5HWCA

Aspergillus fumigatus fkbp12 p90g protein bound with fk506 in p212121 space group
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
HMGVTKELKSPGNGVDFPKKGDFVTIHYTGRLTDGSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPGVIPGNSTLIFEVELLGINNKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
total genus 30
structure length 113
sequence length 113
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hwcA00
2DG4A 1BL4A 2LKNA 1F40A 3MDYB 5HUAA 5HW6A 2OFNA 2RQSA 1FKFA 2ZQTA 4DT4A 1Q1CA 1JVWA 1NSGA 1U79A 4QIBA 1FKLA 2IF4A 3UI6A 3TDBA 3O5DA 5HWBA 1ROUA 3PRDA 4ODLA 3IKGA 3O5IA 3O5JA 3NTPA 4TNSA 1NMVA 2F2DA 4DIPA 4TX0A 2ITKA 1P5QA 2XP3A 4FAPA 2XP7A 5I98A 1T11A 1Q6UA 1QZ2A 1YATA 1QPLA 2FAPA 1YW5A 1FKIA 2M1IA 3EY6A 5HW7A 5DIVA 1J4HA 2F4EA 2KFWA 2RSEA 2XP4A 4U86A 1FKTA 4DRPA 5HWCA 4U85A 4DRJA 1HXVA 3NI6A 3NRKA 4MSPA 1Y0OA 4JFLA 1C9HA 2XPBA 4DRQA 1PBKA 4JFKA 4DH0A 4DRKA 3I6CA 4NNRA 1FJDA 1D7IA 4GGQA 4IPXA 3JYJA 3KZ7A 5DITA 4DRMA 5BXJA 2MNTA 1J4RA 2VN1A 3B7XA 2KO7A 4ITZA 1KT1A 4DROA 3O5PA 2XPAA 2Y78A 5J6EA 3KABA 4GIVA 1L1PA 1PINA 2N87A 3O5GA 2XP6A 1EYMA 3PA7A 4DRNA 4LAXA 2LGOA 4G50A 3IHZA 4ODMA 1ZCNA 3UI5A 4DZ2A 4JYSA 2XP5A 5HW8A 3ODKA 4LAYA 1JNTA 2DG3A 3VAWA 4C02B 2KE0A 2KGJA 4W9QA 1ROTA 2MLXA 4ODQA 3O5EA 3OOBA 5D75A 2D9FA 1D7JA 2MF9A 1FKGA 4TW7A 1FKJA 2AWGA 2PBCA 3TCZA 2ZR6A 2ZR5A 2PV2A 4W9PA 4TW6A 2KR7A 2MLYA 4JFIA 2ZR4A 3CGMA 2UZ5A 3KAIA 4ODNA 4LAVA 2KI3A 3KAGA 4JFJA 2LPVA 2Q5AA 1J6YA 3O5FA 4J4OA 3FAPA 5GPGA 2VCDA 4O2TA 1B6CA 3LUOA 3UI4A 1BKFA 3KADA 2XP9A 2ZQVA 3RFWA 2LJ4A 1FKRA 3CGNA 1F8AB 1A7XA 3KAFA 5HKGA 2FKEA 4TYOA 3O5KA 1W26A 2F21A 3IKDA 2K8IA 2PV1A 4TW8A 2ZQUA 4BF8A 1FD9A 2RUQA 2RURA 4DRIA 4LAWA 4FN2A 3UQIA 3UQAA 3TC5A 2ZQSA 2PPPA 5HTGA 5B8IC 2PV3A 3O5LA 1NMWA 1D7HA 2PPOA 3KACA 4W9OA 4U84A 1FKDA 1FKSA 1M5YA 1R9HA 3H9RB 3O5QA 3UF8A 3O5MA 4QT2A 5HT1A 3GPKA 5DIUA 3O5OA 1FKHA 1EQ3A 1N1AA 1JNSA 3O5RA 2MLZA 2M2AA 4ODOA 2MPHA 4ODPA 1FKKA 3UQBA 4IQCA 1TCOC 3JXVA 2PPNA 4MGVA 2DG9A 3RGCA 4ODRA 3WH0A 1FAPA 4DRHA 1KT0A 1Q6IA 4JFMA 3JYMA 2JZVA 1D6OA 2RUCA 1Q6HA 2L2SA 2M08A 2RUDA 3IK8A 3KCEA 1J4IA 4G2PA 4J4NA 4N19A 1ZK6A 4QT3A 4DZ3A 4R0XA 1QPFA 1FKBA 2XP8A 3PRBA 4IQ2A 4ODKA 3KAHA
chains in the Genus database with same CATH superfamily
4WKAA 2DT1A 2ZQTA 1FKLA 2IF4A 3TDBA 4DWSA 3ALFA 4Q7NA 1HJXA 4TNSA 2DT2A 1E44A 2P4VA 2AOSA 3RM9A 2WLYA 5I98A 2WLZA 1HKIA 4MTVA 2FAPA 1LL4A 1YW5A 1J4HA 1WNOA 2KFWA 4U86A 4DRPA 1HKKA 1W9VA 3BMBA 1Y0OA 2XPBA 4Z2GA 4JFKA 4IPXA 1E6PA 2MNTA 2KO7A 2IUZA 5J6EA 2DSUA 3KABA 1D2KA 1PINA 1LG2A 4DRNA 3PA7A 2LGOA 4G50A 4KR0B 1ZCNA 3WQWA 3GTYX 2XP5A 1X6NA 3WQVA 4LAYA 1JNTA 3ARWA 3WD0A 5DO2A 5D75A 2D9FA 1JCHB 3CZ8A 2WK2A 4JFIA 2ZR4A 2F23A 4LAVA 4JFJA 2LPVA 3AROA 3FAPA 2VCDA 4DWSD 4Z2IA 3UI4A 1BKFA 4DWSB 1FFQA 1FKRA 1A7XA 3ARSA 4ML4A 4TYOA 1HJWA 1W26A 2F21A 2K8IA 1HKMA 2ZQUA 1FD9A 1LG1A 1ZBWA 4W5UA 3ARZA 1NWUA 5B8IC 3OA5A 2PV3A 3WD3A 1NMWA 1D7HA 2PPOA 4WKFA 2DT3A 4MPKA 2PI6A 3B8SA 2A3EA 2MLZA 4L3NA 1FKKA 1OWQA 1GUVA 2PPNA 2A3BA 2DG9A 1H0GA 1Q6IA 4HBOA 4JFMA 2RUCA 1D6OA 1O6IA 3WD1A 3UQBA 4J4NA 1ZK6A 1FKBA 2XP8A 1W1TA 4ODKA 2DG4A 1E9LA 4S3JA 1JVWA 3O5DA 1ZL1A 1ROUA 3O5IA 3O5JA 3NTPA 1E6ZA 2F2DA 2DSWA 3FY1A 1GRJA 1P5QA 3ARUA 1T11A 4Q22A 1FKIA 2M1IA 3ALGA 1TFVA 3WL0A 2F4EA 1FKTA 4DRJA 1HXVA 3NI6A 4IT4A 4MSPA 3FXYA 3I6CA 3ARRA 4DRMA 2VN1A 3ARVA 1OGGA 3O5PA 1ZBKA 4GIVA 2N87A 4Z2HA 4ZPWR 3O5GA 2WM0A 4DZ2A 4JYSA 4WJXA 1LL7A 5HW8A 3ODKA 3RM4A 2DG3A 2KGJA 5GQBA 3O5EA 1ZBVA 1D7JA 1FKGA 2O92A 4W9PA 4P8XA 3CGMA 1RD6A 2UZ5A 4R5EA 4P8WA 3O5FA 4O2TA 4S3KA 2XP9A 3G6MA 1F8AB 2ESCA 1W1PA 4P8UA 2PN0A 4BF8A 2RURA 2PPPA 5JH8A 2O9OA 3O5LA 1ITXA 1CTNA 4MNKA 4ZPVR 1R9HA 1M5YA 1HJVA 3H9RB 3O5MA 2DPEA 5HT1A 5DIUA 1FKHA 1JNSA 1XRVA 4Z2LA 3WD2A 3CHEA 4IT6A 3JXVA 2DT0A 2G41A 3G6LA 4DRHA 3JYMA 2JZVA 1JNEA 3IK8A 2RUDA 3KCEA 3PRBA 4IQ2A 1F40A 3MDYB 5HUAA 2OFNA 3ARQA 1ZU8A 1U79A 4MNJA 1SYTA 3IKGA 3QOKA 3AS3A 2ITKA 2XP3A 1SR0A 1Q6UA 1QZ2A 1YATA 1QPLA 2B31A 3EY6A 4UDMA 4KQZA 5DIVA 3EIPA 2XP4A 4NZCA 4MNLA 4U85A 3NRKA 3ARTA 4DH0A 4DRKA 4NNRA 4GGQA 5DF0A 3JYJA 2OLHA 5BXJA 4XAKA 1NWSA 1J4RA 3B7XA 4ITZA 1KT1A 5GPRA 2XPAA 1LJYA 2YBTA 1L1PA 1OGBA 3CHFA 1EHNA 4LAXA 1UR9A 3IHZA 4ODMA 1H0IA 3UI5A 4C02B 4W9QA 1ROTA 4ODQA 3OOBA 1E15A 2MF9A 1FKJA 2PBCA 2ZR5A 4TW6A 4ZS6A 1J6YA 2KI3A 3KAGA 5GPGA 2G8ZA 3B9AA 3LUOA 3BXWA 2B5UB 3KADA 3RMEA 2ZQVA 3RFWA 2LJ4A 4NSBA 5HKGA 3ARXA 2FKEA 3PRAA 1WB0A 3O5KA 3IKDA 1W9UA 4DRIA 2ETNA 1VF8A 4LAWA 3TC5A 1FFRA 3KACA 1JNDA 1FKSA 2FDMA 3O5QA 4QT2A 1KFWA 3ARPA 3GPKA 1N1AA 3O5RA 2M2AA 1IX5A 1TCOC 3RGCA 2QF8A 4ODRA 1NH6A 3CHDA 2DSZA 4G2PA 4QT3A 1J4IA 1E6RA 2YBUA 4R0XA 4MNMA 3KAHA 5HW7A 1BL4A 2LKNA 5HW6A 2RQSA 1FKFA 2DSVA 5HBFA 4DT4A 4WKHA 1HKJA 1EIBA 1NWTA 1Q1CA 1NSGA 4Z2JA 3UI6A 5HWBA 3PRDA 1LQ0A 1W1YA 4ODLA 1ZB5A 1LL6A 1NMVA 3AS2A 3GU0A 4DIPA 4TX0A 4FAPA 2XP7A 5DEZA 2A3AA 4URIA 1ZBCA 4LGXA 2RSEA 2EULA 2A3CA 3ARYA 3WD4A 4P8VA 1W1VA 4DRQA 4JFLA 1C9HA 3W4RA 1PBKA 1GPFA 3AS1A 1FJDA 1D7IA 1XHGA 1K9TA 3KZ7A 5DITA 1WAWA 4DROA 4AY1A 2Y78A 4HARA 3WL1A 2XP6A 1EYMA 4HBEA 3AQUA 4WK9A 4Z2KA 1W9PA 3VAWA 2KE0A 2MLXA 3RM8A 4TW7A 3TCZA 2AWGA 2ZR6A 2PV2A 3B9DA 1E6NA 2KR7A 2MLYA 3CH9A 1NWRA 4ODNA 3KAIA 1UR8A 2Q5AA 4J4OA 1B6CA 4ZPTR 1GOIA 3CGNA 1X6LA 3KAFA 3WIJA 3PR9A 2PV1A 4TW8A 2RUQA 4L72B 1EQ3A 3UQIA 4FN2A 3UQAA 5HTGA 2ZQSA 3WKZA 4QZVB 4W9OA 4DWSC 3CHCA 4U84A 1FKDA 3UF8A 4MAVA 3O5OA 1EDQA 4ODOA 2MPHA 4ODPA 4PTMA 4IQCA 3B9EA 4MGVA 3WH0A 1FAPA 3AS0A 1KT0A 5HWCA 1Q6HA 2L2SA 2M08A 4WIWA 4DZ3A 4N19A 1QPFA 4QIBA
chains in the Genus database with same CATH topology
4WKAA 2DT1A 2ZQTA 1FKLA 2IF4A 3TDBA 4DWSA 3ALFA 4Q7NA 1HJXA 4TNSA 2DT2A 2AOSA 3RM9A 2WLYA 5I98A 2WLZA 1HKIA 4MTVA 2FAPA 1LL4A 1YW5A 1J4HA 1WNOA 2KFWA 4U86A 4DRPA 1HKKA 1W9VA 1Y0OA 2XPBA 4Z2GA 4JFKA 4IPXA 1E6PA 2MNTA 2KO7A 2IUZA 5J6EA 2DSUA 3KABA 1D2KA 1PINA 1LG2A 4DRNA 3PA7A 2LGOA 4G50A 4KR0B 1ZCNA 3WQWA 2XP5A 1X6NA 3WQVA 4LAYA 1JNTA 3ARWA 3WD0A 5DO2A 5D75A 2D9FA 3CZ8A 2WK2A 4JFIA 2ZR4A 4LAVA 4JFJA 2LPVA 3AROA 3FAPA 2VCDA 4DWSD 4Z2IA 3UI4A 1BKFA 4DWSB 1FFQA 1FKRA 1A7XA 3ARSA 4ML4A 4TYOA 1HJWA 1W26A 2F21A 2K8IA 1HKMA 2ZQUA 1FD9A 1LG1A 1ZBWA 4W5UA 3ARZA 1NWUA 5B8IC 3OA5A 2PV3A 3WD3A 1NMWA 1D7HA 2PPOA 4WKFA 2DT3A 4MPKA 2PI6A 3B8SA 2A3EA 2MLZA 4L3NA 1FKKA 1OWQA 1GUVA 2PPNA 2A3BA 2DG9A 1H0GA 1Q6IA 4HBOA 4JFMA 2RUCA 1D6OA 1O6IA 3WD1A 3UQBA 4J4NA 1ZK6A 1FKBA 2XP8A 1W1TA 4ODKA 2DG4A 1E9LA 4S3JA 1JVWA 3O5DA 1ZL1A 1ROUA 3O5IA 3O5JA 3NTPA 1E6ZA 2F2DA 2DSWA 3FY1A 1P5QA 3ARUA 1T11A 4Q22A 1FKIA 2M1IA 3ALGA 1TFVA 3WL0A 2F4EA 1FKTA 4DRJA 1HXVA 3NI6A 4IT4A 4MSPA 3FXYA 3I6CA 3ARRA 4DRMA 2VN1A 3ARVA 1OGGA 3O5PA 1ZBKA 4GIVA 2N87A 4Z2HA 4ZPWR 3O5GA 2WM0A 4DZ2A 4JYSA 4WJXA 1LL7A 5HW8A 3ODKA 3RM4A 2DG3A 2KGJA 5GQBA 3O5EA 1ZBVA 1D7JA 1FKGA 2O92A 4W9PA 4P8XA 3CGMA 1RD6A 2UZ5A 4R5EA 4P8WA 3O5FA 4O2TA 4S3KA 2XP9A 3G6MA 1F8AB 2ESCA 1W1PA 4P8UA 4BF8A 2RURA 2PPPA 5JH8A 2O9OA 3O5LA 1ITXA 1CTNA 4MNKA 4ZPVR 1R9HA 1M5YA 1HJVA 3H9RB 3O5MA 2DPEA 5HT1A 5DIUA 1FKHA 1JNSA 1XRVA 4Z2LA 3WD2A 3CHEA 4IT6A 3JXVA 2DT0A 2G41A 3G6LA 4DRHA 3JYMA 2JZVA 1JNEA 3IK8A 2RUDA 3KCEA 3PRBA 4IQ2A 1F40A 3MDYB 5HUAA 2OFNA 3ARQA 1ZU8A 1U79A 4MNJA 1SYTA 3IKGA 3QOKA 3AS3A 2ITKA 2XP3A 1SR0A 1Q6UA 1QZ2A 1YATA 1QPLA 2B31A 3EY6A 4KQZA 5DIVA 2XP4A 4NZCA 4MNLA 4U85A 3NRKA 3ARTA 4DH0A 4DRKA 4NNRA 4GGQA 5DF0A 3JYJA 2OLHA 5BXJA 4XAKA 1NWSA 1J4RA 3B7XA 4ITZA 1KT1A 5GPRA 2XPAA 1LJYA 2YBTA 1L1PA 1OGBA 3CHFA 1EHNA 4LAXA 1UR9A 3IHZA 4ODMA 1H0IA 3UI5A 4C02B 4W9QA 1ROTA 4ODQA 3OOBA 1E15A 2MF9A 1FKJA 2PBCA 2ZR5A 4TW6A 4ZS6A 1J6YA 2KI3A 3KAGA 5GPGA 2G8ZA 3B9AA 3LUOA 3BXWA 3KADA 3RMEA 2ZQVA 3RFWA 2LJ4A 4NSBA 5HKGA 3ARXA 2FKEA 3PRAA 1WB0A 3O5KA 3IKDA 1W9UA 4DRIA 4LAWA 1VF8A 3TC5A 1FFRA 3KACA 1JNDA 1FKSA 2FDMA 3O5QA 4QT2A 1KFWA 3ARPA 3GPKA 1N1AA 3O5RA 2M2AA 1IX5A 1TCOC 3RGCA 2QF8A 4ODRA 1NH6A 3CHDA 2DSZA 4G2PA 4QT3A 1J4IA 1E6RA 2YBUA 4R0XA 4MNMA 3KAHA 5HW7A 1BL4A 2LKNA 5HW6A 2RQSA 1FKFA 2DSVA 5HBFA 4DT4A 4WKHA 1HKJA 1EIBA 1NWTA 1Q1CA 1NSGA 4Z2JA 3UI6A 5HWBA 3PRDA 1LQ0A 1W1YA 4ODLA 1ZB5A 1LL6A 1NMVA 3AS2A 4DIPA 4TX0A 4FAPA 2XP7A 5DEZA 2A3AA 4URIA 1ZBCA 4LGXA 2RSEA 2A3CA 3ARYA 3WD4A 4P8VA 1W1VA 4DRQA 4JFLA 1C9HA 3W4RA 1PBKA 1GPFA 3AS1A 1FJDA 1D7IA 1XHGA 1K9TA 3KZ7A 5DITA 1WAWA 4DROA 4AY1A 2Y78A 4HARA 3WL1A 2XP6A 1EYMA 4HBEA 3AQUA 4WK9A 4Z2KA 1W9PA 3VAWA 2KE0A 2MLXA 3RM8A 4TW7A 3TCZA 2AWGA 2ZR6A 2PV2A 3B9DA 1E6NA 2KR7A 2MLYA 3CH9A 1NWRA 4ODNA 3KAIA 1UR8A 2Q5AA 4J4OA 1B6CA 4ZPTR 1GOIA 3CGNA 1X6LA 3KAFA 3WIJA 3PR9A 2PV1A 4TW8A 2RUQA 4L72B 1EQ3A 3UQIA 4FN2A 3UQAA 5HTGA 2ZQSA 3WKZA 4QZVB 4W9OA 4DWSC 3CHCA 4U84A 1FKDA 3UF8A 4MAVA 3O5OA 1EDQA 4ODOA 2MPHA 4ODPA 4PTMA 4IQCA 3B9EA 4MGVA 3WH0A 1FAPA 3AS0A 1KT0A 5HWCA 1Q6HA 2L2SA 2M08A 4WIWA 4DZ3A 4N19A 1QPFA 4QIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG4 A;  1BL4 A;  2LKN A;  1F40 A;  3MDY B;  5HUA A;  5HW6 A;  2OFN A;  2RQS A;  1FKF A;  2ZQT A;  4DT4 A;  1Q1C A;  1JVW A;  1NSG A;  1U79 A;  4QIB A;  1FKL A;  2IF4 A;  3UI6 A;  3TDB A;  3O5D A;  5HWB A;  1ROU A;  3PRD A;  4ODL A;  3IKG A;  3O5I A;  3O5J A;  3NTP A;  4TNS A;  1NMV A;  2F2D A;  4DIP A;  4TX0 A;  2ITK A;  1P5Q A;  2XP3 A;  4FAP A;  2XP7 A;  5I98 A;  1T11 A;  1Q6U A;  1QZ2 A;  1YAT A;  1QPL A;  2FAP A;  1YW5 A;  1FKI A;  2M1I A;  3EY6 A;  5HW7 A;  5DIV A;  1J4H A;  2F4E A;  2KFW A;  2RSE A;  2XP4 A;  4U86 A;  1FKT A;  4DRP A;  5HWC A;  4U85 A;  4DRJ A;  1HXV A;  3NI6 A;  3NRK A;  4MSP A;  1Y0O A;  4JFL A;  1C9H A;  2XPB A;  4DRQ A;  1PBK A;  4JFK A;  4DH0 A;  4DRK A;  3I6C A;  4NNR A;  1FJD A;  1D7I A;  4GGQ A;  4IPX A;  3JYJ A;  3KZ7 A;  5DIT A;  4DRM A;  5BXJ A;  2MNT A;  1J4R A;  2VN1 A;  3B7X A;  2KO7 A;  4ITZ A;  1KT1 A;  4DRO A;  3O5P A;  2XPA A;  2Y78 A;  5J6E A;  3KAB A;  4GIV A;  1L1P A;  1PIN A;  2N87 A;  3O5G A;  2XP6 A;  1EYM A;  3PA7 A;  4DRN A;  4LAX A;  2LGO A;  4G50 A;  3IHZ A;  4ODM A;  1ZCN A;  3UI5 A;  4DZ2 A;  4JYS A;  2XP5 A;  5HW8 A;  3ODK A;  4LAY A;  1JNT A;  2DG3 A;  3VAW A;  4C02 B;  2KE0 A;  2KGJ A;  4W9Q A;  1ROT A;  2MLX A;  4ODQ A;  3O5E A;  3OOB A;  5D75 A;  2D9F A;  1D7J A;  2MF9 A;  1FKG A;  4TW7 A;  1FKJ A;  2AWG A;  2PBC A;  3TCZ A;  2ZR6 A;  2ZR5 A;  2PV2 A;  4W9P A;  4TW6 A;  2KR7 A;  2MLY A;  4JFI A;  2ZR4 A;  3CGM A;  2UZ5 A;  3KAI A;  4ODN A;  4LAV A;  2KI3 A;  3KAG A;  4JFJ A;  2LPV A;  2Q5A A;  1J6Y A;  3O5F A;  4J4O A;  3FAP A;  5GPG A;  2VCD A;  4O2T A;  1B6C A;  3LUO A;  3UI4 A;  1BKF A;  3KAD A;  2XP9 A;  2ZQV A;  3RFW A;  2LJ4 A;  1FKR A;  3CGN A;  1F8A B;  1A7X A;  3KAF A;  5HKG A;  2FKE A;  4TYO A;  3O5K A;  1W26 A;  2F21 A;  3IKD A;  2K8I A;  2PV1 A;  4TW8 A;  2ZQU A;  4BF8 A;  1FD9 A;  2RUQ A;  2RUR A;  4DRI A;  4LAW A;  4FN2 A;  3UQI A;  3UQA A;  3TC5 A;  2ZQS A;  2PPP A;  5HTG A;  5B8I C;  2PV3 A;  3O5L A;  1NMW A;  1D7H A;  2PPO A;  3KAC A;  4W9O A;  4U84 A;  1FKD A;  1FKS A;  1M5Y A;  1R9H A;  3H9R B;  3O5Q A;  3UF8 A;  3O5M A;  4QT2 A;  5HT1 A;  3GPK A;  5DIU A;  3O5O A;  1FKH A;  1EQ3 A;  1N1A A;  1JNS A;  3O5R A;  2MLZ A;  2M2A A;  4ODO A;  2MPH A;  4ODP A;  1FKK A;  3UQB A;  4IQC A;  1TCO C;  3JXV A;  2PPN A;  4MGV A;  2DG9 A;  3RGC A;  4ODR A;  3WH0 A;  1FAP A;  4DRH A;  1KT0 A;  1Q6I A;  4JFM A;  3JYM A;  2JZV A;  1D6O A;  2RUC A;  1Q6H A;  2L2S A;  2M08 A;  2RUD A;  3IK8 A;  3KCE A;  1J4I A;  4G2P A;  4J4N A;  4N19 A;  1ZK6 A;  4QT3 A;  4DZ3 A;  4R0X A;  1QPF A;  1FKB A;  2XP8 A;  3PRB A;  4IQ2 A;  4ODK A;  3KAH A; 
#chains in the Genus database with same CATH topology
 4WKA A;  2DT1 A;  2ZQT A;  1FKL A;  2IF4 A;  3TDB A;  4DWS A;  3ALF A;  4Q7N A;  1HJX A;  4TNS A;  2DT2 A;  1E44 A;  2P4V A;  2AOS A;  3RM9 A;  2WLY A;  5I98 A;  2WLZ A;  1HKI A;  4MTV A;  2FAP A;  1LL4 A;  1YW5 A;  1J4H A;  1WNO A;  2KFW A;  4U86 A;  4DRP A;  1HKK A;  1W9V A;  3BMB A;  1Y0O A;  2XPB A;  4Z2G A;  4JFK A;  4IPX A;  1E6P A;  2MNT A;  2KO7 A;  2IUZ A;  5J6E A;  2DSU A;  3KAB A;  1D2K A;  1PIN A;  1LG2 A;  4DRN A;  3PA7 A;  2LGO A;  4G50 A;  4KR0 B;  1ZCN A;  3WQW A;  3GTY X;  2XP5 A;  1X6N A;  3WQV A;  4LAY A;  1JNT A;  3ARW A;  3WD0 A;  5DO2 A;  5D75 A;  2D9F A;  1JCH B;  3CZ8 A;  2WK2 A;  4JFI A;  2ZR4 A;  2F23 A;  4LAV A;  4JFJ A;  2LPV A;  3ARO A;  3FAP A;  2VCD A;  4DWS D;  4Z2I A;  3UI4 A;  1BKF A;  4DWS B;  1FFQ A;  1FKR A;  1A7X A;  3ARS A;  4ML4 A;  4TYO A;  1HJW A;  1W26 A;  2F21 A;  2K8I A;  1HKM A;  2ZQU A;  1FD9 A;  1LG1 A;  1ZBW A;  4W5U A;  3ARZ A;  1NWU A;  5B8I C;  3OA5 A;  2PV3 A;  3WD3 A;  1NMW A;  1D7H A;  2PPO A;  4WKF A;  2DT3 A;  4MPK A;  2PI6 A;  3B8S A;  2A3E A;  2MLZ A;  4L3N A;  1FKK A;  1OWQ A;  1GUV A;  2PPN A;  2A3B A;  2DG9 A;  1H0G A;  1Q6I A;  4HBO A;  4JFM A;  2RUC A;  1D6O A;  1O6I A;  3WD1 A;  3UQB A;  4J4N A;  1ZK6 A;  1FKB A;  2XP8 A;  1W1T A;  4ODK A;  2DG4 A;  1E9L A;  4S3J A;  1JVW A;  3O5D A;  1ZL1 A;  1ROU A;  3O5I A;  3O5J A;  3NTP A;  1E6Z A;  2F2D A;  2DSW A;  3FY1 A;  1GRJ A;  1P5Q A;  3ARU A;  1T11 A;  4Q22 A;  1FKI A;  2M1I A;  3ALG A;  1TFV A;  3WL0 A;  2F4E A;  1FKT A;  4DRJ A;  1HXV A;  3NI6 A;  4IT4 A;  4MSP A;  3FXY A;  3I6C A;  3ARR A;  4DRM A;  2VN1 A;  3ARV A;  1OGG A;  3O5P A;  1ZBK A;  4GIV A;  2N87 A;  4Z2H A;  4ZPW R;  3O5G A;  2WM0 A;  4DZ2 A;  4JYS A;  4WJX A;  1LL7 A;  5HW8 A;  3ODK A;  3RM4 A;  2DG3 A;  2KGJ A;  5GQB A;  3O5E A;  1ZBV A;  1D7J A;  1FKG A;  2O92 A;  4W9P A;  4P8X A;  3CGM A;  1RD6 A;  2UZ5 A;  4R5E A;  4P8W A;  3O5F A;  4O2T A;  4S3K A;  2XP9 A;  3G6M A;  1F8A B;  2ESC A;  1W1P A;  4P8U A;  2PN0 A;  4BF8 A;  2RUR A;  2PPP A;  5JH8 A;  2O9O A;  3O5L A;  1ITX A;  1CTN A;  4MNK A;  4ZPV R;  1R9H A;  1M5Y A;  1HJV A;  3H9R B;  3O5M A;  2DPE A;  5HT1 A;  5DIU A;  1FKH A;  1JNS A;  1XRV A;  4Z2L A;  3WD2 A;  3CHE A;  4IT6 A;  3JXV A;  2DT0 A;  2G41 A;  3G6L A;  4DRH A;  3JYM A;  2JZV A;  1JNE A;  3IK8 A;  2RUD A;  3KCE A;  3PRB A;  4IQ2 A;  1F40 A;  3MDY B;  5HUA A;  2OFN A;  3ARQ A;  1ZU8 A;  1U79 A;  4MNJ A;  1SYT A;  3IKG A;  3QOK A;  3AS3 A;  2ITK A;  2XP3 A;  1SR0 A;  1Q6U A;  1QZ2 A;  1YAT A;  1QPL A;  2B31 A;  3EY6 A;  4UDM A;  4KQZ A;  5DIV A;  3EIP A;  2XP4 A;  4NZC A;  4MNL A;  4U85 A;  3NRK A;  3ART A;  4DH0 A;  4DRK A;  4NNR A;  4GGQ A;  5DF0 A;  3JYJ A;  2OLH A;  5BXJ A;  4XAK A;  1NWS A;  1J4R A;  3B7X A;  4ITZ A;  1KT1 A;  5GPR A;  2XPA A;  1LJY A;  2YBT A;  1L1P A;  1OGB A;  3CHF A;  1EHN A;  4LAX A;  1UR9 A;  3IHZ A;  4ODM A;  1H0I A;  3UI5 A;  4C02 B;  4W9Q A;  1ROT A;  4ODQ A;  3OOB A;  1E15 A;  2MF9 A;  1FKJ A;  2PBC A;  2ZR5 A;  4TW6 A;  4ZS6 A;  1J6Y A;  2KI3 A;  3KAG A;  5GPG A;  2G8Z A;  3B9A A;  3LUO A;  3BXW A;  2B5U B;  3KAD A;  3RME A;  2ZQV A;  3RFW A;  2LJ4 A;  4NSB A;  5HKG A;  3ARX A;  2FKE A;  3PRA A;  1WB0 A;  3O5K A;  3IKD A;  1W9U A;  4DRI A;  2ETN A;  1VF8 A;  4LAW A;  3TC5 A;  1FFR A;  3KAC A;  1JND A;  1FKS A;  2FDM A;  3O5Q A;  4QT2 A;  1KFW A;  3ARP A;  3GPK A;  1N1A A;  3O5R A;  2M2A A;  1IX5 A;  1TCO C;  3RGC A;  2QF8 A;  4ODR A;  1NH6 A;  3CHD A;  2DSZ A;  4G2P A;  4QT3 A;  1J4I A;  1E6R A;  2YBU A;  4R0X A;  4MNM A;  3KAH A;  5HW7 A;  1BL4 A;  2LKN A;  5HW6 A;  2RQS A;  1FKF A;  2DSV A;  5HBF A;  4DT4 A;  4WKH A;  1HKJ A;  1EIB A;  1NWT A;  1Q1C A;  1NSG A;  4Z2J A;  3UI6 A;  5HWB A;  3PRD A;  1LQ0 A;  1W1Y A;  4ODL A;  1ZB5 A;  1LL6 A;  1NMV A;  3AS2 A;  3GU0 A;  4DIP A;  4TX0 A;  4FAP A;  2XP7 A;  5DEZ A;  2A3A A;  4URI A;  1ZBC A;  4LGX A;  2RSE A;  2EUL A;  2A3C A;  3ARY A;  3WD4 A;  4P8V A;  1W1V A;  4DRQ A;  4JFL A;  1C9H A;  3W4R A;  1PBK A;  1GPF A;  3AS1 A;  1FJD A;  1D7I A;  1XHG A;  1K9T A;  3KZ7 A;  5DIT A;  1WAW A;  4DRO A;  4AY1 A;  2Y78 A;  4HAR A;  3WL1 A;  2XP6 A;  1EYM A;  4HBE A;  3AQU A;  4WK9 A;  4Z2K A;  1W9P A;  3VAW A;  2KE0 A;  2MLX A;  3RM8 A;  4TW7 A;  3TCZ A;  2AWG A;  2ZR6 A;  2PV2 A;  3B9D A;  1E6N A;  2KR7 A;  2MLY A;  3CH9 A;  1NWR A;  4ODN A;  3KAI A;  1UR8 A;  2Q5A A;  4J4O A;  1B6C A;  4ZPT R;  1GOI A;  3CGN A;  1X6L A;  3KAF A;  3WIJ A;  3PR9 A;  2PV1 A;  4TW8 A;  2RUQ A;  4L72 B;  1EQ3 A;  3UQI A;  4FN2 A;  3UQA A;  5HTG A;  2ZQS A;  3WKZ A;  4QZV B;  4W9O A;  4DWS C;  3CHC A;  4U84 A;  1FKD A;  3UF8 A;  4MAV A;  3O5O A;  1EDQ A;  4ODO A;  2MPH A;  4ODP A;  4PTM A;  4IQC A;  3B9E A;  4MGV A;  3WH0 A;  1FAP A;  3AS0 A;  1KT0 A;  5HWC A;  1Q6H A;  2L2S A;  2M08 A;  4WIW A;  4DZ3 A;  4N19 A;  1QPF A;  4QIB A; 
#chains in the Genus database with same CATH homology
 4WKA A;  2DT1 A;  2ZQT A;  1FKL A;  2IF4 A;  3TDB A;  4DWS A;  3ALF A;  4Q7N A;  1HJX A;  4TNS A;  2DT2 A;  2AOS A;  3RM9 A;  2WLY A;  5I98 A;  2WLZ A;  1HKI A;  4MTV A;  2FAP A;  1LL4 A;  1YW5 A;  1J4H A;  1WNO A;  2KFW A;  4U86 A;  4DRP A;  1HKK A;  1W9V A;  1Y0O A;  2XPB A;  4Z2G A;  4JFK A;  4IPX A;  1E6P A;  2MNT A;  2KO7 A;  2IUZ A;  5J6E A;  2DSU A;  3KAB A;  1D2K A;  1PIN A;  1LG2 A;  4DRN A;  3PA7 A;  2LGO A;  4G50 A;  4KR0 B;  1ZCN A;  3WQW A;  2XP5 A;  1X6N A;  3WQV A;  4LAY A;  1JNT A;  3ARW A;  3WD0 A;  5DO2 A;  5D75 A;  2D9F A;  3CZ8 A;  2WK2 A;  4JFI A;  2ZR4 A;  4LAV A;  4JFJ A;  2LPV A;  3ARO A;  3FAP A;  2VCD A;  4DWS D;  4Z2I A;  3UI4 A;  1BKF A;  4DWS B;  1FFQ A;  1FKR A;  1A7X A;  3ARS A;  4ML4 A;  4TYO A;  1HJW A;  1W26 A;  2F21 A;  2K8I A;  1HKM A;  2ZQU A;  1FD9 A;  1LG1 A;  1ZBW A;  4W5U A;  3ARZ A;  1NWU A;  5B8I C;  3OA5 A;  2PV3 A;  3WD3 A;  1NMW A;  1D7H A;  2PPO A;  4WKF A;  2DT3 A;  4MPK A;  2PI6 A;  3B8S A;  2A3E A;  2MLZ A;  4L3N A;  1FKK A;  1OWQ A;  1GUV A;  2PPN A;  2A3B A;  2DG9 A;  1H0G A;  1Q6I A;  4HBO A;  4JFM A;  2RUC A;  1D6O A;  1O6I A;  3WD1 A;  3UQB A;  4J4N A;  1ZK6 A;  1FKB A;  2XP8 A;  1W1T A;  4ODK A;  2DG4 A;  1E9L A;  4S3J A;  1JVW A;  3O5D A;  1ZL1 A;  1ROU A;  3O5I A;  3O5J A;  3NTP A;  1E6Z A;  2F2D A;  2DSW A;  3FY1 A;  1P5Q A;  3ARU A;  1T11 A;  4Q22 A;  1FKI A;  2M1I A;  3ALG A;  1TFV A;  3WL0 A;  2F4E A;  1FKT A;  4DRJ A;  1HXV A;  3NI6 A;  4IT4 A;  4MSP A;  3FXY A;  3I6C A;  3ARR A;  4DRM A;  2VN1 A;  3ARV A;  1OGG A;  3O5P A;  1ZBK A;  4GIV A;  2N87 A;  4Z2H A;  4ZPW R;  3O5G A;  2WM0 A;  4DZ2 A;  4JYS A;  4WJX A;  1LL7 A;  5HW8 A;  3ODK A;  3RM4 A;  2DG3 A;  2KGJ A;  5GQB A;  3O5E A;  1ZBV A;  1D7J A;  1FKG A;  2O92 A;  4W9P A;  4P8X A;  3CGM A;  1RD6 A;  2UZ5 A;  4R5E A;  4P8W A;  3O5F A;  4O2T A;  4S3K A;  2XP9 A;  3G6M A;  1F8A B;  2ESC A;  1W1P A;  4P8U A;  4BF8 A;  2RUR A;  2PPP A;  5JH8 A;  2O9O A;  3O5L A;  1ITX A;  1CTN A;  4MNK A;  4ZPV R;  1R9H A;  1M5Y A;  1HJV A;  3H9R B;  3O5M A;  2DPE A;  5HT1 A;  5DIU A;  1FKH A;  1JNS A;  1XRV A;  4Z2L A;  3WD2 A;  3CHE A;  4IT6 A;  3JXV A;  2DT0 A;  2G41 A;  3G6L A;  4DRH A;  3JYM A;  2JZV A;  1JNE A;  3IK8 A;  2RUD A;  3KCE A;  3PRB A;  4IQ2 A;  1F40 A;  3MDY B;  5HUA A;  2OFN A;  3ARQ A;  1ZU8 A;  1U79 A;  4MNJ A;  1SYT A;  3IKG A;  3QOK A;  3AS3 A;  2ITK A;  2XP3 A;  1SR0 A;  1Q6U A;  1QZ2 A;  1YAT A;  1QPL A;  2B31 A;  3EY6 A;  4KQZ A;  5DIV A;  2XP4 A;  4NZC A;  4MNL A;  4U85 A;  3NRK A;  3ART A;  4DH0 A;  4DRK A;  4NNR A;  4GGQ A;  5DF0 A;  3JYJ A;  2OLH A;  5BXJ A;  4XAK A;  1NWS A;  1J4R A;  3B7X A;  4ITZ A;  1KT1 A;  5GPR A;  2XPA A;  1LJY A;  2YBT A;  1L1P A;  1OGB A;  3CHF A;  1EHN A;  4LAX A;  1UR9 A;  3IHZ A;  4ODM A;  1H0I A;  3UI5 A;  4C02 B;  4W9Q A;  1ROT A;  4ODQ A;  3OOB A;  1E15 A;  2MF9 A;  1FKJ A;  2PBC A;  2ZR5 A;  4TW6 A;  4ZS6 A;  1J6Y A;  2KI3 A;  3KAG A;  5GPG A;  2G8Z A;  3B9A A;  3LUO A;  3BXW A;  3KAD A;  3RME A;  2ZQV A;  3RFW A;  2LJ4 A;  4NSB A;  5HKG A;  3ARX A;  2FKE A;  3PRA A;  1WB0 A;  3O5K A;  3IKD A;  1W9U A;  4DRI A;  4LAW A;  1VF8 A;  3TC5 A;  1FFR A;  3KAC A;  1JND A;  1FKS A;  2FDM A;  3O5Q A;  4QT2 A;  1KFW A;  3ARP A;  3GPK A;  1N1A A;  3O5R A;  2M2A A;  1IX5 A;  1TCO C;  3RGC A;  2QF8 A;  4ODR A;  1NH6 A;  3CHD A;  2DSZ A;  4G2P A;  4QT3 A;  1J4I A;  1E6R A;  2YBU A;  4R0X A;  4MNM A;  3KAH A;  5HW7 A;  1BL4 A;  2LKN A;  5HW6 A;  2RQS A;  1FKF A;  2DSV A;  5HBF A;  4DT4 A;  4WKH A;  1HKJ A;  1EIB A;  1NWT A;  1Q1C A;  1NSG A;  4Z2J A;  3UI6 A;  5HWB A;  3PRD A;  1LQ0 A;  1W1Y A;  4ODL A;  1ZB5 A;  1LL6 A;  1NMV A;  3AS2 A;  4DIP A;  4TX0 A;  4FAP A;  2XP7 A;  5DEZ A;  2A3A A;  4URI A;  1ZBC A;  4LGX A;  2RSE A;  2A3C A;  3ARY A;  3WD4 A;  4P8V A;  1W1V A;  4DRQ A;  4JFL A;  1C9H A;  3W4R A;  1PBK A;  1GPF A;  3AS1 A;  1FJD A;  1D7I A;  1XHG A;  1K9T A;  3KZ7 A;  5DIT A;  1WAW A;  4DRO A;  4AY1 A;  2Y78 A;  4HAR A;  3WL1 A;  2XP6 A;  1EYM A;  4HBE A;  3AQU A;  4WK9 A;  4Z2K A;  1W9P A;  3VAW A;  2KE0 A;  2MLX A;  3RM8 A;  4TW7 A;  3TCZ A;  2AWG A;  2ZR6 A;  2PV2 A;  3B9D A;  1E6N A;  2KR7 A;  2MLY A;  3CH9 A;  1NWR A;  4ODN A;  3KAI A;  1UR8 A;  2Q5A A;  4J4O A;  1B6C A;  4ZPT R;  1GOI A;  3CGN A;  1X6L A;  3KAF A;  3WIJ A;  3PR9 A;  2PV1 A;  4TW8 A;  2RUQ A;  4L72 B;  1EQ3 A;  3UQI A;  4FN2 A;  3UQA A;  5HTG A;  2ZQS A;  3WKZ A;  4QZV B;  4W9O A;  4DWS C;  3CHC A;  4U84 A;  1FKD A;  3UF8 A;  4MAV A;  3O5O A;  1EDQ A;  4ODO A;  2MPH A;  4ODP A;  4PTM A;  4IQC A;  3B9E A;  4MGV A;  3WH0 A;  1FAP A;  3AS0 A;  1KT0 A;  5HWC A;  1Q6H A;  2L2S A;  2M08 A;  4WIW A;  4DZ3 A;  4N19 A;  1QPF A;  4QIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...