5JH8A

Crystal structure of chitinase from chromobacterium violaceum atcc 12472
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
317
structure length
309
Chain Sequence
AAMVLAYYSGYAGNYAALTRYAASFNAVAVDFYNITAQGAVTGNGDPAPNDAISFLLGRIPAYGCVSNVDGNGNWSADIAHAVSTSAQSQAVANLVFAQDRFSGINVDFEAVAQGDRNNFSHFIQVLGRALHAKGLLIVSVPAFSADENHPANYGYDLRALGAAADYLQIMSYDEAIPAWDPGPVAGSDWMEDDLDYAVERVPAAKILNGIPAYGYDWRPGDGGMLYWDTQALIARYGAQPRYDAGTHSLTFNYGAADGSRHTVWTENARSVALKASLVNAYGLGGTSLYALGMEDDAFWAAVQGLAQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Probable chitinase
publication title Crystal structure of chitinase from Chromobacterium violaceum ATCC 12472
rcsb
source organism Chromobacterium violaceum
total genus 101
structure length 309
sequence length 317
ec nomenclature
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5jh8A02
1JNEA 1XHGA 3QOKA 4P8WA 4NZCA 1NWRA 3RMEA 1E6PA 3AS3A 1LG2A 3ARWA 4WJXA 1D2KA 2DT0A 4NSBA 3WIJA 3WKZA 1HKIA 1OWQA 1K9TA 3ALGA 1LL6A 5DF0A 1UR8A 1ZBCA 5GQBA 1HKMA 4PTMA 4S3KA 2B31A 1EHNA 1HKJA 4MAVA 1KFWA 2PI6A 4Z2KA 1NWUA 4URIA 3RM8A 2G41A 2O92A 1HJWA 1W9UA 1ZBVA 3CHFA 2QF8A 3AS1A 4WKFA 4Z2IA 1H0GA 3B8SA 1E6RA 3WD1A 2DT3A 4Z2GA 1ZL1A 1OGGA 3ARXA 1LL7A 4Q7NA 3ARPA 3ARZA 1JNDA 3WL0A 1X6LA 3WD0A 4WKHA 1LL4A 1HJVA 1X6NA 3ARYA 2IUZA 4Q22A 3WL1A 2A3AA 1WNOA 5HBFA 4ML4A 4MNMA 3ARVA 1E6ZA 3AROA 3ARRA 2FDMA 4MNKA 3WD3A 4W5UA 1H0IA 2DT1A 4R5EA 1ZU8A 4P8VA 1GPFA 1E15A 1O6IA 4P8XA 4DWSB 1OGBA 1ZB5A 1TFVA 3CH9A 4P8UA 3G6MA 1NWTA 4MPKA 2DT2A 1W1PA 3CHEA 1W9VA 2A3BA 1UR9A 3OA5A 3WD4A 3WQWA 2A3EA 1SYTA 1NWSA 1RD6A 1WB0A 2O9OA 3B9AA 3CZ8A 3FY1A 3W4RA 5JH8A 2AOSA 4WK9A 4Z2HA 3AS0A 4MNLA 4WIWA 2DSVA 1ZBKA 2DSZA 1W1VA 1ITXA 2DPEA 3RM9A 2WM0A 2ESCA 5DEZA 4Z2JA 3ARUA 1FFQA 1E6NA 4AY1A 4MTVA 3AS2A 3ARSA 3CHCA 2OLHA 1GUVA 4S3JA 2YBTA 3ALFA 3CHDA 1HKKA 1VF8A 1E9LA 3B9EA 1EIBA 3BXWA 2DSUA 3G6LA 1SR0A 1HJXA 4DWSA 1ZBWA 4DWSD 2DSWA 4LGXA 3ARTA 1W9PA 4Z2LA 1W1YA 1WAWA 3FXYA 4DWSC 1FFRA 1NH6A 4MNJA 2WLZA 3WQVA 3RM4A 1XRVA 2G8ZA 2WLYA 4WKAA 1LQ0A 3B9DA 1LG1A 2YBUA 1GOIA 2WK2A 1LJYA 5GPRA 3WD2A 1CTNA 1W1TA 2A3CA 3ARQA 3AQUA 1EDQA
chains in the Genus database with same CATH superfamily
3H9RB 4JFMA 1JNEA 5HWBA 3O5JA 1F8AB 4NZCA 1HXVA 1LG2A 2PPOA 2IF4A 4G50A 3ALGA 1UR8A 1ZBCA 4W9PA 1JVWA 4J4NA 2PN0A 4ITZA 2B5UB 2EULA 2VN1A 4IPXA 2G41A 3NTPA 1W9UA 3PA7A 1JNSA 4ODKA 2ZR4A 2Y78A 3JXVA 4Z2GA 3ARXA 4BF8A 1Q6UA 5I98A 4JYSA 1X6LA 4HBOA 3UI4A 2MLXA 2IUZA 4Q22A 1F40A 4ODPA 3O5GA 4TYOA 3CGNA 4MNMA 3AROA 3ARRA 3RFWA 5DITA 2MNTA 2KO7A 1ZU8A 5BXJA 3O5IA 4P8VA 1J4HA 1FKBA 1GPFA 1O6IA 1TFVA 3CGMA 2K8IA 4LAWA 4DRQA 3O5LA 3OA5A 2XP4A 3CZ8A 1NWSA 1RD6A 3JYMA 5JH8A 3PR9A 4Z2HA 4WIWA 2ZQUA 2DSZA 1W1VA 1ITXA 4QIBA 3RM9A 4Z2JA 1QPLA 1E6NA 4MTVA 3ALFA 3TDBA 3CHDA 3B9EA 3KAIA 4C02B 4DWSA 1NSGA 4GGQA 2DSWA 1KT1A 5D75A 1FKSA 2UZ5A 4L72B 1W9PA 1W1YA 3FXYA 1FFRA 3PRDA 1XRVA 4NNRA 1D6OA 3IKDA 2XP6A 2A3CA 4LAVA 3IKGA 1Q6HA 4TX0A 2ITKA 3UQBA 3AS3A 3B7XA 5HT1A 4WJXA 4QT2A 1OWQA 4TW7A 2LGOA 4DZ2A 1LL6A 2MPHA 4ODNA 3TCZA 1FKGA 3IK8A 4MAVA 4Z2KA 4URIA 2RURA 5HW8A 2ZQSA 1HJWA 1GRJA 1ZBVA 3KAGA 4WKFA 5HKGA 1EQ3A 3B8SA 3WD1A 4R0XA 2DT3A 1ZL1A 3I6CA 3KACA 5HW7A 1M5YA 1JNTA 3WD0A 4WKHA 1QPFA 2KGJA 2ZQTA 1T11A 3WL1A 1TCOC 4JFKA 3O5KA 2A3AA 5HBFA 4ML4A 4TW6A 3NI6A 2XPBA 4TW8A 1E6ZA 2MLYA 4JFLA 3WD3A 2DT1A 2ETNA 1P5QA 2LKNA 1D7HA 2KI3A 1A7XA 1FKHA 4DWSB 4UDMA 1OGBA 5GPGA 1FJDA 4LAYA 1NWTA 1U79A 3CHEA 2PV2A 3IHZA 3KZ7A 2KFWA 2A3EA 4DRMA 1WB0A 3FY1A 3W4RA 4WK9A 1FKFA 1KT0A 4U85A 4W9OA 3UI6A 1W26A 2WM0A 4U84A 4KQZA 3ARUA 3O5QA 1FFQA 4TNSA 3CHCA 1FKIA 1PINA 2OLHA 4IQCA 1VF8A 1E9LA 2FKEA 1EIBA 2AWGA 2DSUA 3G6LA 4DRJA 4DIPA 1ZBWA 3EY6A 2MF9A 4LGXA 2LJ4A 3ARTA 2M1IA 3LUOA 4U86A 2XP9A 3WQVA 3UF8A 2G8ZA 2WLYA 1LQ0A 3B9DA 3PRAA 2WK2A 2P4VA 1CTNA 1FKTA 1W1TA 2PV3A 3NRKA 3O5MA 3AQUA 2D9FA 2O9OA 3KAFA 1NMWA 3QOKA 4P8WA 1YATA 5HW6A 2DT0A 4ZS6A 3WKZA 1J6YA 3O5RA 1HKIA 2ZQVA 2DG4A 4MSPA 1K9TA 1QZ2A 3KCEA 3RGCA 4PTMA 5J6EA 2DG3A 1B6CA 1KFWA 1ZCNA 3RM8A 3KAHA 1EYMA 1R9HA 2O92A 3CHFA 2QF8A 1ZK6A 3AS1A 5DIVA 5HUAA 3OOBA 3WH0A 4DRNA 1D7JA 3ARZA 4FAPA 3WL0A 1FAPA 1HJVA 1D7IA 2KR7A 4DRPA 3ARYA 1IX5A 2M08A 2FAPA 3TC5A 2RQSA 3EIPA 2XPAA 3O5DA 1WNOA 4DRHA 3ARVA 4J4OA 4MNKA 1FKLA 2FDMA 2F4EA 1H0IA 4R5EA 4W5UA 3UI5A 1E15A 4DRKA 4P8UA 3CH9A 2A3BA 3WD4A 3GU0A 1UR9A 3WQWA 2DG9A 5B8IC 1JCHB 4ODOA 3B9AA 4IT4A 2AOSA 2LPVA 3FAPA 4MNLA 2PPPA 2XP7A 2ESCA 2MLZA 4AY1A 1E44A 4FN2A 3AS2A 3ARSA 4ODRA 2Q5AA 1J4RA 1SR0A 1HJXA 1ROTA 4IT6A 1BL4A 2XP5A 4GIVA 4DT4A 4Z2LA 1WAWA 1L1PA 3O5PA 4LAXA 2OFNA 1PBKA 2ZR6A 1NH6A 2WLZA 1NMVA 1YW5A 4ODLA 4WKAA 4XAKA 2RUDA 1LJYA 5GPRA 3WD2A 4MGVA 2XP8A 3O5EA 3ARWA 3ARQA 5DIUA 2VCDA 1Q1CA 1XHGA 1C9HA 4JFIA 1NWRA 1ROUA 1E6PA 2XP3A 3RMEA 3UQIA 4DROA 1D2KA 3KADA 4NSBA 3WIJA 4HBEA 3PRBA 5DO2A 5DF0A 5GQBA 1HKMA 4S3KA 2B31A 1EHNA 1HKJA 1J4IA 2PI6A 1NWUA 2PPNA 3VAWA 2L2SA 4ZPWR 2RUQA 2ZR5A 4L3NA 1BKFA 4Z2IA 1H0GA 5HWCA 1E6RA 2F23A 1OGGA 4G2PA 1LL7A 4Q7NA 3ARPA 3MDYB 4KR0B 1JNDA 1LL4A 2RSEA 1X6NA 4N19A 3GPKA 1FD9A 1FKKA 1N1AA 4DH0A 4ZPVR 3UQAA 1Q6IA 4ODMA 4DRIA 1FKJA 4QT3A 4HARA 4P8XA 4DZ3A 1ZB5A 1Y0OA 3G6MA 4MPKA 2DT2A 1W1PA 1FKRA 3KABA 3BMBA 1W9VA 2PBCA 1SYTA 2KE0A 2JZVA 3AS0A 3GTYX 2DSVA 5HTGA 1ZBKA 2DPEA 4ZPTR 5DEZA 4S3JA 1GUVA 2YBTA 1HKKA 2M2AA 4W9QA 1FKDA 3BXWA 3ODKA 3O5OA 4DWSD 2F2DA 4QZVB 2PV1A 3JYJA 4DWSC 3O5FA 4JFJA 4MNJA 4O2TA 3RM4A 4ODQA 4IQ2A 2N87A 1LG1A 2YBUA 1GOIA 2RUCA 2F21A 1EDQA
chains in the Genus database with same CATH topology
3H9RB 4JFMA 1JNEA 5HWBA 3O5JA 1F8AB 4NZCA 1HXVA 1LG2A 2PPOA 2IF4A 4G50A 3ALGA 1UR8A 1ZBCA 4W9PA 1JVWA 4J4NA 4ITZA 2VN1A 4IPXA 2G41A 3NTPA 1W9UA 3PA7A 1JNSA 4ODKA 2ZR4A 2Y78A 3JXVA 4Z2GA 3ARXA 4BF8A 1Q6UA 5I98A 4JYSA 1X6LA 4HBOA 3UI4A 2MLXA 2IUZA 4Q22A 1F40A 4ODPA 3O5GA 4TYOA 3CGNA 4MNMA 3AROA 3ARRA 3RFWA 5DITA 2MNTA 2KO7A 1ZU8A 5BXJA 3O5IA 4P8VA 1J4HA 1FKBA 1GPFA 1O6IA 1TFVA 3CGMA 2K8IA 4LAWA 4DRQA 3O5LA 3OA5A 2XP4A 1NWSA 3CZ8A 1RD6A 3JYMA 5JH8A 3PR9A 4Z2HA 4WIWA 2ZQUA 2DSZA 1W1VA 1ITXA 4QIBA 3RM9A 4Z2JA 1QPLA 1E6NA 4MTVA 3ALFA 3TDBA 3CHDA 3B9EA 3KAIA 4C02B 4DWSA 1NSGA 4GGQA 2DSWA 1KT1A 5D75A 1FKSA 2UZ5A 4L72B 1W9PA 1W1YA 3FXYA 1FFRA 3PRDA 1XRVA 4NNRA 1D6OA 3IKDA 2XP6A 2A3CA 4LAVA 3IKGA 1Q6HA 4TX0A 2ITKA 3UQBA 3AS3A 3B7XA 5HT1A 4WJXA 4QT2A 1OWQA 4TW7A 2LGOA 4DZ2A 1LL6A 2MPHA 4ODNA 3TCZA 1FKGA 3IK8A 4MAVA 4Z2KA 4URIA 2RURA 5HW8A 2ZQSA 1HJWA 1ZBVA 3KAGA 4WKFA 5HKGA 1EQ3A 3B8SA 3WD1A 4R0XA 2DT3A 1ZL1A 3I6CA 3KACA 5HW7A 1M5YA 1JNTA 3WD0A 4WKHA 1QPFA 2KGJA 2ZQTA 1T11A 3WL1A 1TCOC 4JFKA 3O5KA 2A3AA 5HBFA 4ML4A 4TW6A 3NI6A 2XPBA 4TW8A 1E6ZA 2MLYA 4JFLA 3WD3A 2DT1A 1P5QA 2LKNA 1D7HA 2KI3A 1A7XA 1FKHA 4DWSB 1OGBA 5GPGA 1FJDA 4LAYA 1NWTA 1U79A 3CHEA 2PV2A 3IHZA 3KZ7A 2KFWA 2A3EA 4DRMA 1WB0A 3FY1A 3W4RA 4WK9A 1FKFA 1KT0A 4U85A 4W9OA 3UI6A 1W26A 2WM0A 4U84A 4KQZA 3ARUA 3O5QA 1FFQA 4TNSA 3CHCA 1FKIA 1PINA 2OLHA 4IQCA 1VF8A 1E9LA 2FKEA 1EIBA 2AWGA 2DSUA 3G6LA 4DRJA 4DIPA 1ZBWA 3EY6A 2MF9A 4LGXA 2LJ4A 3ARTA 2M1IA 3LUOA 4U86A 2XP9A 3WQVA 3UF8A 2G8ZA 2WLYA 1LQ0A 3B9DA 3PRAA 2WK2A 1CTNA 1FKTA 1W1TA 2PV3A 3NRKA 3O5MA 3AQUA 2D9FA 2O9OA 3KAFA 1NMWA 3QOKA 4P8WA 1YATA 5HW6A 2DT0A 4ZS6A 3WKZA 1J6YA 3O5RA 1HKIA 2ZQVA 2DG4A 4MSPA 1K9TA 1QZ2A 3KCEA 3RGCA 4PTMA 5J6EA 2DG3A 1B6CA 1KFWA 1ZCNA 3RM8A 3KAHA 1EYMA 1R9HA 2O92A 3CHFA 2QF8A 1ZK6A 3AS1A 5DIVA 5HUAA 3OOBA 3WH0A 4DRNA 1D7JA 3ARZA 4FAPA 3WL0A 1FAPA 1HJVA 1D7IA 2KR7A 4DRPA 3ARYA 1IX5A 2M08A 2FAPA 3TC5A 2RQSA 2XPAA 3O5DA 1WNOA 4DRHA 3ARVA 4J4OA 4MNKA 1FKLA 2FDMA 2F4EA 1H0IA 4R5EA 4W5UA 3UI5A 1E15A 4DRKA 4P8UA 3CH9A 2A3BA 3WD4A 1UR9A 3WQWA 2DG9A 5B8IC 4ODOA 3B9AA 4IT4A 2AOSA 2LPVA 3FAPA 4MNLA 2PPPA 2XP7A 2ESCA 2MLZA 4AY1A 4FN2A 3AS2A 3ARSA 4ODRA 2Q5AA 1J4RA 1SR0A 1HJXA 1ROTA 4IT6A 1BL4A 2XP5A 4GIVA 4DT4A 4Z2LA 1WAWA 1L1PA 3O5PA 4LAXA 2OFNA 1PBKA 2ZR6A 1NH6A 2WLZA 1NMVA 1YW5A 4ODLA 4WKAA 4XAKA 2RUDA 1LJYA 5GPRA 3WD2A 4MGVA 2XP8A 3O5EA 3ARWA 3ARQA 5DIUA 2VCDA 1Q1CA 1XHGA 1C9HA 4JFIA 1NWRA 1ROUA 1E6PA 2XP3A 3RMEA 3UQIA 4DROA 1D2KA 3KADA 4NSBA 3WIJA 4HBEA 3PRBA 5DO2A 5DF0A 5GQBA 1HKMA 4S3KA 2B31A 1EHNA 1HKJA 1J4IA 2PI6A 1NWUA 2PPNA 3VAWA 2L2SA 4ZPWR 2RUQA 2ZR5A 4L3NA 1BKFA 4Z2IA 1H0GA 5HWCA 1E6RA 1OGGA 4G2PA 1LL7A 4Q7NA 3ARPA 3MDYB 4KR0B 1JNDA 1LL4A 2RSEA 1X6NA 4N19A 3GPKA 1FD9A 1FKKA 1N1AA 4DH0A 4ZPVR 3UQAA 1Q6IA 4ODMA 4DRIA 1FKJA 4QT3A 4HARA 4P8XA 4DZ3A 1ZB5A 1Y0OA 3G6MA 4MPKA 2DT2A 1W1PA 1FKRA 3KABA 1W9VA 2PBCA 1SYTA 2KE0A 2JZVA 3AS0A 2DSVA 5HTGA 1ZBKA 2DPEA 4ZPTR 5DEZA 4S3JA 1GUVA 2YBTA 1HKKA 2M2AA 4W9QA 1FKDA 3BXWA 3ODKA 3O5OA 4DWSD 2F2DA 4QZVB 2PV1A 3JYJA 4DWSC 3O5FA 4JFJA 4MNJA 4O2TA 3RM4A 4ODQA 4IQ2A 2N87A 1LG1A 2YBUA 1GOIA 2RUCA 2F21A 1EDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNE A;  1XHG A;  3QOK A;  4P8W A;  4NZC A;  1NWR A;  3RME A;  1E6P A;  3AS3 A;  1LG2 A;  3ARW A;  4WJX A;  1D2K A;  2DT0 A;  4NSB A;  3WIJ A;  3WKZ A;  1HKI A;  1OWQ A;  1K9T A;  3ALG A;  1LL6 A;  5DF0 A;  1UR8 A;  1ZBC A;  5GQB A;  1HKM A;  4PTM A;  4S3K A;  2B31 A;  1EHN A;  1HKJ A;  4MAV A;  1KFW A;  2PI6 A;  4Z2K A;  1NWU A;  4URI A;  3RM8 A;  2G41 A;  2O92 A;  1HJW A;  1W9U A;  1ZBV A;  3CHF A;  2QF8 A;  3AS1 A;  4WKF A;  4Z2I A;  1H0G A;  3B8S A;  1E6R A;  3WD1 A;  2DT3 A;  4Z2G A;  1ZL1 A;  1OGG A;  3ARX A;  1LL7 A;  4Q7N A;  3ARP A;  3ARZ A;  1JND A;  3WL0 A;  1X6L A;  3WD0 A;  4WKH A;  1LL4 A;  1HJV A;  1X6N A;  3ARY A;  2IUZ A;  4Q22 A;  3WL1 A;  2A3A A;  1WNO A;  5HBF A;  4ML4 A;  4MNM A;  3ARV A;  1E6Z A;  3ARO A;  3ARR A;  2FDM A;  4MNK A;  3WD3 A;  4W5U A;  1H0I A;  2DT1 A;  4R5E A;  1ZU8 A;  4P8V A;  1GPF A;  1E15 A;  1O6I A;  4P8X A;  4DWS B;  1OGB A;  1ZB5 A;  1TFV A;  3CH9 A;  4P8U A;  3G6M A;  1NWT A;  4MPK A;  2DT2 A;  1W1P A;  3CHE A;  1W9V A;  2A3B A;  1UR9 A;  3OA5 A;  3WD4 A;  3WQW A;  2A3E A;  1SYT A;  1NWS A;  1RD6 A;  1WB0 A;  2O9O A;  3B9A A;  3CZ8 A;  3FY1 A;  3W4R A;  5JH8 A;  2AOS A;  4WK9 A;  4Z2H A;  3AS0 A;  4MNL A;  4WIW A;  2DSV A;  1ZBK A;  2DSZ A;  1W1V A;  1ITX A;  2DPE A;  3RM9 A;  2WM0 A;  2ESC A;  5DEZ A;  4Z2J A;  3ARU A;  1FFQ A;  1E6N A;  4AY1 A;  4MTV A;  3AS2 A;  3ARS A;  3CHC A;  2OLH A;  1GUV A;  4S3J A;  2YBT A;  3ALF A;  3CHD A;  1HKK A;  1VF8 A;  1E9L A;  3B9E A;  1EIB A;  3BXW A;  2DSU A;  3G6L A;  1SR0 A;  1HJX A;  4DWS A;  1ZBW A;  4DWS D;  2DSW A;  4LGX A;  3ART A;  1W9P A;  4Z2L A;  1W1Y A;  1WAW A;  3FXY A;  4DWS C;  1FFR A;  1NH6 A;  4MNJ A;  2WLZ A;  3WQV A;  3RM4 A;  1XRV A;  2G8Z A;  2WLY A;  4WKA A;  1LQ0 A;  3B9D A;  1LG1 A;  2YBU A;  1GOI A;  2WK2 A;  1LJY A;  5GPR A;  3WD2 A;  1CTN A;  1W1T A;  2A3C A;  3ARQ A;  3AQU A;  1EDQ A; 
#chains in the Genus database with same CATH topology
 3H9R B;  4JFM A;  1JNE A;  5HWB A;  3O5J A;  1F8A B;  4NZC A;  1HXV A;  1LG2 A;  2PPO A;  2IF4 A;  4G50 A;  3ALG A;  1UR8 A;  1ZBC A;  4W9P A;  1JVW A;  4J4N A;  2PN0 A;  4ITZ A;  2B5U B;  2EUL A;  2VN1 A;  4IPX A;  2G41 A;  3NTP A;  1W9U A;  3PA7 A;  1JNS A;  4ODK A;  2ZR4 A;  2Y78 A;  3JXV A;  4Z2G A;  3ARX A;  4BF8 A;  1Q6U A;  5I98 A;  4JYS A;  1X6L A;  4HBO A;  3UI4 A;  2MLX A;  2IUZ A;  4Q22 A;  1F40 A;  4ODP A;  3O5G A;  4TYO A;  3CGN A;  4MNM A;  3ARO A;  3ARR A;  3RFW A;  5DIT A;  2MNT A;  2KO7 A;  1ZU8 A;  5BXJ A;  3O5I A;  4P8V A;  1J4H A;  1FKB A;  1GPF A;  1O6I A;  1TFV A;  3CGM A;  2K8I A;  4LAW A;  4DRQ A;  3O5L A;  3OA5 A;  2XP4 A;  3CZ8 A;  1NWS A;  1RD6 A;  3JYM A;  5JH8 A;  3PR9 A;  4Z2H A;  4WIW A;  2ZQU A;  2DSZ A;  1W1V A;  1ITX A;  4QIB A;  3RM9 A;  4Z2J A;  1QPL A;  1E6N A;  4MTV A;  3ALF A;  3TDB A;  3CHD A;  3B9E A;  3KAI A;  4C02 B;  4DWS A;  1NSG A;  4GGQ A;  2DSW A;  1KT1 A;  5D75 A;  1FKS A;  2UZ5 A;  4L72 B;  1W9P A;  1W1Y A;  3FXY A;  1FFR A;  3PRD A;  1XRV A;  4NNR A;  1D6O A;  3IKD A;  2XP6 A;  2A3C A;  4LAV A;  3IKG A;  1Q6H A;  4TX0 A;  2ITK A;  3UQB A;  3AS3 A;  3B7X A;  5HT1 A;  4WJX A;  4QT2 A;  1OWQ A;  4TW7 A;  2LGO A;  4DZ2 A;  1LL6 A;  2MPH A;  4ODN A;  3TCZ A;  1FKG A;  3IK8 A;  4MAV A;  4Z2K A;  4URI A;  2RUR A;  5HW8 A;  2ZQS A;  1HJW A;  1GRJ A;  1ZBV A;  3KAG A;  4WKF A;  5HKG A;  1EQ3 A;  3B8S A;  3WD1 A;  4R0X A;  2DT3 A;  1ZL1 A;  3I6C A;  3KAC A;  5HW7 A;  1M5Y A;  1JNT A;  3WD0 A;  4WKH A;  1QPF A;  2KGJ A;  2ZQT A;  1T11 A;  3WL1 A;  1TCO C;  4JFK A;  3O5K A;  2A3A A;  5HBF A;  4ML4 A;  4TW6 A;  3NI6 A;  2XPB A;  4TW8 A;  1E6Z A;  2MLY A;  4JFL A;  3WD3 A;  2DT1 A;  2ETN A;  1P5Q A;  2LKN A;  1D7H A;  2KI3 A;  1A7X A;  1FKH A;  4DWS B;  4UDM A;  1OGB A;  5GPG A;  1FJD A;  4LAY A;  1NWT A;  1U79 A;  3CHE A;  2PV2 A;  3IHZ A;  3KZ7 A;  2KFW A;  2A3E A;  4DRM A;  1WB0 A;  3FY1 A;  3W4R A;  4WK9 A;  1FKF A;  1KT0 A;  4U85 A;  4W9O A;  3UI6 A;  1W26 A;  2WM0 A;  4U84 A;  4KQZ A;  3ARU A;  3O5Q A;  1FFQ A;  4TNS A;  3CHC A;  1FKI A;  1PIN A;  2OLH A;  4IQC A;  1VF8 A;  1E9L A;  2FKE A;  1EIB A;  2AWG A;  2DSU A;  3G6L A;  4DRJ A;  4DIP A;  1ZBW A;  3EY6 A;  2MF9 A;  4LGX A;  2LJ4 A;  3ART A;  2M1I A;  3LUO A;  4U86 A;  2XP9 A;  3WQV A;  3UF8 A;  2G8Z A;  2WLY A;  1LQ0 A;  3B9D A;  3PRA A;  2WK2 A;  2P4V A;  1CTN A;  1FKT A;  1W1T A;  2PV3 A;  3NRK A;  3O5M A;  3AQU A;  2D9F A;  2O9O A;  3KAF A;  1NMW A;  3QOK A;  4P8W A;  1YAT A;  5HW6 A;  2DT0 A;  4ZS6 A;  3WKZ A;  1J6Y A;  3O5R A;  1HKI A;  2ZQV A;  2DG4 A;  4MSP A;  1K9T A;  1QZ2 A;  3KCE A;  3RGC A;  4PTM A;  5J6E A;  2DG3 A;  1B6C A;  1KFW A;  1ZCN A;  3RM8 A;  3KAH A;  1EYM A;  1R9H A;  2O92 A;  3CHF A;  2QF8 A;  1ZK6 A;  3AS1 A;  5DIV A;  5HUA A;  3OOB A;  3WH0 A;  4DRN A;  1D7J A;  3ARZ A;  4FAP A;  3WL0 A;  1FAP A;  1HJV A;  1D7I A;  2KR7 A;  4DRP A;  3ARY A;  1IX5 A;  2M08 A;  2FAP A;  3TC5 A;  2RQS A;  3EIP A;  2XPA A;  3O5D A;  1WNO A;  4DRH A;  3ARV A;  4J4O A;  4MNK A;  1FKL A;  2FDM A;  2F4E A;  1H0I A;  4R5E A;  4W5U A;  3UI5 A;  1E15 A;  4DRK A;  4P8U A;  3CH9 A;  2A3B A;  3WD4 A;  3GU0 A;  1UR9 A;  3WQW A;  2DG9 A;  5B8I C;  1JCH B;  4ODO A;  3B9A A;  4IT4 A;  2AOS A;  2LPV A;  3FAP A;  4MNL A;  2PPP A;  2XP7 A;  2ESC A;  2MLZ A;  4AY1 A;  1E44 A;  4FN2 A;  3AS2 A;  3ARS A;  4ODR A;  2Q5A A;  1J4R A;  1SR0 A;  1HJX A;  1ROT A;  4IT6 A;  1BL4 A;  2XP5 A;  4GIV A;  4DT4 A;  4Z2L A;  1WAW A;  1L1P A;  3O5P A;  4LAX A;  2OFN A;  1PBK A;  2ZR6 A;  1NH6 A;  2WLZ A;  1NMV A;  1YW5 A;  4ODL A;  4WKA A;  4XAK A;  2RUD A;  1LJY A;  5GPR A;  3WD2 A;  4MGV A;  2XP8 A;  3O5E A;  3ARW A;  3ARQ A;  5DIU A;  2VCD A;  1Q1C A;  1XHG A;  1C9H A;  4JFI A;  1NWR A;  1ROU A;  1E6P A;  2XP3 A;  3RME A;  3UQI A;  4DRO A;  1D2K A;  3KAD A;  4NSB A;  3WIJ A;  4HBE A;  3PRB A;  5DO2 A;  5DF0 A;  5GQB A;  1HKM A;  4S3K A;  2B31 A;  1EHN A;  1HKJ A;  1J4I A;  2PI6 A;  1NWU A;  2PPN A;  3VAW A;  2L2S A;  4ZPW R;  2RUQ A;  2ZR5 A;  4L3N A;  1BKF A;  4Z2I A;  1H0G A;  5HWC A;  1E6R A;  2F23 A;  1OGG A;  4G2P A;  1LL7 A;  4Q7N A;  3ARP A;  3MDY B;  4KR0 B;  1JND A;  1LL4 A;  2RSE A;  1X6N A;  4N19 A;  3GPK A;  1FD9 A;  1FKK A;  1N1A A;  4DH0 A;  4ZPV R;  3UQA A;  1Q6I A;  4ODM A;  4DRI A;  1FKJ A;  4QT3 A;  4HAR A;  4P8X A;  4DZ3 A;  1ZB5 A;  1Y0O A;  3G6M A;  4MPK A;  2DT2 A;  1W1P A;  1FKR A;  3KAB A;  3BMB A;  1W9V A;  2PBC A;  1SYT A;  2KE0 A;  2JZV A;  3AS0 A;  3GTY X;  2DSV A;  5HTG A;  1ZBK A;  2DPE A;  4ZPT R;  5DEZ A;  4S3J A;  1GUV A;  2YBT A;  1HKK A;  2M2A A;  4W9Q A;  1FKD A;  3BXW A;  3ODK A;  3O5O A;  4DWS D;  2F2D A;  4QZV B;  2PV1 A;  3JYJ A;  4DWS C;  3O5F A;  4JFJ A;  4MNJ A;  4O2T A;  3RM4 A;  4ODQ A;  4IQ2 A;  2N87 A;  1LG1 A;  2YBU A;  1GOI A;  2RUC A;  2F21 A;  1EDQ A; 
#chains in the Genus database with same CATH homology
 3H9R B;  4JFM A;  1JNE A;  5HWB A;  3O5J A;  1F8A B;  4NZC A;  1HXV A;  1LG2 A;  2PPO A;  2IF4 A;  4G50 A;  3ALG A;  1UR8 A;  1ZBC A;  4W9P A;  1JVW A;  4J4N A;  4ITZ A;  2VN1 A;  4IPX A;  2G41 A;  3NTP A;  1W9U A;  3PA7 A;  1JNS A;  4ODK A;  2ZR4 A;  2Y78 A;  3JXV A;  4Z2G A;  3ARX A;  4BF8 A;  1Q6U A;  5I98 A;  4JYS A;  1X6L A;  4HBO A;  3UI4 A;  2MLX A;  2IUZ A;  4Q22 A;  1F40 A;  4ODP A;  3O5G A;  4TYO A;  3CGN A;  4MNM A;  3ARO A;  3ARR A;  3RFW A;  5DIT A;  2MNT A;  2KO7 A;  1ZU8 A;  5BXJ A;  3O5I A;  4P8V A;  1J4H A;  1FKB A;  1GPF A;  1O6I A;  1TFV A;  3CGM A;  2K8I A;  4LAW A;  4DRQ A;  3O5L A;  3OA5 A;  2XP4 A;  1NWS A;  3CZ8 A;  1RD6 A;  3JYM A;  5JH8 A;  3PR9 A;  4Z2H A;  4WIW A;  2ZQU A;  2DSZ A;  1W1V A;  1ITX A;  4QIB A;  3RM9 A;  4Z2J A;  1QPL A;  1E6N A;  4MTV A;  3ALF A;  3TDB A;  3CHD A;  3B9E A;  3KAI A;  4C02 B;  4DWS A;  1NSG A;  4GGQ A;  2DSW A;  1KT1 A;  5D75 A;  1FKS A;  2UZ5 A;  4L72 B;  1W9P A;  1W1Y A;  3FXY A;  1FFR A;  3PRD A;  1XRV A;  4NNR A;  1D6O A;  3IKD A;  2XP6 A;  2A3C A;  4LAV A;  3IKG A;  1Q6H A;  4TX0 A;  2ITK A;  3UQB A;  3AS3 A;  3B7X A;  5HT1 A;  4WJX A;  4QT2 A;  1OWQ A;  4TW7 A;  2LGO A;  4DZ2 A;  1LL6 A;  2MPH A;  4ODN A;  3TCZ A;  1FKG A;  3IK8 A;  4MAV A;  4Z2K A;  4URI A;  2RUR A;  5HW8 A;  2ZQS A;  1HJW A;  1ZBV A;  3KAG A;  4WKF A;  5HKG A;  1EQ3 A;  3B8S A;  3WD1 A;  4R0X A;  2DT3 A;  1ZL1 A;  3I6C A;  3KAC A;  5HW7 A;  1M5Y A;  1JNT A;  3WD0 A;  4WKH A;  1QPF A;  2KGJ A;  2ZQT A;  1T11 A;  3WL1 A;  1TCO C;  4JFK A;  3O5K A;  2A3A A;  5HBF A;  4ML4 A;  4TW6 A;  3NI6 A;  2XPB A;  4TW8 A;  1E6Z A;  2MLY A;  4JFL A;  3WD3 A;  2DT1 A;  1P5Q A;  2LKN A;  1D7H A;  2KI3 A;  1A7X A;  1FKH A;  4DWS B;  1OGB A;  5GPG A;  1FJD A;  4LAY A;  1NWT A;  1U79 A;  3CHE A;  2PV2 A;  3IHZ A;  3KZ7 A;  2KFW A;  2A3E A;  4DRM A;  1WB0 A;  3FY1 A;  3W4R A;  4WK9 A;  1FKF A;  1KT0 A;  4U85 A;  4W9O A;  3UI6 A;  1W26 A;  2WM0 A;  4U84 A;  4KQZ A;  3ARU A;  3O5Q A;  1FFQ A;  4TNS A;  3CHC A;  1FKI A;  1PIN A;  2OLH A;  4IQC A;  1VF8 A;  1E9L A;  2FKE A;  1EIB A;  2AWG A;  2DSU A;  3G6L A;  4DRJ A;  4DIP A;  1ZBW A;  3EY6 A;  2MF9 A;  4LGX A;  2LJ4 A;  3ART A;  2M1I A;  3LUO A;  4U86 A;  2XP9 A;  3WQV A;  3UF8 A;  2G8Z A;  2WLY A;  1LQ0 A;  3B9D A;  3PRA A;  2WK2 A;  1CTN A;  1FKT A;  1W1T A;  2PV3 A;  3NRK A;  3O5M A;  3AQU A;  2D9F A;  2O9O A;  3KAF A;  1NMW A;  3QOK A;  4P8W A;  1YAT A;  5HW6 A;  2DT0 A;  4ZS6 A;  3WKZ A;  1J6Y A;  3O5R A;  1HKI A;  2ZQV A;  2DG4 A;  4MSP A;  1K9T A;  1QZ2 A;  3KCE A;  3RGC A;  4PTM A;  5J6E A;  2DG3 A;  1B6C A;  1KFW A;  1ZCN A;  3RM8 A;  3KAH A;  1EYM A;  1R9H A;  2O92 A;  3CHF A;  2QF8 A;  1ZK6 A;  3AS1 A;  5DIV A;  5HUA A;  3OOB A;  3WH0 A;  4DRN A;  1D7J A;  3ARZ A;  4FAP A;  3WL0 A;  1FAP A;  1HJV A;  1D7I A;  2KR7 A;  4DRP A;  3ARY A;  1IX5 A;  2M08 A;  2FAP A;  3TC5 A;  2RQS A;  2XPA A;  3O5D A;  1WNO A;  4DRH A;  3ARV A;  4J4O A;  4MNK A;  1FKL A;  2FDM A;  2F4E A;  1H0I A;  4R5E A;  4W5U A;  3UI5 A;  1E15 A;  4DRK A;  4P8U A;  3CH9 A;  2A3B A;  3WD4 A;  1UR9 A;  3WQW A;  2DG9 A;  5B8I C;  4ODO A;  3B9A A;  4IT4 A;  2AOS A;  2LPV A;  3FAP A;  4MNL A;  2PPP A;  2XP7 A;  2ESC A;  2MLZ A;  4AY1 A;  4FN2 A;  3AS2 A;  3ARS A;  4ODR A;  2Q5A A;  1J4R A;  1SR0 A;  1HJX A;  1ROT A;  4IT6 A;  1BL4 A;  2XP5 A;  4GIV A;  4DT4 A;  4Z2L A;  1WAW A;  1L1P A;  3O5P A;  4LAX A;  2OFN A;  1PBK A;  2ZR6 A;  1NH6 A;  2WLZ A;  1NMV A;  1YW5 A;  4ODL A;  4WKA A;  4XAK A;  2RUD A;  1LJY A;  5GPR A;  3WD2 A;  4MGV A;  2XP8 A;  3O5E A;  3ARW A;  3ARQ A;  5DIU A;  2VCD A;  1Q1C A;  1XHG A;  1C9H A;  4JFI A;  1NWR A;  1ROU A;  1E6P A;  2XP3 A;  3RME A;  3UQI A;  4DRO A;  1D2K A;  3KAD A;  4NSB A;  3WIJ A;  4HBE A;  3PRB A;  5DO2 A;  5DF0 A;  5GQB A;  1HKM A;  4S3K A;  2B31 A;  1EHN A;  1HKJ A;  1J4I A;  2PI6 A;  1NWU A;  2PPN A;  3VAW A;  2L2S A;  4ZPW R;  2RUQ A;  2ZR5 A;  4L3N A;  1BKF A;  4Z2I A;  1H0G A;  5HWC A;  1E6R A;  1OGG A;  4G2P A;  1LL7 A;  4Q7N A;  3ARP A;  3MDY B;  4KR0 B;  1JND A;  1LL4 A;  2RSE A;  1X6N A;  4N19 A;  3GPK A;  1FD9 A;  1FKK A;  1N1A A;  4DH0 A;  4ZPV R;  3UQA A;  1Q6I A;  4ODM A;  4DRI A;  1FKJ A;  4QT3 A;  4HAR A;  4P8X A;  4DZ3 A;  1ZB5 A;  1Y0O A;  3G6M A;  4MPK A;  2DT2 A;  1W1P A;  1FKR A;  3KAB A;  1W9V A;  2PBC A;  1SYT A;  2KE0 A;  2JZV A;  3AS0 A;  2DSV A;  5HTG A;  1ZBK A;  2DPE A;  4ZPT R;  5DEZ A;  4S3J A;  1GUV A;  2YBT A;  1HKK A;  2M2A A;  4W9Q A;  1FKD A;  3BXW A;  3ODK A;  3O5O A;  4DWS D;  2F2D A;  4QZV B;  2PV1 A;  3JYJ A;  4DWS C;  3O5F A;  4JFJ A;  4MNJ A;  4O2T A;  3RM4 A;  4ODQ A;  4IQ2 A;  2N87 A;  1LG1 A;  2YBU A;  1GOI A;  2RUC A;  2F21 A;  1EDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...