4DRM A;  1YW5 A;  4XAK A;  2DSV A;  2A3A A;  4ODO A;  5HKG A;  4ODP A;  3WL0 A;  2M08 A;  3EY6 A;  1FAP A;  5HW7 A;  2MLY A;  3RM4 A;  1JND A;  2LPV A;  3KAH A;  2ZQU A;  4Z2I A;  3B9A A;  1GOI A;  3WQV A;  2F2D A;  4JFL A;  1J4H A;  1ZBV A;  4LAX A;  3NRK A;  2MNT A;  3FY1 A;  2MLZ A;  1NMW A;  4U86 A;  4DRJ A;  1UR9 A;  3W4R A;  2DT3 A;  2XP9 A;  3KCE A;  1NWS A;  4P8X A;  1FKG A;  2ITK A;  1X6N A;  3WH0 A;  3ARZ A;  4L3N A;  1QPL A;  5J6E A;  2N87 A;  4WIW A;  1D7I A;  1RD6 A;  3UI5 A;  2KE0 A;  3ODK A;  5HTG A;  4ODQ A;  1ZBK A;  2UZ5 A;  2L2S A;  1L1P A;  5DIV A;  4NZC A;  1N1A A;  3OA5 A;  1ITX A;  1Y0O A;  2G8Z A;  3O5F A;  4KQZ A;  1GPF A;  2Y78 A;  3ARP A;  5B8I C;  2DT0 A;  3WQW A;  4BF8 A;  4G50 A;  4N19 A;  1J4I A;  2PI6 A;  3CHF A;  3O5G A;  1J4R A;  3RM9 A;  4ZPV R;  4WKH A;  1OGG A;  4HAR A;  2YBU A;  1KFW A;  1JNE A;  1FKJ A;  3CZ8 A;  4HBO A;  2RUC A;  1BKF A;  1EDQ A;  4IQ2 A;  1FJD A;  4LAW A;  3RGC A;  3JXV A;  5D75 A;  3KAG A;  4ITZ A;  2A3B A;  4O2T A;  4DRQ A;  3KAB A;  1CTN A;  1D7H A;  4MTV A;  4IT6 A;  5DIT A;  4FAP A;  2OLH A;  1FKB A;  1A7X A;  4MSP A;  1W1Y A;  2XP8 A;  1WB0 A;  4DT4 A;  1FKH A;  1NWT A;  1VF8 A;  1B6C A;  2JZV A;  2DT1 A;  2KO7 A;  3UQB A;  1LQ0 A;  1NWR A;  4IQC A;  4P8W A;  3B7X A;  2ZQS A;  2FKE A;  2PPP A;  3ARR A;  4DWS C;  1KT1 A;  3LUO A;  3KAD A;  4GIV A;  2O92 A;  1HKM A;  2XP7 A;  1E6P A;  2DG4 A;  1LL4 A;  2PBC A;  3ALG A;  1HXV A;  2PPN A;  2RUD A;  3KAC A;  1JNT A;  1W1T A;  3I6C A;  1EIB A;  4DRH A;  2OFN A;  3ARU A;  3G6L A;  4MAV A;  4TW8 A;  5I98 A;  1X6L A;  1JNS A;  4DRK A;  3KAF A;  1ROT A;  1H0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...