5J6EA

Structure of disulfide crosslinked a. fumigatus fkbp12(v91c)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
MGVTKELKSPGNGVDFPKKGDFVTIHYTGRLTDGSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPPCIPGNSTLIFEVELLGINNKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
total genus 27
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5j6eA00
1ROUA 3O5JA 4ITZA 3KAIA 1FJDA 1D6OA 1N1AA 1L1PA 4J4NA 2PPPA 2XP4A 3NI6A 1JVWA 5J6EA 1Q6IA 3JYMA 4DROA 4IPXA 2MF9A 2ZR6A 2D9FA 3KADA 3NTPA 1FAPA 4IQ2A 1J4IA 1FKLA 4JFIA 1YW5A 4JFJA 4JYSA 5HWCA 1EQ3A 2XP6A 1U79A 3KAFA 1FKSA 4FN2A 4GGQA 1B6CA 3O5FA 4JFKA 1W26A 5HKGA 3JXVA 1J6YA 4TW6A 2DG3A 4LAVA 3O5PA 2XPAA 4ODPA 1M5YA 1JNTA 3KACA 4DRNA 2MLYA 4W9OA 4ODOA 2PV3A 5HT1A 3UQAA 4ODNA 1PINA 1D7HA 3TCZA 4QT3A 2MLXA 1NMVA 4DRMA 4DZ2A 4ODRA 2LJ4A 1FKKA 4DRIA 1YATA 3O5QA 4ODKA 2PPNA 2MLZA 2XP5A 2LPVA 1FKTA 2RUCA 3MDYB 3KABA 2ZR4A 3O5DA 4C02B 1FKBA 2DG9A 3PRDA 1FKDA 2PPOA 2M2AA 3O5GA 5HTGA 4O2TA 5HW8A 3B7XA 5B8IC 4ODMA 3TDBA 5HW7A 3FAPA 2KFWA 3EY6A 3I6CA 4DRJA 3O5LA 1QZ2A 3PA7A 3KAHA 4G50A 4R0XA 1HXVA 2XP7A 2ZQUA 2XP8A 2RURA 2RSEA 4U85A 3UI4A 2L2SA 2KI3A 3CGNA 3H9RB 1D7JA 4J4OA 1FKJA 2KGJA 1P5QA 2JZVA 1F8AB 3NRKA 2ZQVA 5DITA 5BXJA 2LKNA 2M08A 4ODLA 3O5MA 5HUAA 1FKIA 3IKDA 5D75A 4MGVA 1ZK6A 4LAWA 2FKEA 4LAXA 1BL4A 4ODQA 2VCDA 2MNTA 3IK8A 4U84A 2KO7A 3ODKA 1D7IA 3RGCA 1T11A 1J4HA 3IHZA 2RUQA 3KCEA 4G2PA 4JFMA 3UQIA 1Q1CA 2VN1A 2OFNA 4QT2A 4FAPA 4MSPA 2M1IA 1TCOC 1KT0A 1FKRA 2N87A 3LUOA 2F4EA 4DIPA 2XPBA 3O5EA 1NMWA 3UF8A 3OOBA 4W9PA 2F21A 4DH0A 1KT1A 1ZCNA 3IKGA 4DT4A 1A7XA 1QPLA 2ZR5A 1C9HA 4N19A 2LGOA 1JNSA 3JYJA 2ZQTA 1J4RA 3O5RA 4DRKA 2AWGA 3UI6A 1Q6HA 2PV1A 2RQSA 2RUDA 2ZQSA 3CGMA 1FKHA 3O5IA 1Y0OA 2DG4A 3RFWA 1FKFA 2PBCA 2Q5AA 4TW7A 1FKGA 2UZ5A 2PV2A 1QPFA 1FD9A 2KR7A 4DRQA 3VAWA 2K8IA 4TYOA 1F40A 3UI5A 3KZ7A 4QIBA 5DIVA 4DRHA 4DRPA 5HW6A 1Q6UA 1EYMA 5DIUA 4NNRA 2Y78A 2FAPA 2MPHA 3TC5A 5I98A 1ROTA 2IF4A 4GIVA 4TW8A 3UQBA 4IQCA 1R9HA 4U86A 4JFLA 3PRBA 2XP3A 4LAYA 5GPGA 4TNSA 1BKFA 3O5OA 4W9QA 3WH0A 4DZ3A 3O5KA 2KE0A 1NSGA 2F2DA 3GPKA 5HWBA 4BF8A 3KAGA 4TX0A 2ITKA 2XP9A 1PBKA
chains in the Genus database with same CATH superfamily
1ROUA 3O5JA 3KAIA 1UR9A 1HJWA 1LL4A 1UR8A 2XP4A 3NI6A 4NSBA 3RM4A 1JVWA 4DROA 5HBFA 2MF9A 4IQ2A 2D9FA 3WL0A 1YW5A 2XP6A 1U79A 5HKGA 4GGQA 4FN2A 3RM8A 1B6CA 1W26A 3ARPA 4ZS6A 4ODPA 3KACA 2MLYA 3EIPA 4ODNA 1PINA 4Q22A 3B9DA 2DSZA 4S3JA 1FFRA 1YATA 3TC5A 2PI6A 1FKDA 3PRDA 2P4VA 3ARSA 4HBOA 5HTGA 3TDBA 3WD2A 1QZ2A 2B31A 4U85A 3CGNA 1HKIA 1FKJA 3WIJA 4R5EA 2DT0A 5BXJA 4HARA 4HBEA 2LKNA 1FKIA 4LAWA 4LGXA 2KO7A 3ODKA 3CHDA 3KCEA 4G2PA 1Q1CA 4FAPA 1TCOC 1KT0A 1ZB5A 4ZPVR 3LUOA 3OOBA 4W9PA 1KT1A 1D2KA 1W9UA 1A7XA 4DT4A 1QPLA 3W4RA 1HJXA 3CHCA 1J4RA 3ARZA 2PV1A 2RQSA 3RFWA 1LG2A 2WLYA 4XAKA 1WNOA 4Z2GA 3VAWA 4WKFA 3ARXA 4QIBA 3CH9A 4DRPA 1EYMA 4MAVA 4NNRA 1ROTA 3UQBA 4JFLA 2DSUA 3PRBA 4L72B 1GPFA 2DSWA 3BMBA 4TNSA 4W9QA 3WH0A 3AS0A 1W1PA 3GPKA 3WL1A 4BF8A 3AS1A 2XP9A 3WQVA 3WKZA 3AROA 3WD1A 1N1AA 1SR0A 1E9LA 2PPPA 1CTNA 2YBTA 5J6EA 3JYMA 4IPXA 2ZR6A 1J4IA 3KAFA 1FKSA 1NH6A 3O5FA 1J6YA 2FDMA 4DRNA 4Z2JA 1NWSA 2PV3A 3ARRA 4QT3A 1NMVA 1HKMA 3O5QA 3O5DA 2RUCA 1FKBA 3O5GA 4O2TA 4ODMA 2KFWA 3EY6A 1E6NA 3I6CA 1X6LA 3PA7A 4R0XA 3KAHA 1ZBVA 4ML4A 1E6RA 2XP8A 2ZQUA 1GUVA 2RURA 2RSEA 3H9RB 4P8XA 1D7JA 1F8AB 4Q7NA 3NRKA 4URIA 3ARUA 2M08A 2O9OA 4MGVA 5DF0A 1ZK6A 1FFQA 4LAXA 4PTMA 4DWSB 4Z2KA 2QF8A 2VCDA 2MNTA 3IK8A 1NWUA 1J4HA 2VN1A 3ARYA 3BXWA 4MSPA 3B8SA 2G8ZA 2F4EA 4DIPA 4Z2IA 3O5EA 1NMWA 1ZCNA 1C9HA 1JNSA 1IX5A 3GTYX 3GU0A 3CGMA 2EULA 2PBCA 1FKGA 1W1TA 1LQ0A 1NWRA 1GOIA 2KR7A 2DT2A 1F40A 3KZ7A 4AY1A 4DRHA 1W9VA 5DIUA 2FAPA 5I98A 3RMEA 1LL6A 4U86A 1OWQA 4MTVA 4WIWA 4LAYA 2DT3A 5GPGA 2DT1A 3WD0A 3O5OA 3ARTA 3O5KA 1WB0A 1NSGA 1H0IA 2DPEA 2F2DA 4WKAA 4UDMA 3KAGA 4TX0A 2ITKA 3FXYA 2ZR5A 1PBKA 4MNMA 4ITZA 3CZ8A 1L1PA 4J4NA 4NZCA 3G6LA 4JFIA 4JYSA 5GQBA 1W9PA 4Z2LA 1OGBA 1EIBA 4TW6A 2DG3A 4LAVA 1EHNA 2XPAA 4QZVB 1JNTA 3WQWA 2O92A 1ZBCA 4KQZA 3UQAA 1ZL1A 4P8UA 1JNDA 4ODRA 4WJXA 4DRIA 4ODKA 4DWSD 2MLZA 3MDYB 4C02B 1FKTA 3WD4A 1W1VA 2M2AA 2PN0A 1XRVA 3FY1A 3O5LA 4G50A 4P8VA 2XP7A 1E6PA 3UI4A 2L2SA 1O6IA 3RM9A 2B5UB 2DSVA 2KGJA 5DO2A 1P5QA 2JZVA 1NWTA 4ODLA 1RD6A 3O5MA 5HUAA 2A3EA 3IKDA 1HKJA 5D75A 1H0GA 4ZPTR 1EDQA 1T11A 2A3BA 3IHZA 4MNLA 4W5UA 2OFNA 4QT2A 4WKHA 3AS2A 1W1YA 3OA5A 2N87A 4P8WA 4KR0B 1K9TA 2F21A 2ETNA 3ARWA 1XHGA 2IUZA 1ZBKA 2ZQTA 3JYJA 2YBUA 4DRKA 2AWGA 2ZQSA 3O5IA 1FKHA 2Q5AA 2UZ5A 1E6ZA 1QPFA 1X6NA 5DIVA 1HKKA 2OLHA 2WM0A 1KFWA 1Q6UA 3PRAA 2IF4A 4IT6A 2WK2A 4IQCA 1R9HA 5GPRA 2ESCA 1HJVA 3AS3A 4DZ3A 1VF8A 3ARVA 3CHEA 2KE0A 5JH8A 1FD9A 4L3NA 3ALGA 1FJDA 1D6OA 4IT4A 1ZU8A 1Q6IA 1WAWA 3KADA 3NTPA 4JFJA 1FAPA 1FKLA 5DEZA 5HWCA 1EQ3A 4MNKA 4S3KA 3QOKA 4JFKA 3JXVA 3O5PA 1M5YA 4W9OA 3B9AA 4ODOA 3AQUA 5HT1A 1JCHB 1GRJA 3TCZA 1D7HA 2MLXA 3ARQA 4DRMA 4DZ2A 2LJ4A 1FKKA 2PPNA 5HWBA 2XP5A 2LPVA 2WLZA 4WK9A 3WD3A 3KABA 2ZR4A 2DG9A 2PPOA 4MNJA 5HW8A 3B7XA 5B8IC 5HW7A 3FAPA 2AOSA 4DRJA 1HXVA 1LJYA 2KI3A 4J4OA 2A3AA 2ZQVA 5DITA 1LG1A 2FKEA 2G41A 1BL4A 4ODQA 3RGCA 4U84A 1D7IA 1E15A 4JFMA 3UQIA 1LL7A 1ZBWA 2M1IA 1JNEA 1FKRA 4Z2HA 2XPBA 1OGGA 3UF8A 4DWSC 4DH0A 3IKGA 3CHFA 3PR9A 4N19A 2LGOA 4DWSA 3O5RA 3UI6A 1Q6HA 2RUDA 1Y0OA 2DG4A 1FKFA 4TW7A 4ZPWR 1ITXA 2PV2A 4DRQA 2K8IA 4TYOA 3UI5A 4MPKA 3B9EA 5HW6A 1SYTA 1TFVA 1E44A 2MPHA 2Y78A 4GIVA 4TW8A 2F23A 2XP3A 1BKFA 3G6MA 2A3CA 2RUQA 3ALFA
chains in the Genus database with same CATH topology
1ROUA 3O5JA 3KAIA 1UR9A 1HJWA 1LL4A 1UR8A 2XP4A 3NI6A 4NSBA 3RM4A 1JVWA 4DROA 5HBFA 2MF9A 4IQ2A 2D9FA 3WL0A 1YW5A 2XP6A 1U79A 5HKGA 4GGQA 4FN2A 3RM8A 1B6CA 1W26A 3ARPA 4ZS6A 4ODPA 3KACA 2MLYA 4ODNA 1PINA 4Q22A 3B9DA 2DSZA 4S3JA 1FFRA 1YATA 3TC5A 2PI6A 1FKDA 3PRDA 3ARSA 4HBOA 5HTGA 3TDBA 3WD2A 1QZ2A 2B31A 4U85A 3CGNA 1HKIA 1FKJA 3WIJA 4R5EA 2DT0A 5BXJA 4HARA 4HBEA 2LKNA 1FKIA 4LAWA 4LGXA 2KO7A 3ODKA 3CHDA 3KCEA 4G2PA 1Q1CA 4FAPA 1TCOC 1KT0A 1ZB5A 4ZPVR 3LUOA 3OOBA 4W9PA 1KT1A 1D2KA 1W9UA 1A7XA 4DT4A 1QPLA 3W4RA 1HJXA 3CHCA 1J4RA 3ARZA 2PV1A 2RQSA 3RFWA 1LG2A 2WLYA 4XAKA 1WNOA 4Z2GA 3VAWA 4WKFA 3ARXA 4QIBA 3CH9A 4DRPA 1EYMA 4MAVA 4NNRA 1ROTA 3UQBA 4JFLA 2DSUA 3PRBA 4L72B 1GPFA 2DSWA 4TNSA 4W9QA 3WH0A 3AS0A 1W1PA 3GPKA 3WL1A 4BF8A 3AS1A 2XP9A 3WQVA 3WKZA 3AROA 3WD1A 1N1AA 1SR0A 1E9LA 2PPPA 1CTNA 2YBTA 5J6EA 3JYMA 4IPXA 2ZR6A 1J4IA 3KAFA 1FKSA 1NH6A 3O5FA 1J6YA 2FDMA 4DRNA 4Z2JA 1NWSA 2PV3A 3ARRA 4QT3A 1NMVA 1HKMA 3O5QA 3O5DA 2RUCA 1FKBA 3O5GA 4O2TA 4ODMA 2KFWA 3EY6A 1E6NA 3I6CA 1X6LA 3PA7A 4R0XA 3KAHA 1ZBVA 4ML4A 1E6RA 2XP8A 2ZQUA 1GUVA 2RURA 2RSEA 3H9RB 4P8XA 1D7JA 1F8AB 4Q7NA 3NRKA 4URIA 3ARUA 2M08A 2O9OA 4MGVA 5DF0A 1ZK6A 1FFQA 4LAXA 4PTMA 4DWSB 4Z2KA 2QF8A 2VCDA 2MNTA 3IK8A 1NWUA 1J4HA 2VN1A 3ARYA 3BXWA 4MSPA 3B8SA 2G8ZA 2F4EA 4DIPA 4Z2IA 3O5EA 1NMWA 1ZCNA 1C9HA 1JNSA 1IX5A 3CGMA 2PBCA 1FKGA 1W1TA 1LQ0A 1NWRA 1GOIA 2KR7A 2DT2A 1F40A 3KZ7A 4AY1A 4DRHA 1W9VA 5DIUA 2FAPA 5I98A 3RMEA 1LL6A 4U86A 1OWQA 4MTVA 4WIWA 4LAYA 2DT3A 5GPGA 2DT1A 3WD0A 3O5OA 3ARTA 3O5KA 1WB0A 1NSGA 1H0IA 2DPEA 2F2DA 4WKAA 3KAGA 4TX0A 2ITKA 3FXYA 2ZR5A 1PBKA 4MNMA 4ITZA 3CZ8A 1L1PA 4J4NA 4NZCA 3G6LA 4JFIA 4JYSA 5GQBA 1W9PA 4Z2LA 1OGBA 1EIBA 4TW6A 2DG3A 4LAVA 1EHNA 2XPAA 4QZVB 1JNTA 3WQWA 2O92A 1ZBCA 4KQZA 3UQAA 1ZL1A 4P8UA 1JNDA 4ODRA 4WJXA 4DRIA 4ODKA 4DWSD 2MLZA 3MDYB 4C02B 1FKTA 3WD4A 1W1VA 2M2AA 1XRVA 3FY1A 3O5LA 4G50A 4P8VA 2XP7A 1E6PA 3UI4A 2L2SA 1O6IA 3RM9A 2DSVA 2KGJA 5DO2A 1P5QA 2JZVA 1NWTA 4ODLA 1RD6A 3O5MA 5HUAA 2A3EA 3IKDA 1HKJA 5D75A 1H0GA 4ZPTR 1EDQA 1T11A 2A3BA 3IHZA 4MNLA 4W5UA 2OFNA 4QT2A 4WKHA 3AS2A 1W1YA 3OA5A 2N87A 4P8WA 4KR0B 1K9TA 2F21A 3ARWA 1XHGA 2IUZA 1ZBKA 2ZQTA 3JYJA 2YBUA 4DRKA 2AWGA 2ZQSA 3O5IA 1FKHA 2Q5AA 2UZ5A 1E6ZA 1QPFA 1X6NA 5DIVA 1HKKA 2OLHA 2WM0A 1KFWA 1Q6UA 3PRAA 2IF4A 4IT6A 2WK2A 4IQCA 1R9HA 5GPRA 2ESCA 1HJVA 3AS3A 4DZ3A 1VF8A 3ARVA 3CHEA 2KE0A 5JH8A 1FD9A 4L3NA 3ALGA 1FJDA 1D6OA 4IT4A 1ZU8A 1Q6IA 1WAWA 3KADA 3NTPA 4JFJA 1FAPA 1FKLA 5DEZA 5HWCA 1EQ3A 4MNKA 4S3KA 3QOKA 4JFKA 3JXVA 3O5PA 1M5YA 4W9OA 3B9AA 4ODOA 3AQUA 5HT1A 3TCZA 1D7HA 2MLXA 3ARQA 4DRMA 4DZ2A 2LJ4A 1FKKA 2PPNA 5HWBA 2XP5A 2LPVA 2WLZA 4WK9A 3WD3A 3KABA 2ZR4A 2DG9A 2PPOA 4MNJA 5HW8A 3B7XA 5B8IC 5HW7A 3FAPA 2AOSA 4DRJA 1HXVA 1LJYA 2KI3A 4J4OA 2A3AA 2ZQVA 5DITA 1LG1A 2FKEA 2G41A 1BL4A 4ODQA 3RGCA 4U84A 1D7IA 1E15A 4JFMA 3UQIA 1LL7A 1ZBWA 2M1IA 1JNEA 1FKRA 4Z2HA 2XPBA 1OGGA 3UF8A 4DWSC 4DH0A 3IKGA 3CHFA 3PR9A 4N19A 2LGOA 4DWSA 3O5RA 3UI6A 1Q6HA 2RUDA 1Y0OA 2DG4A 1FKFA 4TW7A 4ZPWR 1ITXA 2PV2A 4DRQA 2K8IA 4TYOA 3UI5A 4MPKA 3B9EA 5HW6A 1SYTA 1TFVA 2Y78A 2MPHA 4GIVA 4TW8A 2XP3A 1BKFA 3G6MA 2A3CA 2RUQA 3ALFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROU A;  3O5J A;  4ITZ A;  3KAI A;  1FJD A;  1D6O A;  1N1A A;  1L1P A;  4J4N A;  2PPP A;  2XP4 A;  3NI6 A;  1JVW A;  5J6E A;  1Q6I A;  3JYM A;  4DRO A;  4IPX A;  2MF9 A;  2ZR6 A;  2D9F A;  3KAD A;  3NTP A;  1FAP A;  4IQ2 A;  1J4I A;  1FKL A;  4JFI A;  1YW5 A;  4JFJ A;  4JYS A;  5HWC A;  1EQ3 A;  2XP6 A;  1U79 A;  3KAF A;  1FKS A;  4FN2 A;  4GGQ A;  1B6C A;  3O5F A;  4JFK A;  1W26 A;  5HKG A;  3JXV A;  1J6Y A;  4TW6 A;  2DG3 A;  4LAV A;  3O5P A;  2XPA A;  4ODP A;  1M5Y A;  1JNT A;  3KAC A;  4DRN A;  2MLY A;  4W9O A;  4ODO A;  2PV3 A;  5HT1 A;  3UQA A;  4ODN A;  1PIN A;  1D7H A;  3TCZ A;  4QT3 A;  2MLX A;  1NMV A;  4DRM A;  4DZ2 A;  4ODR A;  2LJ4 A;  1FKK A;  4DRI A;  1YAT A;  3O5Q A;  4ODK A;  2PPN A;  2MLZ A;  2XP5 A;  2LPV A;  1FKT A;  2RUC A;  3MDY B;  3KAB A;  2ZR4 A;  3O5D A;  4C02 B;  1FKB A;  2DG9 A;  3PRD A;  1FKD A;  2PPO A;  2M2A A;  3O5G A;  5HTG A;  4O2T A;  5HW8 A;  3B7X A;  5B8I C;  4ODM A;  3TDB A;  5HW7 A;  3FAP A;  2KFW A;  3EY6 A;  3I6C A;  4DRJ A;  3O5L A;  1QZ2 A;  3PA7 A;  3KAH A;  4G50 A;  4R0X A;  1HXV A;  2XP7 A;  2ZQU A;  2XP8 A;  2RUR A;  2RSE A;  4U85 A;  3UI4 A;  2L2S A;  2KI3 A;  3CGN A;  3H9R B;  1D7J A;  4J4O A;  1FKJ A;  2KGJ A;  1P5Q A;  2JZV A;  1F8A B;  3NRK A;  2ZQV A;  5DIT A;  5BXJ A;  2LKN A;  2M08 A;  4ODL A;  3O5M A;  5HUA A;  1FKI A;  3IKD A;  5D75 A;  4MGV A;  1ZK6 A;  4LAW A;  2FKE A;  4LAX A;  1BL4 A;  4ODQ A;  2VCD A;  2MNT A;  3IK8 A;  4U84 A;  2KO7 A;  3ODK A;  1D7I A;  3RGC A;  1T11 A;  1J4H A;  3IHZ A;  2RUQ A;  3KCE A;  4G2P A;  4JFM A;  3UQI A;  1Q1C A;  2VN1 A;  2OFN A;  4QT2 A;  4FAP A;  4MSP A;  2M1I A;  1TCO C;  1KT0 A;  1FKR A;  2N87 A;  3LUO A;  2F4E A;  4DIP A;  2XPB A;  3O5E A;  1NMW A;  3UF8 A;  3OOB A;  4W9P A;  2F21 A;  4DH0 A;  1KT1 A;  1ZCN A;  3IKG A;  4DT4 A;  1A7X A;  1QPL A;  2ZR5 A;  1C9H A;  4N19 A;  2LGO A;  1JNS A;  3JYJ A;  2ZQT A;  1J4R A;  3O5R A;  4DRK A;  2AWG A;  3UI6 A;  1Q6H A;  2PV1 A;  2RQS A;  2RUD A;  2ZQS A;  3CGM A;  1FKH A;  3O5I A;  1Y0O A;  2DG4 A;  3RFW A;  1FKF A;  2PBC A;  2Q5A A;  4TW7 A;  1FKG A;  2UZ5 A;  2PV2 A;  1QPF A;  1FD9 A;  2KR7 A;  4DRQ A;  3VAW A;  2K8I A;  4TYO A;  1F40 A;  3UI5 A;  3KZ7 A;  4QIB A;  5DIV A;  4DRH A;  4DRP A;  5HW6 A;  1Q6U A;  1EYM A;  5DIU A;  4NNR A;  2Y78 A;  2FAP A;  2MPH A;  3TC5 A;  5I98 A;  1ROT A;  2IF4 A;  4GIV A;  4TW8 A;  3UQB A;  4IQC A;  1R9H A;  4U86 A;  4JFL A;  3PRB A;  2XP3 A;  4LAY A;  5GPG A;  4TNS A;  1BKF A;  3O5O A;  4W9Q A;  3WH0 A;  4DZ3 A;  3O5K A;  2KE0 A;  1NSG A;  2F2D A;  3GPK A;  5HWB A;  4BF8 A;  3KAG A;  4TX0 A;  2ITK A;  2XP9 A;  1PBK A; 
#chains in the Genus database with same CATH topology
 1ROU A;  3O5J A;  3KAI A;  1UR9 A;  1HJW A;  1LL4 A;  1UR8 A;  2XP4 A;  3NI6 A;  4NSB A;  3RM4 A;  1JVW A;  4DRO A;  5HBF A;  2MF9 A;  4IQ2 A;  2D9F A;  3WL0 A;  1YW5 A;  2XP6 A;  1U79 A;  5HKG A;  4GGQ A;  4FN2 A;  3RM8 A;  1B6C A;  1W26 A;  3ARP A;  4ZS6 A;  4ODP A;  3KAC A;  2MLY A;  3EIP A;  4ODN A;  1PIN A;  4Q22 A;  3B9D A;  2DSZ A;  4S3J A;  1FFR A;  1YAT A;  3TC5 A;  2PI6 A;  1FKD A;  3PRD A;  2P4V A;  3ARS A;  4HBO A;  5HTG A;  3TDB A;  3WD2 A;  1QZ2 A;  2B31 A;  4U85 A;  3CGN A;  1HKI A;  1FKJ A;  3WIJ A;  4R5E A;  2DT0 A;  5BXJ A;  4HAR A;  4HBE A;  2LKN A;  1FKI A;  4LAW A;  4LGX A;  2KO7 A;  3ODK A;  3CHD A;  3KCE A;  4G2P A;  1Q1C A;  4FAP A;  1TCO C;  1KT0 A;  1ZB5 A;  4ZPV R;  3LUO A;  3OOB A;  4W9P A;  1KT1 A;  1D2K A;  1W9U A;  1A7X A;  4DT4 A;  1QPL A;  3W4R A;  1HJX A;  3CHC A;  1J4R A;  3ARZ A;  2PV1 A;  2RQS A;  3RFW A;  1LG2 A;  2WLY A;  4XAK A;  1WNO A;  4Z2G A;  3VAW A;  4WKF A;  3ARX A;  4QIB A;  3CH9 A;  4DRP A;  1EYM A;  4MAV A;  4NNR A;  1ROT A;  3UQB A;  4JFL A;  2DSU A;  3PRB A;  4L72 B;  1GPF A;  2DSW A;  3BMB A;  4TNS A;  4W9Q A;  3WH0 A;  3AS0 A;  1W1P A;  3GPK A;  3WL1 A;  4BF8 A;  3AS1 A;  2XP9 A;  3WQV A;  3WKZ A;  3ARO A;  3WD1 A;  1N1A A;  1SR0 A;  1E9L A;  2PPP A;  1CTN A;  2YBT A;  5J6E A;  3JYM A;  4IPX A;  2ZR6 A;  1J4I A;  3KAF A;  1FKS A;  1NH6 A;  3O5F A;  1J6Y A;  2FDM A;  4DRN A;  4Z2J A;  1NWS A;  2PV3 A;  3ARR A;  4QT3 A;  1NMV A;  1HKM A;  3O5Q A;  3O5D A;  2RUC A;  1FKB A;  3O5G A;  4O2T A;  4ODM A;  2KFW A;  3EY6 A;  1E6N A;  3I6C A;  1X6L A;  3PA7 A;  4R0X A;  3KAH A;  1ZBV A;  4ML4 A;  1E6R A;  2XP8 A;  2ZQU A;  1GUV A;  2RUR A;  2RSE A;  3H9R B;  4P8X A;  1D7J A;  1F8A B;  4Q7N A;  3NRK A;  4URI A;  3ARU A;  2M08 A;  2O9O A;  4MGV A;  5DF0 A;  1ZK6 A;  1FFQ A;  4LAX A;  4PTM A;  4DWS B;  4Z2K A;  2QF8 A;  2VCD A;  2MNT A;  3IK8 A;  1NWU A;  1J4H A;  2VN1 A;  3ARY A;  3BXW A;  4MSP A;  3B8S A;  2G8Z A;  2F4E A;  4DIP A;  4Z2I A;  3O5E A;  1NMW A;  1ZCN A;  1C9H A;  1JNS A;  1IX5 A;  3GTY X;  3GU0 A;  3CGM A;  2EUL A;  2PBC A;  1FKG A;  1W1T A;  1LQ0 A;  1NWR A;  1GOI A;  2KR7 A;  2DT2 A;  1F40 A;  3KZ7 A;  4AY1 A;  4DRH A;  1W9V A;  5DIU A;  2FAP A;  5I98 A;  3RME A;  1LL6 A;  4U86 A;  1OWQ A;  4MTV A;  4WIW A;  4LAY A;  2DT3 A;  5GPG A;  2DT1 A;  3WD0 A;  3O5O A;  3ART A;  3O5K A;  1WB0 A;  1NSG A;  1H0I A;  2DPE A;  2F2D A;  4WKA A;  4UDM A;  3KAG A;  4TX0 A;  2ITK A;  3FXY A;  2ZR5 A;  1PBK A;  4MNM A;  4ITZ A;  3CZ8 A;  1L1P A;  4J4N A;  4NZC A;  3G6L A;  4JFI A;  4JYS A;  5GQB A;  1W9P A;  4Z2L A;  1OGB A;  1EIB A;  4TW6 A;  2DG3 A;  4LAV A;  1EHN A;  2XPA A;  4QZV B;  1JNT A;  3WQW A;  2O92 A;  1ZBC A;  4KQZ A;  3UQA A;  1ZL1 A;  4P8U A;  1JND A;  4ODR A;  4WJX A;  4DRI A;  4ODK A;  4DWS D;  2MLZ A;  3MDY B;  4C02 B;  1FKT A;  3WD4 A;  1W1V A;  2M2A A;  2PN0 A;  1XRV A;  3FY1 A;  3O5L A;  4G50 A;  4P8V A;  2XP7 A;  1E6P A;  3UI4 A;  2L2S A;  1O6I A;  3RM9 A;  2B5U B;  2DSV A;  2KGJ A;  5DO2 A;  1P5Q A;  2JZV A;  1NWT A;  4ODL A;  1RD6 A;  3O5M A;  5HUA A;  2A3E A;  3IKD A;  1HKJ A;  5D75 A;  1H0G A;  4ZPT R;  1EDQ A;  1T11 A;  2A3B A;  3IHZ A;  4MNL A;  4W5U A;  2OFN A;  4QT2 A;  4WKH A;  3AS2 A;  1W1Y A;  3OA5 A;  2N87 A;  4P8W A;  4KR0 B;  1K9T A;  2F21 A;  2ETN A;  3ARW A;  1XHG A;  2IUZ A;  1ZBK A;  2ZQT A;  3JYJ A;  2YBU A;  4DRK A;  2AWG A;  2ZQS A;  3O5I A;  1FKH A;  2Q5A A;  2UZ5 A;  1E6Z A;  1QPF A;  1X6N A;  5DIV A;  1HKK A;  2OLH A;  2WM0 A;  1KFW A;  1Q6U A;  3PRA A;  2IF4 A;  4IT6 A;  2WK2 A;  4IQC A;  1R9H A;  5GPR A;  2ESC A;  1HJV A;  3AS3 A;  4DZ3 A;  1VF8 A;  3ARV A;  3CHE A;  2KE0 A;  5JH8 A;  1FD9 A;  4L3N A;  3ALG A;  1FJD A;  1D6O A;  4IT4 A;  1ZU8 A;  1Q6I A;  1WAW A;  3KAD A;  3NTP A;  4JFJ A;  1FAP A;  1FKL A;  5DEZ A;  5HWC A;  1EQ3 A;  4MNK A;  4S3K A;  3QOK A;  4JFK A;  3JXV A;  3O5P A;  1M5Y A;  4W9O A;  3B9A A;  4ODO A;  3AQU A;  5HT1 A;  1JCH B;  1GRJ A;  3TCZ A;  1D7H A;  2MLX A;  3ARQ A;  4DRM A;  4DZ2 A;  2LJ4 A;  1FKK A;  2PPN A;  5HWB A;  2XP5 A;  2LPV A;  2WLZ A;  4WK9 A;  3WD3 A;  3KAB A;  2ZR4 A;  2DG9 A;  2PPO A;  4MNJ A;  5HW8 A;  3B7X A;  5B8I C;  5HW7 A;  3FAP A;  2AOS A;  4DRJ A;  1HXV A;  1LJY A;  2KI3 A;  4J4O A;  2A3A A;  2ZQV A;  5DIT A;  1LG1 A;  2FKE A;  2G41 A;  1BL4 A;  4ODQ A;  3RGC A;  4U84 A;  1D7I A;  1E15 A;  4JFM A;  3UQI A;  1LL7 A;  1ZBW A;  2M1I A;  1JNE A;  1FKR A;  4Z2H A;  2XPB A;  1OGG A;  3UF8 A;  4DWS C;  4DH0 A;  3IKG A;  3CHF A;  3PR9 A;  4N19 A;  2LGO A;  4DWS A;  3O5R A;  3UI6 A;  1Q6H A;  2RUD A;  1Y0O A;  2DG4 A;  1FKF A;  4TW7 A;  4ZPW R;  1ITX A;  2PV2 A;  4DRQ A;  2K8I A;  4TYO A;  3UI5 A;  4MPK A;  3B9E A;  5HW6 A;  1SYT A;  1TFV A;  1E44 A;  2MPH A;  2Y78 A;  4GIV A;  4TW8 A;  2F23 A;  2XP3 A;  1BKF A;  3G6M A;  2A3C A;  2RUQ A;  3ALF A; 
#chains in the Genus database with same CATH homology
 1ROU A;  3O5J A;  3KAI A;  1UR9 A;  1HJW A;  1LL4 A;  1UR8 A;  2XP4 A;  3NI6 A;  4NSB A;  3RM4 A;  1JVW A;  4DRO A;  5HBF A;  2MF9 A;  4IQ2 A;  2D9F A;  3WL0 A;  1YW5 A;  2XP6 A;  1U79 A;  5HKG A;  4GGQ A;  4FN2 A;  3RM8 A;  1B6C A;  1W26 A;  3ARP A;  4ZS6 A;  4ODP A;  3KAC A;  2MLY A;  4ODN A;  1PIN A;  4Q22 A;  3B9D A;  2DSZ A;  4S3J A;  1FFR A;  1YAT A;  3TC5 A;  2PI6 A;  1FKD A;  3PRD A;  3ARS A;  4HBO A;  5HTG A;  3TDB A;  3WD2 A;  1QZ2 A;  2B31 A;  4U85 A;  3CGN A;  1HKI A;  1FKJ A;  3WIJ A;  4R5E A;  2DT0 A;  5BXJ A;  4HAR A;  4HBE A;  2LKN A;  1FKI A;  4LAW A;  4LGX A;  2KO7 A;  3ODK A;  3CHD A;  3KCE A;  4G2P A;  1Q1C A;  4FAP A;  1TCO C;  1KT0 A;  1ZB5 A;  4ZPV R;  3LUO A;  3OOB A;  4W9P A;  1KT1 A;  1D2K A;  1W9U A;  1A7X A;  4DT4 A;  1QPL A;  3W4R A;  1HJX A;  3CHC A;  1J4R A;  3ARZ A;  2PV1 A;  2RQS A;  3RFW A;  1LG2 A;  2WLY A;  4XAK A;  1WNO A;  4Z2G A;  3VAW A;  4WKF A;  3ARX A;  4QIB A;  3CH9 A;  4DRP A;  1EYM A;  4MAV A;  4NNR A;  1ROT A;  3UQB A;  4JFL A;  2DSU A;  3PRB A;  4L72 B;  1GPF A;  2DSW A;  4TNS A;  4W9Q A;  3WH0 A;  3AS0 A;  1W1P A;  3GPK A;  3WL1 A;  4BF8 A;  3AS1 A;  2XP9 A;  3WQV A;  3WKZ A;  3ARO A;  3WD1 A;  1N1A A;  1SR0 A;  1E9L A;  2PPP A;  1CTN A;  2YBT A;  5J6E A;  3JYM A;  4IPX A;  2ZR6 A;  1J4I A;  3KAF A;  1FKS A;  1NH6 A;  3O5F A;  1J6Y A;  2FDM A;  4DRN A;  4Z2J A;  1NWS A;  2PV3 A;  3ARR A;  4QT3 A;  1NMV A;  1HKM A;  3O5Q A;  3O5D A;  2RUC A;  1FKB A;  3O5G A;  4O2T A;  4ODM A;  2KFW A;  3EY6 A;  1E6N A;  3I6C A;  1X6L A;  3PA7 A;  4R0X A;  3KAH A;  1ZBV A;  4ML4 A;  1E6R A;  2XP8 A;  2ZQU A;  1GUV A;  2RUR A;  2RSE A;  3H9R B;  4P8X A;  1D7J A;  1F8A B;  4Q7N A;  3NRK A;  4URI A;  3ARU A;  2M08 A;  2O9O A;  4MGV A;  5DF0 A;  1ZK6 A;  1FFQ A;  4LAX A;  4PTM A;  4DWS B;  4Z2K A;  2QF8 A;  2VCD A;  2MNT A;  3IK8 A;  1NWU A;  1J4H A;  2VN1 A;  3ARY A;  3BXW A;  4MSP A;  3B8S A;  2G8Z A;  2F4E A;  4DIP A;  4Z2I A;  3O5E A;  1NMW A;  1ZCN A;  1C9H A;  1JNS A;  1IX5 A;  3CGM A;  2PBC A;  1FKG A;  1W1T A;  1LQ0 A;  1NWR A;  1GOI A;  2KR7 A;  2DT2 A;  1F40 A;  3KZ7 A;  4AY1 A;  4DRH A;  1W9V A;  5DIU A;  2FAP A;  5I98 A;  3RME A;  1LL6 A;  4U86 A;  1OWQ A;  4MTV A;  4WIW A;  4LAY A;  2DT3 A;  5GPG A;  2DT1 A;  3WD0 A;  3O5O A;  3ART A;  3O5K A;  1WB0 A;  1NSG A;  1H0I A;  2DPE A;  2F2D A;  4WKA A;  3KAG A;  4TX0 A;  2ITK A;  3FXY A;  2ZR5 A;  1PBK A;  4MNM A;  4ITZ A;  3CZ8 A;  1L1P A;  4J4N A;  4NZC A;  3G6L A;  4JFI A;  4JYS A;  5GQB A;  1W9P A;  4Z2L A;  1OGB A;  1EIB A;  4TW6 A;  2DG3 A;  4LAV A;  1EHN A;  2XPA A;  4QZV B;  1JNT A;  3WQW A;  2O92 A;  1ZBC A;  4KQZ A;  3UQA A;  1ZL1 A;  4P8U A;  1JND A;  4ODR A;  4WJX A;  4DRI A;  4ODK A;  4DWS D;  2MLZ A;  3MDY B;  4C02 B;  1FKT A;  3WD4 A;  1W1V A;  2M2A A;  1XRV A;  3FY1 A;  3O5L A;  4G50 A;  4P8V A;  2XP7 A;  1E6P A;  3UI4 A;  2L2S A;  1O6I A;  3RM9 A;  2DSV A;  2KGJ A;  5DO2 A;  1P5Q A;  2JZV A;  1NWT A;  4ODL A;  1RD6 A;  3O5M A;  5HUA A;  2A3E A;  3IKD A;  1HKJ A;  5D75 A;  1H0G A;  4ZPT R;  1EDQ A;  1T11 A;  2A3B A;  3IHZ A;  4MNL A;  4W5U A;  2OFN A;  4QT2 A;  4WKH A;  3AS2 A;  1W1Y A;  3OA5 A;  2N87 A;  4P8W A;  4KR0 B;  1K9T A;  2F21 A;  3ARW A;  1XHG A;  2IUZ A;  1ZBK A;  2ZQT A;  3JYJ A;  2YBU A;  4DRK A;  2AWG A;  2ZQS A;  3O5I A;  1FKH A;  2Q5A A;  2UZ5 A;  1E6Z A;  1QPF A;  1X6N A;  5DIV A;  1HKK A;  2OLH A;  2WM0 A;  1KFW A;  1Q6U A;  3PRA A;  2IF4 A;  4IT6 A;  2WK2 A;  4IQC A;  1R9H A;  5GPR A;  2ESC A;  1HJV A;  3AS3 A;  4DZ3 A;  1VF8 A;  3ARV A;  3CHE A;  2KE0 A;  5JH8 A;  1FD9 A;  4L3N A;  3ALG A;  1FJD A;  1D6O A;  4IT4 A;  1ZU8 A;  1Q6I A;  1WAW A;  3KAD A;  3NTP A;  4JFJ A;  1FAP A;  1FKL A;  5DEZ A;  5HWC A;  1EQ3 A;  4MNK A;  4S3K A;  3QOK A;  4JFK A;  3JXV A;  3O5P A;  1M5Y A;  4W9O A;  3B9A A;  4ODO A;  3AQU A;  5HT1 A;  3TCZ A;  1D7H A;  2MLX A;  3ARQ A;  4DRM A;  4DZ2 A;  2LJ4 A;  1FKK A;  2PPN A;  5HWB A;  2XP5 A;  2LPV A;  2WLZ A;  4WK9 A;  3WD3 A;  3KAB A;  2ZR4 A;  2DG9 A;  2PPO A;  4MNJ A;  5HW8 A;  3B7X A;  5B8I C;  5HW7 A;  3FAP A;  2AOS A;  4DRJ A;  1HXV A;  1LJY A;  2KI3 A;  4J4O A;  2A3A A;  2ZQV A;  5DIT A;  1LG1 A;  2FKE A;  2G41 A;  1BL4 A;  4ODQ A;  3RGC A;  4U84 A;  1D7I A;  1E15 A;  4JFM A;  3UQI A;  1LL7 A;  1ZBW A;  2M1I A;  1JNE A;  1FKR A;  4Z2H A;  2XPB A;  1OGG A;  3UF8 A;  4DWS C;  4DH0 A;  3IKG A;  3CHF A;  3PR9 A;  4N19 A;  2LGO A;  4DWS A;  3O5R A;  3UI6 A;  1Q6H A;  2RUD A;  1Y0O A;  2DG4 A;  1FKF A;  4TW7 A;  4ZPW R;  1ITX A;  2PV2 A;  4DRQ A;  2K8I A;  4TYO A;  3UI5 A;  4MPK A;  3B9E A;  5HW6 A;  1SYT A;  1TFV A;  2Y78 A;  2MPH A;  4GIV A;  4TW8 A;  2XP3 A;  1BKF A;  3G6M A;  2A3C A;  2RUQ A;  3ALF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...