5I98A

Structure of apo fkbp12(p104g) from c. albicans
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPGIIGPNETLVFEVELLGVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
total genus 26
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5i98A00
4DZ3A 3VAWA 1NMVA 1ROUA 3NI6A 3TDBA 4LAVA 1NMWA 2PV3A 4TX0A 5HTGA 1FD9A 2RURA 1R9HA 3O5LA 4C02B 4G2PA 5HUAA 1W26A 2F21A 1FKGA 4DRMA 3KZ7A 4DT4A 4JFJA 2XP8A 3KADA 3OOBA 1FKBA 3EY6A 2MNTA 3MDYB 4MGVA 3RGCA 3KAHA 4LAWA 5DIUA 1T11A 2PPOA 3KCEA 3ODKA 3UQBA 1D7JA 1BKFA 2MLXA 1P5QA 2VCDA 4DRNA 3IKDA 2L2SA 1Q6IA 4GIVA 4ODOA 2M08A 4TNSA 1FKIA 1Q1CA 1FJDA 4ODLA 2XP4A 5HW6A 5HW8A 2PV2A 4FAPA 4R0XA 4QT2A 3NRKA 1FKSA 3RFWA 2ZR4A 1BL4A 4JFIA 5DIVA 2F4EA 2OFNA 4QT3A 4ODKA 2XP9A 4J4OA 2LKNA 4U86A 5BXJA 2M1IA 4NNRA 1FKHA 3TC5A 3UI6A 2D9FA 2ZR5A 1HXVA 3O5RA 1QZ2A 1B6CA 2DG3A 2AWGA 4G50A 1QPFA 2MLZA 1FKLA 3O5MA 2RUQA 2KO7A 1PBKA 4TYOA 2KE0A 2RSEA 3IK8A 1D7HA 1EYMA 2RQSA 2XP5A 1NSGA 4IPXA 1Q6HA 2RUDA 4JFLA 1ZCNA 4TW8A 1KT1A 1FKDA 2MLYA 1Q6UA 2Q5AA 4JFMA 1YATA 3UF8A 3NTPA 2ZQUA 4DRHA 4JYSA 2MPHA 3WH0A 4DZ2A 2FKEA 4TW7A 5HWCA 1F40A 3KABA 3PRBA 5D75A 2DG9A 3TCZA 2LPVA 4TW6A 1FKJA 4ITZA 5J6EA 1YW5A 4DRIA 4DRKA 3GPKA 4DRQA 1TCOC 2XP7A 1FKTA 3KAIA 5I98A 2XPAA 4MSPA 1JNTA 1PINA 2ZR6A 1F8AB 3B7XA 2ZQVA 3O5KA 1C9HA 2MF9A 1FKFA 2LJ4A 2XPBA 2Y78A 1J4HA 3PRDA 1KT0A 4O2TA 2N87A 4W9QA 2XP3A 5HKGA 2DG4A 4FN2A 4QIBA 5HWBA 1EQ3A 1L1PA 3LUOA 4ODPA 5DITA 2K8IA 4LAYA 1ZK6A 1J6YA 3I6CA 4DIPA 3KAGA 1FKKA 4DH0A 2KFWA 1ROTA 1FAPA 4IQ2A 3CGNA 3UQAA 3O5DA 3O5PA 2M2AA 4IQCA 3UQIA 5B8IC 2UZ5A 3PA7A 2JZVA 2KGJA 3CGMA 3O5JA 1J4IA 2RUCA 5GPGA 2PPPA 1U79A 1A7XA 2LGOA 2KI3A 3JYJA 3O5OA 4U85A 4W9PA 1FKRA 1D6OA 1JVWA 4ODRA 2VN1A 3O5IA 3UI5A 2F2DA 1M5YA 4N19A 3O5EA 2IF4A 2ZQTA 4ODQA 3UI4A 2ITKA 3O5QA 4U84A 5HT1A 3KAFA 4DROA 1N1AA 4J4NA 3O5GA 5HW7A 1D7IA 3JYMA 2PBCA 2PPNA 2ZQSA 4W9OA 2KR7A 4JFKA 4LAXA 3IKGA 3JXVA 1QPLA 4BF8A 3H9RB 2PV1A 1Y0OA 4DRPA 3KACA 4ODMA 3O5FA 4ODNA 2XP6A 1JNSA 3FAPA 3IHZA 2FAPA 4DRJA 4GGQA 1J4RA
chains in the Genus database with same CATH superfamily
1NMVA 1XRVA 4MNLA 3CZ8A 1WNOA 3ARTA 4PTMA 5HTGA 4Z2KA 1R9HA 3O5LA 4Z2JA 5HUAA 4ZS6A 2F21A 3KADA 3RGCA 3KAHA 3KCEA 1D7JA 2MLXA 2VCDA 1ZBVA 2L2SA 1Q1CA 4ODLA 5HW6A 1NWTA 4QT2A 1IX5A 1OGBA 2DSZA 2OFNA 3PRAA 4Z2IA 4U86A 5BXJA 1HXVA 4Z2GA 3O5RA 2AWGA 4G50A 3AROA 1FKLA 3O5MA 1PBKA 4TYOA 4WJXA 2KE0A 1TFVA 4IPXA 1JNEA 3ARPA 3B8SA 4MTVA 1NH6A 1FKDA 4DRHA 4HBEA 3WIJA 1XHGA 1WAWA 4MAVA 3ALGA 2LPVA 4ITZA 2DSUA 4DRIA 4DRKA 1HJXA 1KFWA 2XP7A 4ZPWR 1E6ZA 1JNTA 2ZQVA 3O5KA 2A3EA 1KT0A 4O2TA 5HWBA 4QIBA 1EQ3A 4ODPA 1JNDA 1FFRA 2K8IA 4LAYA 2DPEA 3WD3A 3I6CA 4KQZA 4DH0A 2KFWA 1HKIA 4DWSA 3B9AA 4IQCA 4WIWA 1W1PA 1J4IA 1HKMA 4NZCA 4U85A 2A3AA 3WKZA 3O5IA 2G41A 1M5YA 3RMEA 2IF4A 3CHCA 3O5QA 4U84A 3KAFA 2A3CA 3CHEA 1D7IA 2KR7A 4LAXA 3IKGA 1QPLA 3H9RB 3O5FA 1LG2A 3IHZA 4DRJA 4GGQA 4L72B 1J4RA 2RSEA 3WL1A 1NWRA 4S3KA 1ROUA 4LAVA 1FD9A 2F23A 3ARWA 4DRMA 1FKGA 3KZ7A 1FKBA 3EY6A 4IT6A 1NWSA 2PI6A 4MGVA 5JH8A 1E6NA 4DRNA 3WQWA 4ODOA 2M08A 3CHFA 1FKIA 1X6NA 4MPKA 3AS0A 3B9EA 4FAPA 4R0XA 1FKSA 3RM8A 2ZR4A 4JFIA 2F4EA 4QT3A 4ODKA 2XP9A 3ARZA 1W1VA 2M1IA 4NNRA 2DG3A 4QZVB 1NWUA 1QPFA 4P8XA 1LL4A 3IK8A 1EYMA 1NSGA 1EDQA 1ZCNA 3CH9A 3WL0A 1LQ0A 4JFMA 2Q5AA 3ARQA 1YATA 3UF8A 2ZQUA 4JYSA 4DZ2A 2WLZA 5HWCA 1F40A 1E6PA 3WD1A 3GPKA 4NSBA 1X6LA 3RM9A 2A3BA 4ML4A 1PINA 3ARYA 2MF9A 3G6MA 3PRDA 3W4RA 5GQBA 3EIPA 2N87A 2DG4A 5DF0A 2G8ZA 3FXYA 3GTYX 4DIPA 5DEZA 1HJVA 3CHDA 1E6RA 3UQIA 2UZ5A 2DSWA 4DWSD 3O5JA 2RUCA 1U79A 1A7XA 2KI3A 4HBOA 1D6OA 2P4VA 4DWSB 4ODRA 2VN1A 2F2DA 1W9VA 2ITKA 1FFQA 1N1AA 5HW7A 2PBCA 2PPNA 4IT4A 2DT0A 4R5EA 3FAPA 2B31A 2FAPA 4WKHA 1K9TA 1D2KA 3NI6A 3TDBA 1NMWA 4Z2LA 2PV3A 3ARXA 1LL7A 4DWSC 2DSVA 4DT4A 3RM4A 1ZL1A 4JFJA 3ARSA 1W1TA 5DIUA 1T11A 2PPOA 3UQBA 2IUZA 1BKFA 3PR9A 3AS2A 5HW8A 2XP4A 5HBFA 4P8WA 1BL4A 5DIVA 1ZU8A 2YBTA 4J4OA 1FKHA 2D9FA 1QZ2A 1B6CA 4URIA 2MLZA 1GPFA 1HJWA 2RUQA 2KO7A 2DT3A 1D7HA 2O9OA 2XP5A 2RUDA 4JFLA 1KT1A 3BXWA 1Q6UA 1GRJA 4P8UA 2MPHA 2FKEA 3TCZA 1CTNA 2WK2A 1FKJA 1GUVA 5J6EA 4KR0B 1YW5A 4DRQA 3WD4A 1FKTA 3KAIA 4MNJA 4MSPA 1W9UA 1SR0A 3B7XA 3ARRA 1C9HA 1FKFA 1LG1A 2LJ4A 2XPBA 1J4HA 2Y78A 4AY1A 4FN2A 1L1PA 5DITA 1ZK6A 4W5UA 3KAGA 1WB0A 2DT2A 2WLYA 3O5DA 2M2AA 2ETNA 4WK9A 3PA7A 4WKFA 2JZVA 3B9DA 2WM0A 3CGMA 5GPGA 1HKKA 1JCHB 3JYJA 4XAKA 4Q7NA 4HARA 4W9PA 1JVWA 3WD2A 3UI5A 4N19A 3O5EA 1OGGA 4DROA 4J4NA 3ARVA 2DT1A 4W9OA 2OLHA 4JFKA 3JXVA 3G6LA 2PV1A 3KACA 4ODNA 5GPRA 1ZB5A 1RD6A 2XP6A 2O92A 1ZBWA 4DZ3A 3VAWA 1LL6A 4TX0A 1W9PA 3QOKA 4C02B 2RURA 2AOSA 4G2PA 2PN0A 1W26A 2ESCA 2XP8A 1H0IA 3OOBA 4WKAA 2MNTA 3WQVA 3MDYB 1LJYA 4LAWA 3ODKA 1P5QA 3BMBA 3IKDA 4GIVA 1Q6IA 4TNSA 1FJDA 2YBUA 2PV2A 3NRKA 3RFWA 1UR8A 2LKNA 1GOIA 1ZBCA 3TC5A 3FY1A 3UI6A 4MNMA 2ZR5A 1UR9A 1E15A 1ITXA 1VF8A 4L3NA 4P8VA 2RQSA 3AQUA 1Q6HA 3AS1A 4TW8A 3WD0A 2MLYA 3NTPA 1W1YA 3WH0A 4TW7A 1H0GA 3ARUA 3KABA 3PRBA 2DG9A 5D75A 4TW6A 1TCOC 4Z2HA 5I98A 1O6IA 2XPAA 2ZR6A 2QF8A 1F8AB 5DO2A 1HKJA 4LGXA 4W9QA 5HKGA 2XP3A 2EULA 4Q22A 3LUOA 3AS3A 1E9LA 1J6YA 1OWQA 1FKKA 1ZBKA 1EHNA 1ROTA 1FAPA 4IQ2A 3CGNA 4ZPTR 3UQAA 3O5PA 3ALFA 5B8IC 2KGJA 2PPPA 2LGOA 3O5OA 1EIBA 1FKRA 4ZPVR 2ZQTA 2FDMA 4ODQA 3UI4A 5HT1A 3O5GA 3JYMA 2ZQSA 4S3JA 2B5UB 4BF8A 4UDMA 1Y0OA 3GU0A 1E44A 4ODMA 4MNKA 1SYTA 4DRPA 1JNSA 3OA5A
chains in the Genus database with same CATH topology
1NMVA 1XRVA 4MNLA 3CZ8A 1WNOA 3ARTA 4PTMA 5HTGA 4Z2KA 1R9HA 3O5LA 4Z2JA 5HUAA 4ZS6A 2F21A 3KADA 3RGCA 3KAHA 3KCEA 1D7JA 2MLXA 2VCDA 1ZBVA 2L2SA 1Q1CA 4ODLA 5HW6A 1NWTA 4QT2A 1IX5A 1OGBA 2DSZA 2OFNA 3PRAA 4Z2IA 4U86A 5BXJA 1HXVA 4Z2GA 3O5RA 2AWGA 4G50A 3AROA 1FKLA 3O5MA 1PBKA 4TYOA 4WJXA 2KE0A 1TFVA 4IPXA 1JNEA 3ARPA 3B8SA 4MTVA 1NH6A 1FKDA 4DRHA 4HBEA 3WIJA 1XHGA 1WAWA 4MAVA 3ALGA 2LPVA 4ITZA 2DSUA 4DRIA 4DRKA 1HJXA 1KFWA 2XP7A 4ZPWR 1E6ZA 1JNTA 2ZQVA 3O5KA 2A3EA 1KT0A 4O2TA 5HWBA 4QIBA 1EQ3A 4ODPA 1JNDA 1FFRA 2K8IA 4LAYA 2DPEA 3WD3A 3I6CA 4KQZA 4DH0A 2KFWA 1HKIA 4DWSA 3B9AA 4IQCA 4WIWA 1W1PA 1J4IA 1HKMA 4NZCA 4U85A 2A3AA 3WKZA 3O5IA 2G41A 1M5YA 3RMEA 2IF4A 3CHCA 3O5QA 4U84A 3KAFA 2A3CA 3CHEA 1D7IA 2KR7A 4LAXA 3IKGA 1QPLA 3H9RB 3O5FA 1LG2A 3IHZA 4DRJA 4GGQA 4L72B 1J4RA 2RSEA 3WL1A 1NWRA 4S3KA 1ROUA 4LAVA 1FD9A 3ARWA 4DRMA 1FKGA 3KZ7A 1FKBA 3EY6A 4IT6A 1NWSA 2PI6A 4MGVA 5JH8A 1E6NA 4DRNA 3WQWA 4ODOA 2M08A 3CHFA 1FKIA 1X6NA 4MPKA 3AS0A 3B9EA 4FAPA 4R0XA 1FKSA 3RM8A 2ZR4A 4JFIA 2F4EA 4QT3A 4ODKA 2XP9A 3ARZA 1W1VA 2M1IA 4NNRA 2DG3A 4QZVB 1NWUA 1QPFA 4P8XA 1LL4A 3IK8A 1EYMA 1NSGA 1EDQA 1ZCNA 3CH9A 3WL0A 1LQ0A 4JFMA 2Q5AA 3ARQA 1YATA 3UF8A 2ZQUA 4JYSA 4DZ2A 2WLZA 5HWCA 1F40A 1E6PA 3WD1A 3GPKA 4NSBA 1X6LA 3RM9A 2A3BA 4ML4A 1PINA 3ARYA 2MF9A 3G6MA 3PRDA 3W4RA 5GQBA 2N87A 2DG4A 5DF0A 2G8ZA 3FXYA 4DIPA 5DEZA 1HJVA 3CHDA 1E6RA 3UQIA 2UZ5A 2DSWA 4DWSD 3O5JA 2RUCA 1U79A 1A7XA 2KI3A 4HBOA 1D6OA 4DWSB 4ODRA 2VN1A 2F2DA 1W9VA 2ITKA 1FFQA 1N1AA 5HW7A 2PBCA 2PPNA 4IT4A 2DT0A 4R5EA 3FAPA 2B31A 2FAPA 4WKHA 1K9TA 1D2KA 3NI6A 3TDBA 1NMWA 4Z2LA 2PV3A 3ARXA 1LL7A 4DWSC 2DSVA 4DT4A 3RM4A 1ZL1A 4JFJA 3ARSA 1W1TA 5DIUA 1T11A 2PPOA 3UQBA 2IUZA 1BKFA 3PR9A 3AS2A 5HW8A 2XP4A 5HBFA 4P8WA 1BL4A 5DIVA 1ZU8A 2YBTA 4J4OA 1FKHA 2D9FA 1QZ2A 1B6CA 4URIA 2MLZA 1GPFA 1HJWA 2RUQA 2KO7A 2DT3A 1D7HA 2O9OA 2XP5A 2RUDA 4JFLA 1KT1A 3BXWA 1Q6UA 4P8UA 2MPHA 2FKEA 3TCZA 1CTNA 2WK2A 1FKJA 1GUVA 5J6EA 4KR0B 1YW5A 4DRQA 3WD4A 1FKTA 3KAIA 4MNJA 4MSPA 1W9UA 1SR0A 3B7XA 3ARRA 1C9HA 1FKFA 1LG1A 2LJ4A 2XPBA 1J4HA 2Y78A 4AY1A 4FN2A 1L1PA 5DITA 1ZK6A 4W5UA 3KAGA 1WB0A 2DT2A 2WLYA 3O5DA 2M2AA 4WK9A 3PA7A 4WKFA 2JZVA 3B9DA 2WM0A 3CGMA 5GPGA 1HKKA 3JYJA 4XAKA 4Q7NA 4HARA 4W9PA 1JVWA 3WD2A 3UI5A 4N19A 3O5EA 1OGGA 4DROA 4J4NA 3ARVA 2DT1A 4W9OA 2OLHA 4JFKA 3JXVA 3G6LA 2PV1A 3KACA 4ODNA 5GPRA 1ZB5A 1RD6A 2XP6A 2O92A 1ZBWA 4DZ3A 3VAWA 1LL6A 4TX0A 1W9PA 3QOKA 4C02B 2RURA 2AOSA 4G2PA 1W26A 2ESCA 2XP8A 1H0IA 3OOBA 4WKAA 2MNTA 3WQVA 3MDYB 1LJYA 4LAWA 3ODKA 1P5QA 3IKDA 4GIVA 1Q6IA 4TNSA 1FJDA 2YBUA 2PV2A 3NRKA 3RFWA 1UR8A 2LKNA 1GOIA 1ZBCA 3TC5A 3FY1A 3UI6A 4MNMA 2ZR5A 1UR9A 1E15A 1ITXA 1VF8A 4L3NA 4P8VA 2RQSA 3AQUA 1Q6HA 3AS1A 4TW8A 3WD0A 2MLYA 3NTPA 1W1YA 3WH0A 4TW7A 1H0GA 3ARUA 3KABA 3PRBA 2DG9A 5D75A 4TW6A 1TCOC 4Z2HA 5I98A 1O6IA 2XPAA 2ZR6A 2QF8A 1F8AB 5DO2A 1HKJA 4LGXA 4W9QA 5HKGA 2XP3A 4Q22A 3LUOA 3AS3A 1E9LA 1J6YA 1OWQA 1FKKA 1ZBKA 1EHNA 1ROTA 1FAPA 4IQ2A 3CGNA 4ZPTR 3UQAA 3O5PA 3ALFA 5B8IC 2KGJA 2PPPA 2LGOA 3O5OA 1EIBA 1FKRA 4ZPVR 2ZQTA 2FDMA 4ODQA 3UI4A 5HT1A 3O5GA 3JYMA 2ZQSA 4S3JA 4BF8A 1Y0OA 4DRPA 4ODMA 4MNKA 1SYTA 1JNSA 3OA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DZ3 A;  3VAW A;  1NMV A;  1ROU A;  3NI6 A;  3TDB A;  4LAV A;  1NMW A;  2PV3 A;  4TX0 A;  5HTG A;  1FD9 A;  2RUR A;  1R9H A;  3O5L A;  4C02 B;  4G2P A;  5HUA A;  1W26 A;  2F21 A;  1FKG A;  4DRM A;  3KZ7 A;  4DT4 A;  4JFJ A;  2XP8 A;  3KAD A;  3OOB A;  1FKB A;  3EY6 A;  2MNT A;  3MDY B;  4MGV A;  3RGC A;  3KAH A;  4LAW A;  5DIU A;  1T11 A;  2PPO A;  3KCE A;  3ODK A;  3UQB A;  1D7J A;  1BKF A;  2MLX A;  1P5Q A;  2VCD A;  4DRN A;  3IKD A;  2L2S A;  1Q6I A;  4GIV A;  4ODO A;  2M08 A;  4TNS A;  1FKI A;  1Q1C A;  1FJD A;  4ODL A;  2XP4 A;  5HW6 A;  5HW8 A;  2PV2 A;  4FAP A;  4R0X A;  4QT2 A;  3NRK A;  1FKS A;  3RFW A;  2ZR4 A;  1BL4 A;  4JFI A;  5DIV A;  2F4E A;  2OFN A;  4QT3 A;  4ODK A;  2XP9 A;  4J4O A;  2LKN A;  4U86 A;  5BXJ A;  2M1I A;  4NNR A;  1FKH A;  3TC5 A;  3UI6 A;  2D9F A;  2ZR5 A;  1HXV A;  3O5R A;  1QZ2 A;  1B6C A;  2DG3 A;  2AWG A;  4G50 A;  1QPF A;  2MLZ A;  1FKL A;  3O5M A;  2RUQ A;  2KO7 A;  1PBK A;  4TYO A;  2KE0 A;  2RSE A;  3IK8 A;  1D7H A;  1EYM A;  2RQS A;  2XP5 A;  1NSG A;  4IPX A;  1Q6H A;  2RUD A;  4JFL A;  1ZCN A;  4TW8 A;  1KT1 A;  1FKD A;  2MLY A;  1Q6U A;  2Q5A A;  4JFM A;  1YAT A;  3UF8 A;  3NTP A;  2ZQU A;  4DRH A;  4JYS A;  2MPH A;  3WH0 A;  4DZ2 A;  2FKE A;  4TW7 A;  5HWC A;  1F40 A;  3KAB A;  3PRB A;  5D75 A;  2DG9 A;  3TCZ A;  2LPV A;  4TW6 A;  1FKJ A;  4ITZ A;  5J6E A;  1YW5 A;  4DRI A;  4DRK A;  3GPK A;  4DRQ A;  1TCO C;  2XP7 A;  1FKT A;  3KAI A;  5I98 A;  2XPA A;  4MSP A;  1JNT A;  1PIN A;  2ZR6 A;  1F8A B;  3B7X A;  2ZQV A;  3O5K A;  1C9H A;  2MF9 A;  1FKF A;  2LJ4 A;  2XPB A;  2Y78 A;  1J4H A;  3PRD A;  1KT0 A;  4O2T A;  2N87 A;  4W9Q A;  2XP3 A;  5HKG A;  2DG4 A;  4FN2 A;  4QIB A;  5HWB A;  1EQ3 A;  1L1P A;  3LUO A;  4ODP A;  5DIT A;  2K8I A;  4LAY A;  1ZK6 A;  1J6Y A;  3I6C A;  4DIP A;  3KAG A;  1FKK A;  4DH0 A;  2KFW A;  1ROT A;  1FAP A;  4IQ2 A;  3CGN A;  3UQA A;  3O5D A;  3O5P A;  2M2A A;  4IQC A;  3UQI A;  5B8I C;  2UZ5 A;  3PA7 A;  2JZV A;  2KGJ A;  3CGM A;  3O5J A;  1J4I A;  2RUC A;  5GPG A;  2PPP A;  1U79 A;  1A7X A;  2LGO A;  2KI3 A;  3JYJ A;  3O5O A;  4U85 A;  4W9P A;  1FKR A;  1D6O A;  1JVW A;  4ODR A;  2VN1 A;  3O5I A;  3UI5 A;  2F2D A;  1M5Y A;  4N19 A;  3O5E A;  2IF4 A;  2ZQT A;  4ODQ A;  3UI4 A;  2ITK A;  3O5Q A;  4U84 A;  5HT1 A;  3KAF A;  4DRO A;  1N1A A;  4J4N A;  3O5G A;  5HW7 A;  1D7I A;  3JYM A;  2PBC A;  2PPN A;  2ZQS A;  4W9O A;  2KR7 A;  4JFK A;  4LAX A;  3IKG A;  3JXV A;  1QPL A;  4BF8 A;  3H9R B;  2PV1 A;  1Y0O A;  4DRP A;  3KAC A;  4ODM A;  3O5F A;  4ODN A;  2XP6 A;  1JNS A;  3FAP A;  3IHZ A;  2FAP A;  4DRJ A;  4GGQ A;  1J4R A; 
#chains in the Genus database with same CATH topology
 1NMV A;  1XRV A;  4MNL A;  3CZ8 A;  1WNO A;  3ART A;  4PTM A;  5HTG A;  4Z2K A;  1R9H A;  3O5L A;  4Z2J A;  5HUA A;  4ZS6 A;  2F21 A;  3KAD A;  3RGC A;  3KAH A;  3KCE A;  1D7J A;  2MLX A;  2VCD A;  1ZBV A;  2L2S A;  1Q1C A;  4ODL A;  5HW6 A;  1NWT A;  4QT2 A;  1IX5 A;  1OGB A;  2DSZ A;  2OFN A;  3PRA A;  4Z2I A;  4U86 A;  5BXJ A;  1HXV A;  4Z2G A;  3O5R A;  2AWG A;  4G50 A;  3ARO A;  1FKL A;  3O5M A;  1PBK A;  4TYO A;  4WJX A;  2KE0 A;  1TFV A;  4IPX A;  1JNE A;  3ARP A;  3B8S A;  4MTV A;  1NH6 A;  1FKD A;  4DRH A;  4HBE A;  3WIJ A;  1XHG A;  1WAW A;  4MAV A;  3ALG A;  2LPV A;  4ITZ A;  2DSU A;  4DRI A;  4DRK A;  1HJX A;  1KFW A;  2XP7 A;  4ZPW R;  1E6Z A;  1JNT A;  2ZQV A;  3O5K A;  2A3E A;  1KT0 A;  4O2T A;  5HWB A;  4QIB A;  1EQ3 A;  4ODP A;  1JND A;  1FFR A;  2K8I A;  4LAY A;  2DPE A;  3WD3 A;  3I6C A;  4KQZ A;  4DH0 A;  2KFW A;  1HKI A;  4DWS A;  3B9A A;  4IQC A;  4WIW A;  1W1P A;  1J4I A;  1HKM A;  4NZC A;  4U85 A;  2A3A A;  3WKZ A;  3O5I A;  2G41 A;  1M5Y A;  3RME A;  2IF4 A;  3CHC A;  3O5Q A;  4U84 A;  3KAF A;  2A3C A;  3CHE A;  1D7I A;  2KR7 A;  4LAX A;  3IKG A;  1QPL A;  3H9R B;  3O5F A;  1LG2 A;  3IHZ A;  4DRJ A;  4GGQ A;  4L72 B;  1J4R A;  2RSE A;  3WL1 A;  1NWR A;  4S3K A;  1ROU A;  4LAV A;  1FD9 A;  2F23 A;  3ARW A;  4DRM A;  1FKG A;  3KZ7 A;  1FKB A;  3EY6 A;  4IT6 A;  1NWS A;  2PI6 A;  4MGV A;  5JH8 A;  1E6N A;  4DRN A;  3WQW A;  4ODO A;  2M08 A;  3CHF A;  1FKI A;  1X6N A;  4MPK A;  3AS0 A;  3B9E A;  4FAP A;  4R0X A;  1FKS A;  3RM8 A;  2ZR4 A;  4JFI A;  2F4E A;  4QT3 A;  4ODK A;  2XP9 A;  3ARZ A;  1W1V A;  2M1I A;  4NNR A;  2DG3 A;  4QZV B;  1NWU A;  1QPF A;  4P8X A;  1LL4 A;  3IK8 A;  1EYM A;  1NSG A;  1EDQ A;  1ZCN A;  3CH9 A;  3WL0 A;  1LQ0 A;  4JFM A;  2Q5A A;  3ARQ A;  1YAT A;  3UF8 A;  2ZQU A;  4JYS A;  4DZ2 A;  2WLZ A;  5HWC A;  1F40 A;  1E6P A;  3WD1 A;  3GPK A;  4NSB A;  1X6L A;  3RM9 A;  2A3B A;  4ML4 A;  1PIN A;  3ARY A;  2MF9 A;  3G6M A;  3PRD A;  3W4R A;  5GQB A;  3EIP A;  2N87 A;  2DG4 A;  5DF0 A;  2G8Z A;  3FXY A;  3GTY X;  4DIP A;  5DEZ A;  1HJV A;  3CHD A;  1E6R A;  3UQI A;  2UZ5 A;  2DSW A;  4DWS D;  3O5J A;  2RUC A;  1U79 A;  1A7X A;  2KI3 A;  4HBO A;  1D6O A;  2P4V A;  4DWS B;  4ODR A;  2VN1 A;  2F2D A;  1W9V A;  2ITK A;  1FFQ A;  1N1A A;  5HW7 A;  2PBC A;  2PPN A;  4IT4 A;  2DT0 A;  4R5E A;  3FAP A;  2B31 A;  2FAP A;  4WKH A;  1K9T A;  1D2K A;  3NI6 A;  3TDB A;  1NMW A;  4Z2L A;  2PV3 A;  3ARX A;  1LL7 A;  4DWS C;  2DSV A;  4DT4 A;  3RM4 A;  1ZL1 A;  4JFJ A;  3ARS A;  1W1T A;  5DIU A;  1T11 A;  2PPO A;  3UQB A;  2IUZ A;  1BKF A;  3PR9 A;  3AS2 A;  5HW8 A;  2XP4 A;  5HBF A;  4P8W A;  1BL4 A;  5DIV A;  1ZU8 A;  2YBT A;  4J4O A;  1FKH A;  2D9F A;  1QZ2 A;  1B6C A;  4URI A;  2MLZ A;  1GPF A;  1HJW A;  2RUQ A;  2KO7 A;  2DT3 A;  1D7H A;  2O9O A;  2XP5 A;  2RUD A;  4JFL A;  1KT1 A;  3BXW A;  1Q6U A;  1GRJ A;  4P8U A;  2MPH A;  2FKE A;  3TCZ A;  1CTN A;  2WK2 A;  1FKJ A;  1GUV A;  5J6E A;  4KR0 B;  1YW5 A;  4DRQ A;  3WD4 A;  1FKT A;  3KAI A;  4MNJ A;  4MSP A;  1W9U A;  1SR0 A;  3B7X A;  3ARR A;  1C9H A;  1FKF A;  1LG1 A;  2LJ4 A;  2XPB A;  1J4H A;  2Y78 A;  4AY1 A;  4FN2 A;  1L1P A;  5DIT A;  1ZK6 A;  4W5U A;  3KAG A;  1WB0 A;  2DT2 A;  2WLY A;  3O5D A;  2M2A A;  2ETN A;  4WK9 A;  3PA7 A;  4WKF A;  2JZV A;  3B9D A;  2WM0 A;  3CGM A;  5GPG A;  1HKK A;  1JCH B;  3JYJ A;  4XAK A;  4Q7N A;  4HAR A;  4W9P A;  1JVW A;  3WD2 A;  3UI5 A;  4N19 A;  3O5E A;  1OGG A;  4DRO A;  4J4N A;  3ARV A;  2DT1 A;  4W9O A;  2OLH A;  4JFK A;  3JXV A;  3G6L A;  2PV1 A;  3KAC A;  4ODN A;  5GPR A;  1ZB5 A;  1RD6 A;  2XP6 A;  2O92 A;  1ZBW A;  4DZ3 A;  3VAW A;  1LL6 A;  4TX0 A;  1W9P A;  3QOK A;  4C02 B;  2RUR A;  2AOS A;  4G2P A;  2PN0 A;  1W26 A;  2ESC A;  2XP8 A;  1H0I A;  3OOB A;  4WKA A;  2MNT A;  3WQV A;  3MDY B;  1LJY A;  4LAW A;  3ODK A;  1P5Q A;  3BMB A;  3IKD A;  4GIV A;  1Q6I A;  4TNS A;  1FJD A;  2YBU A;  2PV2 A;  3NRK A;  3RFW A;  1UR8 A;  2LKN A;  1GOI A;  1ZBC A;  3TC5 A;  3FY1 A;  3UI6 A;  4MNM A;  2ZR5 A;  1UR9 A;  1E15 A;  1ITX A;  1VF8 A;  4L3N A;  4P8V A;  2RQS A;  3AQU A;  1Q6H A;  3AS1 A;  4TW8 A;  3WD0 A;  2MLY A;  3NTP A;  1W1Y A;  3WH0 A;  4TW7 A;  1H0G A;  3ARU A;  3KAB A;  3PRB A;  2DG9 A;  5D75 A;  4TW6 A;  1TCO C;  4Z2H A;  5I98 A;  1O6I A;  2XPA A;  2ZR6 A;  2QF8 A;  1F8A B;  5DO2 A;  1HKJ A;  4LGX A;  4W9Q A;  5HKG A;  2XP3 A;  2EUL A;  4Q22 A;  3LUO A;  3AS3 A;  1E9L A;  1J6Y A;  1OWQ A;  1FKK A;  1ZBK A;  1EHN A;  1ROT A;  1FAP A;  4IQ2 A;  3CGN A;  4ZPT R;  3UQA A;  3O5P A;  3ALF A;  5B8I C;  2KGJ A;  2PPP A;  2LGO A;  3O5O A;  1EIB A;  1FKR A;  4ZPV R;  2ZQT A;  2FDM A;  4ODQ A;  3UI4 A;  5HT1 A;  3O5G A;  3JYM A;  2ZQS A;  4S3J A;  2B5U B;  4BF8 A;  4UDM A;  1Y0O A;  3GU0 A;  1E44 A;  4ODM A;  4MNK A;  1SYT A;  4DRP A;  1JNS A;  3OA5 A; 
#chains in the Genus database with same CATH homology
 1NMV A;  1XRV A;  4MNL A;  3CZ8 A;  1WNO A;  3ART A;  4PTM A;  5HTG A;  4Z2K A;  1R9H A;  3O5L A;  4Z2J A;  5HUA A;  4ZS6 A;  2F21 A;  3KAD A;  3RGC A;  3KAH A;  3KCE A;  1D7J A;  2MLX A;  2VCD A;  1ZBV A;  2L2S A;  1Q1C A;  4ODL A;  5HW6 A;  1NWT A;  4QT2 A;  1IX5 A;  1OGB A;  2DSZ A;  2OFN A;  3PRA A;  4Z2I A;  4U86 A;  5BXJ A;  1HXV A;  4Z2G A;  3O5R A;  2AWG A;  4G50 A;  3ARO A;  1FKL A;  3O5M A;  1PBK A;  4TYO A;  4WJX A;  2KE0 A;  1TFV A;  4IPX A;  1JNE A;  3ARP A;  3B8S A;  4MTV A;  1NH6 A;  1FKD A;  4DRH A;  4HBE A;  3WIJ A;  1XHG A;  1WAW A;  4MAV A;  3ALG A;  2LPV A;  4ITZ A;  2DSU A;  4DRI A;  4DRK A;  1HJX A;  1KFW A;  2XP7 A;  4ZPW R;  1E6Z A;  1JNT A;  2ZQV A;  3O5K A;  2A3E A;  1KT0 A;  4O2T A;  5HWB A;  4QIB A;  1EQ3 A;  4ODP A;  1JND A;  1FFR A;  2K8I A;  4LAY A;  2DPE A;  3WD3 A;  3I6C A;  4KQZ A;  4DH0 A;  2KFW A;  1HKI A;  4DWS A;  3B9A A;  4IQC A;  4WIW A;  1W1P A;  1J4I A;  1HKM A;  4NZC A;  4U85 A;  2A3A A;  3WKZ A;  3O5I A;  2G41 A;  1M5Y A;  3RME A;  2IF4 A;  3CHC A;  3O5Q A;  4U84 A;  3KAF A;  2A3C A;  3CHE A;  1D7I A;  2KR7 A;  4LAX A;  3IKG A;  1QPL A;  3H9R B;  3O5F A;  1LG2 A;  3IHZ A;  4DRJ A;  4GGQ A;  4L72 B;  1J4R A;  2RSE A;  3WL1 A;  1NWR A;  4S3K A;  1ROU A;  4LAV A;  1FD9 A;  3ARW A;  4DRM A;  1FKG A;  3KZ7 A;  1FKB A;  3EY6 A;  4IT6 A;  1NWS A;  2PI6 A;  4MGV A;  5JH8 A;  1E6N A;  4DRN A;  3WQW A;  4ODO A;  2M08 A;  3CHF A;  1FKI A;  1X6N A;  4MPK A;  3AS0 A;  3B9E A;  4FAP A;  4R0X A;  1FKS A;  3RM8 A;  2ZR4 A;  4JFI A;  2F4E A;  4QT3 A;  4ODK A;  2XP9 A;  3ARZ A;  1W1V A;  2M1I A;  4NNR A;  2DG3 A;  4QZV B;  1NWU A;  1QPF A;  4P8X A;  1LL4 A;  3IK8 A;  1EYM A;  1NSG A;  1EDQ A;  1ZCN A;  3CH9 A;  3WL0 A;  1LQ0 A;  4JFM A;  2Q5A A;  3ARQ A;  1YAT A;  3UF8 A;  2ZQU A;  4JYS A;  4DZ2 A;  2WLZ A;  5HWC A;  1F40 A;  1E6P A;  3WD1 A;  3GPK A;  4NSB A;  1X6L A;  3RM9 A;  2A3B A;  4ML4 A;  1PIN A;  3ARY A;  2MF9 A;  3G6M A;  3PRD A;  3W4R A;  5GQB A;  2N87 A;  2DG4 A;  5DF0 A;  2G8Z A;  3FXY A;  4DIP A;  5DEZ A;  1HJV A;  3CHD A;  1E6R A;  3UQI A;  2UZ5 A;  2DSW A;  4DWS D;  3O5J A;  2RUC A;  1U79 A;  1A7X A;  2KI3 A;  4HBO A;  1D6O A;  4DWS B;  4ODR A;  2VN1 A;  2F2D A;  1W9V A;  2ITK A;  1FFQ A;  1N1A A;  5HW7 A;  2PBC A;  2PPN A;  4IT4 A;  2DT0 A;  4R5E A;  3FAP A;  2B31 A;  2FAP A;  4WKH A;  1K9T A;  1D2K A;  3NI6 A;  3TDB A;  1NMW A;  4Z2L A;  2PV3 A;  3ARX A;  1LL7 A;  4DWS C;  2DSV A;  4DT4 A;  3RM4 A;  1ZL1 A;  4JFJ A;  3ARS A;  1W1T A;  5DIU A;  1T11 A;  2PPO A;  3UQB A;  2IUZ A;  1BKF A;  3PR9 A;  3AS2 A;  5HW8 A;  2XP4 A;  5HBF A;  4P8W A;  1BL4 A;  5DIV A;  1ZU8 A;  2YBT A;  4J4O A;  1FKH A;  2D9F A;  1QZ2 A;  1B6C A;  4URI A;  2MLZ A;  1GPF A;  1HJW A;  2RUQ A;  2KO7 A;  2DT3 A;  1D7H A;  2O9O A;  2XP5 A;  2RUD A;  4JFL A;  1KT1 A;  3BXW A;  1Q6U A;  4P8U A;  2MPH A;  2FKE A;  3TCZ A;  1CTN A;  2WK2 A;  1FKJ A;  1GUV A;  5J6E A;  4KR0 B;  1YW5 A;  4DRQ A;  3WD4 A;  1FKT A;  3KAI A;  4MNJ A;  4MSP A;  1W9U A;  1SR0 A;  3B7X A;  3ARR A;  1C9H A;  1FKF A;  1LG1 A;  2LJ4 A;  2XPB A;  1J4H A;  2Y78 A;  4AY1 A;  4FN2 A;  1L1P A;  5DIT A;  1ZK6 A;  4W5U A;  3KAG A;  1WB0 A;  2DT2 A;  2WLY A;  3O5D A;  2M2A A;  4WK9 A;  3PA7 A;  4WKF A;  2JZV A;  3B9D A;  2WM0 A;  3CGM A;  5GPG A;  1HKK A;  3JYJ A;  4XAK A;  4Q7N A;  4HAR A;  4W9P A;  1JVW A;  3WD2 A;  3UI5 A;  4N19 A;  3O5E A;  1OGG A;  4DRO A;  4J4N A;  3ARV A;  2DT1 A;  4W9O A;  2OLH A;  4JFK A;  3JXV A;  3G6L A;  2PV1 A;  3KAC A;  4ODN A;  5GPR A;  1ZB5 A;  1RD6 A;  2XP6 A;  2O92 A;  1ZBW A;  4DZ3 A;  3VAW A;  1LL6 A;  4TX0 A;  1W9P A;  3QOK A;  4C02 B;  2RUR A;  2AOS A;  4G2P A;  1W26 A;  2ESC A;  2XP8 A;  1H0I A;  3OOB A;  4WKA A;  2MNT A;  3WQV A;  3MDY B;  1LJY A;  4LAW A;  3ODK A;  1P5Q A;  3IKD A;  4GIV A;  1Q6I A;  4TNS A;  1FJD A;  2YBU A;  2PV2 A;  3NRK A;  3RFW A;  1UR8 A;  2LKN A;  1GOI A;  1ZBC A;  3TC5 A;  3FY1 A;  3UI6 A;  4MNM A;  2ZR5 A;  1UR9 A;  1E15 A;  1ITX A;  1VF8 A;  4L3N A;  4P8V A;  2RQS A;  3AQU A;  1Q6H A;  3AS1 A;  4TW8 A;  3WD0 A;  2MLY A;  3NTP A;  1W1Y A;  3WH0 A;  4TW7 A;  1H0G A;  3ARU A;  3KAB A;  3PRB A;  2DG9 A;  5D75 A;  4TW6 A;  1TCO C;  4Z2H A;  5I98 A;  1O6I A;  2XPA A;  2ZR6 A;  2QF8 A;  1F8A B;  5DO2 A;  1HKJ A;  4LGX A;  4W9Q A;  5HKG A;  2XP3 A;  4Q22 A;  3LUO A;  3AS3 A;  1E9L A;  1J6Y A;  1OWQ A;  1FKK A;  1ZBK A;  1EHN A;  1ROT A;  1FAP A;  4IQ2 A;  3CGN A;  4ZPT R;  3UQA A;  3O5P A;  3ALF A;  5B8I C;  2KGJ A;  2PPP A;  2LGO A;  3O5O A;  1EIB A;  1FKR A;  4ZPV R;  2ZQT A;  2FDM A;  4ODQ A;  3UI4 A;  5HT1 A;  3O5G A;  3JYM A;  2ZQS A;  4S3J A;  4BF8 A;  1Y0O A;  4DRP A;  4ODM A;  4MNK A;  1SYT A;  1JNS A;  3OA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...