2VC2B

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist l-739758
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
461
structure length
457
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 126
structure length 457
sequence length 461
ec nomenclature
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vc2B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vc2B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vc2B03
4DMUB 3TXAA 1JV2A 5HDBB 3AFCA 3EG9B 5KYXA 3ZQKA 3NIDB 1NA5A 3K72B 2ODPA 1RRKA 1XDDA 4MMYB 3ZE2B 4UM8B 4MMZA 4WFQA 5KYNA 1ZOOA 3IJEB 5KYWB 3EG9A 2P26A 2VDNB 1PD1A 3NIGB 1L5GB 1MHPA 3EFOA 1AUQA 2ODQA 2VDMB 1JEQA 3V4VB 3HI6A 4JDUA 3NVQA 1RTKA 2NVOA 4G1EA 2UZYB 5KYYA 4O02B 2XWBF 3TCXB 1MQ9A 1AO3A 4C2AA 4UM9D 2I91A 2I6SA 4WJKB 2NUTA 3RAGA 2XGGA 3NIFB 4NEHB 1N9ZA 4WK2B 1M2OA 4GZ8A 3EH2A 3HXOA 4Z7NB 2WW8A 1MQ8B 3F78A 3TVYA 4F1KA 5E6UA 5KYUA 1JV2B 4C2BA 1U0OC 4NENA 3N2NA 5E6SA 2NUPB 1YVPA 3ZE0B 1IDOA 1PCXA 4MMXB 4XW2A 3BQNB 4CN9A 3V4PB 4G1MB 2P28A 3PPXA 4CNBA 3AL9A 4O02A 4UM9B 5E6RB 4Z7QB 4G1MA 3HXQA 1M2VB 2B2XA 4O3TB 3BN3A 1MF7A 2WINI 5BV8A 1JEYA 1L5GA 2I6QA 1PD0A 2M32A 3EFOB 4BJ3A 5KYUB 3IJEA 3ZDXB 1M1UA 2VDQB 1OAKA 4HQLA 2VDRB 3OKYB 3EGDA 4FX5A 4M76B 3AL8A 1ZOPA 2ICAA 2IUEA 4HQKA 4A0QA 2NUPA 1BHQ1 4CN8A 4G1EB 4HQFA 1FE8A 1MQAA 1DZIA 1M10A 3QA3E 4HQOA 1T0PA 1U8CA 1QC5A 3PPYA 1SSLA 1OLZA 1MJNA 1M2VA 3EGXB 2NUTB 3E2MA 5KYWA 1TYEB 3K71B 5E6RA 1ZONA 3BQMB 3EOBI 3PPVA 1XUOA 1BHO1 3EGXA 1CK4A 3EOAI 1SHUX 3ZDZB 3K6SA 3FCSA 4K3JB 1IJBA 4IHKA 4IGIA 3FCSB 4WK4B 4MMZB 1T6BY 2VDOB 1CQPA 2X5NA 3AL8B 3PPWA 3TW0A 4C29A 5KYYB 3EGDB 3K71A 1SQ0A 1UEXC 1SHYB 1YVRA 1FNSA 2VDPB 4JX0A 3OL2A 1XDGA 3FCUB 2QTVA 3T3PB 4IXDA 2VDKB 1QC5B 1U0NA 1JEQB 4HQNA 1M1XB 1JLMA 3Q3GE 5HGJA 1N3YA 4FWWA 4MMYA 4Z7OB 4O3UB 2VC2B 1RS0A 1IJKA 2ADFA 5HJ2A 4MMXA 2VDLB 5ES4B 4WK0B 1PT6A 3M6FA 4NENB 3GXBA 3K72A 3VI3B 1M1XA 1IDN1 5E6UB 3EH1A 1V7PC 5KYXB 3F74A 1ATZA 1JEYB 3K6SB 2XWJI 4F1JA 3OL2B 3ZDYB 1DGQA 1Q0PA 1SHTX 3VI4B 1RD4A 2O7NA 1QCYA 3ZE1B 1LFAA 1YUKA 1U8CB 3OKWA 1AOXA 3IBSA 3T3MB 5E6SB 4PN7A 5LN1A
chains in the Genus database with same CATH superfamily
3HRZA 3SCMD 1WDTA 3T7SA 4CIDA 2VC2H 121PA 2VEDA 2R8YA 4P3PA 5FORA 2JLPA 2PR4H 3A0OA 1HEYA 3B9PA 3RK1A 1QZTA 4LQLA 4P33A 3CPLB 5MF6A 2PXXA 5LLTA 1YZQA 3OQIB 3GGGA 4LK3A 2G71A 3VU3A 4MUXA 2GSGB 3NT0A 1E9SA 2EBFX 5H82A 3DGCR 5C34B 4ZX4A 1QUPA 3L3OB 4DH2A 2Q4RA 2GN1A 2QSQA 1XQ4A 4YGVA 3BN3A 4P4GA 3I5YA 3HSSA 3DC2A 2Z5LA 1CDBA 5DD5L 1E43A 1Z0SA 3QHTC 1LI5A 1RZUA 4QG7A 4G43A 3KFLA 4JJAA 3ECWA 1TGYA 4MNGE 4OOFA 1PG2A 2JKYA 2BFEB 2R0KH 4F5DA 4FLSA 3I32A 1O9WA 2IBMA 3MVEA 3DC0A 1UYWL 2Q9AA 2I3ZA 4P0TA 2JBHA 4ZYLA 4MYWB 2AXJA 3OH8A 5ARBA 43C9B 4XWGL 1U1IA 4ZCTA 4BNUA 4PG4A 1H0HA 2C7FA 2PEYA 4RJKA 1KCUL 2DL2A 1BX2B 3MRKA 3GJFH 3R1IA 3PQYD 3KBFA 2GPNA 1NBOA 3O6FC 1XU9A 1KR2A 4HH8A 1QG6A 4BNWA 5I4BA 3L0OA 1HC7A 3S70A 3KEOA 2Z98A 3ZKXC 1MLCA 1QFJA 2WK1A 1KRWA 2A0KA 4K9NA 3TZVB 1HS6A 2VAVA 4CI0B 3VNZA 1FVCB 2GJZA 1NKTA 5AXCA 1IGYA 2EC9U 3O4OB 3ZHXA 3C98A 3LNEA 4CQMD 3UTPE 1U3YA 4FABL 2Z8ZA 1FQ9C 1P60A 4ENRA 3VDAA 3T15A 2BM8A 2LRHA 2VYRE 3ARBD 4PGHA 1EJOL 4KQHA 4HJGA 1M6HA 3VYRB 2PUDA 4IMLA 1FZMB 3MGTA 1OXKB 2HKAA 4JDVB 1PEKE 3RAJA 1XV5A 1MRFH 4U8GA 1O5OA 1CCZA 1E94E 2WYZA 3GI9H 1AZWA 4AG3A 1EHNA 2OD9A 2XCOA 3LD9A 1NUPA 1SXJC 5E24E 2YJTD 2Z3FA 5FBZA 2OV0A 5GJVC 5FUCE 2XZCH 4QAMB 3EBAA 5GRJL 4K9RA 3CLEL 2VZEA 4O4JB 4LESA 1GNRA 1I13A 3WL9B 4QEDA 1JHKH 2ICCA 5ED4A 3ZDZB 3KBPA 4BVHA 3A24A 2Q3ZA 1TENA 1INDL 2Y07L 1L9KA 3HDJA 3PNWA 2DLNA 1A6UH 3EGWA 1JHOA 2OSVA 3KOMA 4HKXB 4TLKA 1VADB 4AYWA 2BHZA 4I0CC 3LUHA 4LPWA 4Z3HA 2A9JA 4RCZA 2QL5A 2YZKA 3RVSA 4G8FA 4RA3A 3MXWH 1DQLL 1T9BA 1M1XA 3HPRA 1AP2B 4QXUL 3FPLA 3SOZA 4YDZA 1F6AA 5C0GA 2FDRA 1URIA 3W57A 4ARCA 4C06A 3F9CA 1E99A 1I82A 4V2UA 4PR5B 4W5WA 3ZDQA 4IRXA 2IOYA 5FEUA 5C2BL 4O1HA 3O3DB 1VIMA 4H8HA 1TT5B 2BRRL 4MAAA 1H23A 1F4VA 1O9HA 2JASA 3T1YB 1ISGA 2Z7ZA 5CK4A 2EWMA 1BVYF 1X4ZA 4BX3A 1B3BA 3VSCA 1J21A 1Y1DA 2ISCA 1DMRA 3GLZA 4HHAA 5F51A 1JPFB 1ZJ6A 4PLVA 5BO0D 2WIAA 4MUAA 4YK4B 1BQEA 2PX2A 4OZFA 1G6RA 3IMCA 1UC9A 2PGAA 3EXAA 4XTRA 3T5GA 3WBJA 1XDSA 2EZ4A 3QDME 3IS3A 2NTYC 1W29A 1OAAA 2VHZA 3GB9A 3ODGA 3PCYA 1DZIA 3GELA 1ICIA 4WZBE 3UN1A 3BX7C 3MWGA 1A9XB 2EDEA 2WSYB 4U1NA 1XTIA 4PGMA 2P80A 3BSSA 5CGTA 5HHVL 3EHBB 3AREA 3H2ZA 3FRPA 4JQVA 1O9BA 1EE1A 5AO9A 3G5VB 4L4TA 1JMKC 3CXHJ 4OX9B 1XF9A 1RQ2A 2RGXA 5TDNB 2HLFD 2J9YB 4YQFA 4P2AA 4OSEA 4NBSA 5IVXE 4XPFL 5I9BA 3V6OA 4QNPE 2ZWVA 4AE0A 2IPUG 5CHEA 2W2KB 1AGBA 5EORL 4E51A 4TS1A 2WXHA 4Z95H 3FNFA 4M0CA 1CETA 1FFYA 4MJID 2G9ZA 1X13A 4TRPL 4HDMA 4G4SO 2QRLA 1RD4A 1KTRL 3RJOA 5K8VA 2BBSA 4OQ4A 3TD2A 2E6UX 1BD3A 2UXFA 2GBUA 4MJ6B 2X1XR 4HEA1 4CETA 1K75A 3CR7A 3UGEA 4IJ3C 3ZIYA 3S34L 1OCOB 3T3MF 1IEVA 3MINA 1IM3A 2EUWA 3FPFA 4M9CA 3ESBA 4HWEH 3HC4H 4PLCA 5EZYA 3RGVD 3W5CA 4ESOA 1AXSB 2AHIA 4QRQA 2X09A 3ZQ9A 3F3HA 2HTKC 3AMVA 3G8YA 3K6NA 4US1R 3UJNA 4UUAA 4B9CA 3OCWA 3FFWA 1KI4A 5FYJU 2NPFA 5TNXA 1G60A 2GIYA 1U3DA 3NH6A 4PJFF 5BRZB 5GGVY 3QIAA 1B14A 2IELA 3E2MA 1NH6A 2FT6A 1A27A 1B43A 2H00A 4HWTA 1U9JA 4HLDA 4AK9A 5FKPB 4U7JA 5JWOA 2R9VA 4QUJA 1EUCA 2X3UA 4KDFA 3H9EO 5T41A 2BWDA 4PO1A 1NYTA 1NI3A 4OLWL 1BX2A 3KSUA 3QVXA 2Z8XA 3FB6B 1D1PA 5DUPL 2WJZB 1MDAA 1W34A 1IM3D 3UJJH 2FMHA 2B2XH 1RPQA 4IVNA 2I7XA 2OHHA 3EYQC 1EFRA 4N1CA 1PKEA 1HCFX 4MR8B 3DPBA 3SQBB 3W77A 1R3DA 4WXRA 2UZ1A 3CF2A 3KW7A 2A1IA 2R4QA 5IZCA 1D6NA 2RAFA 1MH1A 2W60A 3WISA 5I76B 1NQOA 5IB1A 3UMCA 2F9MA 1WUJS 3FSWA 5G5DB 5DT9A 3WGUA 2MRYA 3PV7A 2BVQB 1OZFA 3HJEA 4JYCA 4P7BA 1IQWL 1X2EA 5B3JE 3NHSA 5IHBA 1NBYB 1I9IL 4E9SA 3ZDXE 5EF3A 1E5CA 2VLLB 4F7DA 4BUQA 4X6BB 3FYCA 3OEHA 1KCVL 2ZE0A 5HHOA 1Q21A 1UC8A 2EO7A 4OOEA 4BIMA 2JKXA 3L7OA 1ZJWA 4AY0A 1X7HA 4AB1A 3EOAA 3TO4D 3AJ8A 5I18L 4MB0A 4KIJA 3KYCA 1YCFA 1RUMH 2CKBL 1GDTA 1QFUH 1OH7A 1KCLA 3ELWA 4RF3A 2ENSA 2FSFA 1S8AA 3FSVA 4QXUH 1K4MA 3KNBA 3T0EA 2VJNA 4JFYA 5IJAA 2PPCA 2AXQA 3JSAA 2ZOSA 1AIFA 5AYUH 1V96A 3D02A 4DV2B 2C7UA 4O4HB 1TXKA 1Y7HA 4RPCA 4X7RA 2IYPA 1JG4A 5CBPB 2H4HA 1M9NA 5FBQB 3MNDA 1LK2A 2BERA 2I9LB 2ENQA 4Q7QA 2IYUA 1A4XA 4CKVX 1KFEB 2CKDA 2JFFA 5DMXA 4BKTC 3DYOA 4P81A 5DVNA 5AJXA 3KELA 5TQ2B 2PABA 2W8BA 3H1PA 4TSCH 4A7VA 3ZIAA 3C75A 4HAIA 3UYOD 2XV3A 3LNFA 4MKFA 2QW0X 1WSAA 2FD6H 3EBIA 2KI6A 3FN9A 3QSGA 4MDEA 4N48A 4BDTA 3BE4A 4Y1AE 4GO9A 3OM9A 4XGIA 3PL5A 3IOYA 1D4ZA 1JUFA 1IHUA 1J0KA 4WESB 2QUIA 4QXWA 3AUXA 3LNTA 2ZPTX 4JFQB 4RANA 1C2TA 1GOTA 3R0IA 4UQ3A 1JKJB 3MN1A 3UCEA 4Q6WA 8ADHA 1KB3A 2OFQA 3QEMB 1OM9A 3BP4B 2R79A 4QFBA 5HJ3A 1MNUL 3U3KA 3ZO9A 1QF9A 2DETA 1DR9A 4LEEA 5LXTA 4O3MA 2J8UA 3SY6A 1MQAA 3O2DH 5J5CA 4YNYB 1E5BA 1NCAH 4KITB 4KLAA 3FCCA 2D8KA 1PKXA 4QT5B 3DLQR 4MDIB 4TPKA 4LLDA 2VXCA 3C7AA 4Y1SA 3U60B 1XZCA 1EAPB 4PIVA 1O6ZA 4UBLA 5BXQC 5F2KA 4WLCA 1TEVA 4OD1L 1YZFA 2LV4A 1WBJB 3CKMA 1W1IA 2PH1A 5ACZA 4EM6A 3QEGH 4BEBA 2KMWA 4OF6A 4RX4A 5TS3A 4XUEA 1QEWB 1GPAA 2RI1A 1VGQA 1IWPB 4WWHA 3U4DA 2HN7A 2NXCA 4W81A 4JASB 2O61B 5THXA 4CTOA 2R2BA 4YDKL 1T5SA 1FJGB 5E6SB 3TL2A 5CJ2A 2JJ1D 1LMIA 2FX8L 3K9LA 5CVUA 3G9XA 5SYAA 3ZX5A 5C0AD 3FHEA 2GNAA 1QPPA 2H0EA 3E35A 4ZZ1A 4RFSB 1LLAA 5F1KC 3F7TA 1SUHA 5JAQA 4NQDB 5IBUB 4LECA 3BF8A 4JITA 3RBZA 4AQ7A 3G5ZB 1NEZG 2VSQA 4OUOA 3C6KA 5F89B 3GNMH 2H26B 5DRWA 6PAZA 3O8NA 2V59A 4EOGA 2ZG2A 4KO8A 4G6JL 1KJVA 2NO9A 4NONA 4HN9A 3BFPA 5KWYC 3V6OC 4YAGA 2OV6A 2PXYA 3X1NA 1H1TA 2P5YA 4JCCA 5DVLA 2YAOA 4QWWD 4HDIA 4WGVB 2FP4A 2QD3A 4P3NA 3OPZH 4ZI8A 2FJUB 1NBYA 4PJCF 3GRRA 1YI0A 1Z5YD 5IHUL 2PXCA 2XVXA 1UKTA 2NMVA 3ONEA 4LYHA 5FWDA 1V1MB 2X2EA 3SDCA 3HG0A 3VE0B 3H5WA 4G5XA 4WLOA 4PG5A 3BWAB 4ND8A 2HKIA 3WDLA 5DULA 1JPSH 4NZFA 2Y36L 1TG8A 1QBLL 1R34A 1DLFL 2GTZA 2OL3H 2XKUA 4P4UA 3TBBA 2I7DA 2CSPA 3P0VH 4CFSA 1KB9K 3G9VA 4GPIB 1GMIA 4UVIA 1I2ZA 3TW6A 3DV9A 1I9IH 2YO3A 2CLZA 2XRMA 3NTVA 1JZEA 1IQUA 1IVNA 4V0NA 3WFHB 4A39A 3DTXA 4FQLL 2QJOA 4NDNE 4RD3A 3MV8D 4AGOA 1PL6A 2JKVA 4O1MA 2VDLL 1UD2A 3RWHA 1Q9WA 3MRGB 4UXIA 3IKLA 4CR7A 2VP4A 3FFDB 4G5HA 4FC7A 2W0MA 1YFZA 2H4FA 1QFUL 3P40A 2VUHB 2HR1A 3A6KA 5BQ5A 1OU4A 1M57B 2V2WB 1YGPA 5E1AB 4LNHA 4LWPA 3TFKC 5DU2A 4TV8B 5LMNB 1TADA 2NYYD 3C4QA 3O4HA 3QE5A 3E9CA 1E8ZA 1DQRA 1CY7A 2R2CA 2CUMA 3JWDL 3FSGA 4KGJA 3Q2LA 4LC9A 3FQRA 1YVDA 2ZP1A 4EI6A 3FFCA 1NF2A 3L46A 2E76C 1YC8A 4K23H 4QOFA 2I3GA 3Q2CA 2O05A 3TPKA 1OGAD 1D5IL 4I9UA 3RC1A 4GQ9L 1I1FA 5L4FA 2VYVA 3OHXB 5BO1L 1M34B 2W4QA 4AITA 3NEPX 2EIBA 3T3OA 3RS5A 1SC6A 3B7GA 1C4OA 2X6UA 5B1BB 1LTQA 1U8IA 3SKMA 5HBBA 4PF1A 2F1OA 4QOJA 1EO8H 4M7PA 3SPGA 2C9YA 3A0RB 1MOZA 1KY6A 5IBUG 4Y1FA 4CSZA 2VR6A 1MXDA 2MNJB 3W8DA 3AB3A 4HWBH 2BHRA 5F7EH 1C7IA 1U7XA 2GFBA 1URPA 4LEIA 4LMQE 4F5EA 3V4RA 2A9ML 1FFPB 2WWMD 3ZN2A 3O2DL 3VTZA 2RALA 3R9XA 2F8TA 4X80H 3F2LA 4NQQA 1II8B 2XTSA 1KMCA 1FTWA 1X7DA 2WVGA 5C92A 4XIJA 3P20A 2XSZA 3RAJL 4YAQA 1ITZA 2IXQA 2FJFB 3PUHA 3P2BA 3UC2A 5KQGA 3UC0H 4PD4K 2DUMA 5B57C 1U63A 4HAZA 4N8DA 4DGVH 4CCWA 1E2UA 1II8A 3QBTB 1G7SA 2VXQA 4X1YB 2WIGA 5AHRA 4MJ3A 2OMTB 3T5TA 3WLMA 3L6RA 1SQ5A 1JKXA 1V5IA 3MWDA 2J9RA 1YC5A 2CXGA 3Q9PA 1A5TA 2YJNA 3AG6A 2UV3A 1KZHA 3OY7A 3FQ2A 1UBTS 1UB5A 4KZEL 4CDMA 3GI8H 4RA6A 1E1CA 3KHKA 1PSZA 1GEGA 3DX9A 1N3YA 4X6DE 4OUUB 4KPFC 4JI1B 5DJYA 1WTCA 2H85A 5MEPB 1THAA 2C1PA 1U8KA 4HDAA 2UYYA 2XUAA 1HX0A 2NNXA 3MRIA 1EJBA 3E2HC 4ZWNA 4EUEA 4NXKA 1KH1A 1KMQA 4LHYA 1EWRA 1N12A 3WQHA 3AFCA 1XQVA 3LT1A 4MRMB 4IJ5A 1ZUWA 2HB0A 1MJ5A 4EHDA 2OLDA 1ML3A 1A9RA 4BFNA 1V5GA 4RGVA 3PWTA 3N5CA 2A9OA 1L7VC 1HLFA 1ZK9A 3O91A 2VN8A 4ZMVA 5KSOA 1BV8A 1D2OA 4A2CA 3O95A 2WBJD 3AWDA 4MQBA 4Y5VB 2DFNA 2E5WA 4WOCA 5BYJA 5BUPA 2B4QA 4TVSa 2UUAB 3ZOZA 4BH7A 4LMBA 3NRBA 4P2BA 1N25A 4CGUB 4BZXA 5DMKB 4TTVA 4H4DA 3O1HB 1XVLA 1Z4QA 1N5AA 2GD2A 1Z9LA 3MXTA 4AJEA 3FZEA 4YQYA 2AXNA 4TTPA 3G2LA 1W52X 3AJAA 2WUEA 5D3KA 3EDFA 4R4FL 1X87A 1TA0A 4KKBC 3MAGA 4WWNA 4W9NA 3UG6A 3JQ7B 4WUKL 4WK4B 1MUJA 2YUXA 3AT1A 3BWMA 3DAOA 2P77A 1QFWL 3NOOA 1DC4A 3K35A 4J23A 3RA7H 4CM9A 2Y23A 4H18A 1QR6A 4AX4A 2ZCLH 1QG4A 1U1CA 2Q2OA 2J20A 2N0MA 1PIGA 4HBGA 3QFFA 3IVKB 1RVFL 1NX9A 2ADOA 3EUUA 2MKWA 2Q3LA 3KAKA 1OTXA 4XASA 1IH8A 3L8DA 4Q9IA 1MCNA 4DEPB 1VTKA 2YNMD 1NINA 4H13C 1OXVA 1ZHHA 2C8KA 4FULA 2WILA 4QJ4B 5GZOA 1TQDA 3TLZA 1R3HA 4YSAA 1EZLA 4HF7A 4IU2B 1T3HA 1UXSB 2H16A 3W3AD 2QRNA 3SNKA 1O54A 4B44A 3F46A 4R40A 4FJ1A 2JIQA 3O73A 3BH8A 3BJIC 4JBLA 5L4NA 3FTNA 4MCYB 2NY7H 1ZY9A 2GPYA 1N0HA 1N2CB 2XDQA 1EI9A 3OR6B 4PBXA 3T08A 4JNKA 2YZMA 1I9CA 4CSSA 5JXJA 4CM8A 4W7SA 3BH4A 4QIHA 5FGSA 3FUFA 4F56A 5LQMA 3IDZA 4L95C 5HDBE 1RHQA 3VWKA 1WPXA 5GZ3A 4HFWA 5KWSA 1I4EB 3NCHA 3NPSC 4NJMA 4G0YA 1FFHA 3T61A 2CG9X 2ZP9A 2WOBA 1KZ1A 2N59A 4Y0AA 1J7VR 8MHTA 4TYPA 5B5SA 1EGJH 4IRSD 2FG5A 5E9AA 1KXZA 4ABYA 3DE1X 1CZOA 3PUYA 4R51A 1DFXA 3NVKI 5J63A 4ODHH 3IP3A 1HCYA 1YJDL 3AFLA 2C9OA 4NU8X 1YWGO 2VQ3A 4B2LA 4ER5A 3AG5A 3QA9A 1L5VA 4TL5A 4FYSA 1J05A 5EZLA 3COJA 5HVGB 2CLKB 3TCTA 4IUBS 5CSBA 5TLSA 1ORHA 4RENA 3AUSA 4JDEA 1RJZA 4ROTA 3CZMA 3VRIA 1NPUA 2A0UA 3ILVA 2NDFA 5CFPA 2CIKB 3PGFH 5FL3A 5LNDA 1ISSA 1AY1L 4QGBA 5JXAL 1STOA 1FE8H 2IYSA 5AHOA 3VU8A 5HYSG 2QTWB 2VWEE 1B23P 3H5AA 4HUUA 4GLBA 4J16A 4Y19B 5AOLA 1L2TA 3BSGA 2ADFL 4BFJA 5JOPE 1CPYA 1NJ1A 1ZN8A 2H8PA 1U28C 5BW5A 4PUBH 4FE4A 3I4LA 2XWBF 1ORVA 5J58A 2ZJAA 4O4IF 1UM9B 1PZGA 3LRKA 5LB1A 2Z83A 1JZ2A 3H0CA 4YHKL 4RYDA 4G07A 4RIRA 2YWRA 2DWSA 4XPGH 4C9BA 4ERNA 3BRFA 5GVRA 4KTEH 3ON5A 3HCAA 1EB9A 4C7KA 3NIDE 4V2BA 1P7QA 3I8XA 1I8MA 2JBWA 1CRPA 1YUHB 1U8CA 5JSYA 4YLBA 3GI8L 4JHWL 4HGNA 4CIWA 3FE2A 2GIMA 2PBZA 2DLGA 4OQMA 2X0DA 3T77A 4RCVA 3N87A 1MVUA 4GI2A 4URHA 2IA5A 2PBLA 2P44B 4BTEA 1TEHA 3KLHD 3O1JC 2NSDA 1K8RA 4M2LA 1J8YF 2XN9B 3VX4A 4PR3A 1AJ7H 3BQUD 3PVSA 3RHSA 4IGBD 2QRPA 2R4RL 1MB9A 1BVHA 1PUXA 3U4GA 4F2EA 4BY9E 3VYNA 1XJCA 1JLRA 4YR9A 4GYBA 3BUDA 1IATA 2VRAA 2ZWKA 3EXFB 3T6ZA 3KB6A 4QBGB 3HKCA 5AJHA 5AT1A 3KDSE 2AQNA 2AQSA 1E4VA 1ROWA 3PNWB 1G3UA 2FN8A 3SKVA 5DEGA 2ZUBA 1RZRD 3UYRH 1XK7A 3WDHA 1TVHA 3T4YB 4Q97A 3NT5A 3VNYA 4V0OA 3QDAA 1N6PA 1XEXA 3D64A 3MCYA 3AZPA 1BM3H 1WLSA 4QPJC 3GJ0A 4NI3A 3U44B 2X0FA 3ROKA 2PS0A 4TVBA 3D3VB 2F2HA 2QXYA 1NGXB 4RGOL 3CNOA 3VJLA 1PEYA 2G2RB 3QBEA 4URYR 5JPNC 4ADIA 3S1LA 5BQPA 4UNPA 5FO9A 1DFHA 1B73A 5EJ8A 4TROA 4CFZA 4P5RA 3OY2A 1M2KA 1XJWA 2OXTA 5J2UA 3B9BA 4P2QE 3MBOA 3BWAA 5KVFE 2NT1A 1IBKB 2IHVA 3AUWB 1S2IA 3WENA 3ARED 1Y9EA 4WQMA 3LOPA 1NVVQ 4RORA 2CXTA 3QIWB 1WUNT 2Q07A 2P0EA 3KLPX 5KCMA 1VHWA 3CPUA 4HS6B 4M55A 1IN5A 5AKGA 4QYXA 2H5JA 2K6WA 3QE4A 1V45E 3RFZA 3PXGA 5I7UA 1YEFL 1BGXT 1MGPA 4KU1A 3KT0A 3IDSA 4GXUN 2WMNB 3REWB 2XT1B 4S0ZA 4IDDA 3CGTA 5DBIA 4QBIA 3QUTA 1FNEA 2WF9A 3DNMA 3ZHFA 5HBGA 1Y48E 3QVUA 3GLTA 5BMVF 1BCSB 2ZUUA 5DGIA 4QNRA 3N7UA 1NKOA 2EUXA 3ZNNA 4ZTOL 3NORA 2I34A 2V6GA 2WYWA 1SBQA 4FSDA 4LRNH 1G1MA 4CNIB 5GIRB 2VT7A 3F64A 3ECAA 3KPSE 2ZOUA 4KKRA 2R56H 4PRHE 3ZBMA 3FYIB 1DQKA 1SN7A 5IQ9B 2B8TA 4LFCB 2WUWE 4A6EA 1NW7A 1EGJL 2F7SA 4RDHA 5DYGA 3U4AA 3W8EA 3I76A 4M76B 2GAIA 1NGQH 1YMMD 2LP4Y 1FP2A 4BLOA 1JXGA 3D1LA 5DHMC 3HCRA 3WLSA 2OPBA 3R0NA 3CNHA 2HLAB 4IYKA 1V7QA 2R23B 3ZL1A 4L1LA 1XQWA 4CKWA 2A9CA 1L1FA 5F0JB 2IUFA 4YQEA 1FF5A 4B73A 4LARH 2F61A 1AMUA 1EQWA 1IFHH 4PWJA 1BE8A 4GS5A 4LNRB 5C1PA 1EM8A 4WEEA 4BMPB 4A2MA 3GMTA 2ICWA 5A2KH 3WTVA 2XOKA 5DLYA 2W9DL 4RKWA 5FWYA 4XO5A 4KXZH 1BU5A 4FBLA 2A86A 3EZ7A 5DHVA 1UH2A 4DFHA 5BS0E 3R9WA 4XDYA 2QIPA 3NLLA 4L15A 3N40P 2OXGB 4RHEA 1N5LA 1E7VA 2CNDA 5EU6E 4L4VA 1GPYA 4LDRA 2R85A 5EG6C 5DXAA 3EPPA 2VP0A 5F88A 1XGPA 2EFCB 4LJAA 2AFNA 1YASA 4XMWA 2AVGA 4O4YH 1A7QH 4KPEC 4S1OA 2IHNA 3K6DA 1H9VA 4NKDB 2A6PA 3AXIA 1NMZA 3BHJA 3JQCA 3PXUA 1PKOA 2VYFA 1V3TA 2EZUA 4R8LA 3TCLB 4Z3FA 3ZYJA 3KLOA 1ESZA 3G5VA 1T24A 3H2YA 1CFVH 4R6UA 1A98A 4DG5A 3HI4A 5ECGC 1Z32X 4IRZL 1LBQA 4N3TA 1YC7A 2X4GA 3V7FA 4LCUA 4WBXC 2WIJA 3AUTA 2LKCA 3DUHA 3F5WA 3LL7A 1BECA 1U3GA 2C88A 3AHDA 1L7IL 3DX7A 4IDEA 1KSGA 3DMMC 4P34A 2HTKD 1KGXA 3K2BA 5F35A 3KQYA 4AG6A 5KSUB 1RCTE 3C5VA 4JLPA 1TTCA 3TQQA 1XB3A 5F4ZA 3OR6A 3UH8A 4JC4A 4WCYH 1OOWA 3VVWA 2FAXA 2HLDA 4QXQA 2BWIA 1KFGA 1M5TA 3RSSA 4N8SA 4AZ8B 4XMPL 4IHKA 1UC4B 2G5RA 5JY6A 3U81A 1T0OA 1TAUA 2R0ZL 2FCRA 3NCMA 5IT9A 1RK1B 1PQZB 1AT1A 3ZBQA 4OAWA 3QQPA 1ZNWA 5AVVA 1GDHA 4JBYA 5DVPA 1PP4A 4MLDA 3ARYA 2J57A 2ZVPX 4L3VA 5FA6A 3L5XH 1II4E 1RFDL 2O06A 2NNLD 3IEMA 4WKZB 1Z0JA 5EXSA 2BRUA 4HNRA 5EPUA 1P62B 2WXOA 3R4CA 1AG6A 1BJ1J 1RULL 1T5KA 2QTGA 2IFFH 5B1JC 3QE0A 5HIIA 2OMZB 4GNRA 5DURD 3VPBA 1HH6A 1AGCB 1MWOA 1N67A 3F6IA 4PJDF 3UGXA 1OXTA 2JFUA 3IJEB 3G6WA 3KQKA 3HHSA 4Y2DC 3CDFA 3VDBA 1FTQA 2UUDH 2R2GA 4PGGA 3NXSA 2HCRA 4LPVA 3AM8C 3GZTB 1GN9A 4ZAFA 3NCYS 1MLCB 3L7KA 3S96A 5F12A 2IH3B 3BMNA 4BKOA 4XX0A 2YV4A 6NULA 3OIGA 1ZC3A 3ZK8A 3MBEB 3BESR 2YLHA 3ETTA 4LCWA 4TTJA 1VQ1A 2AJLI 1ERNA 1HHKB 4YXLH 5IBCA 4M9UA 1Q7TA 2X1LA 1Y63A 1H3PH 2FOLA 1WSWA 1ZS9A 3AM4A 5I26A 1PFQA 4IEFB 4HDKB 1C4XA 1JA1A 4RAVB 5LNK6 1NFIB 1KAOA 2RARA 1BF5A 5KEIA 1SEVA 1P4JA 5GJWC 4O9HL 4Z4QA 2G3XA 5J8OA 1RM0A 2YFOA 3EZLA 2VDML 3DDOA 1XVAA 3OI7A 4HDNA 1G4RA 2G04A 2WUGA 1N0WA 2O07A 3S2EA 1W6UA 2C9MA 1XNHA 2CO1A 2A2QT 1OASA 3MRCA 4D3FA 2QYSA 3VU9A 4MVJD 2YWEA 1ZVQA 4ER0A 3L17A 3VB9A 2JFZA 2XZAH 2H4ZA 2O3TA 1GQFA 4ZYWA 1QSFD 4YZFF 4NFYA 4PBWD 1XMEB 3T04D 4ZTOH 1KEEA 4LSPL 4CU8A 4LRNL 3JD0A 4BKMA 5C7IO 3GAMA 1KYOJ 5C0AA 1N0XL 1Z66A 3WJ1A 2J6EH 2PTTA 2AW5A 3CIOA 3FG9A 4O25A 3HO8A 3NDJA 1EZVX 5DNYB 2Q3JA 3KDAA 4BB0A 5K51A 3W4KA 3ENKA 5BP7A 4LHJB 2E4YA 4ZVQA 2H0QA 4Z0BH 5BR4A 5K3BA 2C4VA 1UB6B 1TTHA 1K5WA 3LAWA 2HSGA 3HBJA 4NO5B 4UM9D 3A11A 3CW9A 2LTAA 1NGQL 1U0FA 2WUCH 1FZJA 4L16A 4KO2S 4OI2A 2ZWZA 4AZ8A 3CFUA 4KN9S 5KW9L 5LYJF 3MGOA 4C47A 1VYTA 1LZKA 5T4HA 1EJ6A 4KAQL 4DP1X 3RSLA 2DIEA 3A2LA 4XMKH 1ZLVH 3QG1A 1ZGCA 3TBHA 1FNSL 1B0PA 2R65A 4DCOA 3MJ6A 3IEVA 4E0RA 1UD4A 3PJSA 4ZUSB 5ICMA 4BWYA 1DUYB 2Z8YA 2RKWA 1QOQB 2I4NA 5JSQA 4PU2A 4L28A 2EW8A 1H6BA 4ZTPL 1R3UA 2QX9A 4JQYA 2QQKL 4OYYA 1LP9B 1C3OB 2IL1A 1OD6A 3L7AA 2R1WB 5FIEA 3IKCB 1H8ED 1GUAA 3R7AA 1Z7EA 2LE9A 4FC3E 4IIBA 1KFAL 1SK8A 4D8VA 5C0CB 4YH6A 5DFWH 1F6WA 2IT1A 3TN0D 3IXTA 2X5PA 4KV7A 1U8HA 1XT5A 3LP6A 1GU7A 3I3EA 3MX0A 4PC3A 5E1GA 1B3RA 1FMTA 2DQUL 3RVVC 2ONKA 4FYPA 2C4FU 2Z4QA 2GYVA 2FYYB 2GBTA 4LGPB 2H7VA 4IRZH 5J2TB 3ZC3A 1JDJA 3MNZB 3U7QB 1NNEA 3O2VH 3RVUC 1JDTA 5ECDA 4P46B 5KYYA 3C0KA 2K7QA 2EERA 2ZAGA 4PR0A 1L7IH 4QF1B 2Y0BA 4AMWA 4H35A 4MWBA 3N3BC 1FW8A 3RY5A 2Q6OA 4HWOA 5G2NA 5J9PB 4G1FA 2QMEA 1ORRA 3CLSD 5F3FA 2FUG1 1A1MB 1VYVA 2NU6A 5EZQA 1WMSA 4YC7A 4D9LH 1EWYA 3PFFA 3SDSA 5ESXA 2GO1A 1ZOPA 3AR9A 1E9FA 5EEVA 3ENZA 4F27A 3JV5A 1EMDA 1LDPH 5CP7B 3SQDA 2GZHA 2IUTA 2OHVA 2HF2A 1AU9A 2AH5A 3E53A 3IP7A 3C8UA 5K39A 5KNBH 1GITA 3PR1A 2VK1A 4FDMA 1UWGL 4P3DA 3QU4A 4S05A 4JX0A 1B0RA 4ZHSA 5DGQA 5CSZB 1GSKA 4OHFA 4OCMC 1C08A 4HULB 1OBCA 1N1EA 3FU5A 2XHEA 1RU3A 4M5SA 1PT6A 3QULA 2R62A 5BRAA 4Y6GB 3AESA 4KGXA 1GZHC 1EE2A 3NHRA 4NN6C 1Y8RA 2HQBA 1G5IA 3IBSA 3N2IA 1A8PA 3D08A 3VFSB 5KDLA 4Q9HA 5JQ6H 5M29A 3I9OA 4KRYA 4MA3A 5HJ7A 3IO3A 1FJ1A 1JPTH 2X76A 4RWYL 3NM6B 3BJMA 4GP8B 4CF5A 3G79A 1E27A 1ODUA 3Q6NA 1PW5A 1Y1TA 2Q8AL 5LD2C 4JR9L 3QIWA 2AFIA 2IDKA 4NJOA 1NBCA 4YHBA 4K8RL 4X83A 3WLTA 5B3LA 3NABH 4XBGA 2PWFA 1M2WA 5DJ0B 4NS0A 4LRTB 7GPBA 5HK9A 3N8HA 4O58H 3URKA 5I74C 2Q3HA 2Z95A 1BZYA 4BUGA 2QMZA 4EY6A 1DC8A 2LU5A 5J2UF 2WY2D 1X6NA 2ZOKB 2XCIA 1KYXA 3E38A 4NOJA 3MTAA 4U31A 4G0PA 5E8DL 4F84A 2ONJA 5CXQA 1ZPUA 4BBAA 3T34A 2OHGA 1MCWW 5D8JL 4L9WA 5CJJA 3B51X 1RQ5A 1NASA 5KSYA 4PRID 1U81A 3SN6A 2B4RO 5T3ZE 1M67A 1XDTT 1PJ4A 1VHLA 3GS0A 4YSCA 1ZOSA 3L05A 4M46A 1C8KA 1AGDA 3EYOB 1R3LB 3QRBA 1GGBH 1RJCA 3PXBA 4K2AA 4JROA 1BJTA 3UTZB 4Y19E 4ILEA 1UDXA 1UJTA 1WOMA 1BZ8A 3QJ5A 4QTIL 3NTRA 1HQRA 3I0NA 2WUBL 3S8MA 2AC4A 1C16B 3ARDC 4I19A 1BXGA 4XGRA 1NM4A 4G5AA 1WQ4A 2WTPA 4IM8A 1M6YA 3U9SA 3OTGA 1EEZB 2D00A 1HT3A 2HBQA 4PJ9A 5DC2A 5EUOB 2B08A 1PX4A 4F4HA 4M7KL 3LZOA 1J42A 5B3KA 8ABPA 3SVLA 3MFQA 5HXMA 1BEUB 4X1OA 1ZSYA 1EFAA 2YOAA 4UPEA 3X17A 1R3JA 3NV9A 1JZTA 1YYLL 3AG4B 1GSAA 5BN4A 3VO1A 1V3VA 1U3CA 2Y9PB 2V6HA 1HGXA 3M4YA 3B9KB 1F41A 4C57C 1Y1RA 1NBWB 4JFOA 2QTHA 4EYOA 1BMTA 1KYWA 2KYIA 3L6UA 4JX9A 3AVQA 5HTOA 1JTPA 4PMEA 1T1RA 3BW9A 4FIDA 3LN5A 3OXSB 5TPWA 2BY0A 4M22A 5BSUA 3EJCA 4PLPA 3HE7C 2EH7H 2AFIE 1JFFA 2XUHA 2REQB 2B94A 4AJHA 4XX0B 1V7ML 2VLBA 3T7IA 2QX6A 3WNVA 1O5PA 4C4RA 3H3JA 3DQZA 1H2EA 2PMZA 4AQ1A 5DD3H 2CMHA 3B1XA 4HIHA 2GUWA 1F60A 2EW1A 2WHEA 5FOUA 5IFLA 4I7ZC 1LX7A 1MFEL 3RS2A 2RG1A 1OQAA 4NOFA 1WA0X 2LAGB 2R1XA 3ZT6A 3V0AC 1SDDA 4XNUH 3D3QA 4AY4A 3NEOA 3D7KA 3HPLA 2QROA 1MWAH 1NR7A 2PN5A 1VBFA 3MA0A 2QKSA 1SBSH 4AY5A 1ZMOA 4CU5A 2ZTBA 1PNDA 1Y9ZA 4QNNA 1YHPA 2ZBQA 3O2VL 2CLSA 5K3FA 2DJIA 3W6NA 2BFMA 4KIUA 4P5TB 4PS8A 3RKDC 2II6A 2R97A 1VHTA 1CPUA 4ZCIA 4I8IA 4X97A 2X10A 4KWUA 4DCMA 5C6TL 4CKCA 5K0BA 3G0HA 4NJAH 1QQ5A 3BAEH 1Y4DE 1RWKA 1DLHB 4K8OA 1D5XA 5DISB 2VLJE 5DJ6B 5LSAA 1EUDB 2GUOA 4E70A 3GLUA 4NHCH 2EKJA 3EH2A 2FLBT 3OFVA 4WBNF 1A9YA 2WLLA 4S1DC 2LR4A 4G5YA 3PDWA 3NJMA 3BQ9A 1ZLXA 3NSJA 1G1AA 2BUBA 4IIQA 4EYEA 3SPVB 1YS2X 3ZWKA 1RFLA 3BPOB 1JWAB 2PHZA 1XKQA 3Q06A 1OFGA 1NTOA 5E2BA 3FO0H 2KBEA 1W96A 3ZVMA 4NQVA 1G64A 1J9EA 1ZVYA 1VCAA 1FS6A 3HMWL 3GMQB 3RI3A 2PLFA 5HE9A 4D45A 3VNAA 3FI9A 3LI2A 5BVJB 1QLEB 1PJBA 4ODTL 2HKFH 1NAHA 3N7TA 5FUOH 4D7AA 1Q22A 4YQXL 3UEQA 4IIYA 1DUIA 3GD1C 4TN1A 4NQTA 3ZV4A 3FT0A 4DLVA 3DGFC 5EO9A 1A7RL 4EPXA 2V1UA 1Q15A 1BCRB 4H7KA 4FRWA 9ATCA 2X9VA 3FNHA 4BQRA 3HKDB 5TF1L 2LDXA 2YJ6A 1B3JA 2X9YA 2QPOA 4YL4A 3CH6A 5F78A 5FEMA 4C56B 4G0QA 5C3MA 2OP1A 4JLNA 2ED8A 4CIVA 1R17A 5BSGA 1DVYA 1Q50A 4N5UA 1ADWA 4WASA 1WBZA 1JDDA 3PG5A 4J2HA 4P86A 1E4EB 2BSRB 4IIZA 3B13B 1E2WA 1KYZA 4KMSA 2ZTHA 1G8SA 4EGQA 2C7BA 1OXBB 1P1IA 1RQLA 2BDTA 1A7NH 2WEKA 1CXHA 4M1CD 3DE4X 4OZFH 3M3PA 4IJKA 1JZ8A 2VWEC 3R5JA 1G7QB 3A4AA 3LDGA 5E8DH 4K7FB 1WB6A 5EIXA 5CNJA 4TRRA 3GSVA 1EIWA 3OJDA 3LFTA 4UQ9A 4X85A 3KXDA 4TSRA 1WL8A 4JFED 2CJSA 3VHXA 1VLMA 4OCWH 1J07A 3QE3A 1G5GA 2VQTA 4YXWD 1FJHA 3MS4A 4ACTA 4BNXA 5EPMA 3O2NA 5DD5H 2ZREA 3QHPA 1I8KA 2HJLA 4YFEA 4NESA 4U4AA 1WZKA 2ZJ6A 5A4FS 4M37A 4A38A 2R0KL 4WW2C 1SRQA 2A94A 1EFXB 5C09A 3L9BA 1PPIA 4IH9A 721PA 5TMPA 2B0JA 5EYPA 1KY3A 3QQDA 4IIQC 2BGIA 5E2AA 3ZDYB 3BTVA 1DGQA 1KB9J 2EVIA 1ML4A 4W9HC 4RVFA 3PDGA 1VKHA 3TVMD 3OLYA 5KVAA 3WK4A 1VBNA 1OGJA 2IW1A 1IVYA 3CN7A 1U8LA 1RRKA 3L93A 3RYTC 1DJSA 1U8PB 3CEPB 4UB0L 4NKIH 3MM4A 4DMLA 1XA4A 2ZIGA 4PLHA 2E37A 1KF0A 3AZOA 4HJTA 4MR8A 5C32A 4I4TF 4YAIA 3HAEB 3OKDB 3ZWWA 2P5EE 1TZKA 3EARA 3KQWA 3NHJA 1D6JA 5H83A 4M1TA 3AWFA 3VJRA 4NF2A 1T22A 2GI4A 1CUXA 2QTBA 2UWEE 2IMNA 4UQDA 2ZGVA 3IEUA 5GVSA 2GRAA 2YWGA 4DA8A 1ZKDA 4ZA2A 4NV1A 4PH8A 4U1RA 4YJFA 1PAMA 4OCZA 3IFPB 3EA0A 3FJYA 5E1QA 1VJSA 3DOJA 4D9IA 3U26A 3OKEA 4OFQA 1ZSNA 5IBLD 4IRZA 2CDRA 4XCQA 1GUZA 4AYSA 4Y9TA 1SBSL 4UVDA 3FJOA 3L0BA 3T52A 1QHOA 1D1TA 3EIUA 1HXYB 5EBLB 3S8EA 2X3AA 3NA4A 4KRLB 1FPMA 3B6IA 1QFOA 3GC3A 2XWRA 4W9KC 4I89A 3V0FA 4I48B 5C6TH 4EX7A 3J81A 1LEIA 1V7NL 2DQTL 3AUVA 5A2IH 1MJGA 2IF0A 4RGYA 3UAFA 1INDH 3SQWA 5LGJA 5JZVA 2BPBA 4HZAA 1YRQA 2E8ZA 1IBCA 4RFEA 3CURA 2P9BA 2SODB 4IPTA 1I8MB 1SQGA 3M1AA 1FY2A 4WV1C 3MFGB 4X7TB 2WIIB 3HZRA 1NNLA 3EXG1 3VFVA 2B9EA 3C6BA 4AW9A 4IV0A 4PRPA 2Y27A 2PL3A 2XXJA 1C9KA 3NCFB 4L5YA 2NO0A 3QDMA 1JV5B 3V4VH 2ODAA 3BHIA 3II1A 3RWIA 2OV8A 3H9GA 4BFGA 4GAJL 1K6IA 1OLSA 4XUGB 2WSSA 1CUWA 1EBFA 1ZE3C 1E2MA 1IEBB 5FPPA 1FFXB 3GMNB 3HRHA 4HCGA 3ARDB 2Z7YA 3FRPB 1OE3A 4JN2A 2YJ5A 3GU3A 3VCLA 4BQQA 1G5RA 4JU9A 4EMSA 3LD8B 5F1IB 3ECQA 3HLAA 1ZIXA 4OVKA 3MQ4A 3MLUL 4XXCC 2AVDA 5CJBA 1AB6A 2KSQA 5KOJB 3SPIA 4WNAA 5AUOB 5B38G 1AX9A 2FOXA 3FW1A 3RC3A 4KZPA 3P2MA 2JGDA 3DAGA 4MJLA 5LAXB 2ZBGA 1GGFA 4R71A 5DS8B 1ASOA 5JHDB 4H31A 1RYEA 1ECYA 4KZ0A 5CGBA 3L8HA 4OFKA 4Y1TA 3WKBA 3N2LA 4OU5A 3MLYL 3I9V6 1IGYB 4PV1C 2CSUA 4KFTA 1I85C 3I61A 4Q9RL 4LSUH 2E48A 3M6DA 2P6NA 2C1XA 4H6XA 3RFFA 2QEJA 4FGWA 2XETA 3T1OA 1CUSA 3WLQA 1AI1H 1WXIA 5B4MC 3ZBUA 4KXBA 1M1YA 3WA7A 3OPQA 3K15A 4UM8B 1BD2D 3G7NA 1T2FA 5BS0B 3X1YA 4IOLA 1UP7A 4E11A 3AY0A 4B31A 4C6HA 4IDNA 3DRQB 2VRCD 4LAJH 4M1OA 3MG9A 3K5WA 3O3EB 1D6EA 3ILQC 3IUMA 3KPQB 1VCIA 5I6KA 3W3AA 4HYTA 4A0HA 2I27N 5IP5A 3L79A 4PC6A 1GXSA 3V9EA 4XOCA 3Q1LA 3KR1A 1MFUA 4X8XA 3EZJB 1EYZA 5ICYB 2BIIA 3UCRA 1ILUA 3MA9L 2HLDD 2WD8A 1LWJA 3DV6A 3NHUA 2XDQB 5T6BA 4AMUA 4L4JA 2VLRE 1SCUB 3VH8A 3U4QA 4IGKA 1RYFA 1EHYA 2PCFB 4BMDA 1Q1ZA 4DKEL 3GS4A 5CX1A 1T6BY 1TSRA 1TKAA 3WFDL 3KZXA 5I8CA 3EJZD 5ECGA 4J6FA 5I1GH 1YB7A 4FJ6A 2RC5A 1YSOA 5BOSA 4IWNA 5LNEA 2VXYA 3KPMB 1XIWD 4EB3A 2I1VB 4LMAA 2H8KA 1ZZGA 2I8AA 3P0HA 1JK9B 2KPOA 3ZVRA 4NKIL 3NBAA 2OXEA 1Q74A 4JL1A 4PSVA 1Q0PA 4J91A 4FFBB 3TAUA 1BHSA 5LM3A 5JHBA 3C16C 3G2JA 5AKIA 2VXOA 3PICA 4H3VA 4RF4A 3ZHQA 1G38A 3CQPA 3SKXA 3DM5A 1EA5A 4FUQA 1JHTA 3HMXA 2F6RA 1BA3A 3ULUF 3KPLA 3L4CA 4TKUA 3K0FA 2FO8A 1WABA 3GLFE 1E3QA 8GPBA 3HKBA 1MCCA 2RFLA 3ECVA 1ED3B 4P23C 4GRIA 5FUXA 1T20A 1U2PA 3PJLA 5A4AA 2YGPA 3NIFB 1GHFH 2VUUA 5HYQB 1F0YA 3DOIA 1LJ8A 3NP3A 1EK3A 3LLSA 3LBNA 4QHKJ 1PV2A 1KAQA 1ENZA 3SZ3A 2MINB 4GJTB 4PJIE 1C7TA 2Z2JA 1BQ5A 4QEGA 3ORHA 2PKXA 3EQZA 4OI4A 2A2ZA 5D1ZB 4NJ9L 4NHUA 1UWEL 4NRZA 1MLBA 4FFVD 3PGLA 3ALXA 5T5NF 4DKAA 1M0WA 4NT6A 5ENWB 3M89A 1DDHA 5G02A 2YMMA 4XSHA 3IIJA 4N5ED 4DCQA 4GRMB 1SEQL 1VB9A 1GKYA 4MAUL 3U2JA 4J9UE 2IF7A 1DJNA 4M1ZA 2C7QA 3REGA 1HFWA 2IWHA 5EE1A 1JILA 2IYYA 2O19A 4UXHA 1S9XA 1F8YA 4TUOA 2YEQA 3B6SA 4X7FC 3RRXA 1CU4L 1WXFA 4OLUL 1K8DB 3E8UH 4Q6KA 3AY4C 5JPMB 3P2YA 2OL3A 2WMOB 5K9OA 4CN6A 4I1VA 2C4XA 3PKIA 1F6BA 3BQUA 5C0JB 2XT6A 2HFEA 4J3SA 1OAOC 5DD6A 4IIJF 1UXGA 1JLLA 2HK9A 2DQEL 2EF1A 3GB7B 4OKSA 4N2LA 1GILA 3WWZA 3V4VL 4G4JA 2TRSB 3D31A 4UXJA 1FDLL 3VI3E 4TVSA 3F9RA 3K9CA 3PHOB 4OK5A 3VV2A 3C85A 1JYWA 1YMHA 1XRMA 1HAUA 4H1TA 3I04A 1J06A 1A5FH 1J8HA 1JR4A 1NMBH 3GRWH 1VKZA 5JZ7D 1U9IA 3W5MA 4MIKA 3PV6B 3NYIA 3GARA 2WAXA 4G8BA 4YSEA 5C0OE 2IEGA 2FVXA 2QV2A 2ZSDA 2FMXA 2H2SD 3AHHA 2GWHA 2FL5B 4RDQF 3VFWA 1X1DA 1KJ2B 1JPUA 3T2NL 4W6ZA 1HZLA 1EM8B 1WC7B 3WLFA 4HUVB 1ZQ1A 5DHEA 3ZUNC 2GXQA 4KK9D 3BJZA 2Q5FA 3HBPA 2QRQA 4AUMA 2MSPA 3UJ8A 2GZAA 2VLJD 1N2IA 2MQ0A 4CC4C 4AYBA 3UDWA 2ZKYA 1T7VA 3FU3A 4LUCA 2FK9A 3JWGA 2VBIA 2VH5L 1E6JL 5K3AA 2NP6A 1YPZA 2BNQE 4KG7A 1A9SA 1BXKA 4BSJA 4X3OA 1C9EA 1DUYA 4HJUA 3GVHA 1UASA 3NK4A 2NYVA 3PJSB 3PUXA 2B9VA 4Y4FD 2ZRNA 1N1DA 1VZHA 1H6TA 1IXSB 3VFWB 3AOGA 2MTPA 1RYZA 4KRGA 4ZQGA 1VE9A 4YHNA 2GHQA 1ZICA 5H3LA 2QHRL 2ID8A 2I66A 5ISZA 1JHRA 3SD5A 3Q7IA 3EUFA 3MWEA 3SBOA 1SQMA 5BUSA 6PFKA 5T3ZH 2WGXA 4TUKH 4GUPA 3FETA 1ZRHA 2DWEA 2BMFA 1E9AA 4JR1A 4YAWA 2HO4A 5K4HA 3FZGA 1D4FA 1OSEA 1EE9A 2VZ9A 4Q4LA 2ZUTA 1MORA 2F8OA 1XNJA 4X9YA 4E3WA 1JG6A 2Z6UA 2RHJA 4A6YA 3TLMA 1FZOB 3IAM1 2WY3B 4YVFA 1YMMB 5HVHB 1KYUA 2ZAHA 3GUVA 4HYYA 4XN5A 5IDWA 4QJ5A 2DT5A 1B0UA 4UMDA 4BLQA 5ALZA 2QD1A 2MCPH 2UX6A 2RDMA 3R7DA 3HRZC 1NHWA 5L88H 3DSNB 2VRQA 3U79A 1F8TL 2PW1B 4BSVB 2AOTA 3OEEA 1CICB 2FWNA 3KWMA 4EFDA 3QAQA 1F3JA 2V33A 1S9DA 2FEMA 4Q7JB 2HDNB 4G6JH 3OLVA 4MWEA 3P0IA 4DUGA 3C2QA 2IHUA 4KNWA 1RL1A 1SMAA 3B6KA 5KN5B 2REOA 1QWHA 3EHBC 4XWOD 3SBQA 1ZNQO 5LU8A 1J1XL 3M70A 4OL9A 5JA8B 3UWOA 1YACA 1B0IA 1GVIA 4FOPA 4H6VA 4WTQA 3B3JA 4RPJA 1YRKA 1IQPA 1GDDA 3V0IA 2X14A 2UUBB 5AVOA 5KVDH 4XODA 3DOFA 1AA6A 5B7PA 4RZQA 2BNQA 2DQFA 4J03A 2YXMA 1KP3A 1QO0A 4H2AA 2WLZA 5E94A 1PO7A 2Y36H 1I32A 3ZCRA 1SF5A 4D8WA 3FYEB 1UXOA 5IJVB 3LC2O 4KUZL 5HHPA 2NY4B 1J5CA 3QIWD 2OS7A 4ZPJA 3A6BL 1H6FA 4FD3A 3BKJH 1QLFA 4GVPA 1G5AA 4OAPA 2DUNA 3OIYA 4CUCA 2OX5B 2DMKA 3V9CA 4D25A 4IKJA 1RJDA 2ILTA 1P5HA 2DD8H 2P28B 4BAGA 2IBZY 4YT4A 3B89A 3INUH 4MOWA 3PQ5A 3FVWA 2ZX5A 3ZJAA 3MOGA 1UPTA 2H4JA 3HE3A 4S0TD 3K6RA 1A6UL 3L6BA 4JLVA 3MV9B 5E6IB 4GBXA 1HH4A 3N2KA 1H2XA 2JKWA 4UV7H 2E7LA 2ILVA 4ACBA 4C0AC 4J0HA 2ES4A 3E8UL 2J4WL 1G66A 1V05A 4B45A 3O3UN 1E6KA 5E4JA 1U6AH 3U7YL 1KPHA 3V0EA 2BFFB 2RQ8A 4EG6A 2DCUA 1E7SA 2Q4OA 4Q6BA 2IS2A 2HT6A 1E7QA 2FN7A 3Q85A 4L29B 1JX6A 2LKDA 2DAVA 5DX8A 2EYSB 5L51A 3NBNA 3ROFA 1YL7A 3FHQA 1I3OA 1N5DA 5I16A 4KK8D 5A1TA 1KUMA 4TSAH 3ITEA 1I7TB 3ASVA 1U8MA 2DQKA 4LLUB 4HIEB 3OD3A 3AJRA 3KWWB 1HM5A 1CUVA 2JEOA 3CPHA 1KACB 1X5FA 5K6AC 1RK7A 4WTWA 5KNDD 5AOAA 2HCJB 3LNIA 2G75A 2XUWA 1YEKL 4HEPA 2ADYA 4JRXB 1BVLA 1D5IH 5TK2A 2OG1A 1TEGA 1HHGB 4X6DB 1ICEA 3EH4B 5AW8B 5CHNA 3HUEA 2OV2A 3DHVA 1J2YA 4DABA 1T8YA 1RCYA 4YPGA 2R51A 2YKKA 1POXA 5IY5B 2FFHA 3I6BA 1V41E 3LF2A 1OX6A 4MEJA 4DN3H 2IP2A 3NGBC 3ZRFC 1HDCA 2RGGA 2HG0A 4HN4B 3ELAT 1Z3GH 1TR7A 5F7EL 1JGTA 3DX6A 3PEVA 1U2HA 2C26A 4KHTL 1ZHLA 4LISA 3N85H 2H4EA 3GRCA 3QVGB 3RY6C 3D9AH 4IGAA 1B93A 4C4YA 1Q7GA 2A4ZA 4X1IA 3Q01A 4LYGA 1JXOA 1OV4A 3B2VH 1IJBA 1FMJA 4A6PA 2HWKA 1DQQB 2X9GA 2YGOA 2DHDA 1C5BL 4E5XG 1NBEA 2V7QA 3JAKB 1E8XA 4BN5A 2BZGA 3HLKA 3DX8A 2ZQKA 1I5EA 4UUOA 2WUDA 4DAGL 4TUKL 1Q9OB 4N7RA 4AC4A 4N0CC 2ZXFA 4DREA 5TQ2A 4H7IA 4EB6A 3IAPA 5FK9B 3JWJA 4G1VA 4M1WA 2V7NA 1AKPA 1CXKA 3RBVA 1SKYB 5AVWA 2YINC 5TMDA 1Z9MA 4FCWA 5E4FA 3T3MB 4QXTB 3RRZA 3AVYA 3ETBF 1HHHA 4XNMB 2F5AL 4HUWA 1D0IA 1JJUA 1Q95A 5H4HA 1B74A 5AW6A 2QTNA 1SKYE 3WVNA 2GT9A 1M3IA 4P5MA 3NHAA 2BZSA 4QIRA 5IESH 3OMLA 1H8NA 1NT4A 2WV3A 3GGSA 2IEDA 2XBDA 3EJZC 3BW9B 4EJSB 5T3XL 2TRYA 1HMYA 3PLAE 3QUYD 1E4YA 1YAZA 4B7AA 2Q21A 1JECA 4RIHA 1MVYA 1LEKA 1Z8HA 2NXEA 3WHKA 1PNOA 4YLGA 1KAMA 3ZHUA 1XR8A 3F6YA 4PX9A 4XWWA 4BK5C 5GS0L 5HHOB 1NIEA 4JVUA 4YJ3A 3RUFA 2VFAA 1X7XA 3W8FA 5REQA 2FZWA 1EEZA 1JKFA 5IKMA 2EIZB 1TKRA 1JL8A 4CVXB 4UD2A 4HOZA 4L37B 3CZCA 4COKA 1D7DA 4OGYH 3NTCH 2WQ8A 1VFPA 4GFDA 1H3VA 5EC1A 5A03A 3NIGE 3Q6MA 4DNFA 4R9HA 1XVUA 4DP8X 2B78A 2ZXWB 4ENUA 1CGSL 4QJ4A 4IDQA 4JFUA 2ZWPA 3D7SA 5FKPA 5IMBA 4BO5A 3TOCA 3CB4A 1AXEA 4UTPA 2BZCA 3L95A 5DUJA 4FZVA 5L45A 5B8CA 2GMWA 1I1YB 5KVGE 4BU1A 1XDUA 3TLAA 4ZEVA 3BWBA 2F5BL 2WIMA 4IJQA 4K9LA 5INDA 4AQ1C 1YO4A 1RVFH 4B3HA 5B3JF 4HBCH 4PO8A 2IYZA 5EZOL 2A58A 5E2VH 3L48A 1G9ML 3LCCA 1IM8A 4R81A 4JJIA 1CURA 2DZEA 4P2RB 2JGDB 1WEKA 1L4MA 1WAPA 4BCCA 4ASUD 1R6XA 2OM6A 3D5QA 3HI1A 4OQXA 4HA1A 3GIVB 2J48A 2WNWA 3T0AA 1SYSA 1NCDH 2BEWB 1KCRL 3AERA 1U8UA 1ZGGA 1ZGLM 3OEHD 1B0ZA 4EQ6B 1U6AL 2ZJ7A 3HJNA 1F86A 2Y05A 1I8LA 4IHJA 5T1KD 3K92A 4JBXA 4XDHA 2YMXH 3GINA 2GEQA 1IN4A 5GHWL 1KIFA 1H3WM 4RHYA 5I9MA 1AGBB 2AXHA 4GG8A 4TSAL 3SJVB 1P4IH 2CXXA 4OZHF 3INGA 4A3SA 2P8LB 5F7DB 2G7ZA 5CGQB 3ZEAA 3I5MA 5TE4L 2BLNA 4PCVA 4EHNA 4P9MH 5EZJA 3N2GB 3GWJA 1PR9A 4YWJA 1BQLH 3E3LA 2JTYA 3FGPA 1NKRA 5CINL 5EQFA 5D7KD 4FFOA 3MS7A 4U1NB 3OMIB 3ATDA 1I3GL 3E2HB 2V98A 1I7LA 2JWGA 2XQFA 2X40A 3AQIA 2J6CA 3DX1A 3QNWA 4MS6A 4M9XA 2WNSA 3FT4A 3V1KA 3IMUA 1OARH 3OECA 1EZUA 1A21A 4C4TA 2YYZA 3VH4A 4BQPA 3A22A 4Z53A 2ZD0A 2HXAA 1U3TA 4PXAA 1PYDA 4CHGA 4GAGL 1KXHA 4CT4B 2I24N 3ITKA 1S9KC 2CKBB 3X1EA 4PY8I 4AD8A 4PEVA 3F98A 3FTQA 3GGCA 3FOLA 3G5WA 1P7QB 4XNQB 1WAAE 4CVWA 4CCAA 2ADFH 4XVJL 4IMRA 1R8YA 3F7QA 1EM6A 4GYJA 5DJ6A 3B9DA 1HT6A 4GUCA 3FBQA 1DAGA 3WXMA 4Z4EA 4U4BA 3PUVA 3RRMA 1CEXA 1YR2A 5ALPA 3GOQA 4W9ZA 1EDEA 3O9WB 1LBHA 1RXWA 2M26A 3IIKA 1XZLA 1BTOA 4AJIA 1IULA 1FFCA 3MUGA 5JZSA 3K74B 3UO1L 2Q5LA 2ZQ5A 3W78A 1QZ1A 4YHKH 4TX1A 2J5RA 3BFWA 3JWOC 2IU0A 3KYKH 4NERA 4TLBA 2Y93A 5FCUL 3DXXA 4M0PA 3X43A 3DUWA 5IEJA 2X5NA 1N3NB 2E47A 3RSCA 4HLCA 1K4CA 4P83A 2NQTA 3ZH2A 3CFDA 1ATIA 4W5NA 4JO4H 4E9LA 3WELA 4B4VA 2XXAB 4R4ND 3BP6A 3Q3GE 4C6TB 2C8LA 4PW3A 4B3GA 3PWPE 4M6NL 4LRXA 4I5GA 4MP6A 2F5AH 3GCWA 1U8IB 3SKMB 1ENOA 2AUNA 1B00A 5F9OH 5B36A 4G5ZL 2HT3D 4FD0A 1QKJA 1W8OA 4YCLA 4X93A 4PZZA 3EG5A 2DU8A 3B3BA 3G02A 3NUQA 3K0CA 4OGLA 1MC5A 4XBPA 5F7KC 2VBGA 1JG1A 4JA0A 5BXFA 1B76A 5KTOA 2JJTC 4C4BA 3B9EA 2AG6A 4C1BA 1YS6A 2BS71 4P4LA 2XJ9A 2NPLX 4KWCA 1KDZA 2Q41A 4J3NA 1YN7A 1TJMA 2HDHA 3DK0A 2WB1A 5DQJA 3FCTA 3NMUF 4CEIA 2Y72A 1QAWA 3ZTTA 2Q76A 1P7WA 2VISB 3KVYA 4TMTA 3UW3A 3WNNA 3NG1A 5E8PB 2AN9A 1PCXA 3OZTA 1IWBB 1SEBA 4N18A 4DVJA 1BROA 4ZFZB 2Y77A 2C59A 4W1SA 1C2YA 5E08H 1YNTB 3SGLA 4FCVA 3KJQA 3AR7A 1T66D 2TYSB 3GBSA 4C8XA 2V6IA 3T9FA 1M10A 2V3CC 4OYHA 3MYYA 4L1SA 5IF0A 2FGWL 1YY8A 1W4LA 4RIIA 5KUMA 3ZIUA 2I3AA 2HRCA 3SQOA 2XVAA 3KPWA 2YEZB 2OOSA 1Z6TA 1THZA 2XTZA 4YMSA 3WGVB 1F97A 1KLFB 2REQA 4E41D 1J0BA 1U3WA 1OT3A 3WBFA 1ETA1 4U3HA 1XL1A 3SE6A 4HO1X 4A1FA 4OIFA 3NP9A 1KELH 3K72A 3E15A 5EMHA 3AUKA 2GD1O 4O2AB 3KJIA 2N1KA 3VVLA 5FB8A 4C14A 2IBGA 2X3CA 1G9MH 3ZIMA 4G80B 3O5AA 1CU1A 5L7YA 1BDYA 5JPIA 2VDLH 1YZTA 3A8TA 15C8H 2AMYA 4MVXA 1MHTA 4MKRA 4MV9A 5LQJA 4F71A 4Z3EA 4LVEA 1KCRH 3T0VA 2J30A 3D85A 5JIHA 3FJ1A 5JNVA 2I6SA 2WKPA 3JWDC 5KUKA 4U49A 3UH0A 3S98A 2O7SA 4ZXFA 4YP0A 4JSTA 4P3XA 3U7JA 1JZ6A 2V7GA 3EC7A 1FVXA 3CPSA 4KPHL 1NHGA 2ZB3A 2DYSB 5IK3B 1BOYA 4KVAA 1G6RH 4Y9CA 1P74A 3EOBA 2XXAA 3U9WA 2BM3A 1ETHA 2FPWA 4DARA 5C0IB 4EN3C 1IG0A 3L0YA 2YBGA 1WSBA 4ZI7A 3R6LA 3TYGL 2FJHA 2Y1ZA 1R16A 3BULA 4WLEA 2C9SA 5BW6B 2JJSC 2YL2A 2X2JA 3EBLA 1CJYA 1BMWA 1ZINA 1IQRA 5CJOH 3OF2A 1PBNA 4CQNA 4JG5A 1TMGE 2EKLA 3LS5H 5F2NA 4Q8BA 4G8EB 2K8MA 1J5EB 4OT1H 5FT9A 1UT8A 1EEYA 2VT0A 4Q19A 1VKXB 1HN1A 3FUMA 4WTZG 1HEUA 3L82B 4LDJA 2FJGB 4GP6A 1T5IA 3A2KA 4ZU3A 1JR3A 3FJTA 4N6OA 5CU5A 2Y5EA 4ZI3A 3MBXH 4EI8A 3R9XB 4R83A 2HWZH 4JXZA 4LI0A 5DUML 3D6MA 1ZUIA 5I7EA 3HXLA 3MI6A 1DKRA 4DIBA 4NFHA 4K9KA 3GLFA 4INOA 3GZQA 2J1YA 1BEXA 5DHVH 3J7HA 3RL2B 3N75A 5K6RA 2VNIA 3BVPA 4EL0A 4CVZB 1JR6A 3FFAA 3CSSA 4CDHA 2ZULA 4K73A 2DOKA 4H7PA 3UC0L 2VMDA 2XMDA 5K9KA 5C7ZA 4ZO4A 1JZJA 5CX4A 4P2RE 3ULVD 2X89A 1FP7A 2R27A 4ZREA 5ACMA 2HLPA 1UJNA 3U7QA 4PHGA 2X6AA 3QG7H 5JH7A 4CTJA 2VDJA 1ASPA 3T1FB 2YEVB 2IC5A 5F0PB 4B3MB 4GZLA 3MRJA 4JE0A 4ZVVA 1FG9C 3IPXA 4MKGA 4Q37A 3APMA 3L0CA 2IFGA 2PS9A 1U95A 2M6LA 2XNAB 3DE6X 1N9GA 1QYXA 1H2FA 3AS0A 1KNOB 2HMID 2ZI7A 4I55F 4HH3C 3BP5A 3OCZA 5LZ5A 2WVVA 3MYJA 5D85A 1DWQA 3H4TA 5K3SA 3TFQA 4M43L 4LOIA 3U0PA 1Z4JA 4TPRH 3NQ41 2W0FB 4LP5A 4DZBA 3MCG1 4INZA 3ZL4L 5CKGA 2ZXBA 4ZFFA 4GHWA 2FPIB 1PYWA 3FH7A 5D70L 5FHQA 3ZYZA 4IJTA 4IQGA 1T8TA 4RTRA 1NIPA 2FPKA 3UTDA 1TLKA 5KINB 4AIZA 3AEZA 4AY2A 3VXPB 1NA5A 4ICIA 1QBGA 1KEGH 1LF0A 4DCTA 4DB4A 5C9ZA 2JLXA 4M7JL 3AQYA 3G1TA 1P18A 4JDUA 1HXMA 3RUHA 3DP9A 4KHXH 1UDRA 1QQDB 4XNAA 4AM0Q 2I4LA 3OPVA 4HS9A 4MKIA 1GRWA 2Q5HA 2YZ1A 3OU2A 3ZCQA 2DP4E 3T3PF 4EUFA 3RPBA 3ZTJG 3LVQE 3HV2A 1V71A 3IRCA 1Y3HA 1G9SA 4QT0A 1IK6A 2GYWA 2AN5A 2FLMA 3W9DA 4K1XA 1R4NB 5C7YA 3R5KA 4ZVRA 1CUUA 2C03A 4HB3A 2POQX 5CJ5A 4BCXA 4A2QA 1U4FA 1W0JD 3KXFD 1S6YA 1NNI1 2CDBA 4X0KA 3ZOAA 5JYDA 2GK7A 1XD1A 3HYTA 2ZJ2A 3DTVB 3I1FA 4AUUA 2QMUA 5DHSA 3P32A 5DJXA 3RIYA 1TUGA 2CLLB 5BV7A 3RWJA 1H4SA 3TQSA 2JLUA 1YDPB 4M21A 4PJ7A 2JKZA 4URUR 2I6UA 3CC8A 5LC1A 3EVTA 3E3QE 5JS8A 1YYMH 4QHMA 3DJZA 5B37A 5K9ZA 3MRHA 1O1YA 5AOJA 3Q5OA 4F3CA 2VRWA 4FI7A 3CZEA 3FUTA 1UMDA 3NN8A 4HKJB 4DWWA 3CLKA 4Z77B 1QFHA 1RIUH 3CG0A 4JL8A 2AF2A 3G6DH 2Q1XA 3S8FB 1USZA 4AVYA 1OYYA 1PVVA 3FT2B 2XV0A 5IB2B 4V1CA 2DM3A 1EX7A 4RNCA 3H11B 4PJ7B 1K7CA 5HDBF 3N42F 2W4IA 4U6VL 3Q7RA 1Z6YA 4IZIA 3FLMA 4JLRA 4OHXA 4R97C 1KVSA 2B4AA 2EJBA 4HIJA 5TT1A 2X1OA 4ETQA 3I52A 5G3ZA 4LHZA 2KDGA 4I3SH 2UXBB 5SY4A 5D3QA 3O21A 1VGRA 3SI7A 3IDYC 2VSKB 1ZLUH 4DW2H 4PRNA 5LDUA 3EYUH 3QW2A 1FZOA 4BFBD 4E1VA 1T2DA 3VXOB 3BPCB 3DVLA 1FNSH 4G23A 1CJBA 2E18A 4UF7C 1MV5A 4IOFD 2L7JA 3QT2A 2QRJA 4M1GH 5FO9B 2D59A 1VL2A 1CK0L 1RJFA 3FQNB 1ZD8A 1RXSA 2FLVA 4GG1A 4HB0A 2JHGA 1U5BB 1S2EA 2A7BA 3J07A 3MLTB 1OLXB 2QQKH 4ZIRA 5AK3A 4HFMA 4JJZA 1OH8A 4ZYZA 3FB4A 2YRLA 4Z1PA 4BUJA 1TIKA 3FU7A 2C8VA 3MLSL 3HJUA 3AT0A 3FH0A 2QHXA 2ZXEA 4MZIA 4IZ6A 3PIRA 1RKUA 1WZLA 3UNXA 3W06A 1KO5A 3CG8A 2C54A 1YUHA 1FDIA 1ZVSB 4J4HA 5JYBA 1Z6JT 5F9MA 4N9GA 4OREX 3RAGA 2WQ6A 2LTQB 2X1QA 1EDDA 3SDYH 2NNAB 5LIRA 4OCSH 1E92A 4A7UA 4IF4A 1NRJB 5ALNA 1EIZA 3CUSA 5IB4A 2P7HA 5D7IB 2AKRA 2JH3A 2O59A 1YEHL 2WINI 1NSYA 4UOZA 3KLSA 5ERYA 3T0WA 2CMRH 5COQA 2RHCA 2AZUA 2JPDA 5DZNA 3ATAA 1ML0A 2YTZA 3TZBA 4X44A 3BIKB 1BWRA 5C4IA 1VCBC 4G81A 2C7VA 1A22B 2XTJD 2H2IA 2CFCA 4ENQA 2FTAA 2I0FA 2HXSA 1ZH6A 1HBJA 5SV4A 4MCNA 4MNTA 3OQJA 3B2XA 2EVHA 2IOQA 2QTEA 3CISA 4GKLA 3B1YA 1QR1A 1YQEA 5TJHA 5A4MS 4FK8A 2OULB 3M6FA 5EFIA 2HZBA 3DO4A 2WTRA 1TNNA 2C9ZA 3FNGA 4DCPA 2Y8EA 1J56A 3OKNA 3MODH 4XNBA 2AXPA 1NDHA 4ZMTA 1LS1A 3WO0A 5C0DB 2VKTA 2PUJA 1D6SA 3B9AA 4LZJA 2D8AA 2CJPA 3W0WB 4HUUB 1FDTA 5AD0A 3AVUA 3FNRA 5LLSA 2BJML 4KUCF 3ZWBA 2GBGA 2VZ3A 1OP4A 4M3NA 1OW3B 4OFYA 1A6WH 3SE7A 3UICA 3KL3A 1AKEA 2GYYA 3KDPA 3UEZA 2BP8B 3RVWC 4ZFGL 5DHAA 1QDLB 3HZMA 2OZVA 3UWMA 3PUKA 8PAZA 3AF0A 2RAUA 3YASA 3FB7B 3AACA 1M2EA 3R5XA 13PKA 4BQIA 1KN4H 4AV0A 1B0WA 3VW3H 3MQ2A 2FUTA 1A3RL 1T15A 1DS6A 4OZIE 3CXDH 3IE0A 3FN0H 1YVLA 4H7DA 2COVD 4UTAA 1CXIA 5DVKA 2MNWA 3DL4A 5DP1A 4M86A 2CJTA 4FQJH 2OK8A 5TVGA 3EGIA 1FLTX 4UDUB 1IEHA 1C4KA 2ARJB 2YY6A 2QDVA 1J9ZA 2CLRB 2ZEJA 4U6YA 1JVBA 5SX4H 1NSNL 4AYFA 2VJDA 5A2CA 3WXBA 1WUHS 5J11C 3O3NB 5KSWB 3CX5K 3IIEA 2XTJC 4BRVA 5AW9A 4BGVA 4NQXB 4MBOA 4FFBA 3FCBA 2VR9A 4RAQA 4JIMA 1W46A 4WFED 4LOVA 3AJ9A 3EQ6A 4C05A 1Y7VA 4LIQL 5C0ND 1MCJA 4AEHL 4CLOB 4GSKA 3AY4A 3CZ9A 2Z65C 5IV2A 3SD2A 3MTIA 4P46C 1N5AB 1IKNC 2GC7C 1J20A 3LA8A 2BEVA 3RSHA 3BMCA 3LNDA 2OCBA 4K6HA 1BFVL 2NY6C 4QJIA 2EL9A 1I3LA 1M2FA 5IAGA 1EWTA 4MPTA 4F85A 4QRRD 2IBSA 2HRZA 2PPFA 1FWXA 2ZF9A 2YY7A 4ENED 1YAJA 5EJEA 1TNDA 1W5EA 3RWGB 2V5VA 5J6GB 4F72A 1C3EA 5CYGA 1SHXA 2IANE 4Y2UA 4HFJA 1N3BA 1VBMA 1YZNA 4HK0B 3I1YA 3AS2A 2WZDA 1GOHA 4JYBA 2WXQA 5JXED 2FUKA 3O38A 5L4IA 1XV8A 4GRWH 2BNRD 4YK7A 3FOAA 5K4AA 2XBZA 4CLHA 5D84A 1LNSA 3T0XA 3SC2A 1I9JH 3ZDZE 2DLEA 4G82A 3OUZA 3M1BA 1T1IA 2IHYA 3BH0A 1TZHA 2P2YA 5F2FA 1VDMA 2I8LA 3I8OA 3KPJA 1JN6B 2H54A 5IBTH 1FJ1B 3INTA 1FPQA 1Y1UA 2XMZA 5CMAB 1BSIA 5AM2A 5FYJL 1XRPA 2OTWA 2G09A 2LCIA 3WLPA 3PNYA 3PAYA 3GM0A 8OHMA 1X8KA 3IV9A 1BZ7B 4QRRA 5AOKA 4JENA 1W5FA 1L9SA 1XT6A 3LJ3A 3F8UB 1U8CB 1TYDE 5M3BA 3SDYL 1ZISA 1H15B 5EZ6B 1NATA 2BHYA 3HA3A 2VDRL 4BTVA 1YIDA 3IN0A 2XY4A 4I2XE 2VDOH 1UKBA 1MB4A 3O2WL 3FYTA 3OKFA 1YZVA 3H18A 4JKOA 1MI5B 2VQ6A 2VF4X 2GJPA 1GM5A 4MRRA 4ZC8A 1A9XA 1OAYL 1MA0A 2CMRL 3BUYA 1COZA 3GHPA 4QOKE 1SHMA 4Z76B 1FDWA 5CGZA 1JALA 3HVJA 3VACA 3GROA 1MBZA 4AH2A 4I0PC 2FL5A 1YB5A 2OFPA 1MCPH 1V54B 3DDZX 4WBSA 3GLFB 5CS7A 5E38A 5F1NB 1K6MA 2YMQA 4LOKA 4WACA 3T2OA 3D6JA 5ADWA 1QF7A 4NC1E 3BZEA 2NU6B 2WI8A 3BXPA 2PKYX 1HA3A 5HK8A 1Z56C 1AUXA 2B4TO 4XCNA 4E2ZA 3F58H 3RFZC 1CY2A 4GR9A 5IARA 2B9BA 3MTXA 3FT4B 1R12A 4MHHI 3BRQA 4M5YL 1QYGL 3IDQA 1SIBE 1ZS8B 4HH4A 3MODL 3C8KA 4P7JA 5AB2A 1CYXA 1FVOA 4DUGD 2D7JA 3PC8A 3RU7A 2YIDA 1YNKL 3G5YB 2DE0X 4MHOA 5ITZA 2IDTA 5EAIA 4XWOA 1SUDA 2O72A 3UIZA 4U05A 4NNPH 1UMKA 4EG7A 2GSIA 5HJ2A 3DXAB 1Z88A 1FUNA 2JB6B 4IBSA 4JO1H 2ZS8A 3VOSA 1XPOA 4EUSA 2P8PA 3WEBA 3LIIA 3CNNA 1CHDA 1K8DA 3EXIA 3U0WH 3N6VA 5INCA 2Y3NA 3LQYA 4A2PA 4BZ1A 5K1VA 3I5AA 2FBJH 5HZMA 3OF6D 3RZCB 3K6OA 2W80C 5DCCA 3EFHA 4NLAA 2HJKB 3Q1EA 2E55A 4MA5A 2DWDA 4BKLB 3TR6A 5F0LB 3KX2A 2GN4A 5DHTA 1K5HA 2XV6B 3GEWB 1UDAA 4HT1H 1ZDMA 1ADQL 3Q0HA 1S5IH 1QR2A 1ZLVK 5IZ4A 3ZG6A 3D85B 4RIGA 3GSRB 1D7CA 1DRWA 2FPGA 4AEFA 3T1WA 3BZWA 4QELA 2BMEA 4YLEA 1XTPA 4XE5A 3LQ2A 4JEHA 1WWCA 4OXXA 3T4PA 4FT4A 1JPGB 1ZAYA 4AUYA 1SU6A 4XWGA 3T3DA 4HNVA 3ARTA 4UU1A 5ETJA 3RUGB 2DS4A 3OKMA 2W92A 3JWPA 2DRUA 4KK5D 4UEOA 5C31A 2I9KA 3KUUA 1JNYA 3QK7A 1KY7A 4DKFH 3SKJH 4PWYA 4OD2B 2GEUA 3WUZA 4NUQA 1XGTB 4BD4A 5CG2A 1BAWA 3HNVH 3H4FA 1PNCA 2VUSA 4Z6AT 3EK2A 5JSZA 3OTOB 3RWBA 1FL3A 3OJWA 2QRVB 2AQ2A 4ZPTB 1SLXA 3OUUA 4LMPA 3UWSA 1XB2A 4KAXA 5D2LA 1XRQA 2JGEA 2I5PO 2AJSH 4RMQA 3WSQL 1CIJA 4TZ6A 3Q8XB 1UXWB 3MLXH 2FETA 3ENWA 3SX0A 5DIFA 4PONA 1JF6A 5HM8A 3RWDB 3OKOB 4KAQH 4P57B 4X24A 3QHZH 2F7OA 1I1YA 1QPXA 1G2OA 4IGBC 4FQXD 1ND5A 4JQIA 5ETUA 1KJQA 5E4TA 2R8XA 1JZQA 4JBNA 2BC4A 4NMLA 5GZ1A 2K78A 3HDYA 2NY2B 1JJVA 4XSGA 3WKCA 1C1YA 1VHPA 2NX2A 1I80A 3CUYA 2PMBA 4L9LB 1XZIA 3D6FA 3I04M 4YMWA 3FHTA 1AQ8A 2ZBPA 5C3TA 5JYCA 1HFUA 1P0MA 1A6PA 4B09A 1BAFH 1E65A 1COWD 4XFKA 1N6RA 4RTPA 1AQMA 4O2LA 2EIZA 3PJNA 5EIBD 3QUKB 4RA9B 4PGFA 4P5KA 1BQUA 1JP5A 1P9MA 1W93A 4LK4A 2EEZA 3RKPA 4RHXA 2Y0EA 2NYKA 4CM4A 1DVTA 1J8KA 5C97A 1FCJA 2ASVA 2DH6A 1PTJA 4L1BA 1IM9A 1P84J 3BM5A 4APXB 5KKCA 1AHKA 2BY3A 3T0GA 2Y7NA 2OO3A 3TUZC 3F85A 4BINA 3I6GA 3BL5A 1PYOA 2CR3A 4MTMA 4NV3A 1VENA 2DQ4A 3FMGL 5LCVH 5BVGA 4HOWA 1BMDA 2PCPA 3UG4A 4BVLA 3D2BA 1FVEA 4EF6A 2FR8C 3IFSA 2AS0A 3V4PL 5HHQA 2OMXA 3IGKA 3E7PA 4H44C 1AAJA 4QDKA 2CJYA 3FWZA 5H2BB 2GCOB 3BZDA 3MGGA 1A9ZA 5EKDA 4ETNA 1ID5I 1L7TL 5C07E 1G9NL 3AU0A 3RIMA 3OX8A 3QJFB 3VGDA 1XA0A 5EZLB 2POCA 3RAFC 2R1ZA 3EYVA 1TKCA 3P9SA 4F33B 1KYIA 1RRCA 3FO9B 3RPKA 3V6MA 2V7NB 3HLAB 1OH5A 2HY7A 2FP3A 3UCFA 3DP7A 4IR7A 4IIGA 2B2CA 1GZSA 1FFXA 3MLBA 4K5MA 3NDIA 2IALB 4I9HA 3TW8A 4M88A 3T8MA 4YLCA 3FPJA 4EQ2A 3F58L 3FFTA 3R19A 1QHYA 1W0VB 4YRLA 3MV11 4YVNA 4RK5A 3RANA 4KDRA 3TTTA 1JFQH 4QOSA 1O7DC 3QV2A 1CYGA 1BKYA 4H0FA 1DL5A 1GQOA 1OFUX 4O51B 4A5SA 1SKQA 3NOVA 1ADQA 5FL7D 5CITA 4ALLA 3TM4A 4MV3A 1GJIA 4OXKA 1NZFA 1KKMA 4C0WA 2ROQA 2XQ0A 4DK5A 2WXJA 3L54A 2OESA 2CRMA 4Z7WA 1SU8A 1CF1A 3L7EA 4X5WB 4RFLA 1TU0A 3TCLA 4GOMD 2BY4A 5JQGF 1WHTB 2VJYA 1YR7A 3LT0A 3WTXA 3IOMA 5IPFA 1V7PC 1JPTL 1KF9B 1KEZA 5CBAA 2ZSEA 3PDDA 2GQHA 1NAMB 3JR7A 4NNOA 3RFXA 2VGLM 3GA5A 1JWMA 4FDWA 2REXB 4XQEA 4P5TC 5EGNA 4R0NA 4AL4A 4LDOB 1N5OX 2AV1A 3FOLB 4DEPC 1V8PA 2DN7A 4UAGA 2EO9A 1ADBA 3KC2A 4JA2A 4BRSA 1FRVA 1SRRA 4NOBA 1U90A 2CW5A 3BKYH 4Z54A 2WXIA 2PX5A 2UYQA 4GD3Q 3CSPA 1IZ8A 3WN6A 3L45A 3CH5A 3OC0A 4LLUA 2LPMA 4FFYH 3RB7A 3TCXB 4D98A 3V5KB 1M66A 4CWAA 4PYHA 3M3HA 3VXSE 3VNSA 4P2RA 4MW9A 3BRGC 4ZI7F 2NY0B 1T9CA 1QKZL 2EABA 4K3JH 3ZKMD 2YMLA 3L7MA 1XEDA 3MB8A 1P5UA 1EVYA 5DRZB 1SVUA 4MRNA 1M6OB 2W00A 1Z75A 4DCNA 4C88A 1KWGA 2EC8A 5G5DA 4UT6L 2Q8PA 2VWGA 3WS7A 1EXNA 1QDEA 3LQRA 4A6YH 1SXIA 5AKXA 1BYIA 4Q1VA 5KJ6A 1E1RD 3WGGA 1AZRA 3WXVH 4UTAH 4MTCA 3RTDA 3W4IA 5LWHA 3HR5A 1DZ0A 1L4KA 5BV7H 2NVUB 3IRUA 5ALTA 1UOWA 2Z58A 1T34A 5C1DA 1BG1A 3CTPA 3WSQH 3VD4A 5HBRA 1GZ6A 4GKNA 1X42A 3DUUA 5LDHA 3GJXC 3TA3D 3UF0A 4V1CI 2IQ9L 3P9NA 1Q9LA 2W81C 3BOSA 1J5PA 3ED1A 1PJWA 1PEZA 1T13A 3QF4A 2RHEA 4OI1A 2NZXA 2BEJA 2QNIA 2MMXA 5CR1A 5IMOB 4PD4J 1KCUH 1T35A 1KLUB 1JHPA 1FC0A 3KP1A 3SE9L 2QQNL 3PX2A 1TU2B 2AOVA 5AMXA 3JZAA 4L3FA 2H3XC 1RI2A 3ZE1F 3EAQA 3EYOA 3U6RB 3RFZB 2C2XA 4FMBB 5TD4A 4TLMB 4JCWA 3BAKA 4KRPD 1SVMA 1MX1A 2B30A 1N6UA 2ERJC 4WFGD 2EH8H 4AF7A 5IROC 2C3YA 2QN7A 3N2NA 4G8GB 4AZ3A 2J1KA 1EV2E 4PGBB 3EYSL 4NOLA 2GAJA 1I2MA 2OXHB 3L13A 2VTVA 2XN1A 1EJOH 3ICOA 4TVPH 3DPSA 1BSVA 3BWEA 1PJ2A 2P1YA 3LKSA 4Z9FA 5E00A 1ZMBA 3H42L 5LUBA 3JT2A 4UBMA 1KEEB 1G7PB 3VSUA 2KHZA 3GRVA