2VC2B

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist l-739758
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
461
structure length
457
Chain Sequence
b'GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
molecule tags Cell adhesion/immune system
source organism Homo sapiens
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
total genus 126
structure length 457
sequence length 461
ec nomenclature
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vc2B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vc2B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vc2B03
4MMXA 4WFQA 3ZE2B 1TYEB 2ICAA 5KYNA 3ZE1B 1T6BY 3EGXA 2NUTB 3EH2A 1QC5B 4IGIA 4M76B 4CN8A 4MMYA 1U0OC 3HI6A 1LFAA 2NUPB 3IJEB 3FCUB 3EGDB 2XWBF 3GXBA 1ZOOA 4O02B 1IJBA 1U0NA 2M32A 3PPVA 3TXAA 1BHQ1 3TCXB 3BN3A 1BHO1 1AO3A 1QCYA 4UM9D 1V7PC 4HQLA 4CNBA 1YVPA 3NIFB 3OKWA 1YUKA 4C29A 3TW0A 4HQFA 3OKYB 4FWWA 1JEQA 1XDDA 1YVRA 2I6QA 3PPXA 4FX5A 3E2MA 1NA5A 3EG9A 4BJ3A 1RRKA 1U8CB 2B2XA 3ZE0B 2VDRB 1IJKA 4HQNA 3ZDXB 3ZDYB 2P26A 1U8CA 5KYWB 3HXOA 4JX0A 1Q0PA 5ES4B 5BV8A 3ZDZB 1M1XB 1M1XA 3T3PB 4Z7OB 3AFCA 1DZIA 3EH1A 3M6FA 1FNSA 5HGJA 2VDQB 4NENB 1JLMA 3OL2B 1SQ0A 1M10A 5LN1A 4G1EA 1MHPA 4MMZB 4MMZA 2WW8A 4A0QA 1JEYA 1UEXC 1M1UA 3AL9A 3EGDA 1L5GA 1L5GB 1MF7A 2ODQA 1SSLA 4NENA 2XWJI 3NIGB 1ZOPA 2O7NA 4K3JB 3V4VB 2QTVA 4C2AA 4WK0B 1JEYB 3N2NA 4NEHB 1PD0A 2NUTA 1T0PA 4WJKB 5KYWA 4G1EB 4O02A 2I6SA 3IBSA 3ZQKA 3OL2A 1ZONA 3HXQA 4IHKA 3IJEA 1ATZA 3Q3GE 1M2VA 3TVYA 4O3UB 4Z7NB 3EG9B 3FCSB 3K6SA 2X5NA 2I91A 4JDUA 3PPYA 3F78A 4WK2B 1SHYB 3BQNB 4F1JA 2VDOB 4UM9B 3EGXB 1JEQB 4HQOA 4G1MA 3PPWA 2VDLB 1M2OA 3EOBI 2UZYB 4HQKA 1CK4A 4IXDA 4CN9A 4WK4B 5E6UB 3EFOA 2ADFA 2XGGA 2WINI 1OLZA 1IDN1 1RTKA 2VC2B 3K72A 4F1KA 1AUQA 1MQ9A 2P28A 2VDNB 1CQPA 5KYUA 1N3YA 1N9ZA 2ODPA 3NIDB 4MMYB 1QC5A 1DGQA 3T3MB 1IDOA 3VI4B 4O3TB 2NUPA 5E6RB 1SHTX 3AL8B 3VI3B 1JV2A 1JV2B 5KYXA 5KYXB 1RD4A 2NVOA 1XDGA 5HJ2A 3AL8A 1PCXA 1XUOA 1AOXA 1OAKA 4XW2A 1PD1A 3K72B 5E6RA 1RS0A 4MMXB 1MQ8B 5KYYA 2IUEA 3BQMB 3EOAI 4DMUB 3RAGA 1PT6A 3K71A 3EFOB 5E6UA 5E6SA 5E6SB 4GZ8A 3NVQA 2VDKB 4UM8B 3QA3E 1MJNA 5HDBB 5KYUB 5KYYB 1SHUX 4G1MB 4PN7A 4C2BA 3V4PB 1MQAA 2VDPB 1FE8A 4Z7QB 3FCSA 3K6SB 3K71B 2VDMB 1M2VB 3F74A
chains in the Genus database with same CATH superfamily
5C86A 3RILA 3ULSB 3GLGB 4C87A 3RC2A 2C42A 2OYSA 3ZD9A 3GH3A 4XYEA 1DMSA 5TE7H 1V9CA 1LDYA 2D1YA 3MNWA 4D4JA 3F6RA 2O20A 2W42A 2RALA 4RD2A 3Q7PA 3ZPXA 4M9XA 4DXDA 2GOYA 3LD8C 2R9HD 2C54A 4AMUA 3DO4A 3RJTA 1KGYE 1EQAA 4Y6OA 5HQJA 3DGGB 3GIWA 4M03A 3FTUA 2OCKA 3LKBA 4BNUA 4UTNA 1GPNA 1J97A 4F2HA 1JZIA 2W94A 1QFUL 5I0WA 1I3VA 3DETD 3GL9A 5AW3A 2CXSA 1R64A 2AW5A 4DKDC 3L0YA 3UTSE 3OLCX 5CLGA 1TNMA 4AB1A 2HTLD 2PUTA 4CM1A 4FYSA 5KANI 2YVLA 5TMPA 4B47A 3ULUH 1DV2A 5BVHA 4S0XA 3N06B 2E4AA 2ZAOA 4LHWA 4H20H 4EPSA 1S3KL 3PV0A 2F53B 2BJMH 2E9GA 3KJHA 3VD3A 4MHTA 4APXB 4LFCB 4IDOA 2NY5L 4HH3C 1Y6KR 1NRWA 1NVXQ 3DJ9A 2QT1A 3D3VE 3D02A 5DU7A 4EFDA 4ETYA 3OIGA 1X0VA 2FFAA 2JNZA 3PTZA 3V5NA 4N0UE 3DWGA 3Q8BA 3LKNA 1XD8A 3FB4A 7MHTA 3WKNA 2V5SA 2GK0A 2ERCA 3S36L 2UDPA 1K6JA 1MFDL 5CT4A 4G8GB 4UQAA 5EGNA 1UPBA 3QKSB 3KCPB 4JFHD 4WDIB 3BSWA 3I6ZA 3W2FA 2JIZA 2VA9A 4Q15A 2HSZA 3LA6A 4QRRA 1CV2A 1XU7A 3P2TA 3ZU2A 2D0GA 1ZVJA 5JPMB 5JFTA 5I0XA 3MRLB 5DD3H 1VZ2A 1R15A 5TQ0A 2GILA 3KDAA 3O4JA 4RABA 2ECOA 4RACA 2VKTA 2D2FA 4QAJA 1TEGA 2FEWB 2X6QA 4ZQGA 4AWAA 2PZFA 1T36B 4LRIA 2AC4A 2N1MA 2F53E 2XUPA 1K5NB 5CINH 4FQLL 1NI4B 4LLWA 4B7IA 1MRCL 1JA1A 2DOKA 4L75A 3ICCA 2LR0A 3Q9QA 1U8YA 3IAGC 5BW4A 1JA0A 2MQ0A 1U7PA 2CSXA 4E12A 1C30A 3E38A 2GJ6D 2BFEA 4LP5A 1L5FA 2WMOB 4PD4K 3LPAA 3BMOB 3UTSB 3RFXA 5FUCC 4HDOB 3MMEB 3JWOL 4RESB 4HBCH 4DUXA 3CPLB 1FUEA 1OTYA 2H8PA 1AZTA 2WKPA 1ML0A 1AHIA 4X9HA 1KNOB 3JRWA 5GZ6A 4H1HA 2AZAA 4L6CA 1YEDB 1S3GA 3MGAA 1R8JA 4C6SA 4TLMB 4GT7A 2OULB 2MDTA 2H8KA 1Y0LA 5B4TA 5K3SA 1UKSA 2F6RA 2AN5A 4P2QD 3FDFA 4B3EA 1RQPA 4M5TA 4GMTH 1BOOA 5IAKA 1PX8A 2XA3A 4I3SH 3BICA 3OAWA 4IRSC 4K73A 2W37A 1BVNP 3L8CA 4MWFB 4S11A 2VLRA 3VSDA 2Q9CA 2VQ6A 1QIHA 2A5YB 4OD3L 4LRNL 5F2NA 1WZAA 3TNJA 3K9WA 1WAEA 4UHBA 1B7GO 4YRNA 2OR3A 3TE7A 1J56A 3CFCH 4B97A 1FUKA 1A5AB 4Q4IA 3JQ7A 2AKAB 3BFKA 5C2JB 2POQX 1ZH2A 4LVOA 1X5HA 2VN4A 3LUAA 3MTDA 2J6EH 1ZVNA 1WZCA 2ZYRA 1XAGA 5L3RA 4X20B 1RRCA 5JHAA 4D9QE 4FHFA 4UT9H 1SZJG 3ZMNA 3MNWB 5DGXA 2P5WD 5K9JL 3TQTA 4R4BB 5DI8A 3K1KC 2VXTH 2R7NA 4Q7QA 1OTSC 2FX8L 2M8XA 1RQ5A 3W5MA 1EVEA 4IKPA 2ICES 1GPDG 4GWLA 4ZZ0A 2VJDA 3BMXA 3T4XA 2DLFH 2ATCA 3T0XA 3KJ4C 2J6EL 3FCYA 4P2AA 2QR2A 4E9XA 4UCQA 2DULA 1MT0A 1ROCA 3X1YA 4NAUA 1ZINA 3O4LD 1CB0A 2ZTMA 2MOGA 3QG7L 3EJZD 2VXQA 4HZLA 4PWEA 3GJEB 1GTL1 2H3NB 2D7TL 2AXJA 2EHJA 1TX4B 2FV8A 4E2WA 5E9DB 1J0BA 4M1SA 3UV3A 5BRPA 3AK4A 1LUAA 3K1JA 1E5TA 2V74B 1UJCA 2E7LC 1F8YA 2FD6H 4X94A 4NX0A 3NUZA 1AKJB 3KPRE 1NMCC 1UMBB 1GIGL 5CG1A 3LKRA 3FU7A 4KJWD 3SGJA 1G8SA 4U05A 3V0WH 5ITFA 4R9HA 1OXMA 3E9NA 1QK3A 1C5KA 3B2QA 3PX3A 1FV1A 3G3EA 2ABWA 5CUSL 2JCYA 3EO9H 2A0YA 3KNBA 1DQDL 2F2HA 3F90A 3BYYA 4KC3B 3CLSD 4ONGH 3WIFB 4R2HA 5TH2B 5AUPB 3O8BA 3D9QX 1CUYA 1DBKL 1R5BA 2PPCA 1KJ2B 1M2OA 2B59B 5DWVA 5E94A 5DH9A 4U1LB 1M2FA 4NZUH 3E22A 3EEIA 1Y3IA 1SUCA 4MNQE 1QO0D 3WKCA 3SSGA 5ETUB 2HIMA 2YRBA 3LV3B 1U8UA 521PA 3V0DA 1M0TA 1CUSA 1KBKA 2P27A 4ITUA 3A9UA 4B80A 4PLPA 1NLFA 2AV7A 2GCEA 4HS3A 4NQCD 4TKWA 2GAJA 4NMWA 3FZUC 2GTWA 4KAFA 4ZYVA 1M2OB 3ZX5A 1T3HA 3R0ZA 3A2MA 1SVUA 1A3LL 1BX2B 4XCXA 3HNPA 3SGLA 3P30H 1EINA 3T7RA 4BSWA 3MOQA 2QK4A 4G0XA 4EQ6A 1OAZH 2LFGA 1IBLB 1ZPDA 5GJBA 3BZEB 1QHHB 3DKVA 5CDFA 5TGZA 4FQ2L 5JRZA 4PJHE 3P0YH 1VIYA 4NCBA 2YPLB 1MMFB 2V5MA 3RRJA 1L2TA 2B4CL 5L40A 5KBLA 1HHKA 5A40E 5C9KA 5FR2A 4NP4H 4E6PA 1GTVA 1BS1A 3GLHE 2I7OA 5HY9A 3G2KA 4E88A 2P43B 2H2FA 3IEMA 5CJXC 2Q7YB 3OUTA 3JVUA 2O2GA 3VFUA 4EZBA 2XQYA 2EXYC 1EX6A 4EI5D 3H0TB 2B8EA 3EH3B 4Y4FC 4B6EA 4PHCA 2JLVA 2H0EA 7PCYA 3S1AA 4FFWC 4MK4A 1WZ1L 1E5UI 4TYNA 3EH5B 2EWMA 1T34A 2QGNA 4RQTA 2Q5EA 1IY1A 2O5NA 4I55B 4IOFC 5A16A 1A4JA 4IJVA 3KKLA 1E77A 1ZH4A 2ZBVA 4JCMA 3LJKA 4Y2NA 2BH9A 4H2DA 2NY3C 4Z7OF 4PU0A 1XD2B 2V6FA 1VHPA 1NUUA 2UX7A 1XD2A 3EVCA 5JXEC 3OWXA 2JVKA 4PEEA 1UFUA 1Z5HA 3B9KC 3P0JA 1ECZA 5HUQA 4JJKA 5A16B 1EK6A 4YRCA 4LOFA 1ODSA 4R2GB 4MP6A 3X2SA 1YBFA 2Y06L 5I1HL 4EQ3A 4M21A 5AWNL 2KWIA 1E5XA 3WD5L 5JHDB 3MT8A 3KBPA 4D26A 4CMHB 4UT7L 1ED3A 2HSEA 4WO4C 5E99L 3LCUA 3AWGA 2XEDA 3O0RL 3GLZA 3PB3A 4L8CB 4OJEH 4OHZA 1NL0H 4OM1H 1A8ZA 3B1FA 2JTDA 3HA3A 4G2NA 1XF2B 1KF0A 3RU2A 3AETB 5LQSA 4AKPA 2FX9H 4KDCA 1B41A 5IJDC 2HADA 2FJUA 1E9OA 3GEBA 2NW3A 1JNJA 3D0OA 3BYZA 1D2CA 3K9LA 2WZPD 1PWHA 1UJ3C 4WXEA 1YACA 3PL1A 1HCFX 1NQ5A 1Y0LB 4AKTA 5KOVC 3UYLA 3WHXB 4PZUA 3SKJL 3A6BL 4KBPA 1X3LA 5DD1H 4PSPA 4YDKL 5TVKA 1OR8A 1Z5WA 2W6ID 1FP7A 5HVFB 3ILXA 5IVDA 1IKNC 3ZDYF 4D2IA 1IOVA 4ZOAA 1ET7A 2W07B 1NVVQ 4GP4B 3CD4A 1LDNA 3AIIA 4E9TA 4TRNA 2H11A 1YQ9A 3OX8B 3VJ6B 3W5NA 3I2YX 3M1OA 5CYFA 1BWSA 3WI7A 4M8QA 1DQTA 3RU8L 2W9LA 2A6IA 3ECBB 4WOJA 4W9RA 2YHSA 4NV0A 4X80H 2CEKA 3MBOA 5KQRA 2XWQA 3MA9L 4CTNA 2P1YA 4RL6A 4BRZA 1U0HC 3I75A 4G83A 1MIHA 4G97A 5KYTA 3CHSA 1CZLA 3DHMA 1DQQA 2Q20A 5BPHA 3FNFA 1SM4A 1II8A 2ANCA 1JG7A 1CI3M 5BV8A 3PGA1 4EJFA 3M6AA 2ZM6B 3LCCA 1BQKA 1LEHA 4JX8A 1L5GA 4EN2A 2X4UA 1L7PA 3DI2B 2W6MA 6YASA 4E1VA 2OZ4H 5EJ6A 4MOWA 1K5DA 3NHPA 1O0SA 4K5QA 5G53C 4C0BA 1ND0A 4W9FC 2F67A 3O3CA 4BX3A 4RSMA 4XLZA 5JARA 3K96A 4BWVA 4WTQA 2ZOKB 1U8XX 4WQOA 3AIKA 1VLZA 2CMKA 2IYEA 4Y7DA 1MVYA 5AJYA 2YN2A 4XP9H 4FBMA 2QSCL 4UUMA 1Q1AA 1KRWA 1UBSB 4OZIB 4C1NA 4W5QA 4HS8H 4FI8A 3NB0A 5MHTA 3AC0A 3QPUA 4UOEA 5K3CA 4LSUL 1DZ0A 5K59F 4HAYA 3MXVH 3VV3A 3PEEA 5DZOA 2WJVA 1CPUA 5IULC 4HZLB 1XNJA 1XQ9A 1DKOA 2YYAA 2BR5A 4AGPA 2F1OA 4FT4A 3MLXH 2OJZL 3AVQA 4B84A 2G1AA 3N2ZB 2VUHB 5JY1A 4IKLA 1I6LA 4JPVH 2Z57A 2VQUA 4YUVA 3SDXB 3LBYA 2KMLA 1OROA 1EEYB 2ZE0A 4FL4C 3D64A 3N05A 4QGHA 1YNTF 4HJIA 1R0AH 4JAVC 1H5BC 4D9LL 4YJDA 5E0OA 1F7VA 3OEHD 4LZJA 5AH0A 4Q74A 4UJ5A 4I36A 3VYTB 3UMFA 2X6TA 4EY5A 5JIPA 1P2GA 4BZXA 5C0CA 3CSSA 3RVRA 4X7MA 3K0WA 2CUKA 5KCMA 4PPFA 2AW3A 3B9KB 1VKHA 4LGMA 1O0CA 4LARH 1BS9A 3BRQA 1DQVA 3W2GA 3AADB 1UM4H 4V2IA 2B7CA 4V0NA 3H0CA 3HZOA 3QLJA 5F1KA 2CJSA 5GRUH 4RTLA 4YX2H 5DYOB 4QHLA 3M88A 2CBQA 3RJ9A 3A6DA 2A9FA 5HA5A 3FSEA 1EBAA 4FFBB 4NZMA 4Q6IB 3BVNA 4AP5A 4YRMA 4R2KA 3V7YA 4BJLA 1MAJA 4P54A 2G0TA 1F0NA 2HFEA 4A3SA 4QXUH 1SGKA 2CNBA 2GXAA 4DETA 1YBHA 2R11A 4TQEL 2AAVA 4R0VA 1DJMA 2KBGA 4Q3CA 3AU8A 1RE1A 3MNDA 2H5JA 3I2JA 5JCJD 5E7FA 4TV3A 2B8JA 1BYIA 3ANMA 1SDAB 3EHBD 4Q4HB 5KJ7E 1NQTA 5HDRA 1BC5A 1JHAA 3FKJA 5ISZA 3CCCA 4FGJA 3VFGL 3ZWQA 1JVSA 4FWBA 1U8CA 4GKJB 3L5JA 5FWYA 3L7YA 2BMFA 3ZY7A 4C4ZA 1S7UA 4FDUA 1XMEB 4O4IB 5EJGA 3L01A 1E5BA 3QUMB 5E4EC 3ME5A 5AVZA 4TVPD 4LDNA 2IBGA 3PD0A 1U92A 4Y9RA 2QMHA 1CDUA 1Q0UA 3FQWB 1L3IA 2GBIA 5BVJB 2FUTA 2P5EB 5C8ZA 3OFND 2DLIA 1MB9A 2FSUA 4HQOA 4MVJA 4WKZB 4M4SA 2CXKA 3WTSA 2Y6UA 4WY5A 4I3FA 4I0PA 3ZHRA 1S7WB 3ZGXA 2DQFA 1N75A 4BZ2H 3G5MA 3GBML 1N7JA 4F1ZA 5ECDA 1T5IA 1MCWW 2C2GA 1I85A 4LDOB 1U0LA 1DLJA 4J76A 4QQ8A 4KKVA 4HKTA 3ERXA 5ES3A 1FFSA 3K1AB 1U99A 3J80A 1VCBC 3RTQB 4FMPA 3AY4C 2FGKA 3A4NA 2WLLA 4MRMA 5MFPA 3HRZC 1KB5B 4OFQA 4WFQA 2O7SA 1P4BH 1QS0B 2F8TA 3T3PE 4X7DC 4J3BA 4Q4AA 3ES6B 3SKNB 4OLBA 4XMKL 4FZEH 2LD4A 2XD4A 1NI5A 4UJ3A 1KO8A 2KL6A 3O03A 2VJMB 4ETNA 1OP3K 4PSCA 4MNQD 3JV5A 4NFYA 3LKVA 4GKOA 3HE7A 2X3FA 4YAQA 4JFEA 3RFZB 4G0MA 4ALAC 3AHCA 2NY5H 1AV7A 4P2BA 3RVKA 4QJIA 1W49A 4MRAA 3SY0B 4KXWA 2J0SA 3JAKB 2X1WL 4NKQB 1IY0A 2Z98A 4CGUB 3ZQKA 2O8BA 4JJ6A 3QUMH 2LOEA 3NS7A 1T8PA 4KXDA 3T4YA 2JLBA 3HG1D 1BE8A 1F1BA 5FYDA 4R97C 4MJIE 5DTIA 5B1JA 2IX9A 4XRCA 1FG2A 3BHBA 4AJHA 2G5BB 3WQHA 1Z5ZA 5FPSA 4FQCL 1WUKS 3U0TA 1B4JH 1QR4A 4R4FH 3NIDB 1DE4B 5DLMH 4J1TC 2W2TA 5I1LB 2BZ0A 3RFRA 1Q50A 3LNDA 1HH6B 2AUMA 2XYPA 3AR6A 5I6XC 1UJ4A 3PA8A 4B3CA 1JPTL 4D9LH 1NNI1 4OHBA 3RIFK 3RCBA 3FQTA 3KPPB 2VKXA 1QBBA 1EJFA 4YHYB 3CY6A 3IMBA 4QRUB 4WKPA 2IPAB 3QUXD 1K2VN 5F7FA 4P2RE 4OB6A 3SYPA 12E8L 3F7NA 1JK9A 5GWXA 2ZAMA 3Q40A 1BSVA 1ISSA 3TJHD 3W5UA 3JARB 1A1NA 2FDRA 1NSNH 3WTUA 4JRWA 4HJUA 1VSQA 4F7TB 5IIEB 2ORBL 4G26A 3FPYA 4LCJA 3UF0A 3D4IA 1BAPA 1E59A 1INDL 3NTLA 4BVKA 5B4MD 1I7PA 3LF2A 1E4XI 2V8MA 1RR6A 1Y5IA 3WIIL 3TIFA 5COQA 4GWGA 2PH3A 1QVVA 1KCVH 4DGYH 4XZ3A 1Z68A 35C8L 5EUKB 5IBUG 4PC1A 2BSXA 4WRLA 5K3OA 3BIAX 3RVMA 1AQ6A 4H4CA 4LKXA 1AHHA 3G8CA 4OQ4A 1INEH 5CD5D 3F58H 4Q4JA 2BTOA 2UX6A 5TQVA 4JGBA 3EUEA 1NSYA 3LP8A 4FABL 3TTUA 4Y1EA 1JZDC 4UE2A 3SHFA 4LXTA 3EZNA 3BGVA 4ELMF 4AJYV 2YWBA 1HXYB 1R66A 4I0PC 4JJHA 3EHDA 1E8YA 4EECA 2GCNA 3VDMA 4RGNC 4LMPA 5BSVA 1ZC3A 1GC1H 4LL1A 2LXNA 2B30A 1TJGL 3VFSB 4M9UA 5F33A 3O8XA 5A4KA 2B14A 3BHJA 1BYNA 4KKAC 5ITSA 4YL4A 1E30A 3LN9A 4NCC1 3KR0A 3QCUL 1IV8A 2AXWA 5EPMB 3U81A 5JSYA 4X90A 1H9BA 3W3ZB 2WSLA 3ZIDA 1CUVA 4WEBH 5T3ZE 3GRRA 3UX9B 3FKSA 4RFEB 3ZLVA 3ROEA 3N3EA 4OI2A 4V33A 1P7QD 1I8MA 1DPFA 2DL9A 3AQYA 4C83B 3NORA 1AR1C 2YC1B 1PZ3A 2OTPA 4LPCA 3EH1A 4UAHA 3MUOA 3LCYA 1XTIA 4JFYB 3BH8A 4U5QA 1QFXA 4JLOA 1G7MB 6NULA 1UQTA 1GQRA 3ILQC 2P4UA 1N5KA 5CGTA 3PWUA 3RYCB 5EUMA 4E2OA 3UWMA 1NPYA 3QPQD 4MUAA 1AXGA 5AWFC 4HWRA 4AMYA 2L42A 2G25A 2ALWA 3G9ZA 5J6HB 3CUVA 3NP9A 5BQPA 3WGNA 4QM6A 1A47A 4N9GA 4JJ7A 4OM8A 2CMRH 2WD8A 4JR1A 1WW3A 2OLEA 3L3IA 4ZPXA 3BGWA 4ABUA 4DGIH 5DT1H 3NFRA 3C5ZB 1IGYB 2FX8H 2NZ9C 4NOMA 5CMAA 1K8IA 4CZ2A 3UAJA 5GRXG 2CE2X 5A05A 2ZOUA 1NVGA 1PMYA 1D2PA 4KX3A 1AHWB 4GH7B 4XWOC 4ARCA 2ITDB 1U94A 3MSCA 4JQSA 3T3DA 1QIGA 5B3JE 2J46A 2OILA 2AX4A 2O61A 5ACLA 1TVDA 4IIJF 4DNOA 4EDFA 5A6LA 3MWEA 1M8JA 4O2FA 1LD9A 3VGAC 4U0KA 3CLTC 1PR4A 2ZRKA 3TB4A 1WG3A 4KXQA 5BXYA 1J22A 4C3UA 5FWDA 2FQ1A 3DIDA 1U80A 2DQYA 2YXVA 5MEQA 2YJGA 1NBMA 1CICC 3DHJA 3JTEA 3DUFA 3LIZL 5C52B 3NIGE 1X7YA 2GFBA 3GB9A 1VZGA 1AGBB 1AKNA 3UC9A 1FP4B 1L7DA 1EXDA 2UYYA 5I51A 2HRQA 2CHXA 1LCIA 3RWFB 3O11B 5FUYA 4KO6A 3CA8A 1RAMA 3WJMA 3HZZA 4JPKL 4GAAA 1PL0A 4J28A 3H6AA 4I1UA 5HYVA 3THWB 4EFKA 4G86A 2WD9A 4RAUA 4KPEC 5B58C 2VM4A 1XB3A 1OA0A 1P5RA 4TT3D 2Z3VA 3WFHB 2EDDA 4QJ3A 1JEYB 1NH6A 3CGWA 3PFWO 3FDZB 2UXDB 1ZN8A 4S0SD 2Y5QA 3REQA 2EHDA 1VPWA 1WSAA 1CD1A 3CW9A 4UM9B 2OOSA 2N47A 4DQLA 4GW5A 5MHSE 5GV8A 1W44A 2WJYA 5BWCA 1MXDA 4HUUB 1IQPA 5AESA 5CR9A 4PRIA 4DK5A 1FW8A 1G20A 2AKRB 4QPEA 2D7JA 4BFIA 3MMXA 2Q9AA 5E8DL 3N44F 3OLIA 2BRRH 1NICA 1FLNA 4PJGE 1B3IA 3G6DH 2W2PA 2PBFA 4MQFA 4RPKA 1HORA 3GSUA 3Q10A 4N0FB 3VMOA 4Z7QB 2UZ1B 5JAHA 4JMNA 4FXKB 4UOW1 5B1KA 2EC9U 3HADA 4TUYB 3B1WA 4DZBA 4IM7A 2OV3A 4IGBD 4NT6B 5F1SA 5IAOA 3B3BA 2FCBA 2O72A 4WVRA 1OB2A 5KJ6A 3Q11A 1EXHA 3BWBA 2YWJA 3SSAA 3L7JA 2RAPA 3EW3B 2DVMA 2HKIA 4U39A 2QRGA 4N5IX 5C08D 3TG8A 1SJHB 3VXSD 2OXGB 4CEHB 1BXXA 3B2MA 4FDMA 2YZMA 4FYPA 4P8RA 3BXGA 3V1UA 4F7CB 3HPLB 3W37A 1R0CA 3O3BA 1QZ3A 2PL3A 1YO6A 4HNUA 1A7RH 4G9DB 3QHTC 3GU3A 2V03A 5ILOA 3QXTA 1VG9B 4YJFB 2YICA 4FI3C 2XXMB 3SEZA 3DZBA 1XZHA 3QKIA 2Q3HA 2N56A 3DMMC 5C3MA 4PTTA 5IVKA 2QRUA 2NTEA 3OE1A 4UIKH 4L23A 4XN7A 2GM5A 5DS2A 1OF1A 4OA8A 2DLNA 1H6UA 5IFAL 1H22A 2FKAA 3KV3O 1PPIA 2C95A 3IXAA 2QL9A 4B09A 3I9V1 2Q50A 2ITCA 3W9DB 3MKGA 1P0CA 4GUOA 1KPHA 3N76A 1B2RA 2HU8A 4OIBA 2AF4C 4FR0A 1C1HA 2QVFB 5JUEL 4XM2A 3GWJA 3K5IA 1Z0KA 1R0SA 4M43L 4N7MA 4YJFA 1KMIY 3KE0A 1AD2A 5CD1A 4WWID 4K88A 2PD3A 3WKAA 3T04D 4AXXA 5CDTA 4NH0A 4BZ1A 1UKBA 4AGNA 1OV8A 1YQWA 4PJIB 1TTBA 2D3JA 3WTBA 3QULA 3PEUA 3G9AB 3T3MF 4QLAA 4YSTA 2B7DT 3ARTA 3AUFA 4F8YA 2UUBB 3HEBA 4YUZA 1JNNH 1SBCA 2OCLA 5CD5C 4BQBA 3HZHA 5EXDA 4NQVB 5HHNA 4EPTA 4M0CA 4WTOA 1EZLA 4V1DE 3MRRB 2EUXA 2WU3A 1YJDC 1SYVB 2QUZA 4OUKX 3RABA 4HSQA 3PFGA 3L0PA 4BJHB 3AXTA 1BQHB 4FRWA 2VBGA 2VLLB 4KRPB 4KREA 3RO7A 1E4HA 2DWPA 1NINA 2XCOA 4D9NA 1XGPA 1DUSA 1DVSA 4RZHA 3QEAZ 4TZ0A 1J8SA 1IEQA 5FGSA 1MD9A 3ZDEA 2D06A 5JPDA 1KTLB 2RCSH 1OHQA 4PLKC 2A0XA 1WTLA 1VXOA 3K4ZA 1NURA 3T71A 1KSRA 3AFOA 4TVPH 3I6IA 1A97A 1KI6A 2Q5IA 4HNHA 1CF1A 1C7FA 4UUAA 4GAJH 5JR3A 1U7XA 2H9YA 2QQNL 5C4IA 5F7EH 3T2NH 1DC6A 4IDJH 1CY0A 5T3ZD 3AL8B 2EXWC 3N70A 1MV8A 4PRNB 3KPRA 4AJLA 4BVAA 1AQHA 3JWHA 4RISL 3JYPA 5DFTA 3EFFB 3A6EA 3BO8A 2IJ0C 4ZD3H 4DR4B 1QQ5A 5HE9A 1CD1B 1G8KA 1DC5A 5CFOA 5CGBA 2EQAA 5DWUH 3ZWPA 4F9TA 3DXFA 1FNFA 3G9UA 4CG3A 4Z3KA 4TNEA 2Z2KA 1V96A 1L7IL 1HQDA 5CYOA 3C6SB 2NN3C 3NNDA 4R0MA 2FPKA 2X09A 2I32A 1ZY2A 4HU8A 5JAOA 2RBLA 2IPMA 1KJ2A 3EZ2A 4WI7A 1VLLA 4MVJD 2WBJA 4TXNA 4E5NA 4OZFH 1CZUA 4OCSH 1J5DA 2ARJB 3M3HA 2C1XA 1HL3A 3P9PA 3L95B 2BBTA 4J0DA 3OJCA 3KFXA 4ZJPA 5KWIA 5JW4Q 4Z95H 4OYRA 2F54E 3W6OA 4TTDC 2OS7A 3MQ4A 1OFUA 1E5QA 3TT3H 4DKJA 1W8EA 4N3GA 5EZPA 2ARJA 4OV5B 3T9WA 2VXSL 4UARA 3A4IA 4K3JH 4PR3A 1ZVKA 3KPLA 4PBRA 3L0IB 1UZ6E 3Q05A 4V0QA 4NNXB 4KGZA 2HBZA 2W6JD 3N50A 3MLVH 5ARBA 5IZCC 3MV8B 3MJCA 2GJKA 3VC2A 1V1JA 1Z47A 1KCSL 4GRMA 1K6MA 2ETVA 1CLUA 2F2TA 4E46A 2X1VA 5B37A 4PLOB 2O6DA 2LUOA 5I1JL 1PR5A 3DEZA 4NH4A 2IHTA 3VNRA 1U42A 3VH8B 1POXA 4MDIB 3KYNB 3HS8A 5KZCD 4B3JA 1EDBA 1KCVL 3DKRA 4H8HA 2EFGA 2X4NB 1CGVA 2NTJA 1BHSA 1BMQA 3AOEA 2VXQL 4B53A 2XRMA 1T6BY 3QXXA 1X7WA 4F11A 4HUVA 1PR0A 1PVVA 2CL6X 4K6CA 1DJSA 3PPVA 3EYOA 3FBGA 2YZKA 3UFXA 4ODIA 2AERT 4MNGB 3ZJAA 4KO7A 3L79A 1BPVA 5DCYA 2YY5A 2H2WA 1UA3A 4LSGA 3C5JB 3AR2A 2YC1A 2VJLA 2GEUA 2XI9A 1BZ9B 3T7SA 5EE3A 4IYKA 2QRJA 1LO0H 3NABH 2IY7A 3IT2A 3W81A 4KK3A 3ZDZB 3C8UA 1SKYE 3JRXA 4AMKH 4PLGA 2X4OA 1E63A 4PLTA 4BNJA 2ZT5A 2NYKA 1EX9A 5KDOA 3KVNA 4UQBA 1CEEA 3I8OA 2K3TA 4C22A 3QXJA 1YRWA 4NPHA 2C2KA 3X3GH 1L4LA 1XZJA 1ZDQA 3HEMA 3FGPA 4I9HA 2FSEB 2XKAA 2C29D 3QFJA 2HWKA 3TZVB 1QR6A 5F77A 2BVEA 4JLWA 4QWWC 4XPTH 1NM5A 5L6YL 2HDOA 4J4PA 2V9ZA 4P8QA 4L4ZA 5LPNA 1UT1A 3ECAA 4HS9A 4ZXBA 3O1LA 4JSTA 4XFKA 5H4GA 3F6IA 1AOZA 2IC5A 3BHMA 1IRAY 2WHVA 5D7LB 3BSZL 3QUXC 5F98A 1EVJA 1E9QB 3M8KA 4KTVE 4UU8A 1HT6A 1YJ5A 4FHDA 2FQGA 2OL4A 3FLAA 3ZUPA 2OXHB 1JPGB 1U7DA 3P9MB 4PNPA 2P28B 1BF5A 4CQMB 1DQSA 3WTVA 1GZPA 2FN8A 3GRZA 4EUNA 1Y6QA 3N43B 2PYFB 1RIUL 4YPFA 2IYZA 3VAEA 5J2UF 1WQ4A 1XCOA 4C3ZA 2D7MA 2CVQA 4PRBB 2Q9OA 4N49A 1KJZA 3Q85A 3ORYA 2UZXA 1F20A 3QI9A 4YC7A 2GEEA 2VCOA 3OQRA 4LLDB 1PG7W 4NY1A 3GMOB 2QSUA 4WJG3 4FQ5A 4LLQB 1DSWA 1NGZB 3RL2A 1NI4A 4PB0L 3GMOA 2ZOLB 4IY1A 4F5WA 4TOYL 1KYWA 5E6YA 5M95B 4H0LC 1TQUA 1M6VA 3I09A 4NZZA 3KDMA 1PT9A 3KB6A 1V1RA 3QEQB 3V4RA 3A1VA 3L5XH 2MYNA 4HIXL 2VISA 3FETA 5IEJA 4GF5A 1RJGA 1RPZA 1FN4A 2GQHA 3QISA 4HXBL 4MW0A 2IADB 2PFKA 2CDNA 3VM7A 4PQRA 4L4XA 1DR9A 1Q3TA 4O2RA 4KGJA 2R47A 5EP4A 4TUUA 3OPZL 2HFTA 1VE1A 3BQMB 5ALLA 5KUMA 4WZAB 3I12A 4UQDA 1KS2A 5F7BA 2I0FA 3BE5A 1EJ0A 1EEUA 1R6DA 3PDHA 3USZA 3JQAB 5F0PB 1JPFB 4YHHB 3GA0A 2YLHA 3ST7A 4KY2A 3V4UL 3NQKA 2J1ZA 4XPHL 2ZP1A 3EJJX 2W6OA 3MC1A 3OOSA 1V6CA 5FPIA 3H4IA 1KY4A 3IDJA 1U1IA 3FFCD 2BFDA 2V9CA 4XEHA 1IQ0A 1AO3A 4YE4L 4MPDA 4M7KH 2VDRH 3L43A 2RH9B 4GQPH 4FZJA 5FWAA 1E6MA 1KCRL 1FFXA 3IP7A 4P05A 1ESNA 5DYNA 1EKXA 5DRXB 2V3CC 5TJWK 3IQWA 3N3BC 2VJMA 1HEHC 2J8OA 4DWOA 3EYUH 3AJEA 3MREA 1BGXT 3PXAA 2GK4A 3NBXX 3QE4A 2YGOA 4KROB 4EVQA 3V3KA 1SVCP 3AR3A 3ES6A 1J23A 3I1FA 3RS5A 2JLWA 4LVHB 4FGSA 3AZOA 2X7LB 4EG1A 4UILH 5EA0H 1IQUA 1GY2A 2R2GA 2PGOA 1HQ4A 4FQJL 1US8A 3ED5A 1DN0A 2VATA 3DHYA 5CB6A 2DFDA 4P81A 2QPSA 2ARWA 4PJFB 3TMYA 3E6AA 3FNBA 3OC0A 3FNRA 1DGQA 3SQBA 3BWVA 6CGTA 1HDOA 4G6AD 4ODVL 2JA2A 2X6MA 3QHAA 1BA2A 3HBGA 2AQ2A 5FF6A 3CS3A 2DQTL 3PVCA 2G9UA 4G1VA 5G1OA 1R1CA 1HYHA 4W4OC 3P0GB 3ZTDC 5H80A 2HFKA 4DLXA 1E4WH 5F5XA 1OGAA 3IJYA 2A2ZA 5DULA 2L04A 4K8RB 1UXWA 1G5IA 3UMBA 3EGSB 3AILA 1P1JA 1OW3B 3WO4B 4GP9A 4LSQL 3WL3A 4BH7A 1RPKA 1MXHA 1QMUA 1XTQA 3OQIB 1RPNA 4TF4A 1LWJA 3CW2A 2R0WH 1NJ2A 4KRFA 2KI5A 4M1MA 3GBNH 2ZI3A 1G8HA 2ZX7A 1T1RA 4B50A 2WJHA 3A6GA 1MJJB 3KXFA 4J3VA 2XTMA 2X4DA 1G64A 1Q2XA 1BA9A 4MW6A 5GSRB 2YEQA 2A6JA 3FO1B 1SPBS 4NWTH 1AGPA 4P5SA 3SZUA 4M5ZH 1TK9A 4QHNB 4AXBA 3K6KA 1SOMA 4PAZA 1VDMA 1IAIL 2YAHA 2QAJA 3NASA 3PEVA 3D2TA 1I9GA 2YOHA 5F3HA 1AS3A 2VDOB 4C5CA 2JL1A 1SHMA 1T0NA 3LQ2A 3EF4A 3AUSA 4E32A 2XX1A 1IEVA 4JJZA 4G67A 1T04B 4JQOA 3PENA 4PPQA 1U0BB 1LV7A 3OKPA 1M0SA 1FLRL 3N0VA 1E0OB 4JPSA 4XCYA 4LVOC 4ZTBA 3HC3L 2NVWA 1QLRB 3VFRA 3VO9A 5A0VA 3RQ3A 4QXUL 4JB2A 4KO5A 5DO2D 5ACZB 3JQ9A 1T1ZA 1OSEA 4EBQL 2FW1A 4ZZ3A 3OC5A 2BZ7A 4CADA 4N0UA 1E4KA 4GYKA 4ZXBD 3O73A 4EJ2A 4Y5VB 1AU9A 4BH8A 1NIBA 3PCXA 4KO1S 3GXTA 1PW3A 2XOTA 4L3OA 3HCAA 3HACA 1MOPA 5LBTA 1V11A 4D56A 3JD4A 5I6PA 2R5WA 4CI0B 3DECA 1CETA 3D25A 1WPCA 4NPJA 4ZDWA 3LHPH 5H5JA 4MJ7A 4X54A 2VWEC 4PRHD 1MJJA 4DVJA 2GVYA 1XQYA 3PYCA 2O8DB 1I7UB 3GGJA 1ISPA 4AKEA 3GXNA 1G3MA 4KDFA 1SQ0A 3JVGA 4AEFA 3RTEA 3FOBA 4BMSA 1RXEA 4OATA 3TG2A 2UKDA 1VL5A 2PA3A 1OSPL 1OAAA 2W5PA 4WLNA 2COKA 3HN3A 3FKUS 1A0QH 1L3BA 2AN9A 3UGXA 4H2CA 5DPMA 5LP6C 1UUSA 1OKEA 3MGOB 5AYTA 2KPOA 3FNHA 3FIUA 3QPXH 1NOJA 2DBJA 3SGJC 3MUZ1 1WNFA 2AK3A 3SKNA 4F7DA 5JNSA 1Z3IX 2BVUA 1B73A 2MMGA 1RVV1 5JDIA 1WK0A 2WKWA 2FT6A 4DK6A 3T9EA 4QRUA 2WHQA 3T0EA 1WXFA 2IWFA 4PRKA 3D1VA 1P84K 4XGRA 4DNFA 4J8RA 4ODWB 1DUZA 2CXRA 4TSKA 5AKGA 1WBZA 5K9JH 5D6OA 2VHVA 2XZAH 2PSJA 1GN9A 3KDMB 5TE4L 4W4OA 3QNFA 2XWJA 1TAQA 1EHIA 2VXSH 2OR8A 4PBTA 1TCMA 4NJAL 4IW4C 1HL7A 3MJ7A 2ZSUA 3T2QA 3B1ZA 3ZZSA 1NGZA 3RL2B 2LPMA 3RK4A 1I4FB 3EO9L 3MELA 1BREA 4FZEL 4PJXF 1Q6YA 1NW6A 1C3EA 1EAQA 3H2ZA 4K05A 5GAJA 1CY2A 5JD3A 3FQXB 5DEZA 1NWHA 2D54A 2GSIB 4PJBE 5E7BA 2GN9A 1YRYE 3T94A 1JIVA 2EZ9A 1R10A 3PP3H 3DUUB 4IIZA 3K94A 3T0DA 4TRJA 4I5FA 1DO6A 4ZI2A 4OGQC 3E7FA 3NGBB 3QCTL 4KKAD 2DYPD 1R8YA 2DYKA 2DY1A 2QQFA 3LCRA 2OXCA 1IOWA 1RMFL 2FWSA 2Y7QB 5FFGA 1W52X 3DL7A 1Z7YA 3D0LB 2DRUA 4CTOA 3QY9A 4CT4B 2VC2B 3WHE0 4QTTB 4BLQA 1GGUA 4CKQA 1CFBA 3J7AC 4NOFA 1L8QA 3ZEIA 4Z8FL 3TIEB 1FXWA 2YDXA 1UATA 4PS4L 2NY5C 1YIAA 1XNGA 3ZGIA 2WILA 3PUCA 1PKQE 3H1ZA 4K71C 1Z7WA 5JSZA 1GXSA 5J12B 4M7WA 3VZQA 2MSEB 4LWOA 3K71A 1D6NA 4WEQA 2Z8YA 4ZVOA 3T5MA 2QHRH 4TX1A 3IOCA 5AW6B 4KTYA 5B30A 4E0RA 2B2XH 4BFNA 1SA0A 1KTKE 4CLRB 1M6VB 1FYHB 3GJFK 1G20B 4KRPC 3PNVA 1UPXA 1H5QA 4M5ZL 4KLAA 4AZ0B 4YMUA 4EFLA 4IS3A 2PKEA 1OM9A 2V59A 1LNUB 2K7QA 4NZRH 1GWNA 1KFCB 3C3CA 3GFRA 2ORBH 4BNDB 4F86A 3T9DA 3ABGA 3LNEA 4QRRD 2D2IA 3MWKA 4ND8A 3MYJA 4UM9A 4JLDA 5ILTH 2IDFA 4XVUD 3P77B 3RDTA 4MWSA 3OMNB 5JZ9A 3JPYA 2RI0A 4F4HA 4JK3A 2H1RA 5DHYA 5E8PA 1IARB 3QZMA 5FWRA 2DFTA 2WTOA 4JRYB 4CXMA 2PANA 1CR2A 2K6YA 3NETA 4G1EA 3WS3B 3QELB 2IP1A 2XBZA 3VFNA 4MR7A 2QHLA 4QT0A 4IS2A 5J5VA 2OJEB 5C1IA 2XDYA 1OBFO 2GT9B 3KXFE 5AM5A 1EQ2A 2VHYA 3WDMA 2G0LA 4M54A 5HVNA 3HR7A 1TADA 5AOMA 1V8ZA 5DLEA 4D4GA 5DM2A 2ENWA 4GXNA 1P5UC 3B1TA 5AFSA 1YGPA 3UH8A 5D1ZI 1LTQA 2FPMA 3BN9D 5D6DA 1TOXA 1IBRA 2WHEA 4BJ1A 4XWOD 1YZLA 2R69H 1YZ3A 4DLKA 5LGKA 2BW5A 4R2XA 2OL3B 1YA5A 5D4JA 2NACA 2V7VA 2J0UA 5CKGA 1ACJA 3L1FA 4O2BF 2CHFA 5D96B 2RAMA 2J8ZA 4PRZA 2W00A 2WLNA 1P75A 1WEKA 4XM1A 2NYVA 2FZWA 2NY0D 4WUUD 2W6NA 3FSJX 3BE8A 4J3OF 5A4FS 5J13C 3PFBA 2ZIXA 3HKCA 1IIIA 4DAEA 3MGGA 3U9SA 4XMPL 1ECFA 1NVMB 3D3QA 5IANA 1V3JA 3Q9NA 2FW0A 4CWAA 4P1ZA 4JLAA 3BAEH 4N1EA 3M33A 1EUDA 3N6YA 4LI3X 4ZPVA 5AK6A 4OLEA 2PM8A 1XGYH 2YYYA 4XOEA 3PWNA 3KYIB 5CMLA 3AIMA 8CGTA 1UA6H 4APQA 2Q41A 4FEGA 2D8AA 4G80A 3IMFA 3PUWA 2ADOA 3GSOB 4YWJA 5JYEA 3E53A 4QWWA 2XCRB 2W65B 1PG2A 3QI9D 4DQOH 3USCS 2DRIA 3NW9A 5CM8B 4Y8DC 5DWPA 1NFFA 3LQAC 4UOJA 2CDCA 1RXIA 2NZXA 1MAMH 5BMFL 4K3JB 1QF7A 2HLAB 2D8MA 5LP6B 5KYVA 5TMDA 5AW4B 5GGQL 1ZEMA 3PPYA 1UCBL 5CJJA 3ZJTA 3V4OA 5LCXA 1QP4A 1PJQA 4QAQA 4BZ2L 4E7PA 1S7RB 2R2BB 4CJ1A 3SX2A 1E3ZA 2FG5A 2CNYA 1U8HA 1PK7A 3VISA 2Q3AA 3WEMA 1JBEA 3VDAA 3FGOA 5J4KA 4JRXE 4LWZA 3TFQA 2P9JA 3AL8A 1S9VA 221PA 4JENA 4X5OA 5AG8A 2VHJA 4FDWA 1W9HA 1SKMA 1NT4A 3EC7A 2VG8A 4S10A 7MDHA 5EAIA 2MYPA 4Z49A 4AUYA 2E3VA 4D9BA 2PO6B 1A6PA 5E2WH 1ZHBB 2PZJA 3BE1L 3ND7A 2XQYK 2ZJ3A 4LG1A 4PFQA 5ULLA 4MXQD 2FWRA 5DZSA 1I8LC 1LWHA 3DNMA 1B1CA 2O5CA 2VLLA 1T6VN 1A88A 5C71A 1IB6A 1UADA 4CMAA 2Y2VA 5EEYA 2JGEA 2FB4L 2NUBA 4XVHA 4BE4A 1RDFA 2W2XA 3VD2A 2CFCA 4L6AA 1DIOB 5IOKA 2C9DA 5LP1A 2FJUB 5FHAH 4HC1L 3M1IA 4OXNA 1ZESA 5IHHA 3SYCA 3EADA 3OAZH 3VXOA 2VHEA 4N26A 2JI6A 4DH2A 1ADYA 4Q05A 2M2DA 2QGBA 1E5CA 3JYBA 2BFVH 1PZ5A 3KT0A 2RARA 2X9GA 3AVVA 4FOSA 4UILL 5EA0L 4IGKA 1ZHLB 4HFUH 5KVGE 2YN3A 1NLMA 3GAAA 4KH0A 3BD8A 5KNDH 2R8YA 3JWOH 2WYIA 5B3LA 3B1JA 2YY6A 3QIUB 2MQ3A 1JK9B 4LEBA 3IFPB 3MLTB 5E6RB 3GRVA 1HDIA 2IH5A 1Q9LB 2YJ3A 2WFMA 1XX6A 3QW4B 4J0JA 1U1EA 4DPKA 2YRLA 5E6SB 2XMPA 1Y81A 1E4XH 4R51A 1VPDA 5C8YA 5CINL 2P9YA 2XR1A 1JKMA 3UACA 1JMZA 3FU5A 1ZZEA 2XZOA 1PJWA 4K6KA 5GGSY 3JX9A 3M81A 3DR3A 1XTTA 5C3LD 2NPOA 3G89A 2HTKD 3QEQD 3ZHCA 1XGPB 5FTLA 3RGVA 4XXCA 4ND5A 1FG2B 4GVLA 2BFCA 3BP6B 3LLVA 5KYGA 2P80D 1CVIA 4LVNB 2Q9BA 1KG0A 3DCNA 4EY7A 1VPTA 3T9BA 3H0TA 1PZNA 3IFNH 4GW4B 1KT2B 1GL4B 1A1OB 4JEMA 2P26A 2XRFA 4U2EA 1ZXKA 3WDLA 2BSBA 4WZZA 1KZ1A 1WE5A 3KIPA 2EL7A 4U9UA 4OLYL 4LSUH 2V3VA 1Q7TA 3V9PA 1XF2A 1LJMA 3KLQA 3T12A 1JLKA 3SYLA 5CAYB 4DLUA 1HL4A 1F4YH 1KOLA 5CA1F 1IONA 3D0AA 3FTQA 3I64A 4WU7B 3W7BA 4ZAGA 4OFVA 2D1TA 3QJ5A 1XJCA 3QA9A 2ANBA 3NEAA 2B8WA 4RGNB 5DEJA 3INTA 2N3JA 1E40A 5C7XL 2OLDA 4FQIH 4OGZA 4PLHA 3F73A 1U8OB 1ORSA 5DJXB 3UFXB 3VI3A 2PWPA 3GXPA 1PJRA 5LCVH 3RVVC 1GRWA 3TM6A 2GBLC 4ODXA 4EI7A 4TTQA 4R2WA 1VZHA 3CVCA 3MLTA 4YS6A 5E6RA 1EBFA 2QD3A 1NJ8A 2EJBA 4JCCA 4ZT5A 1G66A 2ODWA 2YHAA 3DFUA 1WUNT 1XH0A 3LRSA 2WWWA 3W0WB 4V03A 4FNSA 4KQ3H 4A82A 3I04M 1UWYA 4OQFA 1M72A 1FC1A 1ECGA 5L4MA 4CKEB 1H1TA 2V9PA 4TVOA 3AM8C 5J4LA 4WV1B 3CN3A 5FGCB 2RK4A 2RCNA 3NJRA 3U3MA 1NQUA 1H3XA 2G83A 5F7OA 4JXXA 3N2EA 1JWLA 3FQ2A 1PN3A 2PO7A 2X2JA 5K9QI 3O2DH 2BEVB 3S96A 5K9OB 1R0BA 5E1AB 3ZNPA 5GGUB 5CVCA 2WZ6A 4M9ZA 1BD2E 4B4OA 2G63A 1IBFA 4K86A 2EAUA 3HPJB 1DNPA 3KCPA 4WDIA 3F5QA 3U3ZA 5HIJA 2GFBB 1G1YA 3UJTH 4DDHA 4A39A 5CU5A 5BN3B 4IOSA 2E4VA 1VJCA 2QTBA 2TRYA 1URLA 2PWYA 1WMEA 1F6FB 4OIIH 1J07A 4L4VE 2PETA 5I76B 3QUBA 5FW8A 5T3ZH 4Q4HA 4KDWA 1LD9B 3HL4A 1H3PL 2ZKHH 2IAAC 1G0DA 2EIDA 5T5NG 5AJVB 4AYXA 4PAMA 1U8MB 2JI9A 1OX6A 2F3UA 4KWUA 4DDWA 2IG2L 1OGTA 2JI1A 4IDGA 4MS8C 2V7WA 2VRBA 1CT8A 1Q1NA 4AVKA 1Z3GL 2ZJBA 3R76A 2GVDC 4PJ7B 1U2GC 2HA7A 2FPPB 2A38A 3AXSA 1QGAA 1YAIA 3VA2C 5E8OA 4EPRA 4JO5A 4QXPA 2JHAA 1SEBA 2WFLA 3TL5A 1E2WA 4K2UL 4GM1A 4UMSA 3JVDA 2OMNA 1KJQA 3UAOA 2HLAA 1SN5A 3H7BB 1AGDB 4D8XA 1U63A 2NNAB 4LPWA 2EV9A 1QYXA 3O75A 1NA5A 4EJSA 3W11D 3S3JA 4E42B 2FLVA 1Q1ZA 2BP3A 5TH2A 3K9BA 4PYGA 4OHWA 1TZCA 4PLKD 2MSCB 4GSRA 4UEOA 4G5ZH 4Z3OA 2Q4OA 2NY1C 2IYFA 2VLJE 4AZVA 1G5GA 4CGYA 1PFQA 1F38A 4WCYH 3ROTA 3DTVA 5IG2A 5SV3A 3LKPA 1ZWLA 1B2LA 1QPBA 5LIRA 3Q0HA 1ESDA 1XSOA 3FOMA 4HHEA 1NE2A 3GRUA 5LXVA 5IHUL 4D9MA 2IKQA 2Z56A 1B4JL 3U0VA 3CPJB 3O8XB 3SF8B 1U0RA 2ZKLA 2WPDA 5FUWA 1FUUA 1U33A 1IHUA 1T1YB 2APBA 4RW0A 1KVUA 1W46A 5IM4F 4GUDA 2Q3MA 1I9IL 3EF3A 2C9SA 1X9RA 1CYXA 2OCAA 4HDKB 4Q47A 4JWTA 4EF3A 5JS6A 1R00A 1IQDA 1G0OA 2NZUG 1P9OA 3ELQA 1XJ5A 4YQYA 2YFKA 4FDLA 3G5WA 2Q8PA 1YEWA 3V7MA 1O6BA 3N75A 2QTEA 1T8RA 3RUAA 1IY9A 1R0XA 4MS4B 3QZWB 4BEBA 3U1BA 1G3UA 2EGGA 2OX5B 3ARYA 2CHZA 1DSFH 4JFYA 2BPOA 1QRNE 4M8VA 1GFSA 4FC7A 4OQ1A 2NXZB 3HKZA 4EHNA 4MO2A 4JB3A 4NKIL 4L0MA 3QT2A 4HP5A 2KYRA 4RJLA 4QR7A 1EDHA 2HPVA 3G6AB 1DRWA 3DMDA 2FEAA 1L8AA 2FPLA 3WGIA 4KW7A 5FYLH 3VX4A 3QLVA 4Y67A 4G11A 4ZU3A 1J05B 4JR0A 1DSSG 2RC6A 3C4JA 4W4NA 1NNSA 3DF7A 1YUKB 2VRAA 2O7NA 1IHPA 2Q2NA 1II0A 3I74A 5F9FA 3EVBA 3DRQA 1Z13A 1I7NA 4OQQA 3M1BB 1M42A 2JJQA 1GAWA 3TESA 5FYKU 2XV1A 3WFBL 4ODBD 3MIZA 4I9FA 5JISA 2VK2A 1TU0A 1M9WA 4ZYTA 2JFGA 3AG4B 2GVNA 3GVCA 4UHFA 1Z37A 1G4MA 5TXGA 5C0FA 4EHIA 1NYQA 3IS1X 3H1FA 2BSSA 3DJFA 1NVBA 2IVFC 5ABZA 4LUCA 3JSAA 3OJOA 5KOHB 1T1JA 2X9XA 5J11C 1VDGA 3QUYD 1EDQA 5L4SA 4MXQC 5IN5A 3EVEA 3T9CA 721PA 4EUEA 2IW1A 2ZJ7A 2H6OA 4AKOA 4MJ6A 1A14H 4CVZB 4HXEB 5E9DD 1WW2A 2J85A 5ECGA 2Y99A 2A1IA 3F98A 5EU6E 1MCEA 2E8YA 1TYZA 2D4HA 4MS6A 2HN9A 4GRIA 1ML4A 3T4YB 4IDAA 3VMFA 5JE8A 4KWTA 2ORWA 2HUHA 4HAZA 3CPLA 3DOEA 4OCRH 1PU2A 4QYAA 1R3UA 2V45A 2WXFA 1QRNB 4M1CD 4TVPE 4AFNA 2HN7B 3B5TA 5I8PA 3ZLUA 1P5HA 3FQRB 4YE0A 1RUKH 2HC9A 4GG6B 2BINA 1SQ2N 4IMLA 4Y5VC 4Q93A 1YDFA 1JR3D 4RFOH 3SJAA 3OQ6A 5K39A 5LGHL 3INYA 1QFWL 4FINA 1DJNA 3NIGB 4KXFB 4G5QA 4JMXA 3S36H 4L8CA 1R19A 4GBJA 3C6MA 4KHXH 2RFXA 4U7SA 5EHXA 3TLEA 1D0VA 2V33A 3LO8A 4MWTA 5J56B 2ZRJA 1KFAH 1YONA 4ME6A 3TTSA 3RBZA 4K28A 5EPEA 1U91A 3JD1A 3QA3A 2H07A 3KLOA 4EW2A 2WINA 2WLZA 2WLLB 4Y9TA 2HIHA 3CH1B 1IX2A 3LL7A 4GI9A 2V1XA 4IOSD 3TTXA 2V96A 1VHLA 4R1MA 3SE8H 2B1GA 2FWBA 1CICD 4DCQA 1Y8QB 3WJ2A 2GK0B 5FPKA 2F54D 4NRZB 4OLHA 4HATA 1H94A 3FRPB 1E2QA 4G5OA 3SKYA 2PUFA 3CV5A 1LX7A 3P9XA 3SDCC 1ZRMA 2AITA 1U5AA 3Q2CA 3QVJA 5D7JD 4APXA 4UEJA 3MCLL 7GPBA 2ZWYA 4YXWD 2VPZA 4G65A 1NXXA 3E48A 4Z7UA 1CJTC 2GO7A 5FYLE 5E8RA 4LJ9A 2CHGA 5DBIA 3RNOA 5A3VA 1HWHB 5D7SL 5IW1B 3A22A 1V5FA 2PABA 2GPYA 5AKTA 2LCQA 1C8BA 5DCWA 4AVYA 3WTWA 4DJAA 3NUGA 5C09B 4W8HA 5FCUL 4N6OA 3EXIB 3ZKSD 1LPOA 3GSWB 3OR7B 2FHSA 4MUXA 1JPSH 3CSPA 1FVOA 3UENA 1SOUA 4UZEA 1S4IA 3RBXA 1AXSA 3C8ZA 2BEKA 1W6WA 2H0AA 1ZD8A 2HSJA 4LV5B 3VC1A 2QLBA 3EGEA 4BNXA 1MPXA 5F1OA 1AMYA 4DA0A 1TRHA 4NLLA 4O59O 4WNAA 2JDIA 4PM4A 3EUDA 3U1VA 2BCMA 4RZ2A 4YHZL 3PQ5A 5L53A 3WEOA 2NX5D 5E7JA 2I7TA 4LRNH 4TPRH 5GRJL 1LTXA 1RJZA 2QD2A 1LPSA 2KLSA 1X39A 2EJVA 25C8L 5BRZA 1ZD6A 1PZUB 2I2FA 1AZSC 4UDNA 5E51A 1Q95A 4GG6E 2DECA 1U7HA 2J9YB 4LZNA 1PY9A 1RKVA 2WM9B 2X4NA 5CEYB 5DHPA 1UADC 2WPNA 2XADA 5ANME 1W7AA 5J9PB 1A96A 1E1MA 4LSRH 4BWFB 2C4HA 2H7XA 4AI6A 1HILB 2DUNA 4IUYA 4QT5A 5KSZA 2ALJA 5HQ3A 2W83A 3S70A 1W1WA 3BW9B 4DV0B 5M5BA 3J2PA 4FXKC 3PPIA 3V0JA 1PQZA 4ZTPH 1TQWA 5IWLC 4XVTH 3G0GA 5I01A 1RK7A 3OWRA 2VDUE 4ZYKA 3FCAA 3RB7A 1IFHL 3TQFA 3TPKA 2J9ZB 4UQ9A 4N40A 5E4TA 1MVOA 4RWZA 2G3YA 2EO7A 1U8CB 1WH0A 4P5RA 1J9EA 2IH3A 4XNYL 3DMHA 4QGGA 5HDQH 1OAKL 4ZAWA 2C4KA 4LPVA 4DMFA 4GRWB 1OCZB 2FYVA 2YVQA 4OQYA 5IEKA 2R83A 4QUHA 3RSZA 3KYMA 2ZUQC 2FH6A 3EULA 1QE5A 3FD8A 3STWA 1EHNA 3L3DA 4R90L 2ETXA 4MICA 4MBOA 4DB2A 1MLBB 3IBFA 4MQ7A 3WNBA 2IWEA 4YLEA 1HOCA 3K0HA 2NY3B 3BTOA 3SZKC 3OESA 2PUEA 4AJ4A 1CXIA 3THYA 2J5WA 4AL4A 2WAXA 2ZITA 4BNGA 1PJZA 3HNVL 1YTUA 1MGPA 2OD7A 3E1KA 1P4UA 3CH4B 1V55B 3NHUA 1BNCA 1Y7LA 5IF0A 2G5UA 2QSJA 1H23A 1J8DA 1FYWA 1GKIA 3HB7A 1M7XA 2AN1A 1EO8L 3W9EA 4M37A 3D7NA 4MUHA 1E92A 1HXHA 3O2JA 1QLEH 1XR8B 3UZQA 4G6FB 1LDBA 4R7XA 2E21A 5BOSB 4OQPA 4YUXA 5HDBB 5KVDH 3HXTA 4RZCA 1RPAA 5FOTA 4PJFA 1MQAA 2P9RA 3AJRA 5TLSA 2IOMA 1QM5A 3CU7A 2ZXBA 3EJSA 4OI8A 2FBOJ 3ARFB 3EGDB 4DVRH 3S28A 1J0KA 2PJDA 4RY0A 4JXJA 1ZA3A 4BIMA 5KSBF 4LSDA 4Q82A 3CLEL 4I4NA 1KKLA 4QXMA 3AKZA 5JLZA 1GO2A 4IGEA 3UBMA 2CO7B 1CGXA 4K9LA 3HYRA 1X38A 2GJ6A 5MN4A 2DGDA 3PNPA 5BRNA 5C2BL 1E8XA 1MAAA 4C7OB 3KW8A 1WUIS 4TV8A 4NZTL 1EGJA 2Y07H 4I77H 4FFLA 2HHLA 5H0IA 1MIEH 2DUMA 2ZYTX 5CWSA 3O8LA 4LF3B 1IE3A 2A4EA 1CDZA 1C8KA 1A2BA 3AS0A 3QTLA 4GC9A 1OPXA 3HKBA 4LZZA 4LKRA 2WK2A 1TQBB 3S2UA 5FFFA 1J8HE 4R3SB 2IIBA 3VWJB 3NHAA 4HLUA 1DVUA 1QLJA 1JW9B 5C5EA 4MYTA 2DQZA 4JQZA 3TRFA 1RD4A 2O93L 4DZZA 2HYDA 3CU5A 4FOMA 4LYFA 2GLTA 4OFBA 4YMGA 2IG2H 2XJ4A 2H59A 2V2WB 5ITBH 1ZOSA 3RTQA 3ZV6A 3VD0A 3OPYI 2EDBA 3HEAA 3PLYA 4JM0A 1KGCE 2VMDA 3QDJE 3BF7A 4RGND 4X6BA 1UBJS 3K0BA 5H37A 5CW1A 3S98A 3X1GA 4FNMA 1YVEI 3GLKA 2VT0A 1MP0A 5I1DB 3X1EA 4N8PA 4NPAA 2IANA 1Y07A 4FHCA 3UTQB 4L37B 4S1DC 3HY4A 4NQXA 4NZUL 3O31A 3HCWA 1TUPA 1T0OA 2CB9A 3GLDA 4W9EC 5IH3A 4TUOB 4E30A 1A3CA 2WV3A 1YR6A 4A8PA 1BA3A 1O2DA 3B6SB 4EGCB 5ERGB 3OR6B 1ECCA 3GJ7A 3AUVA 2B34A 3R7FA 2Q1WA 3T1FA 1L3NA 3B5GA 4MW4A 3PUJA 4M7PA 3AM3A 1R0LA 3BK1A 4L3CB 4EJ1C 1G7LA 3D51A 3T06B 4OBXA 2NZVG 4IXMA 3ZC3A 4RQQA 1W4ZA 4PJCE 4PPTA 3DNKA 3QDHA 4ZMYA 1CP3A 4X6BB 2CJUL 1U7ZA 4M1YA 5DMHA 1UEIA 1F51E 4FDTA 4P9NA 3F5WA 2IUYA 5D70L 3BIJA 1WDKA 5IGXH 4NYMQ 5E5LA 2O05A 3TH4T 2C9RA 2AEPH 3NDYE 1NCBH 3VG0L 2FEDD 3JAMA 3TNYA 1G59A 4WW2B 2FFJA 4YAUA 4N0YH 1HGXA 5KX5F 3S8MA 1C7RA 2DQKA 1PLBA 3NCHA 2V54A 1AKRA 1E98A 1Z0FA 3FB1A 4IU2A 3IF1B 1J86A 1M7DA 1MQSA 1T6XA 1P4BL 2WCGA 1L5YA 4B2IA 3EYVB 1QE3A 4O2AF 4IMPA 5IJ9A 2DDQH 2Y1GA 1G21A 4KQ6A 1EYZA 1O3YA 3QYCA 4NULA 4TLSA 5C07D 2QLJA 5BVHB 2Z30A 1PJSA 3ZI4A 5EQTA 3N8GA 4J4PC 1E99A 4XNZC 5DFVC 3WHKA 3HB3B 1JXJA 2CKBB 1W72H 2VDRB 5KAQF 1K2WA 3V95A 3WLIA 4OSUH 4AZWA 3V0VA 4PZ0A 2RGGA 1XDBA 5EXTA 3BGDA 2EDQA 4DUPA 4IRJD 1L7NA 2DBLH 2W22A 2J6CA 3F00A 3SEAA 4MNGA 3U7WH 3KGRA 1JNHA 2PPEA 3W2DL 2BJVA 4OBBA 3WGUA 3VXRB 3ABOB 1U4NA 4BNMA 3IVKA 4NQZA 1OI7A 2C9CA 2LGJA 2W48A 3TBFA 4ID3A 1JHKL 1IGTA 2Y1CA 3CYFA 1A9EB 2ADFA 1G1OA 1QQTA 3H5TA 2DH2A 5G02A 6REQB 3RFZC 1ODFA 1CLCA 1IAMA 4BNYA 2H5IA 4OCRL 1MFAH 2JJSA 4TLLB 1NLBL 4OJFH 1KB3A 1UWFA 3MFQA 2XUIA 1E6CA 2W8CA 1QDUA 4NONA 1D4OA 5EG5A 2AQ3A 2YD3A 3WWYA 3IWVA 1RBYA 1ISGA 3FYUC 5G41A 1FCGA 3MLSL 2QZJA 4KR9A 1HY3A 2IPNA 2F58H 1LZLA 4HH8A 4FKKA 1PX4A 3OZAA 1G6HA 4PGCB 1YA8A 4LOIA 3KPLB 3IPCA 1G60A 4PG7A 2A6DA 3PQ3A 1J8MF 4OJAA 4LMAA 1DLFH 4XE0A 4NNPH 1PP4A 4PSDA 1ZK0A 5FOXA 2VT7A 4XOCA 1G94A 3HI1A 4XAKD 4NUMA 3KZCA 4MV4A 1W93A 1IC4L 5C5CA 2EEBA 4JFZH 1RYDA 1KF9B 2XN9E 3IXQA 5KVGL 4IOJA 4G56A 1FIGH 1QGOA 1X9QA 5DK0B 3GRFA 3IE4A 3QYAA 3FLEA 2VZLA 4MQLA 1QE0A 2I3GA 5I4KA 2DTXA 2CKBH 2FWUA 4P35A 1QCZA 3BH8B 1G7QA 3P45A 3O2WH 4F7PB 1U2HA 1JL3A 4PVLA 4HX1B 4K9OA 3PQ2A 5EDXA 1F3OA 4LYHA 3RWHB 5ERWA 3EZLA 1LFDB 1UB5B 5AI9A 2HLFC 2UVQA 3MV11 3CXUA 4AQOA 1P6QA 5FUVA 4HSCX 4ONFL 4Q9JA 4HU2A 1IDN1 3VG9B 3LHDA 5G1NA 3BKJH 2X6CA 1WFOA 4KXZH 4YDJA 3EFFA 2P2ZA 3K5WA 5EPMA 3H9SE 2WEKA 5HYEA 2HNBA 2H2PC 3APFA 1NIEA 2A6IB 3ECBA 4JKWA 1ACYH 2PS9A 1T9ZA 2FUQA 5ICZB 5DXFA 4YDIH 1HS6A 5TDNB 2OLJA 4OUOA 3FPKA 4HJJH 4S2SA 4UAUA 4D5EA 1KIRA 1CFJA 1NANI 1IATA 3D7SA 2R25B 1RKQA 1BCSA 4LBZA 2W07A 1ZK1A 3N7AA 4KGLA 3QRLA 2GD0A 4RWYH 5D2NE 4LQCA 4Q9AA 3F7VA 5DLQC 3OZ9H 5M34A 2D7OA 4M62L 2XOXA 2YIHA 3W39A 3T0VA 2ED7A 4Z3FA 1ESMA 1V10A 3KNBB 2TMDA 2DE0X 5HJ3A 1P2VA 5A2GA 3P4OB 2I1QA 5HTOA 4I9WD 2XG5A 3C3XA 4K7JA 4TVBA 4YFEA 5IHUH 4LSMA 2P5WA 4MI9A 5GRJH 4OTXH 2HA0A 3NT5A 4EPWA 1M1XB 1CDDA 2E4XA 3CO5A 4Q3NA 2PYZA 2ZCKL 1RLWA 2PGIA 2IAND 2PX0A 2H2GA 1QWOA 2P5UA 1Z3RA 3CIFA 3RWEB 4WJKB 2CMGA 4US0R 3NOXA 2QRMA 3HM2A 1X9LA 2GYYA 2YMLA 3QX9A 2BJML 1XFDA 4XQCA 3JV6A 4OKIA 3NFNA 4PC2A 3NHWA 4F3KA 4LNHA 3O81A 5AVTA 5I1KL 3TBWA 1SOVA 3APMA 4RV5A 5JECA 1F3DH 3CSGA 3QC6X 4I48B 1M7BA 5CK5A 1EAMA 2DBLL 1FNMA 2B4AA 4D3FA 3FONB 2GCPA 1SVNA 3O91A 1SBTA 4V3CA 4O4YH 4X8MA 3DVFA 1CCWA 4CL2A 4PTTB 4BU0A 2XLLA 1G7LB 4MB3A 1FQOA 3IV6A 2FXIA 5EY5B 3QO1B 2BLFA 1L6RA 1E1QA 3TA4D 4AG4H 4N3BA 1P4LB 1QZNA 3ZL4L 4MCIA 5DR5L 2FOLA 4LLWB 1IJKA 4G6ML 2LWIA 3N2YA 3BMCA 4RGOH 2WWFA 1J2YA 2CWWA 1S4MA 4A2EA 3KWWA 1F6LL 4NDAA 5K99A 3GGWA 3JVIA 3DBLB 2JFHA 1OKKA 2Y71A 1QATA 1KZGB 4JOQA 4WNIA 1FO0H 1PEKE 2NDGA 1NKGA 5IP5A 4OCNC 1OXSC 4NS1A 5IZCA 4DT1B 5I17A 4D0NA 4KMQA 2F7QA 3DXXA 4FMKA 1A9VA 4HZAA 4OXYA 2O0KA 1J1PH 3GS0A 5J58A 2C1PB 3QU2A 2X1OA 3HLKA 3TLJA 2JGKA 4M8UA 4B9AA 2IIVA 3HXPA 1BX0A 4B6JA 2CDFB 5YASA 5DK2B 1I9JH 5I30H 1WS6A 4JO1L 4P0DA 4MVBD 3KLMX 1I3RB 1ZHNB 3VJRA 4ZJYA 5A04A 4FZ8L 1YK0A 4OY3A 4DKTA 1F41A 1T1IA 5I7OA 5E2BA 4HKJB 4J4PD 2NQ2C 3D5TA 2R96A 3QHFL 2ZXFA 3ECVA 3L9WA 4H3VA 3QF7A 4LHVA 2FFQA 3OJWA 5A4DA 1W94A 2IOHA 3GJFA 4N01A 1FNNA 2C1PA 3B2VH 1NUTA 1UZLA 1U9ZA 2WVUA 5A5GA 4D82A 1ECPA 3R0QA 3GI8H 1Q5PA 5B3JC 3FRIA 1P5VA 4FT2A 4EK9A 4FZ8H 2BDEA 2ROYA 2EE6A 3F3KA 3LNCA 2XWDA 1CR9L 3KKEA 5KQMA 5A7HA 1N3NA 4MARA 3KYKL 3FUUA 2NX2A 3P2DA 1YVLA 2N7SA 3U13A 1OBHA 1GPYA 1XEXA 3P9RA 2JAUA 2R0KH 5LJLA 4U31A 2GBPA 1D4FA 3TN7A 1AKVA 3OHXC 2OZVA 2DWSA 5DUJA 4O4IA 2XQ0A 1QD0A 1RZIA 5AVRA 3FHAA 2QUJA 4RL4A 1HE1C 5AP9A 4EB6A 1V7CA 4PR5B 1ZY9A 3LO5A 2QSQA 1J5OH 4JRFA 2R1VB 2VPYA 4GX5A 1SCAA 1AURA 4PZPA 3CG0A 4FNTA 3N07A 3OIVA 4OJYA 1FIUA 4XB6B 6FABH 4IIUA 5HIAA 4PGEA 5K0GA 5HVHB 3SVTA 2YAQA 3F05A 1U3VA 4PZAA 3U9UB 3EXLA 2O2ZA 4HJTA 3OURA 4NYIQ 1ZTXE 4UAOC 2FZEA 1N8KA 1F5NA 1O6FA 3EOAI 4CMHC 3F3SA 2WKGA 3HN5A 2IV2X 4ZRGA 3HU3A 5IUCA 3AUJB 2H3NA 5FXMA 4CT5A 4B9ZA 3ZDBA 2C4UA 5ENZA 3D39D 1KGSA 2G5RA 1E9DA 5AXDA 2XXJA 1W2KT 4MVXA 1F3JB 3RPBA 1YI8A 4JH0A 3DFMA 3V1LA 4ZZ2A 2QR3A 3ED1A 4HAWA 4K26A 3B82A 3R7AA 1S5IH 2M26A 4WFJA 4KXVA 5CYGA 3DV6B 3X12B 1WXHA 4Q89A 5J11B 2WM0A 2XH8A 1MCDA 5FYKH 3PLNA 4ZUUB 1KO5A 2QV0A 5CDUA 4RMQA 1DVFA 4K15A 5IGXL 2HTKC 2A33A 4EB6B 5JLAA 5FKJA 2C0CA 3DHNA 2GYSA 4BRJA 1Y6RA 4OXKA 3NKLA 5I8EB 3D1JA 3S36X 4OF0A 2ZPUA 3STVA 1IBDA 1D09A 1WZLA 4P08A 2OFPA 3REOA 4HNQA 3SOBH 4Q1AA 5HYJA 2Q1EA 4WADA 1S7SA 1ZK9A 1TZ8A 3CVIL 2P2SA 4COKA 3VUFA 1Q4NX 3RUIA 3ILYA 1EVTC 5CZXC 4D8OA 4TZTA 1BEUB 1N2JA 3DBXB 2AW2A 3X2EA 4NTZA 3SM3A 4LCCC 2OCXA 1IZ8A 1EEZA 3C60C 1BF8A 4YDJB 4J39A 1SKAA 4QA9A 2NVOA 3LP6A 3O82A 1L7EA 4BXOB 1D7CA 1U02A 5C0BB 3ARDC 4DSZA 5JAIA 2FPRA 4XPBL 4AUMA 3UMNA 2WWMD 4QG7A 2BP8A 4ZMTA 3U48A 3GSNB 2JIPA 1R8QA 5LWHA 1GPLA 3P2KA 4UQ3B 4QAMB 2WSIA 5B7EA 4GRLB 4P4KA 4AQAA 2PSSA 5E2VL 1U2CA 3PK0A 2AVNA 4I50A 4M7RA 5H94A 2EIBA 3A1CA 1SXGA 3V8EA 2C7BA 4OP3A 3BMOA 3KXFD 1FNSA 2HWZL 4B35A 1MI5A 4B45A 2HIGA 4DCSA 2ILTA 2J6WA 3CQ9A 4POZC 5E8EA 2FH8A 3UOWA 5L2KB 3LE8A 1BEXA 3OKCA 3DOSB 5TGBB 1ZDMA 3NT4A 2NY6C 5A7EA 4EHAA 2ZIEA 5E3HA 1ADGA 2O26U 4YASA 4IRSA 3HWRA 3X43A 1IL0A 2WTXA 3IT0A 1XTJA 2OO5C 3DAGA 1CK4A 3I73A 4CR8A 4C8XA 1Z7BA 2BY4A 3P20A 4RNRB 4G8CA 4DR1B 2IAMA 3MRLA 3VB8A 4ZZIA 4ILDA 4XI9A 3ON5A 3GLEA 3NDIA 4A7PA 3HA7A 3HUTA 1FX0A 4QPJC 1CVSC 3U4EA 3L8ZA 3AP3A 1SURA 1B88A 1YH3A 3P2OA 1REIA 5AVOA 4TSAL 3TSZA 3DZDA 1W88A 2AJYL 4OB5H 1VE6A 3G88A 4ZRDA 4EKYA 1TEZA 4O58L 4HG4K 1G9NC 5HE8A 1WX1A 2CM6A 5BVGB 1JILA 1J8QA 2QAGA 3RGVD 4Z99A 2G5BA 3PD7A 3RWGA 2H31A 2FT8A 4IVRA 3I0NA 5KTEH 2UZAA 1XCQB 4MSUA 5JSHA 2AQRA 1RJLB 1ORSB 1BX3A 3GO1H 2JEYA 3A6CH 5E1QA 3TRDA 2XBUA 1IJBA 2J41A 2PMEA 3DR5A 4JOBA 2A6KA 3V7AE 3ML8A 3TW0A 4HWZA 1LS1A 4MNGE 2OAP1 4NAJA 3GVXA 4V3BA 2WMDA 3ARFC 3OMAB 4F24A 2A77L 3PQ4A 1J1OL 5DBEX 3QHZL 5I2IB 4XBEH 3CTTA 2D5AA 4GO1A 1PNTA 4RHFA 2E48A 3LWBA 3K5SA 1XTKA 1QUEA 4WENB 4N8DA 4DUWA 2GN0A 2J31A 3FKSD 3KWWB 4ELME 1A6VL 8LDHA 3CNQS 2Y4OA 4D8VA 3V0HA 2Z8VC 1OI2A 4JJEA 3MBKA 2DPGA 1PZAA 1HE8B 4WW0A 2C9AA 1TEFA 1T22B 4FFDA 1JFHA 2NO4A 4U7WA 4NQCA 3DCIA 2IS4A 3F85A 1BMDA 1KSHA 1ZO8A 3MUFA 4MUYA 4QAWA 2W2LA 2X2EA 3QEBZ 3A8TA 2EKDA 3I83A 1EFVB 3LKQB 2XHZA 1UM4L 4P4GA 4Z7UF 3FB8A 2VAXA 2D7DA 3FTCA 2QL6A 1MJGM 1JP7A 4RGQA 4YGAB 4HY3A 2HX8A 4R7NA 4IRSB 2NUTB 1KEGL 1G7IA 1TVMA 4LHUB 5E9AA 1G7SA 1QB8A 1WPXA 5IVXE 3OX2A 2FR8C 1F4WH 1YUKA 4S2UA 4HGNA 3KDPB 1GPJA 3LM8A 3L4VA 5DP2A 3VGGA 4BIIA 1T2QH 4JHAH 2I4RA 2BP7B 1ZVMA 5EO1A 5AKLA 3VYSB 1CGSH 3F3MA 2D3VA 5FTMA 2IZ1A 4WWKD 3GZKA 1RLOA 4POZD 1T83C 1CG9A 3IKKA 1I36A 3PR2B 4GI2A 4WWKC 3ANSA 5DO2C 3LUCA 3GJ5A 4ZHQF 2P3QA 5BSGA 2P5TB 3FWPA 1QQAA 4AYFA 2XGGA 5GMOA 3H85A 3GBEA 3MQFA 3MRSA 2PSEA 2IE8A 1NC2A 4KO9A 5C08B 3VFVA 3NA9H 1W47A 3A2LA 1QCCA 2AB0A 2WC1A 1O94A 4M0PA 4NN7B 1KI3A 2P44B 1QOQB 3ZL4H 3LPWA 5LYJA 2WPGA 1SULA 3CX3A 5CT9A 5SY6A 1GADO 3BXXA 5L45A 1VPVA 5JPMC 4I66A 4XWGL 3BVNB 1TD1A 1SBNE 2GSDA 3TPUB 1K7CA 4RO0A 1W2HA 1ARZA 1H93A 5GGYA 3ZX4A 2FNAA 3BVDB 1I8KB 1T9GR 1B0PA 2ZWKA 2B98A 1IM3D 4TV8B 3SE0A 4C0QC 1S9XA 4PGFA 4Y2OA 4LJ5A 4U7KA 4UREA 3VE0A 3GOHA 1FNSL 2AFVA 2VTBA 1VE9A 3BKMH 4ODTH 4U1SA 4PGHA 3GH1A 5AUOB 3L8EA 4MKIA 4NKIH 2E4ZA 3KPYA 4RZXA 4RIRB 3HG1A 2YD0A 3W5HA 3F97A 4HH4A 2C7UB 3RUFA 3FC8A 3TT1H 1VZ3A 3DZIA 3T77B 3T6VA 2CYCA 1W0KA 4BFEA 3ARFA 3EGDA 3LB6C 3NT2A 3NH6A 3HMXH 3AHJA 3CRMA 2X0NA 3FPBA 2ERYA 4MQBA 4JEIA 5IDQA 3IDGB 3CQFA 2B36A 3ZI7A 1L4GA 1BFKA 3W9YA 3NPMA 3CFBA 3TNDA 3PXCX 3MJ4A 2R68A 5KOIA 2ZYVX 2ZF8A 2W6PA 4YJ3B 4E22A 4CRWB 3HPQA 1YCFA 3L18A 2JLQA 1QC5A 3HL0A 1RZFH 3UXEA 1W6RA 3EYVA 3EFHA 2A5GA 3ND6A 1BG6A 1NGXA 2WJWA 9ATCA 3LD8B 5F71A 1UZUA 1BJ1J 5CGYC 2I7DA 4DP8X 2K9FB 4DJDC 1TVHB 2P0AA 2HZHA 4FULA 4D9HA 3DZJA 3STLA 1NDUA 1W0YT 4B3DA 1IUOA 1ZKDA 2NMSA 5ICFA 5LB4A 5JXHA 1WBBA 3G5XB 1RURL 2RHOA 1CGWA 5DV9A 1C1XB 5A0FA 1GITA 5A9TA 1K1EA 3ROFA 3NAMA 5I6DA 2CIKB 4BLUA 2XKNA 5FR3A 1UJ3A 1E3WA 2F8OA 1T2FA 2O8CB 1DQPA 1JDBB 1UOEA 3I6LD 5DSTA 1DWUA 1A21A 1EFDN 4C4YA 1OANA 3O21A 1TJYA 3WGUB 1PKQA 4BINA 3ZH2A 2G3XA 2OSXA 3B48A 4GKLA 1G5FA 3CVBA 2J9XB 3LDHA 3L7BA 1GGCL 1P5UA 3TCNA 1FFYA 2F1KA 4M9CA 4FNOA 1OT4A 4RQBA 4YSPA 4UQ2A 1U3TA 1GARA 3TJMA 1XNRB 1P8JA 1Q2UA 1I2BA 5J5AA 3K4DA 3GXDA 3T7KA 4MVJI 1TITA 3V2AR 4EY3A 3PUZA 1WR8A 1LO3L 3HMWL 2Z9BA 3GRYA 4RLHA 4QU8A 1RC1A 5B3JA 4YSOA 3H19A 4XC1L 4P04A 1GNLA 3UXFA 1WITA 1QYVA 2VK8A 2V6GA 1NWCA 3ATEA 4F3TA 3KR2A 4HKBA 3F2VA 1HE5A 3A6KA 1NCWH 1M2GA 4IRZH 2MOQA 1FO0B 2BNQA 1ODIA 2AJUL 5D1QB 1RHUA 5AW8A 1IL1B 2LT9A 1FZKB 5CNHA 3M5CA 4G6KH 4HQ6A 1XAUA 2WSKA 1OAYL 3FMGA 2HAZA 2N1TE 1GPMA 2V3EA 4D9RE 4NHOA 2C04A 5GGQH 3X13A 3E3LA 4PQFA 2GXUA 3M3PA 3UJTL 1YKSA 2XV0A 3Q2LA 4EKGA 2VH5H 1U3JA 5ALNA 1JZ8A 4G4JA 2FR1A 3DO7A 3L4SO 3KGUA 3U4AA 4NZDA 1PJ2A 3K92A 3NTUA 4TYMA 1T66C 2QDXA 2VAMA 4W93A 1CERA 1JHXA 4GYWA 5LR6A 1JYSA 1W6UA 2OUIA 4C4PA 3VG9C 4DBLE 2C3MA 3Q9PA 2QZ5A 1EBBA 3KD2A 4WJ5A 1WRBA 5FX2A 3DVRX 4YO0B 5KZCB 3RR2A 5IVOA 1U9YA 4X84A 4C4TA 4PJGF 3NAAH 3P0IA 3LIPA 3TZEA 5CEFA 2JLZA 2WLKA 2ZJ6A 3DX9B 3BXPA 3TURA 4HDSB 4Z9FA 1P2FA 1UPUA 1RC0A 3HI4A 2B5VA 3PJEA 3P32A 4RKQA 1E9SA 4WUVA 3CGTA 4ZO4A 4DN3L 1O5TA 4QVGA 1ZXQA 4I89A 2QMKA 3DDWA 4NO0D 4PSRA 1QASA 4LEXL 1C4OA 1TM3E 1LGYA 5K1NA 1AUQA 1Q7CA 3RWCA 5F23A 3V33A 1GCYA 3TN0A 1Z56C 5ARDA 2XTJB 2EFCB 4BKPA 3CSDA 1E67A 4LOUC 1NX9A 2QWXA 4J8RB 5ICXA 1YOBA 5AAMC 3K72B 5LQBH 3H5VA 2CUMA 1HSAA 4DMUB 4X5WA 3DHVA 4PG9B 1ONBA 4KKRA 3VSUA 4X7EC 4YXWA 3VAYA 3NCFB 2R23B 4MVJG 1P17A 2GF9A 5AKZA 2BDUA 4NESA 1UT6A 3RB5A 1T4BA 5ANHA 2WOBA 3ZWKA 2WT8A 1U95A 2CCJA 3G6JB 5JNLA 4AC9A 5CEZD 3DMPA 3DVAB 2Y1XA 1WDLA 5F1KC 2H52A 1LLCA 1Q20A 3JWNG 1SO8A 5A06A 2YSTA 3HUJE 3MX0B 5FPTA 3R3JA 1C0IA 2EW2A 2II6A 5J12C 1QXSA 3UK2A 5I2IA 1EPUA 4O29A 1KPVA 2DFVA 1MI5B 3VGFA 1JZ3A 1UBLS 1ZN2A 3OTWA 1XB6A 4L0PB 3ZCPA 4G9GA 2HH0H 1WBJB 5HDOA 3ZE0E 4WFEE 2G0KA 4I1PA 1VPEA 3NCJH 5LZ5A 5JC8A 2DH6A 3UT5A 4AY3A 4OSPA 4JIMA 3X1NA 3D50A 4R2JA 1U3ZA 3FE2A 2Q29A 1C3JA 3JVGC 2GPBA 1I0IA 4B17A 2EDFA 3IE2A 4P4NA 3S2ZA 3D05A 5LGYA 3QUAA 1NASA 3LX5A 3H5WA 1C9MA 1FGVH 3HB3C 1Q9KB 3SD7A 2WABA 5IROA 3UUWA 3GGOA 3OJ2C 5MEOB 4QRDA 4H8PA 5C0FB 2WTAA 2I7CA 2JC3A 2E6PA 1HE2A 3MLSH 3TDKA 1P4SA 3ZBTA 4IIQC 4CDNA 5IHWA 2ZI5A 1TJ4A 2WMPA 4FTVA 4MUBA 4FCCA 4ZUTA 3LIZA 1D6VL 3WGVB 4TUKL 2HRBA 2C5HA 3FO2B 1M75A 5CBPA 1MC5A 2DWEA 2VRCA 5EKXA 3PITA 3RUHA 3N0PB 3L08A 4MD5A 2PBRA 3BXEA 4R1PA 3RWHA 1NCNA 2WIKA 2MQGA 4TS6A 2VW7A 4RMVA 4ZS7H 4OZGF 4GOXA 4WV1C 3KM2A 2RE8A 4N6QA 5IYZA 3ZZ0A 2F7OA 3HB3D 2DBYA 3R9KA 1JDPA 2F1BA 1V47A 1CJYA 4YP6A 5C7OO 3RT1A 1EJOH 4H1UA 3TFKD 4INOA 3WLBA 4P36A 1ORQA 5JMWA 4FLOA 3RVUC 1W0VB 2LDXA 1YU9A 1IBYA 1E6LA 5JS2A 2QLTA 1PHPA 5AVQB 4O02H 3SDXF 5A2AA 2R6GA 4R3UC 5EWIH 1DG3A 5H2BB 5JNUA 3UW1A 1CJUC