2VC2B

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist l-739758
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
461
structure length
457
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 126
structure length 457
sequence length 461
ec nomenclature
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vc2B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vc2B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vc2B03
4O02B 3T3MB 4UM8B 3T3PB 3ZQKA 5KYUB 2WINI 3OL2A 4DMUB 3EG9A 1SHYB 4O02A 4O3TB 1CQPA 3PPXA 1OLZA 1ZOOA 3M6FA 3K72B 2ODQA 2QTVA 3NIGB 3EGXB 5KYUA 3AL9A 4A0QA 4MMZA 2ODPA 4Z7QB 3EOBI 2NUTB 5KYWA 3K72A 1M2VB 3TW0A 3IJEB 5BV8A 3QA3E 3HI6A 4HQOA 2P28A 2VDQB 4FWWA 3K71B 3IJEA 3FCSB 1M2VA 1T0PA 1SQ0A 1RTKA 4HQLA 3F74A 1L5GB 3EGDA 2WW8A 3N2NA 3FCSA 2X5NA 3K6SA 1QCYA 2ADFA 1RS0A 2XWBF 5E6SB 5E6UB 1IDOA 1T6BY 1OAKA 3TCXB 2I6QA 3EOAI 4G1MB 4IGIA 1YVRA 5E6SA 4O3UB 4Z7OB 3NIDB 4NENA 3NVQA 1JEYB 1LFAA 1JLMA 1MJNA 3TVYA 1RD4A 1DZIA 2VDMB 1RRKA 2B2XA 1JEYA 5KYXB 4G1EB 5ES4B 2I91A 1MHPA 3EGXA 1M2OA 1MQ9A 5KYXA 5HDBB 1XDGA 2O7NA 4G1EA 2NUTA 3EFOB 2VDLB 3BN3A 4MMYB 1N3YA 1M1XB 3AFCA 1JEQB 3EFOA 1IJBA 1SHTX 3K71A 4CN9A 4MMYA 3VI4B 2XWJI 1L5GA 1PD0A 4UM9B 3EH2A 4F1JA 2VDPB 4WJKB 1M1UA 1U0NA 3E2MA 1U8CB 1M10A 2ICAA 2VC2B 5E6UA 4C29A 1XUOA 4C2BA 5KYNA 1U8CA 4HQKA 4IXDA 5HJ2A 1ZOPA 4G1MA 3V4VB 3EH1A 1V7PC 3V4PB 4JDUA 5KYWB 2XGGA 4HQNA 3OKWA 3ZDZB 3ZDXB 1PD1A 3ZE2B 3TXAA 3ZDYB 1AOXA 4FX5A 4XW2A 1N9ZA 3IBSA 4BJ3A 3HXQA 2VDNB 4GZ8A 4WK4B 1MQAA 3FCUB 1MF7A 3ZE0B 4NEHB 1AO3A 3Q3GE 1IJKA 5KYYB 3RAGA 1YVPA 1MQ8B 3AL8B 1M1XA 5HGJA 3EG9B 1TYEB 1PT6A 1JEQA 1YUKA 1FE8A 3AL8A 3VI3B 4MMZB 1BHQ1 4CNBA 2NUPB 2IUEA 1QC5B 4WFQA 4PN7A 5E6RB 1Q0PA 3GXBA 1PCXA 2NUPA 3HXOA 3PPWA 1QC5A 3ZE1B 4MMXB 1UEXC 5E6RA 2VDKB 1NA5A 4HQFA 1ATZA 4IHKA 2VDRB 3PPYA 3PPVA 2I6SA 3BQMB 3EGDB 4M76B 1FNSA 2M32A 4MMXA 1JV2B 3OKYB 4CN8A 1CK4A 4K3JB 3K6SB 2VDOB 2NVOA 1JV2A 1U0OC 1XDDA 3BQNB 1SHUX 1IDN1 4UM9D 4JX0A 2UZYB 4C2AA 4WK0B 1BHO1 4F1KA 1SSLA 2P26A 1AUQA 5LN1A 1DGQA 4Z7NB 1ZONA 3F78A 4WK2B 4NENB 3OL2B 5KYYA 3NIFB
chains in the Genus database with same CATH superfamily
5C8YB 4P2GA 1E2GA 4RKWA 2R6GA 4QPJC 4LCUA 5C3UA 4H15A 5I8WA 2Z4SA 4MMZA 1JLRA 2G0AA 2OX5A 1KVSA 4I4TA 3S5LA 3S0JA 1D2OA 3NZ8A 2E21A 3FGPA 5FUZL 2ECFA 1KB5L 2X19A 3PC7A 4D9FA 4ZAGA 3OTWA 1ZVHA 2A77H 4OGQC 4M49A 1EO7A 2F00A 4O9HH 3G7UA 4XIFA 4DUGD 4B0MB 3NESA 3FBQA 4IOFD 1Y1KE 3SAJA 4PC7A 4P2QD 2CJPA 5KYXB 4RMQA 2CUTA 2DECA 5EU5B 4LX8A 1K6MA 2JGDA 4M7ZB 4G6MH 4JXKA 5BT9A 2FEJA 3MV8B 1KBQA 5KBLA 1LDNA 2YWGA 1E8MA 4ZG1A 1YMMA 1E4XI 1F5WA 1Y8QB 4XNDA 3A21A 2I22A 3ZWDA 1T2XA 2QZSA 1A8PA 5EZIH 1ISFA 1M5UA 1J11A 3KZ8A 4KMQA 2F64A 4NZFA 5KOHB 5TPWL 1FZOB 4GW3A 3TIEA 2XXAA 4O4LA 3R9WA 3PC8A 2ACVA 3MWDA 4CL0A 2HBYA 4EW2A 5KW9L 7AT1A 1V1MB 5BZWB 4H4CA 4J1NA 4ANFA 3SGDI 1UXOA 2ET6A 2E5LB 1U2CA 3PENA 1MF2L 5TMEA 3ZGVA 5JOPE 4KN6A 2EX1A 4N5ED 4W99A 3HHSA 1L3NA 3ZWNA 1L6ZA 4HB0A 5F9DC 4IKKA 2XRAH 3MNZA 5L7YA 5JJCA 1YMMD 5FF6A 1AF7A 1G2QA 2OXEA 3GNML 2WLIA 1GUAA 3WHKA 3Q1KA 5JLZA 2GA9A 2IIPA 2ZG6A 1ZM2A 4IBVA 4TNEA 2YV2A 4B5LA 4DV1B 1USGA 3EJYD 1VFBA 5B53A 2WXNA 3E8UL 2WJZB 3UUGA 5I8CB 4MR9A 1T8PA 1CFSA 1L5VA 3BUSA 3Q1SH 3RU2A 2IH4A 5EBWA 3I6ZA 1H3WM 1SY7A 5CLWA 1F2UB 1B7GO 4UNPA 2PQ0A 1NCWL 4CL7A 1SRQA 3ULUL 1WMSA 2WAMA 1MY7A 2P79A 4DT1B 4MIKA 1YAIA 3OT5A 1L8OA 3ZY4A 1XXFC 1KLGA 1CULC 4MDFA 2PDAA 3VX0A 1H42A 4DXHA 3VH8A 1D2EA 2VP4A 1OQOA 3X13B 2C5DC 1T4CA 2GJ6E 1MHEB 2H3KA 1M1UA 4MPRA 4OQPA 4Q7LA 3UBFA 3CFCL 4XCCL 2ARJB 1E8YA 1ZLXA 4BNZA 1SD5A 1GQOA 5E00A 1O58A 5K1NA 4LSQH 2GN8A 2VAAB 3KPSB 2DFPA 3EDOA 4B75A 1MCQA 5HI4C 4BO1A 3UENA 4H60A 1P91A 1UD3A 4ODVH 5KBNC 4XNYH 4AJJA 4I7ZC 1BVLA 1CFZA 3FHLA 1KEMH 4JVNA 3V7YA 2R00C 2GBLC 2XQFA 4Q9IA 3DFZA 3OKYB 3L8YA 3WFBH 3LSYA 2FJHB 3DTXA 2LTQB 1JWMB 4R2GB 4LYHA 5I76A 1Y7IA 2UDPA 5M2QA 4X7EC 2BP0A 1OWLA 2E4YA 2RGEA 5I8ZA 1ZIOA 2W2LD 5ALTA 4GRLA 3CINA 1QQAA 4IOKA 4YPOA 1EA9C 4P0TA 3MNFA 3JYBA 4QU8A 3LDAA 4R4NC 1U0GA 5A2QA 4RSVA 5EJ9A 5IBCA 4ZDHB 2ZOLB 1PZMA 3NJLA 3QHZL 5IBQA 2QL7A 4RVFA 4RXUA 3RWBA 3TQHA 3B6IA 4EN3C 3PD0A 3GA7A 3O03A 3GRWH 5I5RA 2C2XA 5FWYB 4A7GA 4Y16C 1Z7YA 2KC0A 5MENA 4P3CH 1SZJG 3NSXA 3ZKSD 1P0IA 2GCEA 3EWAA 3JAKA 2OFFA 1DBKH 4GRLD 1AXTL 4YDKH 1IJBA 1IM9B 4LVOC 3T3MF 1O5IA 1G9SA 3B7SA 5EEXA 4OHUA 2CF5A 5I4KA 1U7DA 4H7HA 4GI8A 4G0PA 2BIPA 3PGCA 4R9SA 4KAAA 4NN5B 5M94B 2VWGA 4ARZA 3AY0A 4AEEA 5A03A 1HE5A 2NDGA 4YRFA 2YXWA 2IV8A 1T20B 2AKRA 2A7QA 1QE3A 1IAKB 5CJOL 3J8F7 4YCCA 4AQ8A 5LIPA 4JR9H 3GLDA 2I3AA 4H4NA 3VI3B 1IG3A 2HU8A 4ZI7B 5MEND 5J9PA 5DJ0B 2HV8A 4NGHL 3UTPE 3AUTA 1V2HE 4MQFB 2WUDA 3RWEB 2QP4A 4HKXA 5AG8A 4BFEA 2UY6A 2OTUA 3H0CA 2JW5A 3KPMB 3SGJA 4ZUUB 1L1RA 2XQ0A 1BE1A 5EHNA 1KFAH 1G59A 1CUJA 1VGKB 2O50A 3DAOA 2XCQA 4HFRA 1M71A 4JFRA 1A7NL 1YZUA 4OIMA 4CIYA 1EFUA 3RB7A 1SCJA 3GFOA 4QLBA 1NUDA 3QRWA 3CM0A 4QI3A 4C4KO 4YFEA 5TMPA 5DGHA 3NAGA 1XMSA 2A74C 3HUJF 2DPLA 1XZAA 4RFNC 3DP7A 3S7GA 1A3CA 1G64A 4JA2A 2BVQB 2Z31B 2QT1A 3DO8A 2VRAA 4X6EB 4GYWA 3T9FA 3R9IA 2CKNA 3NFSH 2Z92A 2VC2L 1MZYA 3O3BB 3DT6A 5IMKB 4ZI5A 1RM3A 3HZYA 1I1HA 4ATTA 5FNVB 4NSKA 4RDHA 1FDUA 4LMAA 1A9BA 1UEIA 3LNTA 3QQ4B 4L0QA 3ASNB 2JLCA 2EIZA 4NERA 2Q8BL 1ODKA 2QRHA 4D0CB 4AVJA 2Y4NA 1A1MB 4E9VA 1I3RA 5FJIA 3AB3A 5E1HB 2GSMB 2J33A 5AD1A 1RUKH 3BHMA 1FRZA 1H6EA 1U9JA 3CLHA 1DO6A 3K6JA 2Q8AH 5IB4B 3ND8A 4AB1A 2J9FB 1C7FA 2GQHA 1V11A 4Q37A 1T5BA 3SX4A 2Z35A 4NNPL 1DQKA 3NZEA 3G08B 3ZDDA 3WY1A 1JS4A 1P1JA 2VF7A 2JFXA 4M8QB 3N7TA 5TDPA 3WLEA 4LVNC 3E22B 1AC6A 1IN8A 4R3NA 3U7IA 4X4ME 3SKOA 4BO7A 2NSJA 2RHTA 2CXKA 5F0PB 2LNDA 3BX1A 3RSFA 3QPWA 2DQCL 3K4AA 2OZLB 3WQHA 3J81A 2JHAA 1FGVL 1R66A 2KLBA 1QRAA 3RK4A 3FN4A 3GUZA 1W7AA 2XUPA 4DZ8A 1POWA 1VKZA 1TO6A 4HFMA 4WW1B 2QXYA 1JWSA 2ADOA 4O2CB 3KLNA 3VBCA 2ZYRA 3A67L 3SDDB 5F9AC 4Z9XA 1JWBB 4J9UE 1RIVL 1W8IA 1JPFB 1OPRA 4I4IA 2JJQA 1Q7TA 4LHJB 4J0IA 3JCZA 4BO0A 4MQEA 1U2SA 4B45A 3PR3A 5L2JA 4XWTA 1E94E 3GDOA 3CW8X 4XUDA 2GB4A 3ILPB 3IKTA 4LLWB 2I87A 4IU3B 1FDWA 3UP1A 4UQDA 4DYHA 3U7QA 3KPRA 1L5FA 3JUZA 1A4RA 3B52X 4WKNA 3GRUA 2ZYUX 5JZVA 3VGPA 2ZZUT 1WCYA 1BREA 4IZOA 4UU0A 5EUCA 3LQYA 4LRUA 13PKA 5AQ1A 2B2XH 3TGPA 3JQCA 2QMYA 5EOVA 4R83A 3O8DA 4UU7A 2N1TE 1RPKA 5ICUA 5AJWA 3BBLA 3WWPA 2G9UA 5IMSA 3X1GA 3UXHA 1KVUA 3T7SA 1C9DB 4RIRB 2XN2A 4B2LA 3IEKA 1N7IA 4K9JA 2X4PA 2EQAA 1LEKB 2JGAA 3I5MA 5E2IA 4PJ6A 3KPRD 2BFFA 3G1TA 2OGSA 5FEBA 5SX5H 1G1KA 3WSVA 1FEZA 1MGPA 3NIGF 3CWQA 1I1FB 4C7XA 5KPJA 1G7MA 4G0ZA 1A4JA 4UCFA 5FEMA 8ABPA 1WAPA 5DBIA 3TPFA 1WZMA 5FCSH 3W2DH 1WUJS 4WJKB 3DX3A 1OSNA 4FHJA 1KK0A 3UJDA 2XMRA 4YRBA 2J6EL 2JVIA 4JODA 2EEZA 3MLBA 2MTAA 2O2YA 2WBWB 2J4CA 2O5ZH 4C06A 3KGSA 1QH8B 2ZIXB 1RNLA 5FPYA 3ZKWB 3KYKH 1SYSA 5SX5K 5IFHH 3CJQA 4WHTB 3C45A 4KWIA 2R4SL 1TQUA 1UB5A 1O7VA 1NCOA 2GK2A 4TV3A 1OSEA 1M6HA 1LWJA 5F78A 2RQEA 2ORBH 1ZP6A 3MXWL 2GK7A 1PCXA 1ZANL 2EZ4A 1WHOA 5C34B 1NGYB 3EIWA 1D9ZA 2PZLA 3NX4A 3EUFA 3QIAA 1T03H 2OCKA 1XELA 4IH4A 5CD3A 3D0QA 4Y2JA 1ESEA 4GX0A 2V7UA 3VKWA 3DHNA 2BIMA 4INJA 2BHFA 1BH2A 3TJPA 3RUIA 2GEBA 4EVSA 2OBNA 2YPVA 1BS1A 5LQDA 5HM8A 3X2EA 3GNSA 1DC3A 5BW6B 1NBCA 4LU5H 2FXVA 4E41B 3H9BA 1TA0A 1Q4NX 1KEVA 3MHTA 3KYBA 3GIVA 1KO8A 4OIAA 2OCIA 1G20E 3BVDB 2F3UA 3JVIA 2FW6A 2JI8A 4LNHA 4UWQB 1P6WA 2DDQH 2I07B 3CC1A 4PBWD 4C04A 2HFGH 1XDGA 3JAWB 2LOEA 4F97A 1EX1A 4JFEE 2UX7A 6REQA 4FNRA 3BIKA 3FHCB 3L9EA 3UTDA 2L7QA 1CY0A 2OQJB 2AV6A 5LWHA 3D8MA 4D8PA 4FMPA 4N6NA 8OHMA 2GW5A 4U1HA 3PAVA 2EDRA 2GRJA 4LW8A 1LD3A 4KYTA 1A5BB 4LXYA 3AVOA 4QT4A 5LZ4A 1CF4A 3K5RA 4K2UL 4XN2A 3PNQA 4MLIA 2D0OB 1G9HA 5EJGA 4ISBA 1TQ6A 5JW6A 2V7BA 3AVYA 5IN5A 4LPWA 2AR9A 2AP2A 1FFNA 2O0MA 4XNXH 2RKOA 3HEIB 1Q2UA 3W5CA 3MACH 4WRLA 1AGBA 1KJ2B 4WL0A 3THWB 1XD1A 3AP2A 2HKFH 4NDMA 3TVMB 2XQBH 4GM4A 3ZJVA 3CMOH 3WXWL 4Q1BA 3ZJUA 1BJ8A 2FSGA 3E9ZA 1D9KA 4Q2ZA 1LM8V 5T4HA 2L0XA 5KSVA 1EXVA 4B53A 4MDHA 4RWEA 3GJFB 3G9QA 5B57C 3L3BA 2P24A 1UEJA 2A9PA 1QRSA 4Y89A 3WWOA 4LZNA 1QFSA 1XAHA 2OV2A 4YXLH 4PRZA 4RDCA 3DE7X 4QXQA 1DP0A 3IUBA 4RTMA 2PUFA 1UKEA 1JZSA 5J2UF 4X9XA 5KBDA 4JW3A 3VU9A 5LNK1 1S7TB 1QZXA 2ONZA 3MJ6A 4BKLA 2FUEA 2HLFC 1NTDA 4P4SB 5B22A 4XX1A 4NI6A 2HT1A 1JIVA 2REOA 1D9KD 3LNCA 2ZPKL 2J8ZA 3G3EA 2VZ1A 4GI1A 1KYFA 5KVFL 1A7AA 2A3NA 1FU7A 2GC4C 4LDZA 2DL2A 1FF9A 3IAAA 2G07A 3ECVA 4WEBL 2O48X 1AGFA 4J0QA 1FTQA 4D4LA 3CB2A 2FL5A 2BZ1A 1RJWA 2P27A 3LQAH 1DJIA 4LSPH 5K4AA 43C9A 3MLVH 4GHWA 4NZ9A 4ZZ3A 2XADA 5C8VA 3PV7A 1RXCA 5ADVA 3HI6L 1J8QA 3N39C 4HCJA 4ZNCD 1V8BA 4J3OD 3ZDAA 3QH3A 3IJ9A 2FUQA 2J7LA 4Q9BA 3X1MA 3K0CA 1CTMA 1QD0A 1UKCA 3GMNA 2FWBA 4O4IB 2XRMA 5J5AA 1D4AA 3WTYA 3A4EA 3CZEA 1I80A 1GC1C 5AB9A 3QQDA 2VUIB 4ZMRA 1U3NA 4X93A 1PLGL 4A0QA 3ZE7A 2Q2OA 4K03A 4OGGA 1UD5A 4QRPB 1GS6X 1FFOA 4GI7A 3CZFB 2G6BA 2HJSA 3EVAA 1HZHL 2X4QB 1PR4A 4PAGA 3BE1H 4E42A 1AQHA 2XZQL 1JYWA 4P35A 5JXEA 1I3MA 4FKHA 3M8OH 3DE3X 3N2KB 1EWQA 1Z4MA 4AE1A 4DIOA 4ND2A 3MCTA 5EMLA 1XF4A 4HJUA 2AH5A 1KI3A 1V3TA 2D7TH 1CFMA 4NX0A 4P4KB 2X28A 3MUGA 4X1IB 1H2ZA 2J3LA 5C0EB 1N64H 3WD5H 3DR3A 2BHNA 2RGNA 4J3JA 1UBSB 3DAPA 4PZCA 1JI1A 3JASA 3VPBA 4KKAC 4YP9A 2WG1A 3I53A 1KJ8A 3VFSB 1AMUA 3UMMA 1IFXA 3SJUA 3K91A 1TAGA 2ONYA 1NJ6A 1KIPB 2CWDA 2WQZA 4ZV7A 3EVDA 5B55A 4ADIA 2GLUA 4IQ4A 5K69A 2Q2WA 5IWCA 1N2XA 2WAYA 1AO3A 2PX8A 1VTKA 5JUEL 1UMCA 4ZFOL 3NHLA 4QWMA 3WKBA 5ANMA 4W9IC 3VXQB 3CEMA 5JMOA 4M8UA 1PT7A 4D4IA 1BEYL 3WIHH 1OLUB 3SEFA 5KX5A 4FZVA 3DHMA 3E3LA 1DQDL 3U7GA 1ENZA 2HA3A 3N0WA 4L22A 3IPAA 3S2CA 1A9EA 4NEGA 4GG6A 4GUPA 4GQZA 4KBGA 4D2NA 1ZA3A 3ESNA 3UAZA 5AVUB 4LWOA 5C35A 3N9GL 3WS3A 4X1YB 1KP2A 4ETNA 2PX6A 2X53A 3RUDA 2ZOKA 2NQ2C 4WFGE 5GZND 3IEPA 2XCRB 5E6IB 3P52A 3ICEA 4DA0A 5B1HA 5LU8A 3GSOB 4TMZA 2YAEA 4LFAB 3EFDH 1QAQA 5F1IA 2PCPA 1GJWA 1BF2A 2FZVA 3RUCA 1PQPA 2ZULA 2FE1A 1U58A 3MJ8A 5ISZB 4K7JA 3Q01A 2QP9X 2NUTA 2VAPA 4UINH 1QOQB 5JY1A 4YP7A 1K2DA 3AS3A 5D1HA 3TTXA 2ZS7A 1U0NA 4X98B 3K2EA 4AROA 1CERA 2GK3A 5HJEA 5K3BA 3CNQS 1CZ8H 2AB0A 4LE2A 4B3FX 2WWMD 1GG9A 5DHVA 1NJGA 2WNGA 1W47A 3NPAA 4UT6H 4KPYA 4WI9A 3JZMA 4TWIA 1C1YA 2YJTD 1QLWA 4CC0A 1Z5WA 4HLUC 4J3WA 2H32H 1CDZA 4Q1EA 2CKBL 4ER0A 4WFQA 3REQB 4W5RA 1T0MB 4Y98A 5DD5L 4JRYE 2AA3A 3FJ1A 3ZWYA 4CF7A 4GKSB 1M6EX 2WKQA 1K4YA 5FYKU 1DC5A 1GPMA 1VCOA 3SFZA 1FU8A 1TJGL 2A4ZA 5TQJA 4FQLH 4FGSA 3O6LH 2YMTA 4HQ6A 3EIOA 4QVGA 3GZJA 1AKMA 2H7CA 5IMLA 1ZBDA 4JJKA 3DGFC 1L7IL 2JGLA 4EHHA 2JEYA 1LO3L 5DS1A 2OMWB 4MYDA 4R9NA 1QW9A 3DFFA 1KB5B 4QUDA 4JAMB 1M53A 1WXHA 2HW8A 3BSYA 1RT9A 3TVTA 3RWCA 2W94A 2JLBA 4HUXB 4XZ4A 1E18A 4GL4A 1GMEA 2JI2A 3B36A 5ALFA 3LC2O 3WOHA 3SC4A 1UIRA 3K71A 2GTWA 5M95B 2IIBA 1L7AA 3PGJA 3TBHA 1U8CB 2QVBA 4BGIA 1UOPA 3FO1A 5ITBH 3E7JA 3ZDZB 5I9NA 3EYSH 1JRHI 3Q3GB 3CSUA 3ZWCA 5BP7A 2B3TA 2GIYA 3CVIH 3O3DB 3CR8A 2Q45A 1RKBA 2V74B 2ZM5A 1XP5A 1NCCL 4G6AD 3EYQC 2H8PA 5DM60 2WIAA 1LK7A 1M6VB 5FWNA 2B8TA 4XCEB 3C6SA 1J5PA 5E5LA 2ARKA 4S2SA 2RHWA 2F90A 3MHPA 3Q8BA 5FYKH 2WO2B 4MVJE 3IR6A 1AKJB 5CJXC 1USIA 4JEIA 2R8OA 2BNQB 3CCHB 3OJCA 2B0JA 5AK5A 3QWAA 3NUQA 1MCFA 3KQLA 3A4AA 2Y1FA 3L0SA 1T9GS 1AHWB 1AKWA 1Z0KA 3IJRA 4PC3A 5I28A 3EB9A 3IP7A 3ADKA 1M5RA 4BC0A 1GL6A 2N59A 1SXJA 2J0UA 5EUOE 2QFPA 2W80C 5A7FA 4MZRA 4KROB 2HUEA 1CVRA 5D2NA 3I6GB 4B82A 4H0IA 1A5TA 1PW7A 4B43A 1RZJL 3IV6A 4CMJA 3ABLB 3REVB 5BNTA 3P9SA 1SOUA 2C5EA 3DUUB 5K2MA 2INGX 1RK7A 2B8NA 4JPKH 2WF7A 5CLLA 2JNZA 1ENOA 3P4OA 3QDME 5E9WA 1SHTX 2LUOA 3MAWA 4K4KA 3PXAA 1T5DX 2NZJA 1PZ2A 2FD6L 3MJGX 1TJMA 4FFWC 1FVHA 2P6UA 2ICAA 4AM0A 4BLVA 1NIAA 4XP1H 3QQ9C 1SXJD 2XGGA 1U8TA 4GAEA 3MV9E 1G21B 4DLSA 1ANUA 5JPCA 3L4BC 4PB0L 3KQKA 3VCLB 4JCWA 3WQBA 4G1VA 5IVHA 4QCIA 5JNTA 1NGQH 1Y1DA 3WBFA 3VDAA 2Y6TE 3N3BC 1N1MA 5F23A 3EEBA 2XOTA 3GSWB 5SY4A 5EIXA 5EF0A 3BMNB 1HV8A 4RWZA 4EW1A 2IW1A 2DBJA 4PJCB 3QXGA 1Q9KB 1NI4A 4LNAA 3K96A 5JG7A 1TJXA 4JRFA 5LBSL 4R4BB 3ABQB 5CFAA 3A0RB 4LJ8A 2BJVA 5BPFA 4LARH 5FBRB 3RVQA 1U7WA 3ARTA 4YXKL 2V7EA 4OPMA 1KYWA 1E5AA 3IMTA 1O0VA 3GWJA 3K15A 2CVPA 5C92A 1BM3L 2L42A 3HAEA 5JPMB 4OKVB 1JGVL 1OAKA 4WZZA 4QARA 2HIHA 2C84A 5IYZA 1SZCA 2V9CA 3D7LA 3AI2A 5LQAA 3U48A 3BKXA 5ILQA 4JJAA 3TJEH 3DV4B 3B6KA 4L5CA 2Z1MA 2AJYH 5FGBA 3H5LA 3EQ8A 3QORA 1VE5A 4RDIA 4ZC1A 5A3RA 4ZUSB 2OMTB 3A4VA 4Q4DA 5AZ2H 2BFOA 1FCCA 1VKHA 1PD1A 2OCXA 1Y9JA 2BOCA 1ZLUH 2NRDA 2UVFA 4M29A 4MYRA 4V33A 4NRDA 4JLDA 1MQ8B 4PJFB 4QJIA 3TR0A 5CVCA 1K3FA 1EDDA 4N6RB 1EUCB 2GXSA 3P11L 3SN6N 2VFAA 3TF5A 5JR1L 4V3BA 3QA3A 4GBXB 1QPPA 3WO1A 2QDVA 2GUOA 4P1ZA 2DICA 3STUA 3QORD 2VWPA 4EQZA 3BP4B 4YIHA 3KJXA 4ARUA 1XRNA 4UTBL 4IRZL 3GFBA 3L4JA 4NQCB 4YCDA 1VBMA 2W37A 5F44A 4ANXA 4YJ3A 4PGEA 4NCNA 4YRPA 5C8ZA 4FS0A 1P5UB 3PQYA 3GF4A 5EWJA 2EDMA 1ZM4A 1UYWH 1FLRH 4ZOLF 2IC2A 4EX7A 3DRTA 2XZZA 1C4WA 3HR5A 1IATA 1SIOA 1PVVA 5AI6A 4PJXA 1G98A 3Q85A 4WE3A 3S3TA 2DFVA 4PGJA 3ZR5A 3P97A 3KQSA 2FV8A 1EXGA 4JBXA 4BQ9A 1EP9A 2D0IA 3PFFA 4E3ZA 5AB2A 1MG0A 4CMCA 1RK1B 3MUUA 5AKIA 1KNOA 4HUVA 3GK3A 1XZBA 3GMLA 4H1LB 2VJBA 4GM0A 3DK2A 5DJ5A 2JJTA 2EATA 3EE6A 2VC2B 3PQYD 5CXUA 5KANI 3UK7A 4BFBD 2TMGA 2JDIA 2VYCA 3ZDXB 2BBOA 3RIHA 2WFAA 2G2RB 1AXEA 3NM4A 3GWZA 2IVFA 2R4TA 5C7OO 3CK0L 4P84A 3FN0L 2DJIA 2C94A 3TLJA 1AMNA 2CDEB 1MCOL 4NTZA 5F98A 1ECZA 2XZDA 5TE6L 4JC8A 3IMKA 4JDZA 4I0CC 1A7PL 5EO9B 1WU7A 4P31A 1JV2B 4Y7MA 3IMGA 1FS5A 4GUDA 4JQIH 3HADA 2R2CA 2PN1A 2QWXA 5K93A 2B1IA 4F2WA 2JDID 3QW4B 2IDUA 4TSAH 3KLHD 4DYVA 1FLAA 3FYUB 3GM0A 2Q1WA 2YWDA 2A83A 3AM1A 1M1YA 3K05A 3FCTA 2R29L 1GZPB 2IH1A 4MTCA 4JH0A 2VLIA 4PAWA 3X43A 1HJCA 1EAYA 2AOVA 5E1GA 5AVTB 2OILA 1B3RA 1G7TA 1EDBA 4RKYA 3L8GA 3LKSB 5C0DB 3QR0A 1K88A 2IG2H 5AI8A 4EVIA 3NHYA 4LJAA 4M5YL 4K0KB 5BMOA 1EWVA 2F8LA 4E9TA 2O1AA 3RVWD 3TVYA 1JGLH 3MTIA 5DEZA 4TLMB 2QJTA 1NMXA 8MHTA 2H0FA 1QSEB 4OX9B 1U4SA 1YNTB 4Q58C 5MI0C 3SS7X 6CGTA 4YQXH 3B2QA 5EO1B 1W4BA 1Z0JA 2DL9A 4ONGL 1E0AA 3GNTA 1RLTA 3ZZNA 3DW3X 2O0JA 3R5XA 4BA8A 3B3IB 5E99L 3ROOB 2NU6B 5HDQH 5CTJA 3UYLA 2BFBB 5KYVA 1MEEA 4P9HL 5ILTH 4HIXL 4M62L 3GMTA 3ZU2A 3IFOA 1C0IA 2NAFA 5K01A 3OG4B 4KHTL 1LBEA 3AB0C 3T5DA 2NG1A 4F57H 5GS1C 2JF0A 2BR4A 5THKA 1CY6A 1BQHB 5C0BE 2CNNA 5BOSA 3NDZE 5DUPH 4FE4A 3TZVC 3ENQA 4D9QD 1KCSL 2P4AB 2VNAA 3ON5A 2FJSA 3HA2A 1RIHH 3TH2T 3SJZA 4N9QA 3ROLA 1WW2A 5REQB 4BE4A 2VRNA 3PFUA 3BFKA 4YC2C 5CBKA 5SWZA 4X92A 5K3EA 1L1EA 2K4AA 2W71A 2LRHA 5GGTA 4NQUA 2ZX7A 4CRPA 3R5HA 1LQSR 4J23A 3LXMA 2VGLM 3U82B 2XWTB 4KTDH 2Z91A 5KQPA 2J0EA 5EHGA 3U7RA 4Z3OA 4HUJA 3OB0H 3QFRA 1NR5A 1JZIA 1B0RA 2JKWA 3EOBB 3DE1X 1KN2L 4P04A 3HEBA 3D8RA 1PL0A 5SWZD 2ZBEA 1OTYA 1XDTT 4LMBA 2EVHA 3T77B 4BZQA 3E6FB 3SLRA 2ZJ4A 3VPGA 1Y9ZA 1S8DA 4Z9YA 5BW4A 2PGJA 1IAVA 4Y9CA 5E7IA 5EU4B 1SIUA 1Z74A 3QUYB 5B3SB 4GP4B 25C8L 3CZKA 3DDSA 3OB0K 4QXRA 5CZKA 2GETA 2YIDA 4DV5B 4X6XA 5IASA 3SJVE 1QKJA 3G5TA 1Y0LA 1EFPB 1TZIA 4OLFA 5JQGB 3KLDA 4N2AA 2JLSA 2ZXCA 4OTXH 3ZDRA 1E67A 3I2JA 4OGKA 3WLFA 2JJUA 5EIVA 4L8BB 1TAUA 1X1RA 4FQCH 4HDKB 2GN0A 4DNLA 1ZAGA 2ATVA 1I2AA 4JP3A 4W9GC 4NS0A 5DJ8B 4LIQE 1ADJA 2HZHA 2MYTA 1JAHA 1KWKA 2V65A 3ADCA 5FM4A 4JCOA 3KZVA 2LTAA 3D7RA 3MYZA 2FGWH 3ULVC 3JATB 1NKRA 2JKRM 2WQRA 3UJCA 1UUSA 2BLNA 4CNIB 5F5NA 3LB6C 2NZYA 4F58L 1N5LA 1NAML 7ADHA 5D5MB 1RZ8B 3EPPA 4XWWA 3PWKA 1Y6NR 2V6HA 3LMJH 3D3JA 4OV6F 2NVBA 2LVBA 2BGWA 2R4UA 2C7OA 2ZJAA 3R7QA 1ZOPA 3ME5A 2D4DA 1DIOB 4GRWF 2J88L 2ZQ5A 4N7BA 1MJ7L 3Q48A 3G02A 5DJXA 1I30A 5BUAA 3W6OA 4LDCA 5M5BA 1IAII 3GBNL 1P3JA 1MIOA 3HCNA 1USVA 4A2GA 3N40F 2R44A 4XI5C 4CM8A 1YE5A 3VDCA 1PWEA 1GHFH 1Q0XH 1RCUA 3CJRA 3ALPA 1NCAL 1IQUA 2DQ4A 2EP7A 2G5RA 2I6FA 4JXJA 2IHNA 3TBBA 2R2HA 5IT2L 4U63A 5BNWA 1ZUD1 1KFBB 3L4WA 1TTUA 5D1QB 4HOXA 1M57B 5KQLA 4E9RA 3RAJH 2RG7A 3IMVA 3H2KA 3LPFA 5B7PA 5SZJA 3EXHA 3G9ZA 3KWVA 4AP5A 2CDAA 3D39E 1X5YA 1A7JA 4KK5C 3P9XA 2JKNA 1R3KA 4HZUA 4NV1A 2VLRA 3WE1A 3QUAA 1CGSL 5ALSA 5A9SA 1G6RL 1YXMA 3EZ2A 3RA7L 1NNLA 3VMNA 5DI3B 4EK9A 3AKYA 5H4ZA 1WY5A 3E5MA 3NJFA 3DK0A 3H42L 4JRXE 4H8WH 3RFCA 1OGAD 4NBZB 4HLEA 4OZGE 3S9DB 4O00A 1FRQA 2PRJA 3SIWA 4LBAA 2O07A 4R8WH 1A6TA 2IS6A 3ENWA 2AL7A 2I25N 5FGCE 3LL4A 2Q3LA 1J0XO 4KI5C 2VLRD 4Q9RH 2NZIA 2NY0B 2B61A 3A4NA 5DRYA 2XA1A 2FJUB 4UOZA 2JANA 1TPXC 4NI3A 1P7YA 2JH3A 1SK8A 2XTJC 4KTVE 1PFUA 1JSXA 4CWAA 1RJDA 1MJUL 1T89C 3RB5A 1TJNA 4AEFA 5E4FA 5EFIB 2OL3H 2ZBQA 5KSWB 3E2PA 1RCTE 3RUGE 4Q18A 3A6CH 3UFBA 4WW2A 4BRJA 1KF0A 3ZWWA 3V7UA 5BOPA 2GPSA 2V7HA 3V7AE 3ORSA 4XDHA 3LEVL 1F4XL 4IEFA 1DSFL 4CODB 5C0GB 3NW9A 5BYBA 5AT1A 2CL0X 3U2SA 5GGSB 3SI7A 4TWAA 5LGJB 3QFDB 2C77A 3SGKC 3S99A 2VUKA 4FWWA 4P7FA 1U8KA 4ZOCA 3L4VA 1Z7JA 3HLYA 4PJBB 4M0PA 2VTBA 3VDQA 1JIKA 1GQQA 3L9RA 4DN3H 4OP1A 4FBGA 4HETA 4M4RB 5AM3A 1IGTB 2BISA 2G7MC 3KWMA 1XH1A 2ZPTX 4OQMA 1AJEA 3C8HA 3EHBB 5HE9A 4F3YA 4TLKA 3S55A 3PLNA 3OXSA 2W92A 3SLKA 1TEGA 4IMKC 4GW4B 4ISCA 3L0CA 3FZEA 4MDYA 2YMPA 3D48R 5FI5A 3UYRL 4MCJA 3EVBA 3IIIA 3Q8XB 2Q9AA 5GZ6A 4L2YA 2W8ZA 3OCYA 3A1VA 4BDSA 4F6RA 1FFPB 5IFJA 4O63O 2I5YL 3ZWOA 3UMRA 3EZJB 4GLLA 4TSCH 4ZFOB 1PFWA 1BZ9B 5ENDA 4ZVUA 4QRRE 1HE8A 3R23A 4IBQA 4G72B 2CK2A 1AT1A 1KGUA 2NQDA 5KSUB 3BRFA 3TBCA 3VHLB 4LHWA 4C3UA 4M0EA 2LU7A 3V4SA 1UJ3C 3PJSB 3GA0A 2Z6AA 1X1AA 1EBAA 2X40A 3G0OA 2CE7A 2Y93A 4OUUB 1XMJA 4EYSA 1NVEA 2ZOOA 2V7XA 4UM8A 4FB5A 3BUBA 1E2UA 1ACJA 3FFOA 2HJHA 1JD9A 3FPBA 5HTSA 2O72A 4CKEA 2YR3A 2IYQA 1WF6A 2PPCA 4G7YH 4AZ8B 1T6NA 3HG5A 3K70B 1T1RA 2GZSA 4BFZA 4GQQA 3F6RA 2GTHA 2Y06H 4E2WA 3PNLA 4U7JA 4OM1H 3HS0A 4J4TA 1SDYA 5ACMA 3FG9A 1SG9A 2GZRA 3HBNA 1R0SA 3MCWA 4L37A 2HMWA 2EIHA 3HPJA 2P4QA 5A0FA 1EAJA 1LLAA 4JROA 3UXMA 4IG9A 1W72A 3D85A 5LB1A 2JIXA 4BCDA 3OC5A 4UQ3B 4RD6A 3VVVA 5HI3C 2G1JA 3S5JA 4Z0BH 4NOKA 3IUNA 3OKFA 1Q3HA 2H2IA 5EE3A 1WETA 3GSVB 3HG2A 4EQ3A 3FNRA 1XKLA 1YIDA 2YYYA 1WPRA 5LWYH 2X38A 4DLNA 2WTUA 3R7WA 1N5AB 4Z7VA 3E1GA 3TL6A 3KM2A 3W57A 3VXNA 1CO1A 2CKBB 4X7SH 1R9FA 5BSHA 1KI6B 5DO2D 2H0PA 4B4OA 3ZE1B 2H11A 4HQFA 5H8WA 4LAJH 1NCJA 2OM6A 4E0BA 3FQTA 2N0SA 4D7BA 2W70A 3D85D 2JIXD 3QDJE 2HQRA 3W8NA 4MULA 4AJVA 2YVQA 4R90H 3PNWA 3TCTA 4LJSA 1DE0A 1DEEA 1BQEA 1ORIA 3E05A 1NFDE 1WZIA 1UBKS 4HDMA 4XB8A 3THSA 1DBIA 4G1UC 2VIRB 4C56B 1WBYA 2RACA 4A2EA 1ZH0A 3MRVA 4WZAA 2W8CA 5LA6F 2ZE0A 2DKNA 2AVFA 4O2FA 3H9CA 3MM4A 3EW7A 4NU5A 3T4AA 1ZMOA 3OKNA 2ZYSA 3M17A 2K2WA 3TZEA 2PCXA 1BQ3A 2BEUA 3QHTC 1KFKB 5L7WA 5HQ3B 3R8FA 2ADJB 3PRZA 1X1QA 3BRCA 1OK0A 3K30A 3KPQA 4FYJA 1QNIA 4CG0A 4HWBL 5LUBA 1S7XA 5DJDB 4R68A 2P6RA 1WV7T 3LUAA 4EJ0A 4AK1A 1C08A 1XL1A 1MJHA 4ZODA 5BQXA 2J2ZB 2BGNA 4N0YH 3RUHA 1MW2A 1H94A 2CYBA 3HPRA 1UBUS 3DJSA 4QPPA 2YJGA 4P3KA 1YCFA 4PZDA 5CH8A 3WGHA 5K9OA 2XODA 3TZCA 3IB4A 1O94A 4YJHB 2WD7A 3DL7A 4CCWA 1GC1H 3GLEA 2FT6A 4C0BA 3OWRA 4HSCX 5IZ7A 5IVZA 4O58H 3E9QA 4OLUL 3GZPA 1CK0L 1IEWA 5IJVA 4PLHA 1GUBA 2EP5A 1MAVA 2B34A 3CLRC 2WQ7A 1P72A 1WCBA 4OKDA 4KQKA 5FHAL 1U4EA 2J31A 2VDOL 3BVWA 3ZDYE 3TUJC 2GVYA 1P60A 3ET5A 1T9HA 2ZYVX 1EEUA 3VXSA 4PV9A 5CEFA 3TASA 1EM6A 1EDOA 1GGCL 2JGNA 3C43A 4C0QC 2F8SA 1V7ZA 2IH3A 1O94D 3NBKA 1ULUA 5KREA 3EXG1 1CJSA 4FEEA 1WCV1 1HL9A 1UQTA 1A72A 3T0EE 1T8YA 2I6QA 4MUEA 3TBFA 3GXMA 1V4BA 3I6LD 4HAKA 3BCUA 1JQEA 3WIUA 1JPTH 4GOJA 1C9YA 2MSNA 3ZCVA 1ITCA 3I5UA 3ARGA 5DYNA 5HG0A 1RU9H 3VXSD 3CN7A 4WTQA 1O6SB 5IULC 3HVNA 5GHWH 5BMVA 2VXVH 2E56A 3UFXA 3M7FB 1Q15A 2NZUG 5DN6A 4G1MA 1I3LA 2AERT 1XNHA 3QQPA 1TFHA 5JS6A 4NIMA 1UPTA 1DQLH 2XACC 3B7WA 2CLRB 3MRCA 1KJYA 3LRPA 5EZYB 1C50A 1RLMA 2GCIA 2J5XA 3LQAC 1GCGA 3P2KA 1YDEA 2HRDA 5HFJA 5C5DA 4TTTS 1NANH 5SX4H 1HH6B 1I9JH 2I2BA 1QGOA 2WICA 1KAOA 2EKDA 2K7FA 3ARGD 3V5DB 2JIOA 1T2FA 2WYIA 4HEA6 4TKZA 4G0MA 3B1XA 1STOA 3L2LA 4RTPA 2AJLI 4KY2A 3R06B 4MYCA 2F9MA 5K7SA 5DRWB 1OALA 4N5DA 5CHYA 2O7SA 5DN6D 3ZZ0A 5FAXA 3FO9A 1TRKA 1LPBB 4HCIA 3MELA 1SBSL 5ICCA 2V2XA 2UUDK 2JTYA 1HNNA 4HEHA 2Z65C 1HEYA 5LB2A 3URMA 1REQA 2CBZA 2I1VB 4WA8A 1G16A 1IQRA 5IARA 2D2OA 3PCYA 1YKGA 4DNFA 2WZAA 3BHNA 1CU1A 3EDDA 4PO8A 1XP8A 2DFNA 1JEYB 4Q21A 4CEIA 2VBCA 4NJ9L 4IIQB 3LTEA 5A0TA 1SBYA 4UQAA 2VHWA 3H8SA 1BXRB 5HHME 4ZA2A 5B1YA 2IF2A 3THYA 2R87A 1RK0B 1D5CA 4PTUB 4DILA 3WP1B 3S5UA 1DBML 4MRBA 3ISJA 2C1EA 2G0TA 2WP0A 3Q2OA 4B73A 2G9HA 3DCNA 4GPD1 5B3KA 2QZQA 3HLAB 1FBIL 4P53A 1XE3A 2BM8A 1WCQA 3KBHE 2GBIA 1C3XA 2WXOA 2PUGA 1TOAA 2FWOA 1S4QA 4MWSA 2NY7H 1TZ8A 4ZMZA 3A9TA 4WBNB 1DCFA 4DNOA 4JFXA 2GT9B 1H2AS 1W36B 3L8FA 3FONA 3TAUA 3V0VB 2IXFA 2H5EA 4U1GB 4DTGL 4H16A 3OT4A 2ZUCA 2KDGA 2JIMA 4LDQA 1EGAA 3KS0H 4ANKA 1TQDA 3Q5YA 3L95B 5JW4R 5LQCA 3K53A 4KO4S 3Q2IA 4YK7A 3DCJA 3DA0A 2A0FA 2A9NL 3ZE2E 4Z7IA 2G09A 3AO0B 3K5HA 2PNJA 3IOBA 3NH7H 3ZQXA 3ZE0E 3I39X 5D7KD 1K4DB 3ZKQD 1UJ2A 1Z4OA 4N01A 2ZAMA 4JUBA 2CO7B 4RYDA 1SRRA 1O6GA 3UXFA 4Z53A 1KMHA 3SGEH 3JPYA 4H8QA 5HOEA 4HUUB 5F12A 3VRHA 4PP1C 1PUXA 3O2DH 1IWOA 3I3SR 2ZSFA 1PR1A 1CUFA 1ODCA 3KDPB 4FEIA 4YFYA 3VMMA 3CVCA 1BZ8A 1IOZA 3HFGA 1ZRHA 3KZXA 5K5YA 1J7JA 3PP4H 3M3HA 4GR5A 2GJ4A 4MZIA 5AW1B 4L3EA 5FI0B 4WO4C 3W90A 3VH2A 2ISDA 2DQDL 1EFVA 5C07A 3A6PC 3WGUA 5L6YH 2HNKA 3O6KH 4E5PA 3BXNB 1M2WA 3K1AB 1KXJA 1J0ZA 2AJUH 2Z9TA 3GSQA 1E61A 2I2DA 4I3SL 3FMPB 5FA5A 1RQNA 3G59A 1C5DA 4TULL 5HPMA 3BSHA 2Z1PA 5IOPB 1DXQA 2OORA 1BX1A 3FETA 3IQGX 5EMMA 1JGUL 1U8NA 3H3PH 3GROA 2HRBA 3OZCA 3VU2A 4WPGA 3CH6A 1T21B 1FI8C 1XWVA 1OAZL 3CBQA 1SUJA 1CIDA 4GAJH 1D7FA 4KQFA 2IUUA 3US9A 4LLMB 5JW5B 3X1YA 1EK0A 3H9QA 4L3ED 5HYJA 5H81A 2FQYA 3CVVA 1XZNA 5DMHA 2XETA 5L3SA 4BQBA 3QJSB 1JXMA 1U36A 4HGRA 3IJ7A 4M0LA 1OYWA 1YUHB 4HDIA 4WCDA 3OQMA 3VRLE 1LSOA 1AC0A 3U4KA 2R7NA 4R9HA 3VJ6A 3MLSH 2W83A 1ACYH 5COQA 3KL3A 4L0PB 4YP5A 1P5ZB 5IQ7L 1F2XK 2R85A 4RH4A 3TFBA 1NOLA 4LGSB 1HIML 3WTSA 4L8SB 1NN0A 1TA4A 4XMKH 5E4OA 4RGNE 5HYJD 3P4XA 2WXKA 1BXKA 3QUKA 1QCYA 4ENQA 1B6UA 1UDRA 1BFVH 4XDYA 2VLME 1O6ZA 3WTVA 4O3UB 5ERXA 1G87A 3AOGA 4NENA 2J4WH 3I9GH 2EC9U 4LSSH 3TNLA 3F00A 4URVR 3GMRA 4PCUA 2OMYA 5KVEL 1MHPA 4IIFA 3U9LA 5FKPB 3W9BA 3ZHSA 4ZGWA 4MV6A 5D7IF 1JD7A 3RF6A 4ZHQB 3FFDB 2IX3A 1R18A 3BK7A 4Y2VA 1GPNA 3SBRA 1VE9A 5BT8A 3ME0A 4XM1A 3S81A 4DGUA 2YD3A 1OXXK 2AJVH 1BX0A 5A7BA 1PT9A 2VNSA 1B4DA 3M46A 1LH0A 3VFMA 3R3WA 4FZ5A 5C0OE 1JGIA 2ZI6A 2UVQA 1S7SA 2DZDA 2FR8C 1JDJA 1MFEL 1D1TA 4AT1A 3PU6A 3WZMA 4NCC1 3WFJA 4DLLA 2DUNA 2CLKB 2OXRA 2B3DA 5F76A 4L4TE 2EE2A 4OBBA 2WGXA 1G9MH 4JNKA 3BGMB 4GEJA 4H1VA 3J2PA 4UAOB 4Q3OA 4DR3B 1ZWKA 4BNXA 3LQ1A 2PQ6A 3SM9A 2OXFA 3F6YA 1E99A 2BE9A 3F7VB 3PWPA 4QRUA 4RMTA 3V4VA 4CLRA 5DZNA 2AHIA 1YEFL 2M9MA 1JHTA 4HWRA 4CV0A 1QIIA 3W34A 3GT6A 1X1DA 2ENUA 2RB8A 5C46F 2O0KA 1NATA 4ZZIA 1FU4A 2IPKB 3PUXA 3V2GA 5ALNA 1DV2A 3TNNA 4MDJB 3QFJE 3SE9H 3D0OA 1NM9A 4BSWB 4JHBA 5J6HA 4WFKA 4RM3A 4KLAA 4MD5A 2GBTA 5CP3H 4F7CB 2ZWNA 4JJ8A 4U1NB 4LMRA 1ORWA 3U40A 4CHTA 3ZLJA 2GNAA 3PWPD 5DVOA 2J85A 3F12A 1GTSA 3TBSB 1DQJA 4NBLA 3VR3A 1GNQA 1JFLA 4PREB 2FBRA 2JVUA 3DX8A 1XRRA 1KF9B 3F3HA 2V98A 3QEQA 1RZIB 2A5DA 4TMTA 1DV1A 3PIQA 2Y1XA 1ILUA 2R751 1B90A 1Z8DA 4JGJA 1KEEB 4ECEA 4AQAB 2A94A 4H6VA 1L7RA 2JA2A 2HT4D 4YJ2F 1IAIM 1AQDB 5JLAA 4N8CH 1JJVA 3RFZC 3COYA 3FO2B 1VE1A 1ZQ9A 4G6JL 5JRZA 4FP8L 8PAZA 4G59C 2VE6A 4PGAA 3CPEA 3G0HA 3KEMA 4I8DA 5EU6A 3UK2A 3VR3D 4J6RH 5CGQB 4DQDA 3PHSA 4PLFA 1PWYE 5I0ZA 3PE3A 3BMWA 1HCVA 3OZKA 1NA5A 4MB3A 3ZDEA 3QEQD 5KWJA 2G4EA 3SDAC 1U2EA 1RU3A 1XRLA 1Z6GA 1K2WA 1PQYA 3KSRA 1EVUA 3BPLC 3IUEA 1BMZA 1MJ8L 1OI7A 1M0TA 2OP1A 4ZX6A 1GNSA 3OG9A 4U5QA 1UVQA 3PL6B 4MR8A 4XPIA 1K8DB 2KYIA 3HCCA 3SPXA 1K7EB 2CVHA 4FMDF 1HOTA 4CL8A 4X99A 5DFAA 2C3WA 2QTCA 5EU6D 1UD8A 1L7TL 1L8AA 3FR7A 5IJ0B 3OMAB 1UJNA 3M7IA 3WQRA 4QTZA 4YLQT 3K92A 2QSUA 5LXGH 4UB0H 1NW5A 2HK9A 4AL8L 4UOW1 4GSQA 3BP7B 4FW9A 4LASH 1YQ2A 1IY8A 4QBFA 4QBKA 2BDNL 1NAMB 3FQ2A 2H5LA 3KK0A 1WSWA 3C2QA 4HWNA 5F5LA 5T6MA 3E8XA 4KVPA 3X3GL 1TCAA 3GGWB 3JQ7B 4LV5B 1Y1SA 1N7HA 3DOSA 1PFVA 7MDHA 4JDTL 4YAWA 2MTBA 2BSTB 3ZBMA 4A6YH 2BT4A 2ZXQA 3Q2LA 5BXFB 5TDHA 2NZ9D 1L5QA 2D62A 4UDTA 3HZKB 5JZ7D 1ABFA 1YRYE 1VKNA 5CFZA 3FRJA 1RYEA 3FQUB 1RAGA 2EDKA 4R6UA 2QGNA 1KJ2H 3IBOA 5AAWA 5JNSA 3NCJL 4I9WD 1NGXB 5MFZA 2WV9A 2NZ2A 4M7KL 4WTOA 2AN5A 5JHDE 3N8IA 5ELIA 2PMFA 2FBJH 3PX3A 4C6TA 1IT9L 4S1RH 3MOGA 4B50A 5FO7A 5C0JB 3QVLA 3FU8A 3GPBA 3GJFH 2WT9A 5CBEA 4KXMA 2F7QA 1EXHA 2QX9A 4DTCA 3VAZA 3CFNA 1JQBA 5KSAA 1RMFL 3NDJA 4W7HA 2WBJB 4Q3LA 4U3JA 5DLML 4ZOAA 4M7RA 3M6UA 2J9XB 3WUWA 4Y6OA 1G6RB 1M8GA 1FNGA 5CVDA 5AI9A 1ESCA 3ELAT 5ALCL 3UPUA 3H42B 1M34B 4CVZB 1B8NA 2O2HA 3QARA 4FNPA 4Z7AA 3GJFK 4TZ0A 2QLVB 1H3XA 4YCJA 5C6TH 1YY8B 3S29A 3UMFA 1P4LB 4WXHA 2WLZA 2DI7A 1MEJA 1S7WA 3S5YA 5KSAD 1KARA 3K8MA 4XP4L 3FYDA 2YD1A 4U6HA 3PWUA 2X09A 3ZIDA 5IB3A 3PNRB 3DOHA 1Y1PA 4ORGA 2CM6A 4ZJZA 2BKAA 5JFTA 5BQ7B 1IZ9A 2CT8A 4FDTA 4BUHA 3HFMH 4K6CA 2YSSB 1MCJA 4D8WA 1TU4A 5HYIA 4YDVA 3L6RA 3OPNA 5KJ1A 3QLVC 3QPQD 1FNMA 2FEDD 3U3RA 3FQXA 1DAGA 1DL5A 5FDFA 3EJQA 3H8JA 1CI5A 2WB4A 1LBQA 1DXHA 2G5CA 5FYDA 2QRQA 5TVKA 1E9PB 2HF8A 3AREC 3KDSE 1SCKA 1QR2A 1H2EA 1NMAL 3QM1A 4WFFE 2CXUA 3PHCA 3EPJA 2EXYC 4UAJA 3V0WL 1F41A 3CFBB 1JOIA 4OQZA 2ADFA 2CLMB 4U02A 4L23A 4JXXA 5T1DH 5HIMA 4NBUA 4JIGA 3TKLA 2CRIA 2IEYA 4F96A 4G6KH 2ABWA 4HF7A 2W2LA 4M1SA 2EZUA 1R6VA 4TVPD 4PW4A 4X6CF 4ACPA 3B51X 3X1ZA 4AIXA 1P4RA 4F2FA 4RSMA 2F1RA 1O95D 4JO3H 1JB9A 4D0DB 3RY6A 4UM5A 1O96B 4Y5YA 2R6R1 5ECJE 1KJIA 4OL0A 4OX9Y 3H8NA 2YHBA 3GLKA 3BDYH 1DKMA 4KK9D 2VDUE 4F2HA 3HN2A 2UVPB 1GPDG 5LD2B 4I9UA 1XZ8A 5IB1B 3IDYC 4ZAFA 2O6HA 2JFQA 1HAUA 1SVCP 5A5EA 2IU3A 4AIZA 1YYMH 4EBFA 4X3OA 2VN5A 4P23C 3CDGA 2PX3A 5JWOA 3HC4L 1T66D 1QZ1A 4NJEA 4H3SA 2AQ8A 2CEKA 2QIOA 1U9KA 5EULV 3E0QA 3RL1B 4YRCA 1U8OA 5DC2A 2EJWA 4Z86A 2FECI 1AGNA 2NY1C 3FN3A 2JFWA 1S9XA 3NIFB 5EFOA 4A3SA 2Q7AA 1R4NA 5JA9A 3N0XA 3AVWA 2NNAB 3ULVH 5I1GL 1ZGLA 5KEIA 3BVNB 2BBSA 3WJ7A 4ONFL 2QORA 2GYYA 4HQLA 2DPXA 1CF2O 2ZCLH 2IEZA 2I6XA 1AGCB 3KVPA 3RAPR 2EDYA 1GR1A 4LF9B 4ATNA 2GSIB 4X7RA 4FUQA 4A2CA 3M07A 3WZLA 2CRZA 2E4UA 4HDCA 1WEKA 4GC5A 5FA3B 3BZEA 3R1GH 1Z36A 4HXGA 3W9EA 5BVPH 2NX5A 4QUEA 3RTGA 3YASA 4ZPTA 1XRSB 4W1RA 3KJQA 2G5BB 2XUAA 1G5FA 1U3TA 3JQFA 3MRKB 4GW1B 3NBFA 4MCZA 4FN0A 4GQ9H 1SVWA 2OK0H 3UN1A 3NEEA 3S36X 3NDIA 3E18A 5EGSA 3A3OA 5IDWA 5T3YA 3D09A 4PRAB 5INDA 4LVHB 4H26B 3JWDL 1ACXA 3QKUA 3SD7A 1EVLA 4TZKA 2NX5D 4R2WA 4Y2DC 1HILB 2ANBA 2GBFA 2BZDA 4OI8A 1NRJB 4M0UA 1JV5A 5H3LA 3FDFA 3TV3H 2CUZA 4Z49A 1G7RA 4PJIF 1DBAL 1P5RA 1QHHA 1DP4A 1N68A 3OKMA 2VW4A 1EFRA 3MRJA 1RFDL 1R46A 2AIRA 3V9PA 2IX9A 3RBXA 1OWRM 3LNGA 1E6UA 4R2XA 1YQUA 4BFOA 3U1VA 4EMUA 1HFUA 5ETUB 4Z7QE 2NQ3A 4FFVC 5B39B 2BM9A 4GPZA 3UCRA 5ADUS 2VPIA 1CFTA 2HG5B 4JG9A 1EXWA 1LTHR 2VF4X 3KEHA 1SUWA 2F74B 3SPCA 5ED4A 4OLXL 3MA9L 1MAHA 5CXXA 2X8JB 1AURA 4ALIA 3LS4H 2RH8A 1EFRD 3NDBB 1ERNA 5CR8A 3DIVA 2RGDA 2YBGA 4F06A 3GXPA 1A1NA 4FYQA 4BQRA 2WJJA 4X5WA 1EJFA 1YPZA 3A0UA 1I3KA 3CEAA 2AANA 3S35L 2OT3B 4N65A 5LMCA 1R3IL 4JHZA 1GMIA 3QSGA 2KUTA 4EDXB 1XFDA 5GRWA 5D1XB 2NNFA 4AYBA 3N8KA 5T8KA 5KW9H 3DBXB 5LCVA 2I7DA 2C00A 2GAZB 1MF2H 4K1XA 1EWRA 4A15A 3GXBA 3KXIA 2AN1A 1UJ5A 1D6VH 4AGQA 2FQXA 2ZROA 1LVEA 3BT2L 3JYPA 2VDOB 2IGFL 1Z62A 2BFWA 2WMPA 2F55A 4D98A 5DEFB 2DQGL 1E5VA 3KKPA 2NT0A 1XN1A 2I78A 4KXQA 4W1SA 2HX7A 3QOWA 3ANYB 3MRQA 3OJLA 1GSMA 1G19A 3HUJB 3NHPA 1BAFL 2WIGA 3MBIA 3ABRB 1C9KA 2C3PA 5K8UA 5EZPA 1KCVL 5D72L 3ER6A 5AKGA 1ZNXA 2H4XA 3W0LB 2CD0A 1M0EA 3LJ3A 2PS9A 4YH1A 2GJZB 2LD4A 3AAZA 3DLTA 2JFVA 3OMIB 4FGJA 3QDGA 2I4MA 4MP3A 1TM2A 3DARA 4ILKA 4JYMA 4H8WC 1BHGA 2PMDA 3DTNA 2BSXA 2XEDA 1DEDA 4XCCH 3A1DA 5IHLB 1GIGH 4OCRH 4XFJA 4XQEA 2X44D 5FCUH 2X2IA 1T04A 5CGYC 2V0GA 4BNKA 5I4CA 2QS9A 2FH6A 3G9AB 2WLNA 5JDIA 2FOXA 4BELD 3KOMA 5F6IC 3TYGL 3HVDA 2ZKIA 2JQMA 4M6ML 1R4AA 3WXBA 3CVHA 3EWNA 2D0FA 2OESA 2QV7A 1PLLA 4QOSA 3ONVA 3QDGD 2PTGA 4RIFA 4NV0A 2PCFA 1H3NA 3L0PA 4JN2B 4F7PA 3KWWB 3TN7A 4F45A 5GJTL 1TZOA 2UZXA 3W2IA 4EGJA 4CKQA 2GZHA 2MSWA 1SN0A 4RSYA 2SKCA 1DTWA 1QFWL 4QLOA 1FSKC 3DVSX 4YPGA 3HCBA 1DG9A 2NLJB 1RBQA 4GLRH 3HYCA 4W1TA 5GGSY 1S3SA 3GN2A 1RRGA 2A6JB 1MFUA 2B4KA 3ZHUA 3PPEA 2WM9B 2HEIA 3VHRA 2MINB 3DUSA 3L1JA 1K9SA 4MGZR 3O94A 3GPIA 4PPGA 3MRXA 1QA9B 3S97C 4L3OA 2CLOB 4DM7A 2ZE5A 4K8RL 1FYFA 2W0LA 1M8JA 2QUHA 3DHYA 4K3DL 4Z0HO 4GM1A 1N9KA 5ICYB 3UK1A 4XDGA 5D2LA 4D26A 4DVBA 2DQTH 2AUNA 1HH9B 3HUUA 1YE3A 3LW7A 4G2TA 2XF8A 3WLTA 3OLQA 4RWYH 1XHLA 3RAFC 1ZHLA 3MO1A 4PIVA 1CY2A 2XN9A 2YHSA 3Q6MA 4EI0A 3UAJC 3SS9X 1QU3A 1HHJA 1V5EA 2I8AA 1W1WA 2K70A 2FX9L 4LOEA 4MGHA 4LF3A 3AB7A 4QD2E 1PYWB 1KIAA 1XDBA 3UJBA 3PQ2A 3NBAA 3CRW1 2G0NA 4KKBD 2YFQA 1DDOA 2AXEA 1YIAA 2AJXL 5IEKB 5FDYA 2P35A 2Y67A 2VR9A 4NBNA 4FDWA 1E5CA 3HYSA 1JU4A 5BZZA 1E9OB 2WQ6A 4NICA 1JYNA 1CQZA 3HN5A 3NIGB 4ALKA 3W6NA 1KE1A 2WM2A 4KKLC 3KJ4B 4ODWB 1RM4A 2X4SB 2XN9D 2Z6VA 1T29A 3ZMNA 5JY6A 1WE2A 1IBYA 3LKRA 5E9QA 1SXIA 5HF8A 3NT2A 4K23H 3FUVA 4TNGA 3NTCL 5J1TC 5DZOA 4IH9A 1NOKA 2ZUVA 5IVNA 1OVZA 3IQWA 3LMKA 3BWUF 4ER5A 1IULA 1H5UA 4RZIA 4EKGA 4H1LH 1N1DA 2XECA 1DO0A 1A5FL 1YDWA 2FFRA 2DLFH 1V3JA 3S4SG 4OZIA 4YSOA 3IT0A 5IFAL 1VB3A 3KETA 1E2VA 4RLDA 5FXMA 1EZ1A 1WHPA 3D3VB 1B14A 1YB2A 3GRKA 1EM8B 1OB1A 4LKCA 2ZOTA 3N53A 1E9AA 1YN7B 2VDNL 1QIMA 4CKWB 3WY3A 4HEA1 2EO7A 2Q8BH 3P40A 4P5SA 2E82A 4CKBA 2RGXA 3AETA 4ISVB 5AVWA 2WBXA 5H59A 4EUKA 2XGJA 4OD2B 1SQMA 4EXKA 1V5IA 5SY9A 4OQLA 5EE1A 2X6TA 3ECBA 2MYPA 1WDMA 1FA4A 4M0FA 3WJ1A 1KQOA 2HSZA 2C0QA 3BH8B 2HFFA 1VB9A 2X9NA 2PFSA 2XNHA 3BAZA 3NWJA 4UREA 3SJBA 3FF7A 3U4QA 3GMMA 3QO1A 4I8IA 5DT1L 2PUHA 3LQZB 1V95A 3FVRA 2VTEA 3KM1A 2AEJA 1X7ZA 4ID3A 1WPXA 1E2WA 5C53B 1Y6GA 1OD6A 1RJ9B 1W9MA 4YDMA 3KNBB 4KCGA 3OZWA 1KULA 1J21A 1P4IL 1TYBE 1NCBL 2C4MA 4BV9A 2QRGA 4KQXA 3TW0A 5I74B 4OYLA 3PCXA 4A8PA 4FQJL 2ITFA 2JZNA 2FX8L 3O41B 2YUXA 3HCOA 3BI9X 3H55A 1LJ8A 1FGVH 1K5NB 2FMUA 3UTSA 4NT6B 4LEXH 4D92A 4LHUA 3L18A 4LBVA 2V3FA 4BP3A 3ONNA 2HCJB 1ACZA 3U83A 2IMMA 1IY9A 3N6YA 4LPCA 2QV2A 3UH1A 1F97A 1NKTA 4M7ZC 3K6OA 3CW9A 4Q7DA 3FUCA 1E7QA 4QGGA 1AQNA 2BYTA 3U0PB 5AOJA 5TQ0L 3F6PA 3BFXA 4ODHH 3PDCA 3OKKA 1FSPA 4BUJA 3UYOD 5FPQA 1JUDA 1RBYA 2G0LA 5GGUB 1B8VA 3MTJA 5DQDL 1KY3A 5DX1A 2JKSA 1WF5A 4CUJA 3G23A 1JK8B 1ZVSB 2FUTA 1MRCH 3UTSD 3GUTA 4G0XA 4LHUD 1GZ4A 1ZOIA 4HIHA 5AOMA 5EPMB 3BIFA 3G6JF 4NBWA 1HHKB 2D5CA 2RCNA 3PWJA 1Z4PX 2LE9A 2ACWA 2V55B 1O54A 1D3CA 2EAEA 1KBPA 5EBMA 3DBHA 4GKNB 2WB7A 5DTEA 4C4ZA 2C4VA 5E5MB 4GMXA 1FZMA 1IEHA 5EMJA 1KB9J 3OZVA 4BWTA 3AKEA 1BZ7B 3W3BA 2WANA 1NIJA 5INCB 3DX0A 3CKKA 3CUPA 5K1ZA 3BW9B 3Q10A 4A68A 4DC9A 3KPPA 5K0JA 3K0AB 1X7DA 4F7TB 4PM4A 5J2UB 2VDRL 3P2TA 2UZIL 4Z0XA 3D59A 3U5TA 5BN4B 2XGSA 3VFRA 2XUQA 4KQ1A 4JJOA 2TMDA 4B7AA 1GA4A 4Y3UA 4F7EB 1P1CA 5ARCA 3E1ZA 3AADB 4GG8B 1DC4A 1DZ0A 2OFPA 4ZEXA 2HUHA 3RYMA 3NPMA 4DK5A 4WHCA 3WB0A 2OHGA 5GZNA 1L6RA 3PG5A 4RH1A 3VDRA 1TUIA 4GPTA 1KOLA 1A9TA 2XUHA 2WINB 1EJOH 2GILA 4GC9A 2W00A 3SDXF 2H00A 3QBTA 4RL6A 2ERXA 1AGEB 3GK8H 1T0HB 1VP3A 1IBFA 4EIGB 1G7IB 3J7AC 4O1MA 2DQFA 4V2UA 3GDWA 4HLCA 3LVBA 3RIGA 4YC7A 3T3EA 4PJAB 1TO1E 4NRZB 1VLZA 3SY0B 2LTQC 2H26B 4BUZA 4JQSA 1KCUH 4BMXA 3S96A 2M32A 4S1DD 4YTEA 3UJHA 3B1ZA 1DUYB 3IVKA 2C9BA 1ZMYA 4OAOA 2RHMA 3CWGA 2IS4A 4DLTA 5I7UA 1E3XA 5IR1A 4NU6A 4QYOA 4M54A 3DBOB 4FFYL 3AESB 5LNEA 4Y5XB 3JPWA 1QHNA 2RJMA 4F37F 2P9QA 1FA9A 2NGRA 4E9SA 4R1SA 1YBHA 3E4CA 3D4PA 2RH5A 4X00A 1KGXA 4MVBD 2HVJA 1E2PA 1JHDA 1ZVJA 1TZJA 1ABBA 1LGYA 2P6MA 5DEOA 1IE4A 4ZPVB 3QRBA 5DJ6B 4FGZA 3X12A 2A84A 2PTTA 1SLWA 4BHUI 3KKLA 4YAKA 1U80A 5JOFB 2ROXA 5BVJB 2WLLA 4KR9A 2X2EA 5ES4B 3FHAA 2CK0L 3II2A 4U4AA 5I7SA 1TYRA 1KA9H 3RGVA 1OW0C 2BPBA 1RFLA 3O0RL 4L48A 3RJZA 4IG4A 4IKPA 1Z2NX 1L5GA 4FC6A 1PDVA 4ONHB 2CXOA 2J3JA 2Q4BA 3TXXA 1FS6A 1KS9A 1ZJYA 2W90A 4NN5C 3GY0A 3I58A 1SXGA 2WCGA 2JMRA 3CY6A 3A4DA 4PYNA 3HZMA 2QV0A 3FOBA 4I2XB 4W68A 2YKGA 2DKUA 2UUPA 1IIRA 1MFDL 2ZSWA 1IC7L 1INDH 1QRRA 4K2UH 1ASPA 1L4MA 4DIUA 3NJIA 1VDMA 3EDMA 3OLXA 1H1LA 3G9TA 4TXVB 3RGVD 2REBA 3MJSA 1A7QL 3IU4L 4W8OA 2DXIA 5EIFA 3ZGOA 4Y1AA 1D5IL 2XB6A 2QJFA 3BIWA 3B82A 3LCCA 3WMEA 3CG8A 4G4SO 3CZAA 2RQ8A 5ANME 3U4GA 4YGYA 1P7VA 2YDXA 4JIMA 2P77A 3SPVB 1Z4LA 4OXKA 2WO3B 1CWVA 3CCBA 2PSDA 4X66B 4ME6A 2B4YA 2HJFA 3E1F1 4KRYA 3R9XA 4XNQA 1UCTA 2JIBA 4URUR 4TRPL 4FVTA 1XGKA 5HZGA 3HB0A 4YAEA 4RHEA 2K3HA 1RIUH 2QBYB 1XCTA 4OVVA 1TQ2A 4KOEC 2BONA 3AU0A 3T3OA 2K6WA 2WM8A 1MU0A 5BZDB 2IFGA 2I4IA 4INZA 3QKSA 3QPCA 4Y1AD 1T36B 1QQTA 5TPWB 4OGAD 1A88A 2Z31C 4G7SB 5HHOE 2F1AA 4IUBS 1PZGA 5ICXA 5KVFH 3QVVA 2AX3A 2YYSA 3AITA 2IV9A 4RVDA 3OKWA 3KU4A 1TJIL 1E4WH 3EDKA 4PG2A 1MOZA 5HJGA 4L4RA 3NABL 4BFNA 1J1OH 4C5BA 2R8BA 4BMSA 5CVJA 1IAMA 1P4AA 2Q9BA 2EEXA 2XYQA 1FE8A 1CF8H 3HI6H 3CRQA 1OF2A 4Z9AA 4TTGA 2DQJH 1GKYA 3I37X 4RX4A 5C5IA 2X76A 1NJ9B 3NWEA 4G9GA 1FQ9C 1SOWA 3G04A 1XD0A 3RG8A 2W8BB 3OKPA 4KMRA 2EDEA 1E58A 1X9QA 5ABAA 1LI7A 1SZNA 1A6WL 4O02A 4JJ5A 2W9DH 3MTBA 2X6RA 2PKWA 4CMMA 5ELXA 1ZU4A 3P0VL 2R1TB 2H8GA 2XZQH 4JO2L 2IALA 1LP9E 3A3YB 4KY1L 3NSFA 1ECGA 2X0EA 4ZARA 4RX4D 3VXUD 2H3EA 2JI4A 5DO8A 5E4EB 5ICZA 3C5CA 2YW9A 1NOJA 4JX9A 4COOA 4XM2A 1MGOA 1DAKA 3BXXA 4PRBB 3TUIC 2E9WA 1HQDA 2F3SA 1B0GA 5EJ6A 2WFLB 3TZLA 2NY2C 3FRHA 5AHOA 4UNIA 1X14A 3QU7A 1U3HB 2HADA 3UIZA 4EEKA 3VD5A 1XRMA 2Y1AA 5BSWA 3I62A 1VL1A 4F5WA 5AVRA 2VL5A 4IJMA 2DX7A 2I1QA 2YK1L 5JUEH 4II2A 5CIWA 1CLYH 4RLQA 5GZOA 2NCEA 3WP0A 5LDDC 1E7RA 5CHEA 1N4AA 1BEYH 1FJ1B 1G9MC 2P9JA 3WHIA 2OPBA 3ETNA 4KREA 4OQNA 1DQDH 3BXHA 2YFHA 3Q8FA 3CWCA 5K8CA 1BMGA 1U5AA 2J09A 3NACL 2OGUA 5I8KL 3FCOA 4PF1A 4Y9EA 2YIVX 5E7QA 1I6WA 4LUCA 1FL5B 2J0QA 2GAJA 3N9GH 3NHFA 2VR3A 1WUIS 4NO2B 5LG1A 2G70A 2WUBL 5IVXF 3JTEA 1NFRA 3CN0A 4XUCA 3H9SA 3JSXA 1CW2B 2DWTA 5GZOD 3BEVB 1Z25A 1AI1H 3IGAA 3G8BA 2E47A 4I1SA 2F15A 3R7DA 1OF0A 1VADA 4F3TA 2VXUL 1MHCB 4AP9A 3NAZA 1RZ7L 3T3PF 4XUGB 1JIQA 3LXXA 5KVCA 1BA9A 4FHZA 5DJ2A 1E3WB 2H0QA 2FATH 3M1OA 1TQSA 1W29A 2EXTA 4RDBA 5L88H 3L5XH 1MCDA 2QD1A 3V33A 4L4UA 5B1CA 4CVWA 2OA0A 1CL7H 3ZKMC 3VFWB 1X9HA 3DR5A 4MGYR 1GWNA 4KFTA 1GGVA 3H9SD 1INLA 2R1VA 3G5XB 3WNZA 3RHWF 2GS9A 1RH8A 2VXSH 3CH4B 1W2WB 5CB6A 3E35A 3HCPA 2VL4A 1HWGB 4BH7A 1M73E 3WVNA 3TNYA 1E0KA 5FKAA 1ITBB 3ROMA 4QKQA 4YHZH 1KGYE 3UZQB 4H0GA 2CKBH 5CEYB 3WAGA 1AF4A 1G60A 2WJHA 2FRXA 3SOBL 1WFOA 4UEOA 3AF0A 1QYIA 3H1AA 4UYQA 1RP1A 5DD5H 4TTVA 4FAAB 1YS6A 3AKDA 1JJAA 3F6JA 3KR0A 1DE4B 4OJDH 4WVRA 32C2B 4KIJA 5C3LD 1UMBA 3ECWA 4C2AA 1QBBA 4JA0A 1OAQL 2E18A 3U6XS 4YRIA 1X8LA 2Q9OA 1K6IA 4L0MA 4HEMA 3K9QO 1C5BL 1PAUA 1EFKA 3NOOA 4PLJC 1HXHA 1IL1A 4WKZA 3LQFA 3TDNA 1NC4B 4ON9A 1Q7CA 1ZA6A 2XSZA 1VSUA 2C5AA 3QZUA 1EHLL 4QTUB 1GUZA 5B21A 2NW2B 1JPJA 3HJFA 3BWAA 1A76A 4BVFA 1KELL 4HTFA 1ISRA 2ZCJA 5T3XH 4M3NA 3O3EB 3MCLH 1MP0A 2YAQA 1PK8A 2W6ZA 4UV4L 5KSZA 5BRZB 5EC1A 3KRTA 4ND8B 3S6JA 2BP7B 3MUOA 1NQWA 4MWDA 3B3FA 4RETA 4IIEA 1NOIA 1BG1A 4EZJA 3EOYG 3H4HA 2FPGA 4Q4HB 5ESWA 4NUJB 5D3ZA 3N2YA 2PNFA 3LBHA 5FHBL 4M0KA 4TLUA 2P0AA 2C98A 3OSKA 4RLHA 2XSZD 5DJAA 1ND0B 4AUJA 3NK4A 3WFHB 5HYSG 2FK9A 2AGVA 2YYZA 5GJBA 1JHUA 4BWWA 1PCSA 4E46A 5I5GA 1KBZA 2QW0X 5DMXA 2X89A 2XVMA 1BOYA 4PTYA 3HKBA 4PSUA 1NPJA 2VTDA 4OFQA 1JGEB 1OTUC 5AVXB 1YS4A 4O8CA 3BH4A 3GLHB 5EIIG 4EI5C 2VRCA 3SC3A 1PS8A 4HPOL 1X6NA 2CPCA 3QV1A 4HWSA 2CKMA 5KSPA 1DU4A 1JJBA 3KT0A 1VFAA 3Q8CA 5HHVH 3HN6A 3I6MA 3OF5A 2ROYA 4L8DB 2VJMA 5JXWA 2HVBA 2G72A 1KYZA 4ZOLB 5KS9E 5I0WA 3WSTA 1XIWC 4YS4A 4WV1B 3OCJA 1DN0B 4MV8A 5F9OL 1P0FA 4RVCA 5FB3A 1UEYA 1U41A 2X89D 1JX6A 1JHKL 1TZGL 2UZ1B 3QA3E 5YASA 5DD1L 4PRDA 4L5FE 3E9CA 4DVGA 1F58L 1Z5NA 1J23A 2CLDX 5T3ZL 5MEPA 1CDOA 3FTDA 3KQTA 2VRCD 3NT4A 1KPVA 3ZJAA 1V3QE 3RANA 1JZTA 3RGHA 4MS3B 1YC5A 4O2AA 1NULA 2CXGA 3PI6A 1KO7A 4M3KB 4R26L 4LKXB 3B3GA 4B46A 3CUUA 1DPGA 1OROA 3UBXG 4DOHE 1ZHKB 3SXUB 1KO5A 3PC4A 2Q76B 4QXGL 2RHGB 2OSLB 1YL6A 4PJXE 4AMXA 1U8AA 4R7DA 3CH8A 1CGYA 5IROC 4EENA 2GZ1A 2CNDA 3I5XA 4RA6A 3A14A 4JREB 1TJ4A 3A1EA 1NZFA 3OX8A 3I01A 3AXHA 3S5ZA 3FHQA 4YASA 1BVKA 4P5EA 4JEUA 5BO5A 1BDBA 1JZGA 4AGLA 1G7HA 2D03L 4M1YA 3HGMA 3MRSA 2XC8A 4S1PA 5EOCJ 5HF5A 4ZUTA 4C0SA 2YQBA 5IM7B 3V1KA 3UTCA 1X8JA 2PRZA 3DHUA 4IRUB 3VPFA 3FT4A 4WI3A 2V7NA 3FGNA 1HG0A 3KP1A 3LLCA 5HGBA 2PXAA 5FXCH 1IHXA 3QEHA 3QI9B 3PTAA 5GSRB 2M1ZA 3QVGA 1ZPUA 4DLZA 1EGJL 4WKGA 2R00A 2GBLA 4Z7UA 4D3FA 1GKEA 2ZDQA 4YACA 3QF7A 4JPQA 3VPCA 4AECA 2RK6A 2HK6A 4P4KC 4Y19E 4M02A 2XVYA 3PCTA 1PGOA 4RA9B 1T1ZB 3SICE 3JQGA 3P30H 1VJGA 3V8PA 5IF0A 3RPEA 4HVLA 4ZMTA 3BN3A 5EEYA 1GNLA 3LY8A 5CA1F 3O8NA 4K8RB 4U0QB 5HI4D 1QYWA 5EKUA 1A64A 2O05A 3D64A 3G5VA 4HD8A 4O4YL 4EHBA 5KYGA 1UK7A 3LIIA 2JC3A 3EH1A 2HJGA 2V97A 3EJUA 1YO6A 3LIZL 3ETEA 4IIHA 3FM9A 1Q17A 1UHVA 2FPOA 4R3UC 4JT8A 4GNKA 3FLBA 3EWSA 2I2WA 4Y16A 2JHPA 1I7RA 4IGAA 1ZR2A 4JKLA 4OI0A 1P7CA 1KH2A 1ZSDA 4BHUA 2ATPB 1NVUQ 2XCUA 4RNRA 3OQ3B 1PKQB 4CM4B 4R4ND 4XP6L 5D87A 1XVUA 4LLDA 4BZ2L 4BFWA 3MJ7B 1IRIA 3SS8A 5FCDA 3HTLX 3VWJB 4IHBA 4UTBH 3LQ4A 4R2LA 4PG7A 4YEFA 3LPWA 4O59O 1DPFA 4GG1A 4QRSA 2BVUA 3E9YA 4N0FB 1UMDA 1KDRA 3Q06A 1M7UA 4HYTB 1TU3A 4RFOH 5E6IC 1XRJA 3L4SO 4Y16D 2EICA 3ORQA 2HHAA 2ZWKA 2OBMA 2ZX9A 5LLDA 3N2NA 3KE8A 3ZD7A 1EFXB 1KIFA 4RD0A 3GMOB 4Q9QH 1WO8A 3KEFA 2PXCA 2D7DA 1BQ5A 3B3JA 1G4HA 3AIMA 3GWGA 1JDPA 3PWZA 2BTEA 3RX5A 1ID5I 5JAHA 3F2VA 4MFHA 1AMYA 3TXYA 2BHUA 3J80A 2WHPA 3RFVA 3O92A 2PO7A 4NG5A 3ZBQA 1RZFL 1F4WL 3LN4A 1GDTA 4Q05A 1J1XH 3MOIA 3F65A 3URKA 3UTTA 3LA8A 1YO4A 3DOJA 4YFVA 4K3HA 1QBGA 3OPUA 3V9FA 4IDAA 2VDNB 1N8NA 3LK7A 3FN0H 4MS6A 2E5FA 3A9WA 3SY6A 5BSRA 4LHZA 5TE6H 4ZFQA 1FIUA 1KR2A 4Q6IB 2AQHA 4KXBA 3VR5H 1U11A 4R8VA 2OLEA 1OGAA 2J1ZA 4QYSA 4RESB 3KAQA 1EUDB 1Q1BA 4DLUA 4AMKL 4F15B 4ZK8A 2H7VA 1ZT4A 1R3JA 5GSVA 3OJ0A 4MROA 3UTTD 3QY0A 4CTOA 3IT2A 3UATA 3OBBA 4KMOA 4QHTA 3EDJA 2AFIB 2VA8A 2EYRB 3BMOB 2XTMA 2QTTA 4N3NA 4M9OA 5DRXA 4YMLA 4EVQA 3I42A 5CBPB 4NWUL 4IP0A 2E59A 1A6PA 1TVCA 4XIIA 4ZD6A 2WZ0A 4ZI8A 4WXEA 5U1PA 4DADA 1IQDA 3CV5A 4LDLB 4M5YH 1DBWA 1D7OA 3US1A 2HK8A 3T1FB 2C1OB 2RK4A 4DQOL 5D86A 1DCEA 1NL0L 1EJBA 2I6TA 3W77A 1ZH8A 4TUOA 3QRGH 1O5PA 5CEZE 1FP6A 4OBEA 4WCYH 4LVNA 5EXSA 3GJ6A 4TVBA 3GHYA 2W65B 4ONGH 5IJDC 3ZTEA 1GTFA 5DHDA 3EO1A 5GONB 3L4YA 4EA7A 4HQRA 1RQPA 2BVNA 5HDBF 5TDNA 4YO7A 4LFBB 4X5XB 3PEVA 1YJXA 5HKBA 2DWSA 5EN2A 1EFDN 1G8FA 2FP4A 1D6NA 1AZVA 1IZZA 5AVSA 4LO9A 2QVLA 5JVDB 2GYSA 4CW7A 3VI4A 2EYUA 4KI0A 1BYNA 4RRPA 4QTHA 3O4HA 5DVKA 1KKMA 4J75A 5AFAA 3R7AA 5FJJA 3AJ9A 1ZN9A 2XDQA 5E9DB 2ETXA 4RFEA 5M29A 3DL4A 4D9LL 1ULAA 1OE1A 4BQ8A 4JLSA 5F7WC 1L4HA 3TCKA 2BK8A 4G5HA 1AHWC 4PJ7E 4C57C 3A1CA 4H4DA 3CDYA 1VZIA 2ENYA 3WWEA 1G2OA 4ACBA 2PABA 2AKAB 3OKAA 1PZBA 1MKFA 4KROC 1F3JB 4BYHA 4DWOA 3DLHA 1Q84A 4A10A 4IJ6A 1Q6YA 4DQXA 2WFMA 5JO9A 3BGVA 3OR6B 4P48A 4NKQB 3TTYA 5I16A 3ULUC 1HNWB 4I77H 4JJ6A 1EVEA 3H9GA 2NTVA 5KNCA 3VVCA 3KXFE 4FINA 3LZPA 3G9XA 4R9UC 3LBNA 2NY4B 1TETL 5EY5B 1NGWA 4RKRA 4O4JA 4ZS6C 1KMNA 1R5VA 4WWNA 4KRGA 1LLQA 2AOXA 2JWGA 2YMMA 2VLKB 3O9ZA 3FB7B 1E1CB 1FP4A 3FE2A 2ZKWA 1I1YB 4TXMA 2CFCA 3GDGA 2I8CA 2V2TA 3HB9A 3GFQA 3MS2A 1LV7A 2XNJA 3HHEA 4QPEA 4PFJA 2IHTA 1OGJA 5KNCD 3VU3A 5IMOB 3T8YA 1FF5A 1NCUA 4Q03A 4DIXA 1DG3A 5FUVA 1NY5A 4IKLA 4AIIA 3RWFA 1ENYA 2XKKA 2JK5B 2C5HA 2XHEA 2UUOA 5L9DH 1JPVA 4BU1A 1AKQA 3I9JA 4XSGA 2OMZA 4CDGA 2VZ9A 2AFRA 1XHEA 3ZWVA 4Z5RB 1U8FO 1TEHA 3I3EA 3K0SA 4ZCRA 3ROPA 2HUNA 3GT4A 3ROEA 3T3HA 3BUYA 1YMHB 2EFDB 2I76A 3QZBA 2UXTA 4Z3EA 5CB4F 3DVNA 4HB4A 4EEXA 1ZV2A 1RC1A 1FY2A 4YT5A 5IF3A 4HPYL 4BZXA 1L0PA 1I9IL 3OTQA 4CKXA 4N90D 2ECQA 3EPHA 1RZGA 1AE1A 1Z17A 3A4IA 2QSZA 2VQFB 4HBCL 3P0YL 4F7MA 1ORQA 3VQ1C 1EGQA 4IKNA 4FNOA 4G65A 3AWEA 4OZHB 4G83A 2IP2A 4OK5A 5CXPA 4L4SA 1QG3A 4JKIA 4F58H 3SKJL 4U1LB 1EE9A 3PHIA 4NZRL 4GXVH 3L9YA 3IETA 1AZUA 1TFRA 1YQVL 4REOA 1IOLA 1TKCA 1CG6A 5JYEA 2PLNA 3HC3H 2WR8A 3ZU3A 1JQ3A 3SHFA 2OBXA 3A1WA 4PRNA 3JARA 3P9RA 1XG5A 1AZSC 3L1UA 1MO3A 2GN9A 4AS1A 4JE4B 4OD3H 2PP8A 4OZ4A 4U1SA 5SV3A 2X77A 3ZHKA 3SMVA 1YYLH 4GBXC 3P2DA 2Z64C 4HP5A 1QC5A 3PDOA 4CR7A 5KB3A 1OCOB 1JUFA 4YL4A 2C3UA 2WVUA 3RSSA 3CH5A 2IAAC 3T9BA 4NJMB 1D2CA 4XRCB 4PFSA 2ZB4A 1H2BA 3VFTA 5K0LA 3NETA 4BFTA 4LCYB 3UCQA 3D6TB 4PPFA 3LPOA 1P5UC 5IM4A 1TTPB 4ZX5A 4NNJA 5KYWA 2F8OA 1DELA 2HLDD 3REWB 2VI5A 2HPAA 1Q0QA 5AI5A 1QRNB 2IXQA 1CY7A 2OXIA 5E94B 3OPVA 2DWYA 4RRPM 4I18B 4LDJA 5K39A 1KGIA 1QLRA 3D2UA 4NIKB 2KBFA 3NDRA 5IGXH 4CQJA 2B77A 3RE1A 4LSRL 4L5IA 4HHAA 3PWVA 3UKDA 4E11A 2VWQA 2C1XA 5FOWA 3CWZA 1XNQB 3G5UA 2B1HL 2AFHB 3UOWA 2LU5A 2CVQA 3U17A 3EJZC 2WHYA 2Q6IA 1EEYB 1CIJA 1QLHA 5IDVA 1HQRA 4M1CC 5B3NA 4H25A 5IJKA 4HXEB 1XQ1A 3D2UD 4YHKH 5LVAA 2C31A 2L3BA 4RQQB 2HLNA 2VM9A 5EKXA 4ZKEA 2JJMA 3QZNA 5FFFA 3V7WA 5I6NA 1WB5A 1OWPA 1I8UA 3DT8A 4J0GA 1BOOA 3S6CA 2WXLA 4NCDA 1QBKC 5E2AA 1SHWA 3PABA 5IUSA 4A67A 1SHUX 1CUDA 1PFCA 4MA1B 2X4TB 2TSBA 3KPVA 5LA6B 1U0EA