5JH8A

Crystal structure of chitinase from chromobacterium violaceum atcc 12472
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
317
structure length
309
Chain Sequence
AAMVLAYYSGYAGNYAALTRYAASFNAVAVDFYNITAQGAVTGNGDPAPNDAISFLLGRIPAYGCVSNVDGNGNWSADIAHAVSTSAQSQAVANLVFAQDRFSGINVDFEAVAQGDRNNFSHFIQVLGRALHAKGLLIVSVPAFSADENHPANYGYDLRALGAAADYLQIMSYDEAIPAWDPGPVAGSDWMEDDLDYAVERVPAAKILNGIPAYGYDWRPGDGGMLYWDTQALIARYGAQPRYDAGTHSLTFNYGAADGSRHTVWTENARSVALKASLVNAYGLGGTSLYALGMEDDAFWAAVQGLAQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of chitinase from Chromobacterium violaceum ATCC 12472
rcsb
source organism Chromobacterium violaceum
molecule tags Hydrolase
molecule keywords Probable chitinase
total genus 101
structure length 309
sequence length 317
ec nomenclature
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5jh8A02
1NWSA 1TFVA 3B9DA 3CHFA 4WIWA 1HKJA 2AOSA 3WIJA 1E6PA 3AROA 3ARUA 1OGGA 4S3JA 3ALFA 3G6LA 1EHNA 1O6IA 3B9AA 5GPRA 3B9EA 3RM9A 1W1TA 3RMEA 1LL4A 4P8WA 1UR9A 3ARSA 1JNEA 3B8SA 1GOIA 3AS1A 3WKZA 1ZBWA 1ZBKA 4P8VA 2G41A 3ALGA 1VF8A 1H0IA 1CTNA 4WJXA 2DT3A 3ARWA 3AQUA 3AS3A 2DSWA 1HKMA 1HKIA 1D2KA 1WAWA 1SYTA 3ARVA 3WD2A 2G8ZA 1ZL1A 1NWUA 1W1PA 3OA5A 5DF0A 1XHGA 2WLZA 2YBTA 1X6LA 4DWSC 4W5UA 1FFRA 4Z2HA 1HJWA 5HBFA 3WD4A 2IUZA 3AS2A 4MNJA 2DT0A 3BXWA 1LL7A 3CHEA 3WQVA 4NZCA 1JNDA 4P8UA 4MNKA 3ARXA 1W9UA 3FY1A 4MNLA 4AY1A 2DSZA 4WKFA 2A3EA 1W1VA 4R5EA 2PI6A 4P8XA 4Z2LA 3ARRA 3CHDA 1W9PA 3FXYA 3ARQA 1E15A 5GQBA 1GPFA 3WD1A 4NSBA 1HJVA 3ARPA 3WD0A 1LJYA 4DWSA 1GUVA 1HJXA 1ZB5A 3WD3A 4DWSD 1E6NA 2DPEA 2A3AA 4MAVA 3ARYA 1EDQA 3QOKA 5DEZA 1ZBVA 2B31A 3W4RA 3ARTA 1H0GA 1OGBA 2A3BA 3G6MA 1E6ZA 2WK2A 2DSVA 3CHCA 1LG2A 2WM0A 4ML4A 1K9TA 5JH8A 3AS0A 4S3KA 3CH9A 1LL6A 2DT1A 2O92A 2QF8A 4URIA 3RM8A 1FFQA 4LGXA 4PTMA 1NWRA 1WNOA 1X6NA 1ZBCA 2YBUA 1E9LA 4WKHA 1ITXA 4Z2GA 1NWTA 4Q7NA 1KFWA 4MTVA 3WL0A 2O9OA 1EIBA 1E6RA 1XRVA 1NH6A 1UR8A 4MPKA 4Z2JA 2FDMA 1WB0A 1OWQA 1SR0A 4Z2KA 1HKKA 2A3CA 1LQ0A 4WKAA 3ARZA 4WK9A 1W1YA 2OLHA 4Z2IA 4MNMA 1RD6A 1W9VA 3WQWA 4Q22A 2ESCA 1LG1A 2DSUA 3WL1A 3CZ8A 3RM4A 2WLYA 4DWSB 1ZU8A 2DT2A
chains in the Genus database with same CATH superfamily
4JFIA 1TFVA 3CHFA 1W26A 1HKJA 2AOSA 4S3JA 5J6EA 5GPRA 3TC5A 2XP9A 4ZPTR 4P8WA 1JNEA 1YW5A 2UZ5A 4G2PA 3WKZA 2XPBA 3KAIA 2PV2A 2PPOA 1H0IA 4WJXA 2IF4A 5DITA 4ODNA 3AS3A 4LAVA 1ROUA 1WAWA 1ZL1A 1NWUA 1W1PA 3OA5A 2WLZA 4BF8A 3KAFA 4DWSC 5I98A 3PRDA 4QT3A 4W5UA 1FFRA 5GPGA 1QPLA 2XP3A 2KFWA 3BXWA 3CHEA 3WQVA 4NZCA 1F40A 4JYSA 4P8UA 2LJ4A 1W9UA 3FY1A 4TX0A 1BL4A 4WKFA 4R5EA 4P8XA 3ARRA 3EY6A 3JYJA 2ZQSA 4DROA 5GQBA 4U84A 4NSBA 1HJVA 4DRQA 2FAPA 1HJXA 1E6NA 2DPEA 1Q6IA 4ODQA 3ARYA 3IKGA 4HARA 4TNSA 3H9RB 4DRHA 4TW7A 4HBEA 3CHCA 2MLZA 2QF8A 4PTMA 2PV1A 1NWRA 4ODOA 3UQIA 1FKKA 3OOBA 2YBUA 1KT0A 4QT2A 4Z2JA 4DRIA 4QIBA 1WB0A 1OWQA 4DRNA 5HWCA 1T11A 1PINA 3UF8A 4G50A 4NNRA 2KI3A 2VN1A 4DH0A 2XP5A 2PPNA 5DIUA 2DSUA 3GTYX 3CZ8A 5HT1A 1ZU8A 2K8IA 1FKBA 2DT2A 4GIVA 3WH0A 4JFKA 3AROA 3ARUA 2Q5AA 3O5MA 1O6IA 1W1TA 1LL4A 3RFWA 5HTGA 3JXVA 5B8IC 3KABA 2XP7A 4O2TA 4P8VA 3UQBA 2G41A 1A7XA 4JFJA 1D6OA 2L2SA 4DRMA 4ODPA 3KACA 4QZVB 3AQUA 4DRKA 2DSWA 4R0XA 1FKLA 1D2KA 3RGCA 3WD2A 3ARVA 4IT6A 2G8ZA 4ZS6A 4U85A 4IQ2A 1HXVA 3GPKA 1NMWA 1FKRA 2DG4A 3VAWA 2Y78A 5HBFA 3WD4A 2IUZA 2AWGA 1LL7A 3PRBA 1Q6HA 1E44A 1EYMA 4DZ3A 2F4EA 4MNLA 5DO2A 2XP6A 1D7HA 1W1VA 2PI6A 2RQSA 4N19A 1W9PA 2N87A 2EULA 2RUDA 4GGQA 3TCZA 3NTPA 4IPXA 4DWSA 1GUVA 3KCEA 4DWSD 1ZCNA 1P5QA 2MF9A 2LGOA 5HW6A 2B31A 3W4RA 3TDBA 1H0GA 1E6ZA 2WK2A 2ZR5A 1K9TA 1B6CA 2XP8A 3AS0A 3O5FA 1FKJA 3CH9A 2PV3A 4URIA 4FAPA 1FFQA 4TW6A 1WNOA 1ZBCA 1E9LA 1ITXA 4DZ2A 3WL0A 4XAKA 1YATA 1E6RA 1XRVA 1UR8A 2FDMA 1JVWA 5BXJA 1J4RA 2ETNA 3O5JA 3ARZA 3ODKA 2OLHA 4Z2IA 1F8AB 2F2DA 4TW8A 3WQWA 1W9VA 1LG1A 2RURA 4DWSB 4LAYA 3IKDA 3O5LA 3JYMA 2JZVA 4WIWA 1E6PA 3ALFA 3G6LA 1EHNA 3KAGA 3RM9A 3ARSA 1M5YA 4ODLA 1GOIA 2F21A 1ZBKA 1PBKA 2ZR4A 1TCOC 3KAHA 2DT3A 3NRKA 3LUOA 1FKTA 1SYTA 3O5KA 3O5PA 1XHGA 2YBTA 1X6LA 1R9HA 3O5EA 2ITKA 4IQCA 2KO7A 2DT0A 1Q1CA 4LAXA 3IHZA 4KR0B 4JFMA 3I6CA 3UQAA 5HKGA 1FKFA 2A3EA 4IT4A 3CHDA 1FKGA 3ARQA 1E15A 1GPFA 3ARPA 2FKEA 3WD0A 1LJYA 2LKNA 2XP4A 4ODMA 2F23A 1ZB5A 3O5OA 1BKFA 1NSGA 4JFLA 3EIPA 1EDQA 3QOKA 1Y0OA 5HW8A 1GRJA 3G6MA 2WM0A 1ROTA 5JH8A 3O5GA 4S3KA 1LL6A 4MGVA 2O92A 4W9QA 1IX5A 4LGXA 4TYOA 1X6NA 3NI6A 4Z2GA 5HUAA 1NWTA 3UI4A 4Q7NA 1KFWA 4MTVA 3CGMA 1FKDA 1NH6A 2MLYA 1FJDA 2A3CA 5DIVA 2XPAA 4MNMA 4UDMA 1D7JA 2ZQUA 2M2AA 3WL1A 3RM4A 2WLYA 4W9PA 2ZQTA 1Q6UA 1J4HA 1NWSA 3B9DA 4ODKA 2KGJA 3WIJA 2D9FA 3KZ7A 4MSPA 2M1IA 1OGGA 4L72B 3B9AA 3B9EA 3RMEA 2RSEA 1NMVA 1UR9A 4ITZA 1FD9A 3B8SA 3AS1A 3O5RA 2PBCA 1ZBWA 3O5IA 3ALGA 4DRJA 1VF8A 1FKHA 3UI5A 1L1PA 1CTNA 1QZ2A 1FKIA 4L3NA 3ARWA 2B5UB 2DG3A 1HKMA 4J4OA 3O5QA 1HKIA 2RUQA 2PPPA 2P4VA 4J4NA 3PA7A 1C9HA 5DF0A 4C02B 4DRPA 4Z2HA 4ODRA 1HJWA 3AS2A 4MNJA 4ZPWR 5HW7A 1U79A 1EQ3A 1JNDA 1JNSA 4MNKA 3ARXA 2M08A 2RUCA 1QPFA 4AY1A 2DSZA 2OFNA 4Z2LA 3FXYA 1D7IA 3PRAA 3WD1A 3IK8A 1JCHB 4KQZA 3WD3A 2MLXA 2VCDA 1KT1A 3PR9A 5D75A 2A3AA 4MAVA 2KR7A 2DG9A 3GU0A 5DEZA 1ZBVA 2MNTA 1JNTA 3ARTA 4ZPVR 3BMBA 1OGBA 2A3BA 2DSVA 1LG2A 4ML4A 2LPVA 2PN0A 3O5DA 2DT1A 2ZR6A 3FAPA 3KADA 4FN2A 3RM8A 4DT4A 4HBOA 4WKHA 2KE0A 4U86A 1FAPA 1J6YA 2O9OA 1EIBA 2ZQVA 4MPKA 1SR0A 3UI6A 1ZK6A 3MDYB 4Z2KA 1HKKA 1FKSA 5HWBA 1LQ0A 4WKAA 4WK9A 1W1YA 3B7XA 1RD6A 3CGNA 4Q22A 2ESCA 2MPHA 4W9OA 1J4IA 4LAWA 4DIPA 1N1AA
chains in the Genus database with same CATH topology
4JFIA 1TFVA 3CHFA 1W26A 1HKJA 2AOSA 4S3JA 5J6EA 5GPRA 3TC5A 2XP9A 4ZPTR 4P8WA 1JNEA 1YW5A 2UZ5A 4G2PA 3WKZA 2XPBA 3KAIA 2PV2A 2PPOA 1H0IA 4WJXA 2IF4A 5DITA 4ODNA 3AS3A 4LAVA 1ROUA 1WAWA 1ZL1A 1NWUA 1W1PA 3OA5A 2WLZA 4BF8A 3KAFA 4DWSC 5I98A 3PRDA 4QT3A 4W5UA 1FFRA 5GPGA 1QPLA 2XP3A 2KFWA 3BXWA 3CHEA 3WQVA 4NZCA 1F40A 4JYSA 4P8UA 2LJ4A 1W9UA 3FY1A 4TX0A 1BL4A 4WKFA 4R5EA 4P8XA 3ARRA 3EY6A 3JYJA 2ZQSA 4DROA 5GQBA 4U84A 4NSBA 1HJVA 4DRQA 2FAPA 1HJXA 1E6NA 2DPEA 1Q6IA 4ODQA 3ARYA 3IKGA 4HARA 4TNSA 3H9RB 4DRHA 4TW7A 4HBEA 3CHCA 2MLZA 2QF8A 4PTMA 2PV1A 1NWRA 4ODOA 3UQIA 1FKKA 3OOBA 2YBUA 1KT0A 4QT2A 4Z2JA 4DRIA 4QIBA 1WB0A 1OWQA 4DRNA 5HWCA 1T11A 1PINA 3UF8A 4G50A 4NNRA 2KI3A 2VN1A 4DH0A 2XP5A 2PPNA 5DIUA 2DSUA 3CZ8A 5HT1A 1ZU8A 2K8IA 1FKBA 2DT2A 4GIVA 3WH0A 4JFKA 3AROA 3ARUA 2Q5AA 3O5MA 1O6IA 1W1TA 1LL4A 3RFWA 5HTGA 3JXVA 5B8IC 3KABA 2XP7A 4O2TA 4P8VA 3UQBA 2G41A 1A7XA 4JFJA 1D6OA 2L2SA 4DRMA 4ODPA 3KACA 4QZVB 3AQUA 4DRKA 2DSWA 4R0XA 1FKLA 1D2KA 3RGCA 3WD2A 3ARVA 4IT6A 2G8ZA 4ZS6A 4U85A 4IQ2A 1HXVA 3GPKA 1NMWA 1FKRA 2DG4A 3VAWA 2Y78A 5HBFA 3WD4A 2IUZA 2AWGA 1LL7A 3PRBA 1Q6HA 1EYMA 4DZ3A 2F4EA 4MNLA 5DO2A 2XP6A 1D7HA 1W1VA 2PI6A 2RQSA 4N19A 1W9PA 2N87A 2RUDA 4GGQA 3TCZA 3NTPA 4IPXA 4DWSA 1GUVA 3KCEA 4DWSD 1ZCNA 1P5QA 2MF9A 2LGOA 5HW6A 2B31A 3W4RA 3TDBA 1H0GA 1E6ZA 2WK2A 2ZR5A 1K9TA 1B6CA 2XP8A 3AS0A 3O5FA 1FKJA 3CH9A 2PV3A 4URIA 4FAPA 1FFQA 4TW6A 1WNOA 1ZBCA 1E9LA 1ITXA 4DZ2A 3WL0A 4XAKA 1YATA 1E6RA 1XRVA 1UR8A 2FDMA 1JVWA 5BXJA 1J4RA 3O5JA 3ARZA 3ODKA 2OLHA 4Z2IA 1F8AB 2F2DA 4TW8A 3WQWA 1W9VA 1LG1A 2RURA 4DWSB 4LAYA 3IKDA 3O5LA 3JYMA 2JZVA 4WIWA 1E6PA 3ALFA 3G6LA 1EHNA 3KAGA 3RM9A 3ARSA 1M5YA 4ODLA 1GOIA 2F21A 1ZBKA 1PBKA 2ZR4A 1TCOC 3KAHA 2DT3A 3NRKA 3LUOA 1FKTA 1SYTA 3O5KA 3O5PA 1XHGA 2YBTA 1X6LA 1R9HA 3O5EA 2ITKA 4IQCA 2KO7A 2DT0A 1Q1CA 4LAXA 3IHZA 4KR0B 4JFMA 3I6CA 3UQAA 5HKGA 1FKFA 2A3EA 4IT4A 3CHDA 1FKGA 3ARQA 1E15A 1GPFA 3ARPA 2FKEA 3WD0A 1LJYA 2LKNA 2XP4A 4ODMA 1ZB5A 3O5OA 1BKFA 1NSGA 4JFLA 1EDQA 3QOKA 1Y0OA 5HW8A 3G6MA 2WM0A 1ROTA 5JH8A 3O5GA 4S3KA 1LL6A 4MGVA 2O92A 4W9QA 1IX5A 4LGXA 4TYOA 1X6NA 3NI6A 4Z2GA 5HUAA 1NWTA 3UI4A 4Q7NA 1KFWA 4MTVA 3CGMA 1FKDA 1NH6A 2MLYA 1FJDA 2A3CA 5DIVA 2XPAA 4MNMA 1D7JA 2ZQUA 2M2AA 3WL1A 3RM4A 2WLYA 4W9PA 2ZQTA 1Q6UA 1J4HA 1NWSA 3B9DA 4ODKA 2KGJA 3WIJA 2D9FA 3KZ7A 4MSPA 2M1IA 1OGGA 4L72B 3B9AA 3B9EA 3RMEA 2RSEA 1NMVA 1UR9A 4ITZA 1FD9A 3B8SA 3AS1A 3O5RA 2PBCA 1ZBWA 3O5IA 3ALGA 4DRJA 1VF8A 1FKHA 3UI5A 1L1PA 1CTNA 1QZ2A 1FKIA 4L3NA 3ARWA 2DG3A 1HKMA 4J4OA 3O5QA 1HKIA 2RUQA 2PPPA 4J4NA 3PA7A 1C9HA 5DF0A 4C02B 4DRPA 4Z2HA 4ODRA 1HJWA 3AS2A 4MNJA 4ZPWR 5HW7A 1U79A 1EQ3A 1JNDA 1JNSA 4MNKA 3ARXA 2M08A 2RUCA 1QPFA 4AY1A 2DSZA 2OFNA 4Z2LA 3FXYA 1D7IA 3PRAA 3WD1A 3IK8A 4KQZA 3WD3A 2MLXA 2VCDA 1KT1A 3PR9A 5D75A 2A3AA 4MAVA 2KR7A 2DG9A 5DEZA 1ZBVA 2MNTA 1JNTA 3ARTA 4ZPVR 1OGBA 2A3BA 2DSVA 1LG2A 4ML4A 2LPVA 3O5DA 2DT1A 2ZR6A 3FAPA 3KADA 4FN2A 3RM8A 4DT4A 4HBOA 4WKHA 2KE0A 4U86A 1FAPA 1J6YA 2O9OA 1EIBA 2ZQVA 4MPKA 1SR0A 3UI6A 1ZK6A 3MDYB 4Z2KA 1HKKA 1FKSA 5HWBA 1LQ0A 4WKAA 4WK9A 1W1YA 3B7XA 1RD6A 3CGNA 4Q22A 2ESCA 2MPHA 4W9OA 1J4IA 4LAWA 4DIPA 1N1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NWS A;  1TFV A;  3B9D A;  3CHF A;  4WIW A;  1HKJ A;  2AOS A;  3WIJ A;  1E6P A;  3ARO A;  3ARU A;  1OGG A;  4S3J A;  3ALF A;  3G6L A;  1EHN A;  1O6I A;  3B9A A;  5GPR A;  3B9E A;  3RM9 A;  1W1T A;  3RME A;  1LL4 A;  4P8W A;  1UR9 A;  3ARS A;  1JNE A;  3B8S A;  1GOI A;  3AS1 A;  3WKZ A;  1ZBW A;  1ZBK A;  4P8V A;  2G41 A;  3ALG A;  1VF8 A;  1H0I A;  1CTN A;  4WJX A;  2DT3 A;  3ARW A;  3AQU A;  3AS3 A;  2DSW A;  1HKM A;  1HKI A;  1D2K A;  1WAW A;  1SYT A;  3ARV A;  3WD2 A;  2G8Z A;  1ZL1 A;  1NWU A;  1W1P A;  3OA5 A;  5DF0 A;  1XHG A;  2WLZ A;  2YBT A;  1X6L A;  4DWS C;  4W5U A;  1FFR A;  4Z2H A;  1HJW A;  5HBF A;  3WD4 A;  2IUZ A;  3AS2 A;  4MNJ A;  2DT0 A;  3BXW A;  1LL7 A;  3CHE A;  3WQV A;  4NZC A;  1JND A;  4P8U A;  4MNK A;  3ARX A;  1W9U A;  3FY1 A;  4MNL A;  4AY1 A;  2DSZ A;  4WKF A;  2A3E A;  1W1V A;  4R5E A;  2PI6 A;  4P8X A;  4Z2L A;  3ARR A;  3CHD A;  1W9P A;  3FXY A;  3ARQ A;  1E15 A;  5GQB A;  1GPF A;  3WD1 A;  4NSB A;  1HJV A;  3ARP A;  3WD0 A;  1LJY A;  4DWS A;  1GUV A;  1HJX A;  1ZB5 A;  3WD3 A;  4DWS D;  1E6N A;  2DPE A;  2A3A A;  4MAV A;  3ARY A;  1EDQ A;  3QOK A;  5DEZ A;  1ZBV A;  2B31 A;  3W4R A;  3ART A;  1H0G A;  1OGB A;  2A3B A;  3G6M A;  1E6Z A;  2WK2 A;  2DSV A;  3CHC A;  1LG2 A;  2WM0 A;  4ML4 A;  1K9T A;  5JH8 A;  3AS0 A;  4S3K A;  3CH9 A;  1LL6 A;  2DT1 A;  2O92 A;  2QF8 A;  4URI A;  3RM8 A;  1FFQ A;  4LGX A;  4PTM A;  1NWR A;  1WNO A;  1X6N A;  1ZBC A;  2YBU A;  1E9L A;  4WKH A;  1ITX A;  4Z2G A;  1NWT A;  4Q7N A;  1KFW A;  4MTV A;  3WL0 A;  2O9O A;  1EIB A;  1E6R A;  1XRV A;  1NH6 A;  1UR8 A;  4MPK A;  4Z2J A;  2FDM A;  1WB0 A;  1OWQ A;  1SR0 A;  4Z2K A;  1HKK A;  2A3C A;  1LQ0 A;  4WKA A;  3ARZ A;  4WK9 A;  1W1Y A;  2OLH A;  4Z2I A;  4MNM A;  1RD6 A;  1W9V A;  3WQW A;  4Q22 A;  2ESC A;  1LG1 A;  2DSU A;  3WL1 A;  3CZ8 A;  3RM4 A;  2WLY A;  4DWS B;  1ZU8 A;  2DT2 A; 
#chains in the Genus database with same CATH topology
 4JFI A;  1TFV A;  3CHF A;  1W26 A;  1HKJ A;  2AOS A;  4S3J A;  5J6E A;  5GPR A;  3TC5 A;  2XP9 A;  4ZPT R;  4P8W A;  1JNE A;  1YW5 A;  2UZ5 A;  4G2P A;  3WKZ A;  2XPB A;  3KAI A;  2PV2 A;  2PPO A;  1H0I A;  4WJX A;  2IF4 A;  5DIT A;  4ODN A;  3AS3 A;  4LAV A;  1ROU A;  1WAW A;  1ZL1 A;  1NWU A;  1W1P A;  3OA5 A;  2WLZ A;  4BF8 A;  3KAF A;  4DWS C;  5I98 A;  3PRD A;  4QT3 A;  4W5U A;  1FFR A;  5GPG A;  1QPL A;  2XP3 A;  2KFW A;  3BXW A;  3CHE A;  3WQV A;  4NZC A;  1F40 A;  4JYS A;  4P8U A;  2LJ4 A;  1W9U A;  3FY1 A;  4TX0 A;  1BL4 A;  4WKF A;  4R5E A;  4P8X A;  3ARR A;  3EY6 A;  3JYJ A;  2ZQS A;  4DRO A;  5GQB A;  4U84 A;  4NSB A;  1HJV A;  4DRQ A;  2FAP A;  1HJX A;  1E6N A;  2DPE A;  1Q6I A;  4ODQ A;  3ARY A;  3IKG A;  4HAR A;  4TNS A;  3H9R B;  4DRH A;  4TW7 A;  4HBE A;  3CHC A;  2MLZ A;  2QF8 A;  4PTM A;  2PV1 A;  1NWR A;  4ODO A;  3UQI A;  1FKK A;  3OOB A;  2YBU A;  1KT0 A;  4QT2 A;  4Z2J A;  4DRI A;  4QIB A;  1WB0 A;  1OWQ A;  4DRN A;  5HWC A;  1T11 A;  1PIN A;  3UF8 A;  4G50 A;  4NNR A;  2KI3 A;  2VN1 A;  4DH0 A;  2XP5 A;  2PPN A;  5DIU A;  2DSU A;  3GTY X;  3CZ8 A;  5HT1 A;  1ZU8 A;  2K8I A;  1FKB A;  2DT2 A;  4GIV A;  3WH0 A;  4JFK A;  3ARO A;  3ARU A;  2Q5A A;  3O5M A;  1O6I A;  1W1T A;  1LL4 A;  3RFW A;  5HTG A;  3JXV A;  5B8I C;  3KAB A;  2XP7 A;  4O2T A;  4P8V A;  3UQB A;  2G41 A;  1A7X A;  4JFJ A;  1D6O A;  2L2S A;  4DRM A;  4ODP A;  3KAC A;  4QZV B;  3AQU A;  4DRK A;  2DSW A;  4R0X A;  1FKL A;  1D2K A;  3RGC A;  3WD2 A;  3ARV A;  4IT6 A;  2G8Z A;  4ZS6 A;  4U85 A;  4IQ2 A;  1HXV A;  3GPK A;  1NMW A;  1FKR A;  2DG4 A;  3VAW A;  2Y78 A;  5HBF A;  3WD4 A;  2IUZ A;  2AWG A;  1LL7 A;  3PRB A;  1Q6H A;  1E44 A;  1EYM A;  4DZ3 A;  2F4E A;  4MNL A;  5DO2 A;  2XP6 A;  1D7H A;  1W1V A;  2PI6 A;  2RQS A;  4N19 A;  1W9P A;  2N87 A;  2EUL A;  2RUD A;  4GGQ A;  3TCZ A;  3NTP A;  4IPX A;  4DWS A;  1GUV A;  3KCE A;  4DWS D;  1ZCN A;  1P5Q A;  2MF9 A;  2LGO A;  5HW6 A;  2B31 A;  3W4R A;  3TDB A;  1H0G A;  1E6Z A;  2WK2 A;  2ZR5 A;  1K9T A;  1B6C A;  2XP8 A;  3AS0 A;  3O5F A;  1FKJ A;  3CH9 A;  2PV3 A;  4URI A;  4FAP A;  1FFQ A;  4TW6 A;  1WNO A;  1ZBC A;  1E9L A;  1ITX A;  4DZ2 A;  3WL0 A;  4XAK A;  1YAT A;  1E6R A;  1XRV A;  1UR8 A;  2FDM A;  1JVW A;  5BXJ A;  1J4R A;  2ETN A;  3O5J A;  3ARZ A;  3ODK A;  2OLH A;  4Z2I A;  1F8A B;  2F2D A;  4TW8 A;  3WQW A;  1W9V A;  1LG1 A;  2RUR A;  4DWS B;  4LAY A;  3IKD A;  3O5L A;  3JYM A;  2JZV A;  4WIW A;  1E6P A;  3ALF A;  3G6L A;  1EHN A;  3KAG A;  3RM9 A;  3ARS A;  1M5Y A;  4ODL A;  1GOI A;  2F21 A;  1ZBK A;  1PBK A;  2ZR4 A;  1TCO C;  3KAH A;  2DT3 A;  3NRK A;  3LUO A;  1FKT A;  1SYT A;  3O5K A;  3O5P A;  1XHG A;  2YBT A;  1X6L A;  1R9H A;  3O5E A;  2ITK A;  4IQC A;  2KO7 A;  2DT0 A;  1Q1C A;  4LAX A;  3IHZ A;  4KR0 B;  4JFM A;  3I6C A;  3UQA A;  5HKG A;  1FKF A;  2A3E A;  4IT4 A;  3CHD A;  1FKG A;  3ARQ A;  1E15 A;  1GPF A;  3ARP A;  2FKE A;  3WD0 A;  1LJY A;  2LKN A;  2XP4 A;  4ODM A;  2F23 A;  1ZB5 A;  3O5O A;  1BKF A;  1NSG A;  4JFL A;  3EIP A;  1EDQ A;  3QOK A;  1Y0O A;  5HW8 A;  1GRJ A;  3G6M A;  2WM0 A;  1ROT A;  5JH8 A;  3O5G A;  4S3K A;  1LL6 A;  4MGV A;  2O92 A;  4W9Q A;  1IX5 A;  4LGX A;  4TYO A;  1X6N A;  3NI6 A;  4Z2G A;  5HUA A;  1NWT A;  3UI4 A;  4Q7N A;  1KFW A;  4MTV A;  3CGM A;  1FKD A;  1NH6 A;  2MLY A;  1FJD A;  2A3C A;  5DIV A;  2XPA A;  4MNM A;  4UDM A;  1D7J A;  2ZQU A;  2M2A A;  3WL1 A;  3RM4 A;  2WLY A;  4W9P A;  2ZQT A;  1Q6U A;  1J4H A;  1NWS A;  3B9D A;  4ODK A;  2KGJ A;  3WIJ A;  2D9F A;  3KZ7 A;  4MSP A;  2M1I A;  1OGG A;  4L72 B;  3B9A A;  3B9E A;  3RME A;  2RSE A;  1NMV A;  1UR9 A;  4ITZ A;  1FD9 A;  3B8S A;  3AS1 A;  3O5R A;  2PBC A;  1ZBW A;  3O5I A;  3ALG A;  4DRJ A;  1VF8 A;  1FKH A;  3UI5 A;  1L1P A;  1CTN A;  1QZ2 A;  1FKI A;  4L3N A;  3ARW A;  2B5U B;  2DG3 A;  1HKM A;  4J4O A;  3O5Q A;  1HKI A;  2RUQ A;  2PPP A;  2P4V A;  4J4N A;  3PA7 A;  1C9H A;  5DF0 A;  4C02 B;  4DRP A;  4Z2H A;  4ODR A;  1HJW A;  3AS2 A;  4MNJ A;  4ZPW R;  5HW7 A;  1U79 A;  1EQ3 A;  1JND A;  1JNS A;  4MNK A;  3ARX A;  2M08 A;  2RUC A;  1QPF A;  4AY1 A;  2DSZ A;  2OFN A;  4Z2L A;  3FXY A;  1D7I A;  3PRA A;  3WD1 A;  3IK8 A;  1JCH B;  4KQZ A;  3WD3 A;  2MLX A;  2VCD A;  1KT1 A;  3PR9 A;  5D75 A;  2A3A A;  4MAV A;  2KR7 A;  2DG9 A;  3GU0 A;  5DEZ A;  1ZBV A;  2MNT A;  1JNT A;  3ART A;  4ZPV R;  3BMB A;  1OGB A;  2A3B A;  2DSV A;  1LG2 A;  4ML4 A;  2LPV A;  2PN0 A;  3O5D A;  2DT1 A;  2ZR6 A;  3FAP A;  3KAD A;  4FN2 A;  3RM8 A;  4DT4 A;  4HBO A;  4WKH A;  2KE0 A;  4U86 A;  1FAP A;  1J6Y A;  2O9O A;  1EIB A;  2ZQV A;  4MPK A;  1SR0 A;  3UI6 A;  1ZK6 A;  3MDY B;  4Z2K A;  1HKK A;  1FKS A;  5HWB A;  1LQ0 A;  4WKA A;  4WK9 A;  1W1Y A;  3B7X A;  1RD6 A;  3CGN A;  4Q22 A;  2ESC A;  2MPH A;  4W9O A;  1J4I A;  4LAW A;  4DIP A;  1N1A A; 
#chains in the Genus database with same CATH homology
 4JFI A;  1TFV A;  3CHF A;  1W26 A;  1HKJ A;  2AOS A;  4S3J A;  5J6E A;  5GPR A;  3TC5 A;  2XP9 A;  4ZPT R;  4P8W A;  1JNE A;  1YW5 A;  2UZ5 A;  4G2P A;  3WKZ A;  2XPB A;  3KAI A;  2PV2 A;  2PPO A;  1H0I A;  4WJX A;  2IF4 A;  5DIT A;  4ODN A;  3AS3 A;  4LAV A;  1ROU A;  1WAW A;  1ZL1 A;  1NWU A;  1W1P A;  3OA5 A;  2WLZ A;  4BF8 A;  3KAF A;  4DWS C;  5I98 A;  3PRD A;  4QT3 A;  4W5U A;  1FFR A;  5GPG A;  1QPL A;  2XP3 A;  2KFW A;  3BXW A;  3CHE A;  3WQV A;  4NZC A;  1F40 A;  4JYS A;  4P8U A;  2LJ4 A;  1W9U A;  3FY1 A;  4TX0 A;  1BL4 A;  4WKF A;  4R5E A;  4P8X A;  3ARR A;  3EY6 A;  3JYJ A;  2ZQS A;  4DRO A;  5GQB A;  4U84 A;  4NSB A;  1HJV A;  4DRQ A;  2FAP A;  1HJX A;  1E6N A;  2DPE A;  1Q6I A;  4ODQ A;  3ARY A;  3IKG A;  4HAR A;  4TNS A;  3H9R B;  4DRH A;  4TW7 A;  4HBE A;  3CHC A;  2MLZ A;  2QF8 A;  4PTM A;  2PV1 A;  1NWR A;  4ODO A;  3UQI A;  1FKK A;  3OOB A;  2YBU A;  1KT0 A;  4QT2 A;  4Z2J A;  4DRI A;  4QIB A;  1WB0 A;  1OWQ A;  4DRN A;  5HWC A;  1T11 A;  1PIN A;  3UF8 A;  4G50 A;  4NNR A;  2KI3 A;  2VN1 A;  4DH0 A;  2XP5 A;  2PPN A;  5DIU A;  2DSU A;  3CZ8 A;  5HT1 A;  1ZU8 A;  2K8I A;  1FKB A;  2DT2 A;  4GIV A;  3WH0 A;  4JFK A;  3ARO A;  3ARU A;  2Q5A A;  3O5M A;  1O6I A;  1W1T A;  1LL4 A;  3RFW A;  5HTG A;  3JXV A;  5B8I C;  3KAB A;  2XP7 A;  4O2T A;  4P8V A;  3UQB A;  2G41 A;  1A7X A;  4JFJ A;  1D6O A;  2L2S A;  4DRM A;  4ODP A;  3KAC A;  4QZV B;  3AQU A;  4DRK A;  2DSW A;  4R0X A;  1FKL A;  1D2K A;  3RGC A;  3WD2 A;  3ARV A;  4IT6 A;  2G8Z A;  4ZS6 A;  4U85 A;  4IQ2 A;  1HXV A;  3GPK A;  1NMW A;  1FKR A;  2DG4 A;  3VAW A;  2Y78 A;  5HBF A;  3WD4 A;  2IUZ A;  2AWG A;  1LL7 A;  3PRB A;  1Q6H A;  1EYM A;  4DZ3 A;  2F4E A;  4MNL A;  5DO2 A;  2XP6 A;  1D7H A;  1W1V A;  2PI6 A;  2RQS A;  4N19 A;  1W9P A;  2N87 A;  2RUD A;  4GGQ A;  3TCZ A;  3NTP A;  4IPX A;  4DWS A;  1GUV A;  3KCE A;  4DWS D;  1ZCN A;  1P5Q A;  2MF9 A;  2LGO A;  5HW6 A;  2B31 A;  3W4R A;  3TDB A;  1H0G A;  1E6Z A;  2WK2 A;  2ZR5 A;  1K9T A;  1B6C A;  2XP8 A;  3AS0 A;  3O5F A;  1FKJ A;  3CH9 A;  2PV3 A;  4URI A;  4FAP A;  1FFQ A;  4TW6 A;  1WNO A;  1ZBC A;  1E9L A;  1ITX A;  4DZ2 A;  3WL0 A;  4XAK A;  1YAT A;  1E6R A;  1XRV A;  1UR8 A;  2FDM A;  1JVW A;  5BXJ A;  1J4R A;  3O5J A;  3ARZ A;  3ODK A;  2OLH A;  4Z2I A;  1F8A B;  2F2D A;  4TW8 A;  3WQW A;  1W9V A;  1LG1 A;  2RUR A;  4DWS B;  4LAY A;  3IKD A;  3O5L A;  3JYM A;  2JZV A;  4WIW A;  1E6P A;  3ALF A;  3G6L A;  1EHN A;  3KAG A;  3RM9 A;  3ARS A;  1M5Y A;  4ODL A;  1GOI A;  2F21 A;  1ZBK A;  1PBK A;  2ZR4 A;  1TCO C;  3KAH A;  2DT3 A;  3NRK A;  3LUO A;  1FKT A;  1SYT A;  3O5K A;  3O5P A;  1XHG A;  2YBT A;  1X6L A;  1R9H A;  3O5E A;  2ITK A;  4IQC A;  2KO7 A;  2DT0 A;  1Q1C A;  4LAX A;  3IHZ A;  4KR0 B;  4JFM A;  3I6C A;  3UQA A;  5HKG A;  1FKF A;  2A3E A;  4IT4 A;  3CHD A;  1FKG A;  3ARQ A;  1E15 A;  1GPF A;  3ARP A;  2FKE A;  3WD0 A;  1LJY A;  2LKN A;  2XP4 A;  4ODM A;  1ZB5 A;  3O5O A;  1BKF A;  1NSG A;  4JFL A;  1EDQ A;  3QOK A;  1Y0O A;  5HW8 A;  3G6M A;  2WM0 A;  1ROT A;  5JH8 A;  3O5G A;  4S3K A;  1LL6 A;  4MGV A;  2O92 A;  4W9Q A;  1IX5 A;  4LGX A;  4TYO A;  1X6N A;  3NI6 A;  4Z2G A;  5HUA A;  1NWT A;  3UI4 A;  4Q7N A;  1KFW A;  4MTV A;  3CGM A;  1FKD A;  1NH6 A;  2MLY A;  1FJD A;  2A3C A;  5DIV A;  2XPA A;  4MNM A;  1D7J A;  2ZQU A;  2M2A A;  3WL1 A;  3RM4 A;  2WLY A;  4W9P A;  2ZQT A;  1Q6U A;  1J4H A;  1NWS A;  3B9D A;  4ODK A;  2KGJ A;  3WIJ A;  2D9F A;  3KZ7 A;  4MSP A;  2M1I A;  1OGG A;  4L72 B;  3B9A A;  3B9E A;  3RME A;  2RSE A;  1NMV A;  1UR9 A;  4ITZ A;  1FD9 A;  3B8S A;  3AS1 A;  3O5R A;  2PBC A;  1ZBW A;  3O5I A;  3ALG A;  4DRJ A;  1VF8 A;  1FKH A;  3UI5 A;  1L1P A;  1CTN A;  1QZ2 A;  1FKI A;  4L3N A;  3ARW A;  2DG3 A;  1HKM A;  4J4O A;  3O5Q A;  1HKI A;  2RUQ A;  2PPP A;  4J4N A;  3PA7 A;  1C9H A;  5DF0 A;  4C02 B;  4DRP A;  4Z2H A;  4ODR A;  1HJW A;  3AS2 A;  4MNJ A;  4ZPW R;  5HW7 A;  1U79 A;  1EQ3 A;  1JND A;  1JNS A;  4MNK A;  3ARX A;  2M08 A;  2RUC A;  1QPF A;  4AY1 A;  2DSZ A;  2OFN A;  4Z2L A;  3FXY A;  1D7I A;  3PRA A;  3WD1 A;  3IK8 A;  4KQZ A;  3WD3 A;  2MLX A;  2VCD A;  1KT1 A;  3PR9 A;  5D75 A;  2A3A A;  4MAV A;  2KR7 A;  2DG9 A;  5DEZ A;  1ZBV A;  2MNT A;  1JNT A;  3ART A;  4ZPV R;  1OGB A;  2A3B A;  2DSV A;  1LG2 A;  4ML4 A;  2LPV A;  3O5D A;  2DT1 A;  2ZR6 A;  3FAP A;  3KAD A;  4FN2 A;  3RM8 A;  4DT4 A;  4HBO A;  4WKH A;  2KE0 A;  4U86 A;  1FAP A;  1J6Y A;  2O9O A;  1EIB A;  2ZQV A;  4MPK A;  1SR0 A;  3UI6 A;  1ZK6 A;  3MDY B;  4Z2K A;  1HKK A;  1FKS A;  5HWB A;  1LQ0 A;  4WKA A;  4WK9 A;  1W1Y A;  3B7X A;  1RD6 A;  3CGN A;  4Q22 A;  2ESC A;  2MPH A;  4W9O A;  1J4I A;  4LAW A;  4DIP A;  1N1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...