2VC2B

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist l-739758
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
461
structure length
457
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
total genus 126
structure length 457
sequence length 461
ec nomenclature
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vc2B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vc2B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vc2B03
2XGGA 1JV2B 5HGJA 3AL9A 1MF7A 3HI6A 4NENB 4MMYB 1PD1A 3EGDA 3AFCA 3T3MB 1YUKA 3ZDZB 2NVOA 3PPWA 4O3UB 1M2VA 4BJ3A 3TXAA 4WK0B 1IJBA 2IUEA 3VI4B 2XWBF 3Q3GE 3NVQA 1CK4A 2UZYB 2NUPB 4C2AA 3HXOA 1MQ8B 1M2OA 1OLZA 5KYUB 1JEYA 5E6RA 2P28A 4NEHB 4HQLA 1QC5A 1ZOOA 2X5NA 4HQFA 3TCXB 1CQPA 1MJNA 3FCSA 3GXBA 1JEQB 5KYWA 4O02A 1T6BY 1DGQA 1PT6A 1T0PA 3PPYA 1NA5A 2NUTA 2ADFA 3ZE0B 3K71A 3NIDB 5ES4B 4C29A 3K72A 2WINI 4F1KA 4HQNA 1L5GA 4Z7NB 3TVYA 1U0NA 2VDMB 4WK4B 3EH1A 4HQOA 1XDGA 4WJKB 4PN7A 1JLMA 3E2MA 3NIGB 4MMZB 1U8CB 4C2BA 1M1UA 3BN3A 5E6UA 2VDPB 4Z7QB 3M6FA 2VDNB 3IJEB 3BQNB 2WW8A 1AOXA 3EGXA 1Q0PA 5E6SB 1MHPA 3K6SB 1MQ9A 4IXDA 4G1EB 4MMXB 3EFOA 3AL8B 1IJKA 1JV2A 1N3YA 3F78A 3ZE1B 3EG9B 5KYXB 4MMYA 2P26A 2I6QA 3IBSA 1M1XB 4M76B 2B2XA 4FX5A 4JDUA 5LN1A 1IDOA 3OL2B 4G1MB 3V4PB 1ATZA 2I91A 1SSLA 1SHUX 4WK2B 1RTKA 3N2NA 1TYEB 1OAKA 2NUPA 1BHQ1 4O3TB 1SQ0A 2VDQB 2O7NA 4HQKA 5KYNA 3OKYB 5KYUA 3QA3E 1UEXC 1QCYA 4UM9D 2ICAA 4A0QA 3PPVA 1YVPA 1SHTX 2I6SA 1JEQA 1ZONA 3FCUB 4XW2A 5KYYA 2VDOB 3ZDYB 1IDN1 3EGDB 3T3PB 1PCXA 4CNBA 3ZE2B 1DZIA 3F74A 4CN9A 1BHO1 5HJ2A 1M2VB 1ZOPA 1XUOA 4FWWA 1U0OC 1MQAA 4NENA 4CN8A 2VDRB 4MMZA 1U8CA 1JEYB 3EFOB 5E6RB 5HDBB 1QC5B 3IJEA 3EOAI 3BQMB 3FCSB 2XWJI 4UM8B 4K3JB 5KYWB 4Z7OB 5E6SA 4O02B 3K6SA 4GZ8A 4G1EA 4MMXA 3TW0A 2NUTB 3AL8A 1FNSA 1PD0A 4IGIA 3K71B 1LFAA 2VDLB 3EG9A 1XDDA 3RAGA 3ZQKA 3K72B 1RS0A 1V7PC 3EH2A 5KYXA 1M1XA 2ODQA 3ZDXB 1RD4A 1L5GB 2QTVA 1FE8A 1AO3A 3OL2A 4G1MA 2ODPA 4WFQA 4UM9B 2VC2B 2VDKB 3EOBI 3VI3B 5E6UB 3HXQA 1SHYB 5KYYB 3V4VB 1AUQA 3PPXA 4IHKA 3OKWA 5BV8A 1N9ZA 1M10A 2M32A 3EGXB 1RRKA 3NIFB 4F1JA 4DMUB 1YVRA 4JX0A
chains in the Genus database with same CATH superfamily
1PFWA 1RUQH 1GSMA 1SJXA 4GKAA 2RJ3A 3Q87B 1RJLB 1CXLA 2BH0A 1A5FL 1KIPA 2X2YA 2EVFA 2JLZA 1QO0A 2HO5A 2P4UA 4RTLA 3GXBA 2A2QT 1VDGA 4U3JA 3ZE8A 4AVIA 2P5SA 4U1IB 3UXMA 1K2DB 4LNUA 2NXYC 3BAFA 2ZUXA 3IBFA 2DHCA 3K2EA 1KE1A 3T0BA 2FJFB 4QBTA 3QU7A 3KZCA 3MC0A 3GEMA 2BRUA 2ITEA 4IBLT 1O7VA 1ZMRA 4HUWA 5FEBA 5GSRA 2BOBA 2UVPB 3I6KA 1S5HB 4FC7A 4OQZA 2WFLB 1GIGH 4JMNA 5KW9L 2X09A 1WZNA 2AAAA 1I10A 4PJHE 4D5EA 4RDHA 4GL4A 2CZGA 1BAFH 3N41B 4M1OA 2XNKA 5JYDA 2Q8NA 4FQ7A 4I0PD 2IXTA 1LO4L 5IK2A 3LCYA 3L3BA 4XNMB 5E7IA 5HGAB 4KIUA 5LYJF 3S8YA 4PYGA 4RA6B 3SSGA 4K3EH 5DJ0B 1W4AA 1E9QB 4Q74A 1CLZL 2GTZB 3L0SA 3CSUA 1ISFA 1F8GA 1ZK3A 3C5JA 1OAOC 3VR6A 5GSVB 4ANVA 3E22A 2R7EB 3DUUA 1KQOA 3D4IA 2J8UF 3U6BA 2WMOB 5J89A 2ETVA 4NU8X 2IUUA 3BK1A 5DPMA 1QFWL 4HEPA 4LXFA 4UZSA 3MROB 5ECJE 4WI2A 1QAMA 2J32A 3GHPA 3VKWA 4DCTA 4JFAA 3WMWA 5JNVA 4HH4A 5BW8A 1AKYA 1RQXA 2JGKA 2LZ0A 5TMEA 1TT5A 2AR0A 3EXHB 4CLOA 4UU9A 4OPMA 4C01A 2YFYA 3GTNA 1JGDA 3PD7A 2FUEA 4EI5C 1P7QB 3FU6A 1DBMH 1BYPA 3UT5B 3L40A 2QVKA 2P9GA 1CFTA 1I1NA 1QGDA 1KHTA 4GWGA 3PR2B 3N2GB 3A37A 4JG1H 2WVHA 4RESB 1I51A 3IKCB 2NX5D 5EV7A 4KN9S 4AKIA 5J43A 4MDYA 1IONA 2AEOA 3X1YA 4XPFH 1TCUA 1Q0HA 4YWJA 3KQSA 2NO9A 3P94A 4OCRL 2P67A 4UQ2B 721PA 4OM0H 4TLDA 3FB5B 4G71B 4KVPA 1G7LB 2HT2C 1EFXD 3MRCA 1G66A 4OUUA 4AV0A 1EJFA 1D4ZA 3VV3A 1PTZA 4YSOA 1RK0A 3RI5K 2Y77A 2RGDA 1I01A 3KCQA 1P3DA 1PNTA 3FT1A 3GP3A 2X4QB 2VZLA 1OLSB 1SFHA 1AO3A 4EKYA 3X2SA 5CSBA 3FU0A 1E3JA 2DT8A 4NC1E 3LV3A 5B21A 4MWFB 2X0JA 4TLCA 5AHOA 2ZSVA 1RZKH 2PZGA 1CL7L 2E9SA 3GQFA 4IF6A 2WKLA 1KBQA 1LU9A 2Q21A 2BSRB 4ND6A 3GPBA 4IWNA 1F3DJ 2B16A 4EMUA 4FGZA 4DZZA 4KYUA 1QQDA 4HR7A 4F37F 5F1KC 3K09A 3A6FA 1BKYA 4BASA 2C8JA 3R0QA 1TQUA 3FB7A 3CV5A 3FQ2A 1PP4A 2RHTA 4JO5A 2XUKA 2BOCA 1JV5B 3Q5OA 5LMCA 4HSAC 4XSHA 4YVNA 3ZXYA 4CMKA 2RDMA 3E0QA 3HA3A 4NUJA 1PGOA 1XTKA 3W7BA 3V6FA 3ETEA 3NDJA 1EAJA 3P7MA 3ZI7A 3Q2WA 4I36A 2CNNA 1YIDA 2W2MA 2W8BB 1U2GC 4HTFA 3RJZA 3SPVA 2AI0L 1AUOA 1PZUB 2IXQB 2EWVA 2A92A 3UB4A 4N8UA 1K8DB 4K7PY 5EKUA 4DWVA 4P5KB 4AECA 5HYJB 3KHSA 2FDXA 4Q1DA 5CCDA 1H9AA 2VHCA 5FCUH 3GXMA 4A66A 4FQXA 4HWBH 3EDQA 4U1HA 3ZSSA 1GGYA 2OCIA 1RK1A 1R3DA 4QM7A 3ZKND 4F4CA 1VHLA 4ELDA 2P9YA 4NQCA 3OQMA 4C89A 4P80A 3GNLA 1ZIOA 3DIFB 1R0SA 2IOFK 2FN3A 3R1IA 3M07A 4RSGA 1CDGA 3I8XA 4JO4H 3AZUA 4RAUA 1K6QH 1CCWA 4G5ZL 4D7AA 2WWMC 3ZDZE 1AXSB 4OHRA 1EWQA 1KAQA 4R4FL 3DGDA 3EXHC 3G2IA 2Q8BH 5A1JA 3G04B 3P9LB 5KC8A 3V0DA 4B9CA 3ABMB 1FU7A 4ED9A 4KPEC 1KXZA 3CE6A 4I19A 3S3CB 4DO5A 2MTBA 3N7TA 1UA6L 3KL0A 2HOQA 1QFYA 1C9YA 1O1YA 1PL3A 4BJHB 5HUHA 3JV6B 3IDMB 1RRGA 1WWWX 5D1XB 1G20B 5HYJE 5E6UA 4PCTA 2ANCA 3VH8G 3QWFA 2Y72A 1KVRA 2I2CA 4DCGA 4H7VA 5GVRA 1OY3B 3NSXA 3TH5A 1JPTH 2JGDA 2H3NB 1VXRA 1LO5A 1WIOA 4JM0A 5KSAD 4M0FA 4C0KA 2GK0A 1QGYA 3AACA 4O4JA 4BJ5A 3Q1LA 5JMTA 3TA3A 4YDHB 3AEKA 1GSHA 2QZPA 2F6AA 1NPJA 3OB0H 5J12B 5A2GA 1UWGH 1A02N 1RR6A 1A3LH 5DLML 3SDDB 3W57A 1N2ZA 4YNBA 4UQBA 2EDHA 3DZDA 1AE6L 5C5EA 5CDYA 3HCFA 1NW9B 3NBQA 4LF5B 3JWNC 4CF7A 4Z0TA 3WADA 4LQFH 3I75B 3QUKB 4AL4A 2EKQA 1ILWA 1ZT4A 5EC2B 3FHQA 3X3HA 4D0CB 1VIYA 4UM8B 1L4MA 3JQ9C 2PMFA 3FRIA 4H1UA 1JDBB 2IUFA 1VEPA 3WLAA 4Q7KA 5AUOB 2KX7A 2GEUA 4IRUB 4L50A 1QR1B 4K07A 3HC4L 3PDJA 1E9OB 3O83A 4IJ3B 2JCCA 2OB1A 4LY6A 4E88A 1KY6A 1G20E 2EIZA 2RIPA 3MTJA 4RIIA 4NZTL 1T2AA 1PSZA 1P9NA 4QDUA 3TL3A 3U7YH 3FOCA 1CXHA 4QPJC 3STWA 1KL7A 4ARCA 5FWDA 3PCXA 3TIDA 5CN1A 1SURA 4DVGA 2NTFB 4XNAA 2E8YA 4OFYD 1FTGA 1YPZB 1SH7A 1U9IC 1VKHA 5D4JA 3QZWG 1U58B 1TLLA 1PPIA 3A4FA 1DUSA 1TMQA 1VF5C 4X6CB 4DCVA 4HDIB 3OPUA 1UKAA 4JEUA 4RKQA 5CXUA 4YUAA 1M9SA 2O8BB 3VVVA 4QD2E 2EDNA 3R44A 4QUEA 1QSEB 3M81A 1OWOA 1YDWA 4A6YA 1TLKA 3I0NA 4KQCA 4Y1AD 3X14B 4OJAA 2DKFA 2OK0L 1BHO1 1KEMH 1UBJS 3KKKA 3U1BA 4FP8H 3UZQB 5IV2A 1KF0A 2WIIB 2O8CA 2BE7A 5D7BA 5CJJA 3RUCA 1PEWA 4R6WA 3UC0H 3MQFA 1VCNA 3D4LA 4DESA 4N5LA 4LCWD 2G60L 2JH9A 2A83B 2SKDA 2N7SA 2XG4B 4JP8A 2VP0A 2B5VA 4DGQA 3AR5A 1IHDA 1E6MA 4WW1A 1ILEA 1X7ZA 3RVXD 1VG1A 5EIBD 1CFJA 3WJ7A 4BHUI 3FH0A 1JE6A 1D1TA 1W2GA 5DUMH 4RACA 1Q7EA 4LVOB 4X6CE 1JZ8A 5CFRA 3TWOA 4P2OA 2W43A 3KH3A 3T95A 1LD3A 1OAYH 5D1XC 1XIWD 4ENQA 5K9OA 1N2CA 1CGVA 1ZJ5A 1Y5NA 3STVA 2HMWA 2AQRA 4WLVA 1TZIA 3VU1A 4Z8YA 3NTLA 3WIIL 4NWUH 1WU8A 4R1PA 3TLXA 3IUYA 3MSXA 1YVDA 4WK6A 4XGIA 5IQLA 3NOXA 4N7RA 4QEDA 2NUBA 1LWHA 2NTYC 1XBDA 1IVNA 3BHBA 5DCLA 2JB9A 4V0RA 4CM4A 2H16A 3C0KA 5HZKA 4DVRH 1FW6A 1Q3TA 1K89A 3BL8A 3T6QC 5J12C 1NOFA 3SDDC 4NEGA 1XEUA 4LCCB 4ZDHB 1E1CB 4TXMA 1NM5A 2E89A 4UBNA 1WSDA 5L3QA 4OLUL 5K7SA 4AP6A 4UB0L 2Y22A 4N86A 1OX6A 2JFPA 1AS8A 1P6QA 1XCTB 2HLAA 3CRRA 3UG3A 3CTMA 4V0KA 3TBWB 3IQEA 3AJDA 4RA0C 3LYHA 1JDBC 2W0FA 3KOWA 4YQYA 4RK1A 1F56A 3TZHA 1SBQA 2VZEA 4RX4D 4XCCL 2ID9A 5HYFA 2EG5A 2KYRA 3Q98A 5BO1H 3HBQA 1L9QA 4IJ3C 1UUNA 5A5GA 5CBPA 5DMJB 3OPZL 4HZLB 2LLGA 3T7RA 1AR1D 1TZBA 2DWUA 1QTYT 3LUJA 3CVIL 1DBVO 1SVKA 2FUNB 1SWVA 1TEXA 4MLCA 3QWRD 2B0SH 2H63A 3ACCA 2YD3A 1NVBA 1KENL 4L74A 3WZ2A 1Z13A 4GW4A 1VKRA 2G1AA 1SHZA 4H6XA 5I82A 3PPWA 4LYAA 4OI0A 4KTEH 2VH5L 4HU8A 4L3FA 1RQGA 3ROKA 4H7DA 3GZOA 4LAQH 1SIOA 2PA0A 5H9VA 5CD5D 2E7HA 2IYPA 2H8PA 1SF5A 1TT7A 4BRUA 4KZCA 1JXKA 1I24A 5E4TA 3VR3A 3QE9Y 2UZIL 3I09A 1NANH 4H3VA 3CTTA 4Q4HA 4FFZH 3R7RA 1BW8A 3VV2A 3ULKA 3J81A 3DURB 1MFCH 2IODA 5L2KD 3CO5A 1UOPA 4RDIA 2XGJA 4XBGA 1G7JB 2VYND 2GZAA 1FNSH 1OTYA 1QPPA 3MRNB 4KXXA 4G3YL 1Z3IX 5KEIA 4ZTPL 4UOEA 5FO9B 2X53A 5TQ0H 4G2AA 2GJ6D 4GBXA 4MNQD 4QOFA 4W82A 2Z3ZA 3S8WA 2CKDA 5IM7A 4HCFA 4XP9H 2ATAA 2HJFB 4H4EA 1RYMA 3HHRB 1RE0A 1ZHKA 2RH8A 3VRIB 5K3FA 3BXHA 3KXPA 4HADA 5A4KA 3L5XL 1SYSB 3DWGA 1SGKA 3GP5A 3OZFA 1S8NA 4LVOC 3QUTA 3PNYA 1CY2A 3OX1A 3HLYA 4OTXH 1II4E 2XBUA 5JNLA 5CFHA 1L3NA 5AVUB 1T9HA 4B4UA 3A6PC 3ZCTA 2BNQA 3QKSB 1A7OH 4KQJA 3I64A 2HCZX 1P61B 1OCRB 3GMSA 3VRLF 5I75B 13PKA 4MPPA 1Y4DE 2E3JA 1TZMA 4V0NA 2ZXUA 2H7YA 5LLSA 5DHSA 1EZSA 3VJ6A 5IEKA 2OAGA 1YMQA 3GFVA 3SICE 1A7RH 1SB8A 1WPCA 4EJSA 3CR7A 4BSJA 1HILA 4LCCC 3MWFA 2Q9OA 2CHQA 3OE1A 4QGHA 4NNYA 7ABPA 1SXGA 2I62A 4BXOB 4H8UA 1LSUA 4G11A 1EVZA 4H25A 3KPQB 3PFHA 2SKEA 1P5UA 5D1QD 4QGAA 5I17B 5LPNA 5FF6A 1SVNA 3APNA 4JJ5A 1JIQA 4DG9A 4B2YA 3D85A 1C2YA 3JTBA 2DEYX 4Q9KA 1ZD6A 3KDMB 4JENA 2OV4A 4WDQA 3JWDC 3SYLA 1MRCH 4O9HL 9ABPA 4YBLB 3CUEF 1KYTA 4TM9A 1CJYA 4CIXA 1D7FA 1QX4A 2ECPA 3A36A 3LDHA 1UINA 5GIRA 1G2IA 2WC1A 4Z0XA 1GNTA 1NZJA 5IQNA 2V58A 3AU8A 4N3AA 2Q9BA 3H4IA 3PBKA 2IFGA 3RYHA 4MRMB 1FNAA 1NUDA 3NESA 2BBTA 2IOHA 1LBHA 1KN4H 4PQRA 1QWHA 5B1KA 1AP2B 3FOEC 1WDLA 2NY6B 2JCWA 4M48H 1FMLA 5B7EA 2Y6SC 2FHFA 5CIPB 3D54D 2H2FA 2J0UB 2FY8A 4ZMOA 3ANLA 5HYQB 2H9IA 5AKIA 1O77A 3IOBA 4OYHA 2A14A 2XH8A 2VF2A 3HA7A 2MQ0A 1I1FA 1QD0A 1KSHA 2CMHA 4GBJA 4TSAL 2NNCA 2P7IA 3WLRA 2OR9H 1JQJC 1Y1QA 4FUQA 1Z68A 2PQ0A 1ZLUH 4CDGC 1ASPA 3NIBA 4LK2A 4ZZ1A 1UFKA 5EC1B 1J23A 1JN6A 5CJPA 5DX0A 2X9NA 3HN3A 1I8KB 2VDML 2ZBGA 3HRKA 4KXZH 3L8CA 2QDKA 1T4CB 2JI3A 2WO2B 3WFIA 4D9QD 5ITVA 4NQXA 5IUSA 2YZ2A 4PINA 3MS2A 2WWVD 4PGGA 2Q8PA 1PZDA 5GRJH 3GM0A 4QOGA 5GOTA 4M4RA 2FNBA 1ZNZA 2E56A 2VBCA 2LFGA 5LM3A 4OSPA 5I75C 3VNYA 3K0BA 5EEWA 4M9OA 4L37A 5J4LA 3DAPA 2RAMA 2GN4A 1X1SA 3BFWA 1KBGL 4CF6A 4YBZA 5FUOH 3DGGB 4MW2A 3OF3A 2W4QA 5DZAA 4IS6A 5DASA 12E8H 1KR2A 5C0EA 3JD1A 1NFAA 3AY4A 1P9MC 4PB0H 1ZVQA 1JWMA 1HSZA 2WK1A 3ESUF 2I71A 1ULHA 4MVJD 4PU0A 3PYCA 1Q1PA 4V1CA 5IULC 5MP6L 2EIDA 2LTAA 4FLEA 3AT9A 1M8JA 3IEPA 1FUIA 1KZHA 3I1JA 1WVIA 1DQJA 3RWJB 2WF5A 2CDRA 1IDOA 1IM9D 3SHVA 4AL8H 2OCPA 4LTNA 4LXQA 1P77A 1IBCA 4YBLC 4OBEA 3QV1A 3KBHE 2J72A 1NXXA 1A4IA 3MM4A 1W93A 3UZEC 3NFNA 1DRJA 5JYEA 4V0SA 1U0OC 3C3MA 4PB9H 2BUCA 4ZXBD 1JDZA 1ZWIB 3X11A 4KTVE 4M9PA 3AXTA 1LK7A 3B9EA 3EXFB 2VL5A 3FF1A 3Q3GA 4EFDA 4J23A 4B76A 3VM5A 2NY6C 1Q3HA 1RHUA 5CZXC 5AI9A 1MNUH 2ODBA 3VPXA 1JNLH 4IU2B 1LMKA 4C7BA 4FN4A 4X60A 3ETBF 3LBAA 2MSNA 1QHGA 5CUSL 2BJMH 1KFBB 2HHLA 1FS4A 2BVUA 4QLWA 4N5HX 5FI5A 2FR0A 5LAXA 3IIMA 3BMQB 5K9QG 1YLBB 3QQDA 1K85A 3B56A 4OJTA 5YASA 5DNYB 5C3UA 1L5VA 1TZ8A 2PLWA 5FP0A 1SJVA 1MFVA 4XM0A 3N2LA 1WE2A 4S0XA 2VN3A 4EIZC 1DQSA 2YFNA 3IC5A 1USKA 5E7JA 4BO6A 1SXJB 5TE6L 3ACDA 1TJHL 5FGCB 2BGUA 3PUZA 3NDRA 3HSKA 1PBYA 1ND5A 4KQ0A 1F41A 4NZZA 5I8KH 1ABFA 4LDLB 3GDOA 3M6WA 2VJLA 3L8FA 1ZE3H 2OZLB 3TLGB 4MMYA 1G9NH 4M7RA 1X5MA 2J56A 3I6GA 4FX5A 4QGBA 1CN4A 1KTBA 2PQ6A 3QFRA 4JHVA 3TO4D 1UKBA 1KXQE 3PHLA 3IKMB 4HAFA 4X6FA 4P86A 1NGQH 3NQIA 1GUAA 2C82A 1XD9A 1U9ZA 2FZCA 3APMA 2O3UA 3PFFA 3UMMA 2GN8A 1DTWB 1JNYA 3VX1A 3GUFA 3GN1A 1QC5B 1JJAA 4AITA 2IPTH 2H0QA 4R98A 3SJAA 2QAGB 3WGNA 3MV9D 4U6HA 2QRQA 5FYLD 4JB8A 4NPJA 4AJJA 3H1PA 5SX4I 3LBIA 2QU8A 1PKQB 2A3TA 4WZBB 2JLUA 4X0KA 4F3FB 2YPVL 4DGUA 1LLAA 3LN9A 3G5YB 1A4JA 4HK0B 4JJIA 4H6VA 1T89A 3IJSA 3ARFD 4TKUB 5C0JA 5F72S 4AYXA 3O6KL 1SXJE 2Z8YM 5FGCE 2W6NA 3PFKA 3S4YA 2XZQL 4UF7C 1JG2A 1QOKA 2N0KA 4HJ1A 4E5UA 1GG9A 1R5IB 3S4SB 3GIWA 1Z56C 1I4EB 4ZYZA 2YD2A 1SRRA 2ATPA 3T0EA 4KMRA 4XNQA 1DQML 2RG7A 3LRPA 2A4ZA 3BWBA 5CP8A 4BQNA 3SZKC 1BFOA 3R5FA 1M1UA 4AK9A 1TO6A 3WJAA 5LG1A 2B37A 1OZGA 1WZAA 3PHQB 3QWNA 4HEME 1F48A 1S3GA 1M2WA 4AMKH 4Y4HA 1HQ4A 3C1UA 2ZP9A 2C26A 3P9CA 1Y6GA 2Y5EA 1LCIA 5FO8A 2WG1A 4U5XA 4NK5A 1CLUA 1PKQE 4WZBE 3KEMA 1ZPLA 1UD6A 5B39B 3K46A 4HX1B 1EFTA 2CZNA 2VLKD 1IM5A 2BBWA 2V6BA 1G8HA 4AM8A 1SVIA 2V0NA 1BFDA 1T3FA 4ZUWB 4NYIR 4BNLA 5HNKA 1U6AL 4UARA 4TVPE 3RL1A 2VP4A 2QVGA 5EEUA 2XMBA 3UAEA 3PQ3A 1CNEA 1TU0A 1MCNA 4X5WA 1YBVA 1XI2A 3IEIA 4R4BA 2UXGA 3NH7L 1ZVKA 3EMBA 3VXME 4EJ1C 3PQ2A 1QHQA 3DNMA 3A4NA 4KKBC 5NLLA 2GBIA 5K3BA 1YR9A 4YMWA 2BFOA 1Q91A 2FJ0A 3PCTA 4M0KA 4FFLA 5FAAA 4HAWA 1YACA 2VQ3A 3F47A 2FMKA 4UDTA 1ZGLP 1ECZA 3VZCA 1UBLS 3ZTNH 4DA9A 1J8HE 4N24A 3SJVE 1N2IA 1J10A 5BO5A 4Q02A 5DQ9A 3MUHL 4JAVC 4QMEA 1SXJC 2GEVA 3CLUC 4ZYYA 3MU3A 1EDEA 3QT2A 3I37X 4KJPC 5ICZA 3ZWKA 2JCYA 1QZNA 3KT0A 2CLVB 3LT4A 2YD4A 4XIJA 5L4SA 2IH8A 1MC4A 2BDNL 2NUAB 5I1LA 4KI0A 4AC2A 1ZS9A 5KNCD 3B2MA 3UGXA 5BUCA 3GKZA 1PZAA 3OQIA 2R1WA 2NV2B 1HCVA 1NP6A 2BOVA 3GD5A 3B3AA 5LWQA 1XVTA 4EDWL 5DM2A 2QTLA 2BKLA 5TEWA 2N01B 1R5VB 5JZ7C 2I60H 4JO3L 4DEXA 1AXTH 2E4UA 3L81A 5A7FA 4JASB 3I2CL 3IUMA 2X7HA 3IPCA 1FJ1B 2P40A 2QAGC 2QRGA 3FOMA 1UH4A 3CVWA 1Q1JH 2IH3B 4FDVA 3ABGA 1F6FB 2Q0QA 4EIUA 2YWGA 1N8ZB 4P3PA 1B0RB 3AV3A 1Q3KA 4ZZ3A 4RXUA 1Z9PA 3P4OA 3PLRA 2ZRBA 5HOEA 4TNVK 2V17H 4N8SA 4D8OA 3LQAH 3K6IA 2PUGA 4GXQA 4NXKA 1A8SA 1XAGA 4I1PA 2HYIC 3I12A 4L51A 1PO7A 4INOA 1MQSA 4AMZA 5L6YH 2XQFA 4KYVA 4HKJA 1A3RL 3STYA 5IPFA 2CL7X 3ME0B 4OSUH 4Q4DA 2DWXA 1U8LA 2YGVA 1R5NA 4JM2B 3WJMB 1DQPA 4QHPA 3E0XA 2DAPA 2XJ4A 3JVDA 2Q6LA 5K4AA 3IDZA 5TS3A 1Y81A 3JAKB 1OASA 2LCFA 1P4AA 1T0PA 1ISHA 1YYCA 3SYMA 4XO4A 3ET9F 5FWYA 5AB0A 3ESOA 3MTIA 4AQOA 3C6MA 3WGYA 3H75A 1TM1E 4CZ2A 1MY5A 1M7HA 1BVNT 3L08A 4MJHA 1OZTG 1L6IA 2B99A 3O2DL 3I73A 2EABA 2RCNA 4XHJD 1M2GA 2DJSA 1SHUX 3OOSA 2H1PL 2OP0A 2OMXB 2AX3A 3A9RA 1SKMA 3O8XD 3U7QB 4J1TC 2VR1A 1GFSA 3FVQA 5HJDA 3DVSX 3GRKA 1O94A 4P08A 1U8JA 1G6RB 1V8OA 2BRRH 1J21A 3MQIA 2F53A 1IC0A 1ZHLA 3O0RL 5E08H 3FTCA 4MAYA 4YDKL 4WFGD 5F7MC 3C7KA 5DYGA 4RTPA 3I9FA 4ZAVA 1V9CA 2EJWA 1BBDL 1G9SA 5JNWA 4IGIA 1OX4A 5IJAA 3OFND 1C50A 2PWGA 1J8RA 4H26B 1BFKA 1ZGZA 3OLDA 1A2KC 3ZDEA 4HN4B 3ZWCA 2P9RA 4L23A 3VFRA 4IHKA 4QDTA 4ZKDA 1YNTA 1JL3A 3DSFH 4JQZA 4BU1A 1QLEB 5IOPA 3MJTA 4YSTA 2IO5A 2M1ZA 3DDNA 1GPBA 5ID0A 3GBVA 3I9LA 1SC1A 2VJDA 2NQTA 4JGJA 4Y7OC 4KX9A 1M6UA 1H2WA 2R1TB 4WJG3 3RU9A 3EPPA 4JRXD 4NWIA 4J1SA 5I45A 3H2WA 4NQSB 2F8VA 2CE2X 4O4JF 2FHCA 3HC7A 4LCJA 1SJHB 4YZFE 2RBKA 3QJHB 2CNBA 2C00A 1PWZA 3K31A 5JLZB 5F9OL 3D1LA 1BKSB 3ZVVA 3VNSA 1AG6A 3LQYA 2RGRA 1CIJA 4DZ8A 3KLSA 5KVEH 1BJ8A 4HIEA 2XCIA 2BPOA 3KRTA 3CPUA 3PGCA 2PDAA 5A62A 1EJOL 5JTUA 4JMLA 4KLRA 2CXSA 4DPRA 1RAEA 4PS1A 4A2WA 4PRZA 4OOEA 4JFWA 2C9BA 1DZ3A 2O8FB 1YNOA 1GEGA 4U7GA 4I1YA 2XYVA 1NGZA 5KANG 5A6MA 3EZ6A 4ZSOB 2GUOA 1WIUA 2HT4D 2ROXA 4R2LA 1R0RE 4H2CA 3MACL 1EVYA 2JCCF 4YJ2F 5BWOA 1C7EA 3WB2A 3C41J 3CSBA 4P4SA 4BB0A 3LOWA 1N64L 1WAPA 2DSNA 3N85L 1SEBA 4ITVA 5DC2A 3QQ4A 1DQZA 1Y9EA 5FPPA 3KZ1E 1P1CA 4NFBA 1T10A 9CGTA 2NT1A 4PWIA 1ZAGA 1VSVA 4OGLA 1QH1B 4CGTA 4JM2C 1LEKA 4REMA 1M67A 2Y5QA 5BMFL 4YBRA 4YECA 2XXGA 3D2UD 1ZCZA 4WDIA 4GSLA 1ZJZA 4EABA 2R2EB 2XLCA 4XARA 4ZDJA 3NOOA 3IFLL 4GX2A 4IFIA 4UMDA 3I52A 5EOVA 5DNDA 1U6IA 4P3YA 2WJ4A 2X8LA 4BV2A 4EKEA 5BSEA 4BDSA 1NG9A 2EERA 3H8VA 4KMTH 1PZNA 4EOWH 5IB3A 4BNYA 3DXZA 2WSMA 1ZGCA 5FUXA 3NDPA 4O25A 2CVFA 2UZ3A 5F9HA 3W6OA 1XXDC 4OKIA 4TMXA 3ULUC 3IQIX 221PA 3FQXA 3H2SA 4IIUA 5CS7A 2CG9X 2X2IA 5FLEX 4IKJA 2AEFA 5EPMA 3TBSA 5KSBB 4BTEA 4N5DA 2WXFA 4YHKH 2OSYA 4OW6A 2JGMA 2ZX6A 5I19H 5GAJA 3Q6GL 1K5PA 3BWYA 1CXEA 2O2ZA 4CVXA 1DAPA 1UMDB 2CRZA 4XW2A 1MUUA 3DX0A 3AR7A 2H2SD 2WLIA 1U2DC 2PL1A 3RPKA 4JQXA 1QKZH 3ZHVA 3Q0EA 4OQQA 3FFCE 5DFVD 1W30A 3V0JA 3SAJA 3CHRA 3OBAA 4PJGA 2PBFA 1AIZA 4LF7B 1BVRA 1M1NA 1GOGA 2VJXA 3VJKA 4Z7OB 1MPAL 3ROZA 4GUPA 4K73A 5CA1A 3B3GA 4P82A 3AKZA 2VBIA 4XGNA 2XQ0A 2JFWA 1RZUA 1FG2A 4HS8H 2X4SB 4O4YL 3HRZB 1DJPA 1H6TA 1PD1A 2ZPKH 2GCOB 3UG7A 5CM2Z 4RXTA 1SDDA 4LLMB 4QOKA 3CV3A 5CVVA 4FA8A 5ADPH 3H3KA 4C22A 1KPHA 1CI5A 1DN2A 5DJ8B 2P43B 4A27A 3E48A 1RJDA 1ID5I 1CLYH 4DDHA 2C04A 1CS0A 2QVXX 3FLBA 4HC4A 4JZKA 1FV1B 4I13B 4CKCA 1IHOA 3ANYB 2F68X 1RHHA 2HPTA 5F96L 1BCRA 5EMYA 2B0JA 3LIIA 3BWVA 2ECQA 3EXIB 1GQOA 2RKBA 4TN9A 1E6JH 3I9IA 5LAPA 2R00A 4EJ6A 3F2IA 3QUZB 1KA9H 1S3KL 1G5RA 2PWBA 5ADUS 1A21A 1TTRA 2AKRB 1JHDA 3RSGA 4W9FC 3MBXL 1RACA 1XRMA 1XTPA 4Z3JA 3IDUA 3D8UA 3ZUPA 1GJUA 4HEA6 3E9QA 1KYXA 4WLEA 5CYPA 2AJYL 4J2TA 1BF2A 1L0YA 3OZ9L 1HORA 3PDOA 2FEDC 2QHLA 5EA0L 3N75A 5DMGC 1YEFL 5KVFL 1T1ZA 4DEYA 3P73B 3QDMD 4Z7WA 1CGXA 1UM6L 1RQLA 4C2UA 4MMXA 2XKJE 3EDCA 1I0ZA 4RCVA 3CBQA 2R6JA 3DEFA 4RVGA 4BZ2L 3LX5A 4DK3A 5E1AB 3MLTB 2AMJA 2DQGH 2AQ1A 1W6LA 3RD5A 1UPTA 4OFVA 2JLQA 1BEUB 3G5VA 4Y19A 2OM6A 2V7NA 4FYSA 3CH7A 2HNAA 1JRLA 4LEXL 4JBYA 1QFJA 3EGDA 1PZCA 2HA2A 2WB2A 4AGNA 1DVRA 1LB1B 2FPOA 1UD4A 3WEOA 4QNRA 5GS0D 2IMNA 3WGHA 3MSCA 4L78A 3OMLA 4FMPA 1QF9A 3DBRB 4FI8A 2Z04A 4EF4A 4O2CA 2FPPB 3ZNQA 4F86A 3TQHA 5IB4A 4M38A 1XZJA 1X2BA 5CJBA 5C2BH 1JWUB 3K2UH 5I8EA 1I32A 5IT2L 1U0FA 3E7DA 1MR3F 3TZVB 1T2QL 4H0NA 3EGOA 1G5QA 1WIWA 4KC3B 4JUFA 3S1AA 1T5DX 3WNVA 2LTQB 5ELXA 4G6MH 4WLUA 3H9QA 2KLRA 3GFBA 2FVXA 4KSBA 2G9HB 1M53A 3CVHA 3BMWA 4PRHD 5IM4A 5HTKA 4DO4A 3WO4B 5I30L 2YPVA 2OILA 2Q8AH 3W9BA 4C1NA 3BRWA 2H41A 4ZTBA 3Q6FA 4RA9A 4EGFA 3D39A 3FCAA 3PU6A 2XT9A 4C5BA 3ADBA 3LQ4A 4P5TA 1FXUA 5F1YA 3HRZC 4KNSA 1NOLA 3HU3A 4G5YA 3JQFA 3VCLA 1BWQA 4C43A 2PX2A 1U99A 5BV8A 1Q0UA 3FAZA 4PNHA 3MRXA 4Q01A 1FCCA 2OMBA 4GAGH 3JRXA 4RKYA 2NTSP 2B5WA 4MVJG 2RR3A 3EDJA 4EO7A 3QIUD 4EYKA 1YRWA 3JATB 3WAJA 1SG9A 1P2VA 2TRSB 4HBCH 1BOYA 1HKUA 4ZICA 2QRHA 3PQYE 3RILA 3DBXA 3CDZB 4XPTL 2XPGB 1R74A 3SY6A 3L7KA 4HGKC 1UPAA 1YY8B 3SX0A 2R751 1BMZA 3QUZC 3PJNA 4BNVA 3DVNA 2C1XA 5AYUH 2WHQA 3LRGA 1AHMA 5AHXA 3WNDA 4HXAL 3DV2A 1LBSA 5HHQA 4LOHA 2B77A 4M83A 1H6UA 5J5VA 3O4OB 5F7UA 4X6UA 2ZAIA 4TL6A 4EECA 3FKSD 3HUJA 2FPIB 1YFZA 2PBZA 4H8QA 3RBVA 2ZETA 4M8UA 3EZXA 2NNAA 5BZZA 1RMTA 2OO3A 1NCDL 2VJQA 4LBZA 5REQA 1KELL 2BX5A 3UT6A 1QG0A 4NO2A 5EWIH 1IL0A 5EC8A 1CUCA 3QNYB 2ZQ5A 3WKCA 3PQEA 4I9XA 4OR1A 2W6ZA 2XKNA 2WI8A 5H2BB 4UQEA 5FYJD 2YJNA 5LGHL 1N6NA 1GZ5A 2A73B 3IDQA 3DDCA 3OOYA 4DDTA 2WLKA 4UQAA 1B8UA 3GYBA 2ROQA 5ALTA 4XO9A 1G8YA 3SIXA 1N92A 4JIGA 2D3WA 3EFDL 5HGDB 1I94B 1BS1A 1K6MA 5BCAA 2QTAA 1UPFA 3T4AB 2Y68A 3NJVA 4E4YA 4D9BA 3C5EA 1NQ5A 2ZVPX 1M05B 3T6KA 2Q5JA 2Y24A 1XT6A 2ZM6B 3RX5A 5J2TB 3TEYA 2XF2A 4IICA 2XY2A 4FMFA 3WLBA 4D3CL 1R3KB 1GXSB 3DHEA 4RTMA 3WGOA 2RFXB 3WIBA 3RLFA 4UNPA 1IC7H 4M5SA 3H6KA 3FVVA 1CQIB 4UIKL 3VOSA 1EPFA 3EO9H 3TZVC 4JKOA 2AVGA 1K4MA 4LI0A 5EB9A 1N5OX 2LOEA 4HEA1 3HXLA 5L95A 1NMYA 2LTQC 3QNUA 1SOQA 4IEEA 1Z5ZA 5E8OA 3JQDA 4Z3DA 2A5DA 4B3JA 1HZHL 4XTCS 5TT0A 1JHYA 2HMYB 1RUPL 3MA9H 2ZG2A 2X40A 3OGOE 3WO4C 2FJGB 1PFKA 3VH4A 4US2R 1SKUA 3DECA 1R2QA 1Z5NA 1KCVH 3MOBL 4V0LA 1QG4A 3TWYA 4KK9D 3PC7A 2XIJA 1U0EA 3WKDA 4Z18A 3WEXA 2OCBA 3D3QA 2XDYA 1CDBA 4ZHSA 2N42A 2PF6A 3A3YB 4G8FB 3EC7A 5EU4B 3OE5A 1RYHA 2YCLA 3BB4A 4FJ2A 2C3HA 2DX7A 3H19A 3AEQA 2RB4A 3W0WE 3EHBD 1OGAB 5AVWB 2BC4B 2VQFB 4HDSA 5IKMA 3GG2A 4ZMVA 4L6CA 4DNPA 3TXYA 3BE8A 1SVMA 1CB4A 2H3XC 2B4RO 4UUAA 3FUUA 2QF7A 1A4XA 3G5XA 1ISPA 3ZCXA 1KT2A 1CBUA 3UB2A 4C4OA 5CLZA 1W75A 2XFXA 3MLXL 1VKJA 1REIA 5U9CA 2CXNA 3W2DH 1K5GA 5JCXA 1XRRA 1X8XA 2ZXAA 4JFFD 3VYWA 2ZWKA 1JTFA 3O4OC 1WFOA 3EXEA 5LQBL 5HPMA 5LVEA 5EP4A 3GZQA 3O2DA 3QQNA 1U0NA 4DABA 4PO1A 5ENDA 2ZQKA 4RWYH 2XV6B 2F19L 3DL7A 4X7MA 3L4EA 2L69A 2GJ9A 3B2XA 1QHHB 3DD5A 4LE0A 4OUDA 4BVLA 3PDUA 2KJQA 1ISGA 1KS2A 1U8AA 3V7FA 5FL3A 3FU3A 3DFMA 2ADJA 4Y4KA 3EADA 2MMGA 2IGLA 3CLWA 3W8EA 3V8NA 3G08A 4L8CB 1FFSA 2NOAA 5K1VA 4EO9A 1OGAE 3G5AA 5DEFB 1XAHA 2XC8A 1TCVA 4K81B 4P3CH 5TC4A 3FNKA 3INYA 2KMWA 1E3WB 4KQHA 3HC3H 3FZUD 3GUYA 3U36A 2R85A 2PSEA 4IMKC 4I55B 1S8FA 2X9QA 5EOTA 1S89A 2FFJA 3T4AC 1P2DA 1EK2A 1KGWA 3F4KA 5F7ZA 3NVDA 2BLFA 4O63O 4Q4JB 2WBWB 2ZZNA 1LQSR 3PAZA 2MYTA 3DR3A 2WT4A 1GZVA 3CLTD 1DTEA 2VIRB 1FFNA 4EG7A 2W93A 1QI3A 2XBDA 3D8HA 2XGGA 2DHEA 2B92A 1J2JA 4YAQA 4NP4H 2IXDA 3LWNA 5EUQB 3LQKA 3BW9A 4NN6B 1NDQA 4AT6A 1YN7B 4P0TA 4HDRB 4F21A 1GTSA 1E58A 3DONA 4P8RA 3SR0A 3JQAB 4QJ5A 4RHFA 3ER9A 3JTMA 3FTUA 3IHWA 4M43H 3VFVA 1FNFA 1EIBA 4OX9Y 3AM8A 3T0DA 3HKDA 4C54A 5KS2A 4KRPD 3PXAA 2IHUA 3OZDA 4V2BA 1HT3A 3P11H 4YXKH 3EQ6A 4QD3A 1GKEA 3WD5H 1K4DB 3KLQA 3TAHA 2WXKA 3T1QA 1A6WL 3MINA 1E2EA 3D18B 4WBXC 2VDNH 3JWIA 3KM1A 1NBZB 1U6KA 3QW4B 3VVWA 2P2YA 1F4XH 2GQHA 4NJMB 1KI8A 2FK8A 2IHBA 4QOJA 1WPRA 2P78A 3IAQA 2NXZD 1UZUA 3A6CH 4YDZA 3UYKA 1FNGB 3ML8A 4ZMTA 3HJTA 3SMVA 2HGZA 5CBEB 3GXDA 3JX9A 1XRJA 4CU5A 5IWAB 1TF5A 5CN2A 3GZJA 4FHEA 4YUZA 3G0OA 2JKRM 3D3VD 1SIWA 3WMRA 5G0TA 4MWTA 3TUZC 1HXKA 1IN5A 2VB5A 1YBHA 5I4KA 4GPIB 4NBRA 2HYMA 4CLRB 4KC0A 1GA4A 1CUWA 1NAKH 4EG5A 1W8OA 2WWWA 5EHZA 5DDHA 1KQGA 1FFOB 3EN0A 3NIFB 5DS1A 4JPQA 1TF7A 1GZPB 2NT4A 1RFDH 4QDZA 5TJ9A 5DF0A 4K94H 4TMWA 5EEZA 1Y6KR 2EYRB 1THZA 1CG6A 2AZMA 5B2ZA 4ND3A 2R97A 4MWOA 3SYRA 3T6ZA 2QL7A 3S27A 1BYOA 3B5HA 2YS6A 4HMPA 5JQ6H 4PCYA 4NCKA 3GBDA 3IFNH 3IGFA 1BW9A 5AVRA 1UYWL 4P07A 1YCFA 2CHDA 1PQZB 1WZCA 2XACC 4G2NA 5G2NA 2FXIA 3AABA 3LEXB 2A4KA 2QZQA 4CUZA 3T61A 3VFWB 2FO4B 4BMZA 2KI6A 2X4PB 3US1A 2VWGA 4CN4A 3L2LA 2PUWA 1Z38A 4KV5E 1LVUA 3NEJA 1SEQL 5I6MA 4OFQA 3K1AA 4OIBA 3N74A 1VFUA 1IE4A 1AHPA 2NTJA 1V8DA 3DOCA 5E8PA 1SNRA 4WX2B 3COWA 3PDCA 5A7HA 4D0DA 4YJDA 4PBDA 4X1KB 1OOWA 1QBGA 4MNQA 2ZS7A 3NIFE 3KJGA 3UXFA 4IUBS 1CE8A 3VD0A 5IU6A 4L1HA 4BKSC 3ADDA 1IZKA 3M4YA 5IJVA 4Y2QA 2WJWA 3HZ3A 1O8BA 3PD1A 3IP6A 5F7FA 2Q0SA 1A5FH 5I1AB 4IG9A 4NN6C 1D6JA 2YW2A 1N77A 4YQXH 1THAA 2EKPA 4C88A 5SYMA 1K9VF 2Q2QA 4ARVA 1T04A 1YHNA 2IADA 4KR9A 3L7JA 1MHHB 2CLIB 1H8ED 2AEIT 4PY7A 3GEIA 1AO0A 1KVSA 1PRYA 4Y5XA 2X5PA 1R66A 1DAIA 4K9LA 4OGXL 3EGSB 3ND9A 4P98A 4N2IA 3DT8A 3KPVA 5K6RA 5KW9H 2JKNA 1JGIA 2HRPL 5IW1A 3TN0A 1RVFL 1ML3A 4HFNA 3E61A 1C7QA 4BNZA 1KVQA 3N07A 2OCYC 1J2RA 4JOSA 2AV7A 5TE4H 2G6TA 4PH8A 3E3OA 1XSJA 5F7LB 3T04D 4RXMA 2O8DB 4FDWA 3H9UA 4E12A 1VHDA 5EQFA 1LO4H 3TR6A 3CLEL 1NLDH 3BO8B 1UEXC 3CFCH 4K5MA 1Y80A 3GRVA 3WP0A 3LVBA 4WV1A 1PGPA 1CLZH 1EEZB 1NXQA 1YR3A 4FT2A 1H5NA 3O3BB 4QHKI 5A6VA 2YIDA 1X3SA 2YXVA 2JFFA 1FL9A 1AAJA 1LSOA 3NAGA 5EPEA 3F12A 2XG5B 5J4HA 3MRRA 4DW2L 2BI8A 2VLMD 2J5BA 4HDMA 2ZU0C 3A25A 5KJ7E 3BH0A 1OQOA 2YKKA 4YO0B 2Y1LA 4TZ0A 1E2JA 4QQNA 1HJCA 4JKLA 2R68A 3VFPA 1GQ2A 4I5IA 1HH9B 2CF6A 3S3SA 1B16A 1MC8A 2VK8A 4YH6A 5B1SA 1XF5B 4F9LA 1YVEI 4ZW8A 2QYHA 2VP5A 3OX8A 3SHFA 1JEYA 4G9EA 4BNWA 1WFUA 4N0UB 3HE6D 5FOBA 2OXRA 4CV2A 1NPNA 4UULA 5CYFA 5DYIA 3WP1B 3HO1A 3H83A 4Y9UA 2FF7A 4EB6B 3BH8B 2X2EA 4YL4A 3C12A 3HNOA 2WANA 4O02L 4HX2A 1QE5A 3LPDA 5CX1B 2VT3A 4UNSA 4WUUE 3W39B 1LPMA 3OQOA 1DARA 1R18A 3ZS8A 4OCRH 3BF8A 5CH8A 3JZAA 3KFXA 4MUNA 2IBTA 1C5DA 3DX1A 1F2XK 3GMRB 4JJKA 5F9FA 3BCFA 1JDPA 5DTFA 3TESA 4GOND 5J3HD 5KWIA 3KHOA 4N0EA 2P8LA 4FCVA 4H59A 1YNTF 1RY7B 4JHBA 1ZBDA 2QJFA 3M5WA 4Y9CA 5HF8A 4MZRA 1G63A 5IH3A 4FNUA 2CA4A 1O9GA 1VACA 1EBBA 2DZEA 1O5PA 1XMSA 4Z77B 3GFFA 4RJJA 3QW9A 4R3WA 4N0UE 1DUYB 4Q9QL 2A9VA 2CJTA 4Y5VB 2CHGA 2B2CA 3SPIA 2PR2A 2HF8A 5AL8A 5AQEA 2AI1A 2YMLA 1TM5E 2QP9X 4MV6A 4ID9A 3R0IA 3Q3EA 2F48A 4EUPB 1JPVA 3G02A 3BT0A 3ETLA 5IAGA 4HUJA 2GXSA 5L4IA 1I4OA 5C31A 3CJRA 4PCUA 3M8OH 4BCBA 1JS1X 1YMME 1RWBA 3TBCA 4LJSA 3H42B 4UMEA 3NETA 4E7OA 3GJFB 1GAEO 2PX4A 2A9RA 3TCXB 2GIMA 2BMKA 1A8PA 4GU5A 4ZALA 3WLSA 4J7XA 4JJEA 2Q5CA 3RI3A 4YJZL 3IHTA 2DJMA 4GUAA 3VHRA 4IJQA 2NDFA 1LGYA 3U60B 3MJ6A 2V9ZA 4Y9DA 2FWAA 2BMVA 4OHMA 3OZ7A 3R3YA 4RQAA 1KOGA 3GFGA 3L5OA 5IUNC 1PR0A 4ZA2A 4XCNB 4MA4A 5A6LA 5CEZD 2C1PB 4S1DC 3KQWA 3CXDL 2VDUE 4BOYA 4PGEA 4XAKD 4N2LA 3CXFA 2ZJBA 1PS8A 4L48A 5AW6A 3UBTA 2YQ2A 4ZTEA 1OALA 5TPZD 4PGDB 3K4DA 5AL0A 3OD5A 2IHKA 3DVAA 1DVSA 3MMXA 4U1KA 2BW4A 3ZDYF 5BPFA 3ARQA 4ZUTA 2IIVA 5FYJU 4GW1B 5D7KE 2FP4B 4I9WD 4G5ZH 1D2MA 4R4FH 1E60A 4UCWA 1C0PA 4KXZI 4GYWA 1FWXA 4BN0A 1KF9B 3REGA 2YPLD 5KWVA 4M37A 5JALA 4TF4A 2DDQH 3IXQA 4XP4L 3L8HA 3MPCA 2O5VA 1OQXA 3EEBA 1UA6H 3D5OF 2ATIA 2Z58A 2UZPA 5K6AA 1YEGH 2ERXA 1ZS8A 1HL4A 4D2NA 3ZW8A 1SVLA 3VSBA 2EKLA 4LY3A 5LVAA 1CWUA 3UBMA 3ICWA 4HWKA 1PL0A 1I6MA 2VO1A 2ERJB 1QIDA 2EAUA 5B4MD 3D4OA 3R77A 3DE2X 5I6OA 2WTUA 3GVCA 4XB1A 2ET6A 2WXIA 3OKLB 1DCLA 1YJQA 1OOEA 4PJGF 5DLMH 1F8XA 3E9MA 5ENZA 2WP8J 1JR4A 3EUAA 4LXXA 4GVXA 3H0TB 2PMCA 4G37A 4YACA 4S2SA 4X7TA 1T20A 5JPMB 1SJEB 5MENA 1VA5A 1ZD2P 2RGAA 5KYNA 3QHZH 2XDWA 4BH7A 5CA1F 2I9LA 4CXMA 3K0CC 1G94A 3EVEA 4LMBA 4JB9H 4NFSA 2EZ4A 2XTMA 4GPZA 1PF7E 3P2BA 3B2QA 4Y5VC 1IAKA 1F4PA 2GFBB 1TEFA 1PG7X 5AD1A 3CD4A 3HC4H 1EO8L 2P1ZA 4ODUB 3U1TA 1HLFA 1MCQA 3N6YA 4L29B 5SWQA 4HLJA 2WA1A 5CTJA 3NASA 3W6PA 3D6UA 4GBMA 1AO7E 1YZYA 1IVLA 4MV9A 4KIGA 4XX0B 1RYZA 2PZBA 4ODVH 3BKJH 1KYZA 2REOA 1MC5A 4A26A 1LXCA 5GVSA 1DL5A 3NJHA 4NNXB 3GMOB 5BR1A 1E5TA 2EXXA 3NDYE 3T3OA 2CO3A 3ZRCC 4TUYB 3OAUH 4KB5A 3CUSA 3U46A 1I4DD 4K2AA 4O00A 2YJGA 2DLIA 3PAUA 1O8CA 2OULB 3OZRA 3VW3H 4CSTA 1UMKA 1TKRA 4DLXA 1I1AD 4OREX 1BWRA 4HHAB 4KJWC 4WASA 5SYNA 5FCSH 5FGRA 1ELOA 4RNRB 3SD7A 1HNGA 3TTWA 3O3DB 4TULL 1CC3A 4BFGA 4ZW5A 4FL4B 3SOZA 1DJNA 1M76A 5KCMA 3GBLA 4KI5D 4Z7WF 2OK0H 4NBYB 3O21A 3K16A 2WDZA 3FTQA 4PRKA 4N5UA 4EG8A 4ZC8A 2CXKA 4GKNB 3GJYA 1X5ZA 2G9NA 2Q76B 2PYZA 1VLHA 5IHUL 2YNMC 2G07A 1H2XA 1OI2A 2MHAB 5DLQC 4IIZA 4LOAA 1E0AA 3MIZA 2G60H 4NBVA 3F8UB 4OGWA 4M60A 2YIMA 4KUHA 1CW2B 2RHEA 1TZKA 4CUKA 5AKLA 2GAOA 5B1AB 5JHMA 2QAIA 4AO6A 4CE6A 3PFIA 5HEKA 3T2NL 4N82A 3FSWA 4QDXA 1MSPA 5CLFA 1NUNB 3RVKA 1BGWA 1SKYE 2BV3A 4ZOLB 1A1NA 4RD3A 5ES3A 1YZNA 4AROA 5KSOA 3BTOA 2G5BA 4RAVA 3KOXA 2PCLA 1T6VN 4O5OA 3LH9A 3CNNA 4GUOA 3WIIH 5BW7C 2UYHA 3E9NA 2ERJC 4Z0BL 3CN0A 4TOYH 5I28A 2GR9A 1EA5A 2EV9A 3HG1B 1ZDQA 1DHRA 3ZC3A 1WBDA 4Z0NA 3KKQA 2EDEA 4KDEA 4XUDA 1MREL 3MOAL 4XH2B 1VP3A 1RMYA 3TZLA 3ADKA 1SXHA 4Y6PA 5I9BA 2X28A 2QD4A 5KQGA 3DE7X 1PY4A 4FQ2L 4OLUH 1HE7A 4KNWA 5JPMC 4JP2A 3H9HA 4UB0H 5AW0B 5B6JA 3BQNB 1AQ6A 3EF7A 1L4NA 5HCUA 1T5XA 1KI6B 4URYR 4R2MA 4RDXA 4JR1A 5EZLB 2RACA 4ID3A 4AQEB 1DJOA 3K0AB 3VZDA 5TXGA 4DRXA 3RDTB 3NMUF 2VPQA 1QKKA 4OMCA 5IFJB 2XQIA 3AK4A 5A5VA 5E9JA 5L8LB 1KIMA 3ZHCA 4PHZA 3CGGA 4DB4A 4LSMA 3HG4A 2PFGA 1FYTA 3ZKXB 2P2SA 5LDHA 3OPZH 4O2EA 2J8HA 5D2LF 4RAOA 2VIIA 3IMWA 2MQGA 1L7DA 2ZZKA 4ML3A 3BKML 5L4NA 3LGXA 3FPJA 2IDZA 3HG1E 4XJXA 1KENH 3U31A 1YK1A 3LFHA 4Z4QA 3I9GL 2JF1A 2ZTHA 2XHNA 1XDBA 4HLDA 5JO5A 2BGRA 1MJ8L 5H37H 4JANA 4AGPA 2IDQA 3USES 1GGIH 4B6FA 5A0VA 1AOHA 4GFTB 3L9WA 2PW1A 1MJUH 3NVKI 1CR2A 3Q8KA 1EFRA 2GXUA 4M7LH 5CBAB 5JRZA 3ZDZB 3SYAA 1S7WA 3RVTD 3MERA 2NY7H 5BUPA 1UXSA 2UZIH 3BZEB 3HUJF 1DE4B 1W94A 3SGDI 3MA7B 4DT1B 1JXJA 4D8TA 1FORL 4EHBA 4PJ5E 4OIIL 1FSZA 3RK1A 3TEJA 4FL4C 3P9MB 4YB8A 1OFIA 2SCUB 1V3VA 1HBJA 4LLYB 5MERB 5EBLA 4JBXA 3Q7TA 5EIXA 4D8PB 5JVDA 1CT9A 3ZKWB 2BFPA 2YVLA 2Z3FA 1XYVA 4G42A 5JAHA 4X4YB 1UQUA 4G3YH 4ZTPH 1HZZC 3DX7A 2BBSA 1UM9B 5KX5A 1FZMA 3MUY1 3V4PB 3OKKA 1NOJA 5EGSA 2EDBA 4AUKA 5JOFA 3LTNC 3DI2B 2Z35B 1CRWG 5DHVH 4BYGA 3ARYA 2HT3C 3QYNA 3LKVA 1ODIA 3IDGB 2A78A 2JGIA 4YYZA 2GD6A 1MLCB 2CFCA 3BUYA 3D4NA 3L5XH 1Z9LA 5C09A 4GLBA 4J90A 3WGVB 5F5NA 5HW0A 1JJUA 1V43A 1VRVA 1KJYA 1QX1A 3P1VA 3JY6A 3DVQX 3IO5A 4A67A 4KNUA 4NLAA 4NC1C 3PJRA 3K71B 4EO4A 5BRQA 1HMPA 2XJLA 5LBUA 4C0AC 1IQ0A 2H32A 4PG2A 3VAAA 2A86A 1P91A 5MN6A 1WA1X 4RMUA 4FDTA 4X6YA 2VITA 4CCSA 1VJ1A 4FJ0A 4B3VA 3JQPA 3FYUB 1X15A 3RUIA 3F96A 1PAZA 1PX4A 1ZUHA 2LXNA 1GYPA 1YRLA 1B2LA 1KC5L 3V3KA 3G2LA 4YDJA 1C30A 5DJZA 2HRCA 1JHOA 2DU8A 3PZRA 1NGPL 5G40A 5KVEE 2YWEA 2LD4A 3N5KA 4NQTA 4WWNA 3TBTB 3T4YA 4AUUA 4AYFA 4DLRA 4KHTL 2PRSA 5KREA 5TDHA 4HYQA 4TS3A 1VFMA 3W2TA 1UMBB 3RDTC 2HF9A 1JHTB 1FL3A 2VHTA 4P2QB 3CHPA 4AKEA 2DI9A 3DO7A 3DMDA 4US0R 1CYGA 1MJJB 1N9KA 4MBRA 4J7AA 2CNDA 4PYJA 3WYBA 3ZKXC 3CF2A 1I6LA 3CFKA 4FOLA 1EFHA 1IEQA 3SGJA 1J9ZA 2QGDA 3D06A 2DBYA 5ALPA 1I2ZA 1I8LC 3I1FA 3UWKA 4JU8A 4LFAB 1FQ9C 1MO4A 3WFEL 4CN9A 5ER6A 4ONEA 5IVXA 3E9RA 4ONOA 1F3JA 1OXMA 3X1JA 2F54D 1LPPA 5FPHA 1Z33A 1MCFA 5DJCA 5IBLD 3BT2H 4OBRA 5DWUL 1B0ZA 2NSQA 2ONZA 4TMKA 1XN4A 3SBWA 2PSDA 3HB1A 2HVBA 4D6YA 2ZSHA 4XYBA 3ZBUA 3SVTA 5IFLA 4AF8A 1IFHL 2ARJA 3O4GA 1BFVL 1G8GA 1NAHA 1EK5A 5JROA 1RYYA 3JBG7 1XL4A 4N90E 1JMXA 1A1OA 2BFBA 2QKIB 5LDUA 2FWUA 1H3FA 4PC3A 3RO7A 3W4KA 4P2QE 1TZCA 1F58L 3L8DA 4I1VA 5K8TA 2XWZA 1M0EA 5DCYA 4GPEA 2JI6A 1JECA 1E9EA 1JEEA 1A7NH 4OVKA 5EE9A 2DWDB 2PABA 1GGMA 1MCCA 4O02A 4LHUB 1D0SA 1JUDA 1G1CA 4BMXA 2R1YA 4URHA 3QUYB 2PA3A 1DT3A 4X83A 2A74A 2ZCHL 4D98A 2WTBA 2AXJA 2OTWB 5JNUA 2QYTA 1NVDA 2BKAA 2VDMH 1SU6A 1ZOIA 4K40A 3V4LA 1G1KA 3DMGA 4Y7CA 1JJBA 4PSCA 3LA8A 4JQOA 5CWSB 4J0QA 1UP4A 1VG8A 1V4VA 2BGKA 3MRTA 1RWXA 3PTLA 1YO6A 5CSZB 2GFQA 1NINA 4HVBA 3AY7A 3FHTA 2HAZA 5ACZB 3IHKA 3H56A 4L0MA 3RSFA 3UAJA 2I6SA 3GWZA 1IEBA 1QO3B 3FUTA 3WNKA 1GDTA 2R6ZA 4BDVA 3HCPA 2WUDA 2VPZA 2C7UB 1KZYC 1RRMA 4XUGB 1H0KA 3NBZC 1B6SA 1FZKB 3AJAA 4XBPB 5EU6B 5IK3A 3GZNB 2F1EA 1KXVA 3IJEA 2YZMA 3HKZA 3GFPA 3BDYL 2D0GA 3FYUC 1E2IA 4JZJA 1IZ9A 2Y7LA 5D55A 2HVJB 3MLZL 4MKMA 4XXDA 3BULA 1ONOA 3FT3B 1OIVA 4DAGL 5C2JB 1C1EL 3L0BA 4N03A 5AAWA 4NKMA 2H54A 2Q2NA 3P0YL 4NNOA 2P5YA 4L8YA 3ARGB 4OKSA 1T0NA 5FGSA 4GP5B 4CTMA 5MP6H 5D8JH 1IM2A 3EYVA 4N9WA 1QTQA 3UJ9A 5K8LA 1JFTA 2DIBA 5BV7H 2FWRA 1H9DA 4N2HA 3VR5H 2EADA 3QHPA 1YWGO 2XZLA 2RD0A 4HXBL 3ZE9A 4MB5A 1EDYA 3BGMB 4KWEA 4QU0A 4TNWK 1E3IA 3WELA 2K87A 4OF0A 3QXSA 5CM8B 1QABA 3L4JA 1UB6B 3Q1SH 4KO1S 1CF8H 3I42A 5EU6E 4G5QA 3QUAA 3BGFB 2OTUB 4UUPA 4HN9A 2AVFA 4MCAA 3QI9D 2GBUA 2PYEE 2ECFA 1GKYA 3GLGB 3PPVA 2J5KA 2DQEH 1V8ZA 3FCUB 4XCEA 1D6NA 1SK9A 2H4XA 1D6EB 5C0BE 5FFFA 1C7ZA 2VDPL 4CM6A 1R4XA 3HZMA 4FZ8L 1C7TA 521PA 4PYMA 1KBVA 3MLAA 3TQFA 1I3UA 4U2KA 4OM1L 5F88B 1EFCA 2UX7A 3FNIA 2CBTA 3LY5A 4GECA 3POCA 4OFBA 2QKIC 3PR1A 5DRXB 3D3EA 3CNOA 1Q9KA 2O6EA 4KAAA 4DMLA 3LN4A 2BGTA 4YC7A 1P5HA 3W81A 4WCVA 2JI7A 3AVEA 1P7YA 4HYYA 4MW4A 1QRUA 4YT4A 1NRXA 3OLGA 5C0DA 2Z93B 4BO9A 1PZMA 3HHSA 1SNYA 1CICB 1OHZA 3HFML 3QUYC 3OFSA 1Y3CE 3UBFA 5TE7L 4BMNA 5JNSA 5TE6H 4PV8A 4ETQB 1TJHH 2BSXA 4MZDA 1T9KA 3SGKC 1A69A 1UKVY 1AA6A 2XGOA 3KU4A 3JASB 3CFMA 4DIUA 1VM6A 4HNAB 3WMEA 3B3QA 3D2BA 4LVUA 1Z2CA 3GLGE 3RNQA 4F8NA 1E1RD 1D7AA 2D0DA 2FOXA 4RHXA 4MA5A 5HI5D 1Z9MA 3GIDA 3DDZX 2CBOA 1SLXA 5D7NA 1V71A 1T5BA 1GZQA 2I3GA 3VSQA 3MTEA 2Y1ZA 4NBNA 2PIDA 3CZPA 3H5LA 1P1IA 1BHQ1 2AJLI 3U2SB 3D6JA 3F05A 4G84A 4U3SA 1FPQA 4KQMA 3ABSB 5B6PA 1PTKA 1ADQL 1B1CA 2ICWJ 2VXSL 3FQRB 4WKCA 3MMNA 1YNKH 3O6FB 4TKMA 4UE6A 2QX8A 2DM7A 1MEXL 3WQHA 3Q6MA 4UATA 4NQDA 3O6KH 4BZQA 1BD2D 1WUZA 5K1ZA 3HP7A 1U80A 3L48A 2I9TA 4DLBA 3ARGC 4JRFA 4ACAA 4W5QA 3OG9A 2X3YA 1WNTA 1VPVA 3AS3A 4JUSA 2JJTA 3YASA 1N6HA 3T7DA 3WMGA 4KUEA 3U49A 3S81A 1MRFL 3FJYA 4MJ7A 4NJAL 4KLCA 4QGYA 4L3CA 5DVPA 4XVCA 4HT1L 5E9DB 3AM3A 1JF1B 1T6BY 4W6XB 2ZIWB 2CNYA 3ES6A 1YHZA 4X5OA 2W58A 2AQKA 3BGFC 4V11A 2GTWA 4NMMA 4EEXA 4PRBA 1R3LB 4RENA 2CNZA 4J1NA 4LS3A 3EG5A 5TDNA 4IHJB 1J20A 2R2HA 1U6AH 4Y67A 1O57A 4WIQA 3HVUA 3TCNA 5B1HA 1AKQA 1E20A 3MFGB 2V3DA 4I1NB 2WNXA 3BCDA 1Z32X 2GSDA 4JR9L 1DQTA 2C2OA 1Q7CA 1CFZA 1CUFA 3O6MH 2KDGA 3WCYA 4JP1A 3VQ2C 5T57A 3BFXA 3VXKA 3MYJB 4MUKA 5EIEA 4TN1A 3U4DA 2YC4C 2J9FB 3CZCA 1UWKA 3NWEA 4FD0A 3NT4A 3S5UA 3ASWA 2NZUG 5AW4B 1FP4B 4OZFH 1MW1A 1Y8AA 2OYCA 5IEHB 1E6CA 1XCOA 1R6UA 4MS1A 1DAEA 2CM6A 4I1SA 4HJUA 3LH2H 5JDCC 5E9DE 1CICC 3CJTA 2X1OA 1KCSL 1VENA 1AKNA 3GA0A 1P17A 1UADC 3WQBA 4PRPA 1HL7A 2FYTA 4MTMA 1IGFL 1PZGA 3BRDA 5A6SB 1XWVA 3H1ZA 3GJ4A 3USZA 3EAGA 2IUEA 1DUZA 3P52A 2PJRA 4YP7A 3QR1A 1RZIB 3CCHA 2AC4A 4R2KA 3OKMB 5JOPE 3IA2A 4N54A 2JIZA 3B1UA 2CXQA 5AKHA 1AGDA 2CDFB 2ZUUA 4JDEA 4Q7MB 1E79A 4GKSA 1T5IA 2GWHA 4YPGA 1GA6A 1KPVA 3MV8B 1RXIA 1N2RB 4PJ8A 4FFYH 4UMFA 2P69A 5EI5A 2D1QA 4G8IA 4L72A 4FNGA 1OGPA 3LHFA 1QVAA 3ZR6A 4TS1A 1KAEA 4O58L 3ARUA 3O6FC 4HIJB 5LZ8A 3BFKA 5BSFA 4I9UA 3D12B 3NABL 4JG0L 3COZA 3T5BA 5C46F 1GCOA 1TVMA 1IN8A 3WL6A 1P1RA 1I0IA 4XWGH 1FA9A 5C0AD 2GN2A 3DARA 1FZJB 1FLTX 4D97A 2VXQH 4LIQL 4HC1H 1HLGA 5FRDA 5H02A 4JLNA 4CVZB 3TTVA 5CCKL 2OWEA 3KL4A 1A3RH 4ZS7H 5I4BA 4TPRL 5AM1A 2DY1A 2W9LA 5JDSA 4CC0A 3NTRA 2PN1A 3GP8A 3R0MA 3GRZA 4CKWB 1UH3A 1HFUA 2OL4A 2IV8A 5DBOA 5CJXC 2JDID 2OXIA 3WLJA 1GXEA 4K7FA 1GDHA 1KZQA 2FEAA 1PE0A 3EQ7A 1SXQA 1HFWA 3ZBMA 3ABRB 1JV2B 3NBMA 2XN9A 3B8HA 5JU6A 4A5SA 3ETJA 3MV8E 2JBHA 3LHDA 1W8EA 2XVKA 2E6KA 4V0MA 4ERXA 1LM8V 2ZU6A 3M89A 3VFDA 4OBSA 2IEDA 4E9LA 4EX7A 3I2KA 1JKFA 1FH5H 1UBHS 4UTPA 5B1BB 1WBYB 2VAJA 2XYPA 2VR6A 4WKZB 32C2A 2M2IA 2Z91B 3ELBA 1PJWA 3GJRA 3H1TA 3QFGA 3FUFA 1G7SA 4EG3A 4HTAA 1KXTB 4P38A 4UFOA 4NCNA 4IDDA 1AGBA 1GGCL 4YRKA 4DV4B 5DI3A 2EKZA 2ZWYA 5DRZB 3O0RH 1CUEA 5ACMA 3P2MA 4R1MA 4ZJ9A 2ANBA 4ZEOA 3AVXA 3CSTA 4HZUA 2NY3B 4M9ZA 1VLQA 4BRWA 1M7DB 2BF4A 4M93B 3ESXA 4FZRA 4ZMSA 5I6KA 2F2TA 1E63A 5DK2B 5GISL 2X70B 1XEXA 3UMVA 2XT6A 3DIVA 5CJQH 5D4HA 1GC1C 4Y6SA 1TJ4A 4OI4A 1QATA 1TR7A 1JHKL 2GPSA 2UYOA 4ZVQA 3U4GA 1I1YB 2XE6A 5I26A 3N8IA 1JQKA 5JORA 4HH9B 1NCAL 3RIFK 1EQUA 3P2EA 3V7AG 3VR2A 2WLTA 1LY1A 3F7YA 1YRQA 3DV4B 2QZ5A 4L2YA 3PP3K 3B9VA 3CFJB 5E5RB 4TTGA 1IGYA 3ARSA 2A5UA 3WWPA 3FXIC 1SXAA 2PXCA 5F5LA 1RQ2A 2BVTA 1M6VB 4NZPA 4IR7A 5AKVA 3EXAA 3VX4A 3LKOB 1B74A 3ET5A 3QDJA 4M99A 2JIBA 3MV7A 2JNWA 2E6JA 3MA0A 1JFFA 1FDVA 4I50B 5LU8A 3BESR 5IH7A 2OXGA 2C4HA 3VH8A 2PFSA 1NVWQ 4H3SA 4MD4B 4G8EA 2HSZA 1RIUL 2JGJA 4BM7A 4MW6A 4LPCA 4C2BA 2E5EA 4OLJA 4LA4A 1ONSA 4TMYA 4M61B 2WW8A 4NO0A 1NR5A 2G4EA 4Z4FA 2OCAA 3GUHA 4Y2DA 1CZUA 3MACH 3NSYA 4GLFA 1CFQA 4DKEL 1DIOB 3OSVA 3TWCL 4B2IA 2DW5A 3CVHL 1B3BA 4A2CA 3UMSA 4GOOD 3N85H 2V7QA 3GB7B 4YEEA 2ZTMA 4N7JA 3I1IA 2UY6B 2DMCA 3TIFA 4WUKH 1VHPA 4OLAA 5F97E 8ATCA 5LXTA 3PXHA 2M1XA 3D3VA 1MAUA 2PS9A 3GSUA 3SVZA 3GUCA 4RCYA 2O1AA 3VXMB 3EYFA 4BFFA 3IFLH 3AB8A 4JITA 3RV3A 2UX6A 4BNIA 4I0KA 2Q1TA 2LU3A 3PWJB 3UA3A 2R65A 2O93L 3C3WA 1DKMA 2CY0A 2AJVH 4JN1L 2GHRA 2OLJA 3OZCA 4HQRA 1RAHA 1J8HB 5F33A 3SJVB 5DNVA 1COWA 4L16A 2FZVA 1X7QB 5D1ZB 3T8VA 4B7XA 3WE7A 2NVBA 3N42B 4RTOA 3RSSA 3QZWA 1NKVA 1U5CA 1S2MA 2HX7A 3GFTA 4B9YA 4WEQA 5K59F 1NZFA 4JLUA 1UZMA 3PIIA 1IBZA 2OM5A 3ESRA 3AB3A 4QAJA 3DO6A 5FHAH 3AWFA 2PCFB 4LRWA 3NIDF 3IKJA 3QCVL 3L5WA 2NY3C 5TMPA 3BJ91 1VPDA 3IT2A 1VKXA 4V33A 4M93C 1VFAA 4M6OH 3JWGA 5ECWA 2B7BA 3TJHC 3JWOH 1K92A 4HWGA 4R1LA 2TRYA 3W5JA 5GGYA 3ZE1F 1D5IL 4M7WA 2G8LA 1YY9D 1AQKH 1J2TA 1J0KA 5B53A 2P2DA 1V3MA 1BBJA 2WUEA 2DPKA 1KEEB 4JL6A 2YJ4A 4K8RD 2PWAA 1OAKL 5IXYA 3DZHA 1HKHA 1J97A 5LN4A 4PIBA 2WAMA 3ZN2A 2F74A 1X3DA 4RZCB 4KHZA 2B25A 2R8OA 3I3EA 2Q29A 2X9GA 1N12A 3IBCA 4WXRA 3P9XA 4UHDA 1V7MH 4DR7B 2JLPA 4BZ1L 3ZI0A 5TVGA 4W99A 1XTVA 3F5MA 4JFDA 3RNKB 3OAWA 1A9RA 2XMGA 2QVTA 4WO4A 1AQIA 2RBLA 5THXA 2B4KA 3P8ZA 1RW4A 4EHAA 1LLFA 3HN6A 3A67H 3H2HA 2YUVA 3GMTA 1FF5A 4XTRC 1J0ZA 2P1YA 2ZD0A 1N2BA 2MIIA 3U7EB 4U1MA 2HX1A 2K6ZA 1T2UA 4Y2SA 2ICEA 5FNVA 4DANA 1R0KA 3F7LA 4REQB 5THKA 2IGFL 5CCHE 2IH5A 2FP3A 2ZAOA 1ZUWA 2C9DA 1SXNA 2O50A 1S3KH 4EWLA 2ZOLB 3V1MA 3I9PA 1UJ3A 2LLLA 1KH2A 2PAFA 4R9VA 2ENQA 3KLNA 1U92B 4QR7A 1XCJA 3SQLA 1Z6JT 2UYLB 1KTLA 3NJRA 4XWAA 1LTKA 4LF4B 1MHCA 4RMWA 4M7LT 1YEWA 3M83A 3UN1A 43CAB 5KZMB 4P3WA 2CR6A 2ZROA 4Y16B 2PKQP 3B5TA 4JBLA 3OZ9H 3FUEA 3TCKA 3VI4A 5EA0H 1J8DA 5AD0A 5KVFH 4I5EA 2F90A 1IXYA 4H2AA 3JAWA 1MAWA 3S29A 4IRSA 1BQHB 1X1RA 4QRPD 4OI2A 4X61A 2VL4A 1ZLXA 5ERWB 1MLDA 2VWEE 4AG6A 4BZ2H 4MGKR 4PTTB 4LJYA 1MAVA 4YXFA 1D5MA 3M86A 1DJZA 3A0OA 5ESQA 4KIFA 4AJ9A 2P9HA 2H3EA 1KCUL 4HJJL 1M6NA 3EX7C 3DLQR 4H7IA 4P5MA 2X5OA 4LEXH 5C1MB 1O9BA 5KQLA 4INPA 2VLLB 3RKUA 3BGVA 4G0YA 1QFWM 1WG3A 3IIKA 1FB5A 4BPRA 1MMFB 1YJAA 2XVLA 3SE3A 3LRLA 1BEXA 5D1ZC 4RK0A 3EK2A 3ZX5A 4ARAA 2Y06L 4D9RD 3SG0A 2ZXQA 4HDKA 5JVDF 1PVVA 2A6IB 1N0LA 1LLQA 2ZRDA 4WGWB 3KWJA 1INEH 4LOEA 2RH4A 3MW8A 3WDJA 1KEVA 2QZJA 4H6WA 4KNYA 1N68A 2UDPA 3FFAA 3B9KB 4U05A 4US1R 5KX5F 4EG0A 1KYOJ 2CGEA 5IESL 3G2KA 5IT2H 1A7KA 1HKLL 5D1ZI 4X45A 4OJQA 3GF4A 1BVLB 4NIYE 4YNYB 3O6VA 3F73A 2GM5A 3ELAT 1SOWA 2REBA 2QKYA 3LPNA 5GP1A 1TUPA 4PONA 2YXNA 2WXNA 4X7DC 3HCAA 4J2QA 4BFIB 1I7DA 2J5WA 3AXSA 2VWQA 2XUOA 1RXCA 3ZIAA 3SJ7A 2HSGA 5TQ2H 1E8DA 2WSSD 3SSNA 3WLEA 1IAOB 4XEHA 1M2NA 3ONEA 1ADQA 2JKTM 4DGYL 5I30H 1XOIA 3AY2A 3DBHB 4QDKA 1YNLL 1PGJA 2DSTA 1WT5C 1S3FA 3AWIA 3W7AA 3ESBA 1FSKB 2VJYA 2PUQT 2O72A 3NU1A 3LRSA 5T1LD 3KVVA 3AF0A 1ZHNA 1T8PA 5FLVA 2QRNA 2PGJA 4M3KB 3GSWA 4AEIL 5IJBC 2QJDA 2MCPL 3OKNA 2Q7NA 2G4CA 2G5TA 2PR7A 3SKJL 4QXUL 2VTEA 4DTIA 1ZRSA 5EHQA 5ULLA 4C1BA 4PG8A 4D80A 3GMPB 1YEKH 5K5EA 4I77H 2YXLA 1VAHA 1WCIB 3DDWA 4Z4IA 1P1ZA 3SBPA 5KUKA 4PLCA 2GARA 3ZV6A 2X0WA 3PVSA 2O3RA 1UFUA 3DETD 2AI3A 5EU3B 2A67A 2VDQL 4XRGA 2D00A 3SZ3A 2QV4A 2DTDA 2P4EA 2JD2A 3GXFA 2J3SA 3WGQA 4D0LB 1TM7E 1RPNA 5HX7A 4P83A 5EJEA 3R7NA 1OXTA 2V7WA 3CZUB 2FJSA 3HR6A 4PSPA 3BBPA 1L9PA 2WJHA 4DRZA 1P7KB 1PNDA 5FECB 3QEHA 2VDRL 4Y16C 3IOMA 3OWOA 4ETYA 4P9HL 3E8XA 3RWFA 3EGXA 3AERB 4TGLA 5CPBA 3R40A 4MAMA 1UKQA 1G4MA 4JK3A 5IP4A 5JQGA 1VSTA 1BQLH 4G0NA 4NRYB 1L1RA 4DPLA 4B97A 4BAZA 5JXEC 5LGHH 2AN4A 4NJEB 4Z1MA 3PLAE 3DOEA 5FBZA 4PJEA 1NR1A 5AJZA 3L8YA 3ZHOA 3ZU3A 1UOOA 1RHJA 5TPZA 3E9TA 1UFOA 2IHVA 4L8WB 4OM8A 3I2GA 3L0DA 3FFCB 5J4YA 3J27A 2W98A 3PP4H 5BN5B 1UGNA 5LMUB 4C6HA 1NDTA 5CM1A 1X9RA 3UABA 1N5AB 3G5WA 4EMZA 2QGFA 5LQKA 4ONHB 1JGLL 3S0JA 5KJ6A 2CD0A 1SBSH 4D3CH 5J9FA 5BSUA 3IQFA 4AI7A 4WPGA 1QSFD 3B9KC 4JRYB 2YMTA 2O05A 1JKJA 1E9AA 3X3GH 1FAIL 5GGUB 4PSVA 3ND8A 4P04A 4UTCA 2CJWB 3N43B 4UIKH 4GAAA 3T4XA 1O9ZA 2R8BA 4KPUA 3P30L 1XRLA 1MHPH 4ZU3A 1T4KB 4E4TA 1O95D 2NUPB 2UZYB 4XI9A 2A0WA 2OCJA 2W9EL 5E8DH 2ZBUA 1JAZA 4JS0A 3JQRA 1C16A 1K8YB 2XCOA 3N1UA 1ND6A 3T5PA 1EVQA 1HZHH 3WL9A 4F27A 1RUPH 3LPGA 2WKGA 3VD5A 2SODB 4FQHA 4OV6F 3CFQA 4JJOA 4K71B 1ZJWA 1NEZG 1WS7A 5JV5A 2NMVA 3EIEA 2O54A 3MOBH 1D7CA 1FSKC 1KCRL 3WMQA 4MW7A 4ZC1A 3FDJA 3DMMD 2X0UA 3D33A 3OQRA 1FOEB 5DJ5A 4X0NA 1DVXA 1L3WA 1WHTA 4TLKA 4JLSA 4ZPXA 1WETA 2V2WB 4F04A 3BVNA 4IS2A 1UKCA 4YEDA 4JRYE 1L8XA 2XZTA 5TTRA 3L8GA 1C7SA 2BVPB 1VDMA 1SOXA 3FFXA 3ZWOA 5ALOA 2GRAA 2HLFD 3KELA 3TDKA 5HHOD 4ESVA 2VQ1A 4JY6A 4YQZA 4U1JA 4KK6D 5F21A 3QFHA 3QCUL 1Q83A 2DCUA 1PG7H 3JTTA 4RBPK 1CIVA 1F6DA 2EBHX 2Q27A 3RF6A 4ZP1A 2CO7A 1MC1A 3H2ZA 4EEKA 3TCTA 1T9GS 2KQNA 1T1GA 1FVOA 4XUEA 2R23B 4W9JC 3X43A 2YFQA 2DYPB 3K0HA 3X1XA 2Z34A 2KZWA 3HBZA 1GTVA 4C87A 2W90A 3BP7B 3NW9A 3LEYH 1XZQA 2F19H 3MCKB 1TGYA 4TRMA 1BTOA 2PKDA 5BN1A 3ZVKA 1SPDA 4FADA 4E68A 2IYAA 1QONA 1T66D 1UODA 3FROA 3OQVA 4N68A 5K4HA 5F3BB 1W85A 2PXYB 4XDYA 5M34A 4Z7QE 4KWTA 4GI1A 3WS3B 2OGZA 2BEKA 3F1KA 5DYYA 4ZIRB 3CVUA 2Y1DA 1ZY9A 1V05A 4I2XB 2F1OA 1U7WA 4I0PA 1F11A 1JQLB 4HI0E 4KBPA 1Y8RB 2GVNA 2XDHA 3REWB 2D4FA 5HSFA 1GM5A 4KBYA 2Y3NA 4YJGA 4TL8A 1LF5A 2PCJA 3TD2A 1JZIA 3QE2A 1BU8A 2IHTA 1KYUA 1NGSA 4BMVA 3VR6H 2HCTA 2JJSC 1G38A 2B9AA 3IU4L 4HH0A 1EEYB 3EIXA 4KYTA 1RJZB 1J1ZA 3PQCA 4NAUA 4B33A 1N8OE 4B27A 1F4YL 5HZMA 4U0JA 5JCJD 1JEOA 2RK3A 2OMTB 3RYIA 4JPVL 4KKCC 3VOBA 2GG1A 1IXKA 3QEQE 2EE9A 1XDZA 4C7OA 2OG1A 2FVYA 3K72B 3MXWH 1V27A 5WRFA 3UWSA 4L4JA 2TRHA 3WWZA 4OFDA 2Y0PA 4AY6A 2HFGH 2QN8A 4PY8J 2GJ4A 5HJGA 1NXPA 1D3CA 4ZEXA 1KEKA 4XCXA 2YAEA 5CGBA 4I2XE 1OK0A 1EFDN 4WNQB 3QQ9D 3B9AA 2K6GA 4UDNA 5JSHA 2BNRD 1SUPA 2Q9CA 4K71C 4NQED 3R5HA 3SC4A 3PQYB 2A5FA 4BLQA 3IPBA 4UZEA 2NPOA 2NX5A 3KS9A 2H65A 2OUKA 5EWLA 1G0NA 4YBQD 2YN3A 1VEMA 1JSYA 3U16A 3HZYA 4RK6A 2VM3A 4DSNA 2GCYA 2WYVA 4G9DA 2FPWA 3GOQA 3NWPA 2IZZA 3U4QA 2KLBA 1GG2A 1HYBA 2IWEA 4DFHA 3BJZA 3TZ6A 1LWJA 1EFXA 1LD9B 4GXUN 4WKPA 2Q6KA 1OCEA 4MTCA 1YCDA 3TURA 5JMOA 2BFVL 4R31A 1ODAA 4XNXL 3KPPA 4A39A 1VA4A 3JVIA 4YRMA 3CZQA 5H82A 3WU1A 3BSHA 3IPFA 2ZUYA 3TV8A 2H1RA 5KBYA 4GZ5A 1SHWA 1P5VB 2IWRA 5AVVB 5I8CA 3UG4A 4CM9D 4AW7A 1EBPA 4BGEA 4K6KA 3OKOA 4QUIA 4ODWB 1XF1A 1QHNA 2Q6OA 5IVDA 4PNZA 2EEFA 3LLCA 4BECA 3RBSA 1R17A 2D5CA 1SC9A 4UM9B 5IQMA 3FO2A 5IF0B 4D42A 1VEOA 3LDFA 1FL6B 1OTSC 5IROD 1BCSB 1MIEH 1O6ZA 2Z08A 1HNNA 4W1PA 5DTRA 1UFGA 2PXYC 5ISZD 5IXSA 4DN6A 4NE9A 2EIBA 3LKNB 4WY2A 1UBFA 4D3DA 3VRJA 4NOJA 4CNIA 4RFLA 5JW5B 2I9PA 4W9ZA 1SEQH 4BC0A 3ECUA 3D25A 3IWVA 3VG0L 3AOGA 1LKZA 3NS7A 4XRCA 5K3CA 1U98A 4TMFA 1E5BA 1KAGA 4N3NA 2EBFX 4FXTA 3ZLTA 2UZXB 3GF8A 4KGXA 4L9LA 3QH4A 4CCYB 4QOHA 4R69A 2OQVA 4HS6A 4YSAA 1CT8A 1NC2B 4XI5C 4CQMD 1IUOA 4YPVA 2APSA 1OAKA 1FC1A 1BVKA 3OXSB 3P0GB 4HETA 3LKRB 1ZSDA 4WHYG 3LN5A 5KNDD 4IGEA 1XPJA 3I9OA 4K26A 3GO1H 4BZ1A 4HGOA 1OPXA 3VB8A 2X6MA 4B48A 5JRJA 1OW0C 5JUEL 5A4FS 1RZKC 5ITBH 3BMOB 2AXPA 3UJBA 1KULA 2CEAA 2ONJA 3LRHA 2P27A 1FH2A 2G4VA 1J1UA 3BTVA 1L1QA 1IAIL 1SCDA 1BGXL 3O2VL 1FBTA 2GITA 4G1BA 3ZY3A 3K6JA 3W0WB 4ZV4A 2KLHA 4AYGA 4NS4A 2WVVB 2VLBA 4OGXH 5IBQA 2CGZA 3AL9A 1D8TA 3KJNA 2CYAA 1BS2A 5IMLA 2DWPA 3UTSD 2Q1XA 2GEFA 1NF3A 2N0SA 3T5MA 2HRPH 3BSZA 4BTLA 4OL0A 3T77B 2Z65C 1RVFH 3KKMA 3IKTA 1ZK9A 2HXSA 5KSAA 3LSOA 4J3FA 3OHSX 3W77A 4IIDA 5EJMA 2CFRA 1MJHA 1G7QB 1D5WA 4WCFB 2GCNA 4GGOA 3CLEH 1HO3A 1QFUL 4BNGA 2Q6WA 5KAPA 3OA0A 1DJQA 4FI7A 5DHAA 4LGMA 1UT2A 5T5FA 1WH0A 2WD0A 4NCXA 3AR2A 3ESZA 2QMOA 4E1AA 2WKQA 1AG0A 4O3TB 1J00A 4DC9A 3FU7A 3QEUB 3FU8A 5DXJA 1N57A 1VKZA 4G63A 1QTPA 4Y2OB 3MX0B 1I80A 2IX9A 3JRWA 2JL1A 4DW2H 4QVKA 1DCEA 2FR8C 3BUQA 3HCWA 1FFRA 1GLVA 5BOSB 4PWKA 3N2EA 4JG9A