2VC2B

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist l-739758
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
461
structure length
457
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 126
structure length 457
sequence length 461
ec nomenclature
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vc2B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vc2B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vc2B03
3EH1A 4IXDA 4MMYA 3FCSA 1DZIA 3RAGA 4XW2A 4K3JB 1JEQB 3EGDB 2VDLB 1FE8A 1XDDA 4O02A 1U8CA 3VI3B 1MF7A 4G1EB 1ZOPA 4FWWA 3EG9B 3Q3GE 4O3UB 5KYUB 1OLZA 3HXOA 1MQ8B 1BHO1 2VDQB 3EFOB 4UM9B 3T3MB 4MMYB 3FCSB 4G1MA 4MMXA 4NENB 3PPYA 3E2MA 4IGIA 2VDNB 4Z7NB 1Q0PA 1M10A 2P26A 3AFCA 1JEQA 3EGDA 3T3PB 2ICAA 4UM9D 1IDN1 3K6SA 4HQFA 2VDKB 4C29A 1N3YA 2M32A 5BV8A 2ODQA 3EG9A 4M76B 3FCUB 5KYUA 4F1KA 1M2VA 4G1MB 4MMXB 1PD1A 4JDUA 3EFOA 4JX0A 4PN7A 5KYNA 1QCYA 3OKWA 1ZONA 2WINI 1YVRA 4NENA 1YUKA 5KYXB 5E6SA 3TCXB 3K6SB 3AL8A 4CN9A 1YVPA 2VC2B 2NVOA 4BJ3A 1M2VB 1JLMA 3TW0A 1M2OA 3EH2A 2X5NA 5E6RB 5HDBB 2VDOB 1BHQ1 3TXAA 3PPWA 4CNBA 1IJBA 5E6SB 3BQNB 1M1UA 3ZDZB 1V7PC 1RD4A 1SSLA 3AL8B 1DGQA 1M1XB 5ES4B 1ATZA 3HI6A 5KYXA 3BQMB 3ZDXB 3IJEB 1NA5A 2O7NA 4WK4B 1T6BY 2NUPA 3N2NA 4HQOA 2I91A 2IUEA 1T0PA 3M6FA 4WFQA 5HJ2A 1IJKA 1RTKA 3F74A 3ZE0B 5LN1A 1JEYA 3VI4B 2VDMB 5E6RA 1SQ0A 5HGJA 4CN8A 4HQNA 1LFAA 4HQLA 3K72B 2NUPB 5KYWB 1M1XA 3OL2A 1RRKA 1RS0A 3IJEA 2I6QA 1CK4A 3EOBI 1MHPA 1JEYB 1SHUX 4IHKA 1U0OC 1MQ9A 3K71A 3NIDB 3NVQA 1ZOOA 3GXBA 1MJNA 1XUOA 2VDPB 2XWBF 4HQKA 3TVYA 4WJKB 2P28A 4NEHB 2UZYB 1QC5B 1SHTX 4F1JA 1MQAA 3OL2B 3HXQA 1XDGA 3ZE1B 4DMUB 2XWJI 3EGXA 3NIGB 4WK0B 3K72A 1CQPA 1PT6A 2QTVA 2ODPA 3PPXA 1U0NA 3ZE2B 3PPVA 3ZQKA 3V4VB 2NUTA 4C2BA 3BN3A 3K71B 1JV2B 4C2AA 5E6UB 3ZDYB 3F78A 3IBSA 4A0QA 4UM8B 2XGGA 1UEXC 4O3TB 1QC5A 3QA3E 3EGXB 5KYYB 1OAKA 2ADFA 4FX5A 1L5GA 4MMZA 2NUTB 1N9ZA 3EOAI 1IDOA 5KYWA 4WK2B 2B2XA 3AL9A 4O02B 4Z7OB 1AOXA 1U8CB 4GZ8A 2I6SA 1AUQA 1TYEB 1JV2A 1PCXA 3OKYB 5E6UA 1AO3A 1SHYB 1FNSA 4G1EA 2VDRB 1PD0A 1L5GB 3NIFB 4Z7QB 4MMZB 5KYYA 3V4PB 2WW8A
chains in the Genus database with same CATH superfamily
1IGJA 3A9TA 3AMKA 5I75B 1IZYA 2C7PA 3QAZB 5A7EA 5CKAA 2QHRL 1MHCA 1GL3A 3R9KA 1V3JA 5KJ1A 2V37A 3V7NA 5AVOA 3L8FA 3D85A 1MWAH 4CEHA 1QFWI 2BONA 3IDGB 2IYXA 2WJGA 4O51A 1A02N 3KHOA 2X4SB 4MS4A 3CZQA 1EDHA 3EH3B 2RHRA 4UU8A 4NUMA 3U3KA 3UJCA 2FBJH 4ELKB 4X62B 2DH2A 1LW7A 5DP1A 2ZRQA 5BQDA 5EN3A 1YE3A 2ZJBA 4POZD 4J16A 3CUPA 3MMPA 3OOHA 4O4LA 4WNJA 5JW6A 2J85A 2WYTA 4NI6A 4V03A 1DC6A 1RLTA 5FBRB 3JWPA 3VDQA 1YR9A 2B9VA 3IJHA 3VHXB 1U0QA 2QL5A 5EZ5A 1CE6B 4DCGA 3RC8A 1C4OA 3TBTA 2Q20A 2FP4A 1GTVA 4NC1C 1I1FA 4L6CA 3EDRA 5FHAL 4M8VA 4KRMB 2O05A 1O87A 3AWEA 3WV0A 3M2TA 2ORVA 3HYSA 3QEMA 1JWMB 2R6ZA 4FQ7A 4WFFD 2WILA 4KNQA 2CRYA 1EDZA 3WVNA 4RAUA 4YAOA 3AAZA 3BH8B 4RE6A 4EB3A 2PGDA 1D0VA 4OMFG 2CEAA 2YIJA 4P23A 5DXFA 4CXMA 1ORSA 3X1WA 1IM9A 2CIKA 4EUPG 3R8QA 1Y8QB 1Z9OA 2W59A 3A6HA 3WFIA 4HNAB 3NSFA 1JG1A 3QKWA 1UWFA 4S1PA 1FORL 4M0EA 3CXHK 5EMMA 1S7GA 1QVOB 3E2MA 3IBYA 1LPNA 1AMOA 2UUCB 1AP2A 3QJVB 2I65A 1KO5A 2Y23A 2AMGA 5D7JC 2UYYA 3U4EB 4M9SA 3PYCA 3AWIA 2EZ0C 4GI1A 1VSTA 6FABH 2AJDA 4NZYA 2GN2A 1YULA 2J0VA 4IFEA 4FEMA 2E6QA 5EBMB 2WJIA 4K23L 5D96B 1JP5A 3BQUC 4FHDA 5LP1A 1NV9A 3SE4C 3L0YA 4HADA 3GFRA 3R09A 1N5OX 1Q17A 4EB0A 4J7RA 1DELA 2VJMA 3WIIH 5KKCA 1C5CL 3BKCH 4JH0A 1A5FL 2CBGA 3NP3A 1J5OL 3DM9B 3NIDB 1MJJA 1OYOA 3SHFA 5IW6A 3Q8KA 3OM9A 3FAZA 1LWOA 1NN3A 4GQ9H 5DWDA 1BF5A 4DO4A 4PV7A 4Y0AA 5F2FA 4B5ZA 1N4AA 3SEQA 5HBRA 2ZPTX 5EMJA 1ISJA 2JKYA 4ERNA 4B3BA 5I6OA 4HULB 4CODB 4MXQC 1A21A 4I5EA 5D1XC 1R6XA 1K08A 2FEKA 4OMCA 4AKPA 1E4VA 2V5RA 2ERCA 5ILGA 4GO8A 3VWJC 1JIJA 4PREB 1RTTA 3O75A 2Q7AA 1Q0ZA 3I6BA 4BEIA 1ZS8A 1MXGA 5DHYB 3HI1A 3IVRA 4OGGA 5LBUA 1KLGB 1B0ZA 2HGZA 4XAWH 3KOWA 4ZQFA 1TEYA 1G5QA 4G1MA 1JLHA 2WP0A 2OJEB 5JH7F 4GKZA 4KX7A 2GFBB 4Y2VA 4GPTA 1N3YA 1N2RB 1M34A 3DSFL 2NIPA 2JCCE 2P6RA 2H2IA 3LKPB 1ZLVK 4DV6B 3X3FL 1J06A 2VP9A 3SKJH 1KXTB 3KUUA 4Y9GA 3HUFA 4JLOA 5B7FA 4C57C 1VQ1A 3VR0A 3VOSA 2ZOLA 3ZDZF 3DVNB 1SJHA 1TYDE 3QNUA 1P7ZA 4IIJA 1XR8B 2WQAA 4FXKB 3HPLB 3PGDA 4XPBH 2GPJA 4HUQA 4N8CL 5FDWA 2PZKA 1X4XA 1DPGA 1PKOA 2D59A 4TRJA 3GUFA 3SJVA 3MB8A 2VXBA 5KUKA 4Y16B 4EYSA 5H3LA 5PAZA 1AACA 3I52A 3KEHA 2YXNA 4TRNA 1VGEH 5KANG 4ZT7A 4D8VA 3K8OE 4OAQA 2PUEA 1Y9JA 1WA1X 1MQAA 2GD1O 5F0LB 5C7XH 1QO3B 4Z0BH 2WSMA 1GCIA 1QMGA 1YNSA 3E53A 3VXQA 2FH8A 4WVRA 2GK4A 4ZALA 1VZHA 1KYDA 3NDYE 4ND4A 4JYMA 4F6CA 1FEZA 1NLBH 2ZXUA 1FE8L 1MLCB 1SXNA 4RGOH 3VFVB 5CR1A 3CFBB 5AW6B 3EZ9A 2VTFA 3K9QO 3QPDA 2RGNA 5TFSH 1E5DA 3SE8H 3IAEA 4U39A 2WLYA 1D09A 1MPAL 3WEBA 1C5KA 2HWXA 1X70A 4NAQA 3GLFE 2O1XA 4CKYA 2PCPA 3OCWA 2COEA 2VJ8A 4MMXA 3QM1A 1O75A 4A67A 4WBSA 3THWA 5EH1A 5IOKA 2OMNA 2X1QA 3QXAA 4YXLL 4LOFA 2Q6VA 3IIKA 2FFRA 4BRSA 4Q4CA 3BW9B 5CLWA 1DQLH 1O5OA 3CEAA 3B9RA 5AK4A 1YCGA 4IBOA 5IT4A 5KC8A 3SN6A 3LK7A 1PZ2A 3X3HA 3F5WA 1ACJA 1NYQA 1Z7BA 5F77A 2F18A 4NLLA 3ECBA 4YAIA 4NHCL 3AM8C 1XIWB 4KKAC 2MCPH 4FHKA 4EI5D 4L7VA 3RVPA 2HZHA 1G6HA 4K0KB 4AKIA 4FTDA 5F1NB 4OH7A 5IMMA 1EH9A 3CDFA 2BEJA 1S2EA 4Q4DA 3TB6A 4GIOA 4BFIA 3JAKA 2FJGB 4H1HA 3ZV7A 1ZV2A 3VNBA 3CEHA 1ZHHA 2WGXA 4FLHA 3SMQA 2C8JA 3WLEA 3HG2A 4CLRB 4I1PA 5IKXA 1BX2A 2DHEA 2Q5FA 1QI5A 3IX7A 1IBSA 5BSFA 3KPNA 4P7FA 5E9DE 4BJLA 2A5GA 3DSRA 3WGJA 1MZVA 4ACBA 3IDSA 5LQMA 3FKJA 4NCC1 1MCWM 3KJNA 3QUML 1TZBA 2Y71A 3LDGA 5I8PA 1SXJB 2XY1A 3W6ZA 1VHPA 4UT9L 3IXTB 1G41A 1JS4A 2FFQA 1FYDA 3WHE1 3JWDC 3LKNA 4TVBA 1MQ8A 2J8ZA 2C57A 2IFFL 1OK8A 1GZHB 3OCUA 5C8XA 4FZ5A 3II1A 4Z7QE 3M5PA 1SRDA 1JFVA 5KAMA 2DPXA 5K0TA 2Q41A 2EVFA 3WDMA 3THXB 1Q1QA 2NY1B 4KWUA 3T3PF 5EF2A 3SOZA 3R6TA 4ALKA 4A7SA 4B5EA 4LJLA 1PYWB 4YHLL 2I9TA 4ZYUA 4CKXA 1IBFA 4JUIA 1J0ZA 5AVWB 4MVJH 3P11L 2WJPA 4K5NA 4QXUH 1A3ZA 4HEJA 3N1FC 4E9WA 3DQZA 3N2GB 3MOAL 3JWOC 2KLBA 2GG1A 4LZOA 4BIKA 2Q9CA 1QB7A 2TRHA 2QSZA 4KREA 1XHHA 3CC5A 3V6FA 1V95A 4P1ZA 3CV5A 1VFBA 2BSED 3PV6A 2DQYA 3WYRA 2ZREA 3G1WA 1HI6A 2I76A 2JK0A 4J2TA 5DC4B 5AK0A 5A3IC 5G2OA 4KVAA 3AVOA 2H2AA 1THCA 4CM4B 4W9DC 1YEJH 2X8JA 4KOBA 4TTPA 2JAOA 3RUGE 1A98A 2IZ0A 4YECA 1ZEJA 1A2YB 3C60D 4IOSD 3FTDA 3NVMB 2JASA 1XSJA 4WTXA 1KJMB 1VLLA 4XN9A 4UM7A 1MHEA 3FL7A 1SHYB 1LPBB 3PJDA 2WSDA 5GXBB 1VECA 1QRND 2V7VA 1JHQA 4LHJB 1H0HA 2HQBA 2G1PA 3MRJB 3H3JA 1ULBA 2IWRA 3LQAH 3P9WB 1PP4A 4HZIA 1EDBA 4QXGH 1LL1A 4D0CB 3PGLA 5EWIH 4YONB 2GITB 3QFRA 1UJBA 1U63A 3VUAA 4Y1TA 3R0XA 3EXAA 3I58A 4CU5A 4TSBH 4W4OA 1JGLL 3D2TA 4OM1H 4CR7A 2E59A 1WZAA 2IP4A 3WB1A 4GBXB 1QM5A 3AUKA 4N2OA 5DQDL 1DO0A 3H5NA 5CM1A 2NW2B 3D3VB 1H05A 2XIQA 3UG6A 2CQVA 3TFKC 2I4OA 4GAYA 3KPWA 2N0MA 4I77H 2GCIA 4ZW3A 4O5OA 4JU8A 3T54A 1OP5K 4WXEA 4LBEB 5JZSA 4YDNA 3HUDA 2CBQA 5LDSA 1YQEA 1MCWW 4L3EE 5AKXA 2YLKA 4EVRA 4S1SH 1V05A 2O7NA 5LFAA 4MRMB 3TOVA 3IMBA 1Z5LA 5GISH 1F02I 4LCWB 3M83A 5HJ3B 3CGWA 5H4GA 2P9RA 3DKRA 2JA2A 4G3XA 1BXXA 2WXPA 2GF9A 2RC5A 5C32A 4CLDA 3IHWA 3L7YA 2QX7A 3P73B 2V65A 1EWVA 1P4SA 1QYCA 2IV7A 1OCWH 2GX6A 4IICA 3JTEA 4YR6B 3HU1A 4PIRF 1G7QB 3RVUD 1TJMA 5F1YA 4PN3A 3JSSA 2FMUA 2OBXA 1AOXA 3ANTA 3QIVA 3SDXA 1DL7H 4HN4B 2GBUA 2Z4QB 4E4YA 3LYUA 1ZLEA 3FDJA 3GMRB 2I85A 2NNLD 1Q9LA 4AJIA 1EUCA 4M48H 4YAWA 2FK7A 2HTKD 1DVFC 3UXMA 1XA0A 1WZCA 3JS5A 2PVSA 2GM9A 4W6XB 1ECJA 4R7ZA 2QXYA 4JJGA 4C56A 3DX9A 2YJ6A 2ZGVA 3TEMA 4BPBA 3TQIA 2C00A 3X1ZA 3GVHA 4AJHA 3CLHA 3WXMA 5AVRA 3H2QA 4MHHI 1MRCH 4LGSB 1M2VB 3WEMA 2ZUQB 3POCA 1MW0A 2AQNA 3DURB 3LN9A 3MVEA 5KC9A 1WBXB 3SDCC 1VE1A 4KBGA 2ZB8A 3FGOA 3BRQA 4K8RB 2FTKE 3FCTB 5AI4A 5T3ZL 4J76A 2D0FA 5I4KA 3IUYA 4M7LH 1NC3A 1RPNA 3S8GB 1HLDA 2ZBDA 3L4KA 4S0SD 3BP6B 1K7CA 3MWGA 2QPSA 1Q0LA 4BKRA 2GB2A 3H3KA 4LPWA 1ZI8A 3ZHDA 5C07A 1CUDA 3ULVH 4B75A 2CXQA 5F7FA 2GCNA 3RDJA 1KC3A 3ZVKA 2IG2H 4HKBA 4P33A 1IEAB 4D0NA 5AAPA 3TMAA 2CLKB 4BA0A 3C6LD 4MIYA 2EYSB 1FFTB 2CWWA 3TS8A 2FO8A 5ER9A 3U62A 1HSAA 3RDTA 2RG1A 1FU4A 2ODEA 2Q5CA 2XPZA 3KR0A 5BXQC 4RX4A 1R8YA 4LVHC 1TB4A 2OGUA 1A14H 3HA3A 1JG9A 4PFEA 4YI5A 4LDCA 4KGLA 4B71A 1EFTA 1YUKB 5CFPA 3B52X 4OBSA 4ISCA 3BWVA 3FTXA 3B6MA 4AZ8B 4O6VA 3MBXH 1P72A 3X1MA 3ZJTA 3BJZA 5SX4H 2ZKYA 2BGJA 2P5WD 4YPGA 2HFFB 4EMBA 2YNMA 4K71B 5KTOA 3WDLA 5E94A 1P33A 5ID0A 1UXIA 3WK7A 1KARA 2CXXA 2WZ0A 4PCSA 4Y9BA 3IDZA 1CQZA 5HHOB 3PXGA 3U6XS 5MFZA 5DD6A 3F7TA 2WDZA 4RGMC 4XP1L 3ULUL 4J6RH 1ZY2A 2FRXA 3WB2A 5C70A 1U2EA 5D5MF 4I87A 3ZZTA 4AFNA 1S7SB 1APBA 3E9TA 2WQSA 3P9QA 1E4OA 3W2EA 5KU1A 4ZUSA 1K8RA 3I92A 5DEOA 3UEOA 5IXJA 3HE6C 3MTRA 2AFHB 2H2GA 2B4CH 1HY3A 3NAQA 4N3AA 2ZZMA 3EFFA 4PRZA 1ABEA 5KSUA 1Y4ZA 2MR6A 4XQ0A 1F1GA 3QI9C 3FM9A 2XB2A 1KIPB 2OHXA 5JW4M 3H3XA 1XCTB 1UZNA 5C0BD 2VPTA 4FKEA 1W93A 1ASPA 3LRPA 4Q9KA 2BSSA 1EBBA 2WD8A 1G4HA 4NNPH 2QLMA 4IHAA 2OYMA 1AGEB 4L4JA 3EGOA 2HL6A 2JKWA 4DHEA 5E6ID 3IAQA 4E07A 5FM4A 3D8TA 2V8MA 2AOWA 4YLBA 1PR6A 2XJLA 3L41A 2P67A 3ICPA 5HDOA 1H93A 1KLFB 5ALPA 4MXWL 4BL5A 1QYXA 2WQRA 1SY6L 4QJ5B 1BQKA 4RVCA 1JEQA 2WXNA 1U8QB 4PRDA 4AKGA 1JHLH 2VZ1A 1P19A 2ID9A 2Q27A 2ZUDA 3RK1A 3SQBB 3IDNA 2NX5B 4QJ4B 3AEUB 1LM8V 1ID2A 4O1MA 3K70D 4BZXA 4UVIA 2CPUA 1TECE 1KTBA 4OU3A 2I2FA 4D46A 4PJIE 2B37A 3H5WA 4LX8A 1WAAE 5IK2A 4P46B 2G5BB 2OVBA 4R1LA 2O3UA 2IXEA 4JZNA 3CSDA 5AHXA 4C7JA 5G0VA 4OZGA 3NG5A 5M2QA 2CVHA 2GEUA 4ILDA 2VXCA 1ZS2A 5TJHA 5I8EA 4IEEA 4CLXA 2HMSA 2YMTA 3WIHH 1Y3CE 1JVSA 5JQWA 4GO9A 1UURA 3PPEA 2Q4RA 5CM2Z 1QRUA 1P6FA 4KR7A 1JV2B 3HU5A 5ITBL 1YOVB 4KK9D 3PHOA 3QWFA 1TMGE 3GM0A 2BWIA 4IGBA 1LJLA 1K4CA 1U2DC 4Z7OF 4Z7IA 1XMVA 1DBWA 4KK8C 3SX4A 2QOEA 1QZ3A 4NAJA 1HNZB 2VL4A 2GN8A 1AZSC 4B81A 3FT4B 3LCUA 3QFGA 3CNBA 2EEFA 3CBQA 4U7FA 3KGRA 1I7RB 3GUUA 1EZSA 1C1XB 3L9YA 4YV7A 5J2UF 2ARJA 2K7QA 4KVCH 2GVYA 1ZUD1 2EDDA 4H13C 5F98A 3OQHA 3VVVA 3H84A 4ELKA 3RT9A 2BC4A 2VPWA 3OKDB 1U9CA 3GKZA 4KROB 3L5WB 4G70B 4BNHA 3ZEAA 5AI8A 5HZKA 1XAIA 4DVRH 2GHQA 2NYKA 3AG1B 2CKBL 2XT0A 5CA0F 3DZIA 3EZYA 3F3HA 3VHXA 1HLFA 4N01A 1CE6A 1QSEE 3IE2A 2WBJB 4P0PB 1VI2A 1P2TA 1K66A 1UZMA 5FPQA 1V7ZA 1ZM2A 1OGTB 2K87A 1O4VA 3HO1A 3BGWA 1HINH 1U93B 3EC1A 1RC8A 4AU1A 4ODUB 1BFTA 2P2ZA 1QEWA 2H26B 1TM4E 4FKKA 2WTRB 1G38A 1BDHA 3BH8A 3X43A 3SPCA 1S9KC 2QN8A 1EZ1A 2VR6A 3OO0A 2KZWA 4K5LA 4AQEA 3LWDA 4ELMF 2JGNA 1S8AA 3CVCA 6NULA 2R27A 1WFUA 1Y8RB 3UPTA 2EIJB 2PX6A 1GAEO 4UNUA 3W8RA 3NH7H 2PLAA 3PLRA 3PWZA 1QVOA 3IVCA 4QOEA 2BBWA 3B89A 1JFQH 2WCGA 5IUCA 4XVCA 1OBHA 1YEHH 4XGNA 2R8RA 1HSZA 3U4EA 5H68A 2W93A 2BVYA 3UKDA 4TUJA 3LNHA 3BFVA 1IO4C 1H3PH 3PTAA 2GFIA 3MWKA 2DW5A 1LEHA 2ZZUT 4M7ZC 3EFHA 2D3NA 1R8SA 3OJWA 1RUQH 1Z7YA 5EBMA 1R0KA 3VC3A 1UDAA 1R4ZA 3ZHFA 1HF3A 1Z2DA 2QL6A 4W7HA 1JKFA 1ZM4A 2IF0A 1GL6A 5GVRA 2IPOA 2WNSA 5IIEA 1XZDA 3KPRA 4HKXB 3IMCA 3Q10A 5CNKA 4L29B 3IKCB 1O94A 3GA5A 1JLKA 4XNBA 4UT6H 4ZUVB 2V7NA 1NQOA 1VGRA 2IH1A 1F3OA 4UT7L 1CC1S 2IS4A 1GTFA 4RCAA 3B2PA 4FNSA 4EW1A 4U0RC 3FKSA 5AICA 2CXTA 5BN3A 3G7TA 2PL1A 2FE4A 5ALTA 1ZHNB 1T9GS 3N39C 2PMCA 4UAHA 3ZW7A 3OAWA 4POZC 1H2HA 1XEXA 2V3FA 5SYNA 3VVLA 2JCGA 1E2NA 2JGLA 3KOYA 1YNLH 1KLGA 1SCKA 2UVQA 3HH8A 4RA9A 1Y07A 4LIQL 2WP8J 4X61A 3G49A 3VVCA 4DR4B 4LOEA 3P40A 2OJEA 3EOZA 3FVRA 1BS1A 1N2RA 4EUHA 4UXIA 1QSFB 4OJFL 2CK2A 4FAAB 1KXTA 4KZKA 4OIMA 4FIDA 5HQ3B 4MVJI 1WQ4A 4MUNA 2X1HA 2YKGA 1D9KD 4RESA 4LEIA 2ZUCA 4TMKA 1H6FA 3K16A 1SVIA 4WO0A 2UWEB 3TDNA 1G21A 1L9SA 2DMHA 5AUPB 3PVSA 1B0AA 6Q21A 2IMNA 4FQ1H 1WB6A 3MS2A 2DQZA 1OQXA 4AIXA 3KNBB 1EO5A 1C8VB 1N5RA 2GBIA 3EMKA 4HJEA 1EJOL 1EFRD 4WOCA 4H3HB 2IOYA 3O94A 4R31A 1WFNA 1SULA 3VTMA 1FXSA 5CJOL 5K3CA 1PT8A 1A47A 5FLYA 1QO3A 2P4EA 4IHKA 3EIHA 3OLGA 3EJ6A 2D8MA 4LRUA 4ZOQI 3LX9A 5ULLA 1Z2NX 1KCLA 1GGVA 2XN9D 3VFVA 3CFBA 1KB5L 4PEVA 5AW6A 2BFCB 3OJ0A 3PVZA 1JNHB 1JJIA 3N9IA 2WOOA 2X87A 1CF8H 2ZCUA 3ZD7A 5HHPA 3KHQA 1EJ6A 4JQYA 1QIGA 3PNQA 4M00A 2MWMA 1TQWA 5BW7C 3ODPA 2EH8H 1P1RA 3DNPA 1P45A 2XIIA 3GNLA 2I71A 4PVLA 1M2WA 3P27A 3D3KA 3DQQA 3BW9A 2WUVA 4YC2B 4JSTA 2WPNA 1U5BA 2VTEA 1HH6B 4M1WA 3VR5A 4HLNA 2VM3A 3PFIA 5LCVH 4D8OA 3FOMB 3RVVD 1PLAA 3U6RB 4O3FA 3TPZA 3COSA 4YEDA 1VAHA 1XIWA 1IY0A 4HGQA 3I3EA 4NB7A 4A7VA 5I30H 1CF2O 4HEME 4A7GA 3TKAA 1R33A 3S0PA 1FUNA 1W35A 4G1BA 4YMPA 4P4UA 3LH5A 3PWTA 5C8DA 3L5XH 4U1HA 5F1NA 4B7IA 4RAQA 2WMOB 3M17B 2GPWA 3BPNC 2WAOA 3GMSA 3QIBD 3NC0C 2FH5B 3SBEA 3HEMA 1J5IA 2RCSL 3WHXB 3OG6B 1UBOS 2D2VA 1W6RA 5L8VA 1T0MB 3QQDA 4ZRGA 1BCRA 3CBGA 5GVSA 4IDPA 4DV2B 2Q7OE 2FYVA 3V42A 3K8MA 2ZJ6A 3HI5L 1FIGH 4HHAA 4YCLA 2CO6A 1E3MA 4D2IA 5DKFA 4Q4HB 3BH4A 3G8AA 1SXJA 4YCAA 3IXTA 3Q6GH 1IBZA 4YBLB 4AQ7A 1QQBA 1QHHA 1UT1A 1PL6A 1BHSA 1S89A 2IQAB 1N3NB 4LCWE 2OCKA 1DRUA 1KYZA 4M99A 5I1HH 1NJ2A 1PJAA 1PLGL 2B8TA 1E30A 2E9JA 3BYTA 3VSBA 1W0YT 3N85H 1M2JA 5LMUB 5EZYB 4GYJA 2HPZA 4JG1H 3DSNA 4BBZA 2ERYA 4WLOA 2P7TB 1QZ1A 5KTEH 1YDPA 1FAIL 3KWTA 2VHUA 4TLCA 5CLYA 4IF6A 5LA6B 5KTKA 1OTHA 1ZH4A 1PFKA 2WQUA 3DMFA 1PFUA 4LCEA 4CSZA 2Q3AA 5HF9A 1MJ7H 3VDAA 2YC1B 1QYIA 1E4WL 4XX0B 1P5UC 3OF5A 4NO0D 4G86A 1E1RA 1CR0A 1O9ZA 4QQFA 2Q7YA 3O4RA 1JTTA 4X4ME 2J9FA 1VMAA 2BFEB 4JQXA 4LCIH 4K86A 3R3ZA 4HTAA 4F5DA 1BVZA 3HR5B 3L1VA 4OD0A 2DBZA 5DJXB 2JJMA 1I4EB 2J3HA 3GC3A 1AJ7L 3PWPE 1TJ5A 1DBJH 3X11B 1TQCC 2GSIA 2JZNA 4GMTH 2R87A 1HEUA 1L9TA 1LNUB 2YAOA 1J9RA 4WFHD 3T4AB 2J6WA 1VMKA 4WDIB 4HEHA 3I34X 3PQ7A 1UGNA 1GO2A 3WGNA 3LH8A 2XXMB 1A2YA 3BEDA 4BQ9A 2Q2EB 3FMFA 1XXHA 1UKEA 3RTCA 4HT3B 2NZUG 4Z76A 3ESRA 4IO1A 3IAS6 4UQLA 4GUAA 1Z3IX 3QLVC 2FYYA 2PJDA 3T0XA 2C1EA 3HXMA 4PJHF 5DV9A 2PO6B 4NFSA 4EI5C 1AZRA 1CXKA 2GITA 4XVSL 5B3JF 4WW0A 2MEJB 2IYFA 1PNOA 3OPZH 3X2QB 1EK3A 3E81A 4R8WL 3PDDA 3HFMH 1E66A 3LGXA 4KE9A 3C4VA 1L5FA 1OB1A 4P2RB 1M7DA 4BCCA 1QNFA 3L01A 3F46A 3C5CA 2ZB7A 4HDQB 5IEJA 4P3YA 1ZOIA 2ED8A 4CGUB 1BXRB 2XDAA 3NVDA 2NW2A 3O6LH 3DDFA 2O06A 3D3VA 3PENA 5J6HA 4EI0A 3P45A 1DX9A 4NQQA 1NCOA 3IPAA 4LBEA 2CXNA 1BBDH 5DYOA 3U49A 4JN6B 4YX9A 5KQRA 5LMNB 1NYRA 3C70A 4L23A 4B3MB 5L51A 3IOBA 1K98A 5BV2P 4FFWA 3N2KB 1R0AH 4X6UA 5GADl 4BN0A 1Y1QA 2QUKA 4B95C 1UB5A 1VOTA 3RVJA 1XLTC 2RG7A 2YXBA 2GJ6B 3MI6A 3ELAT 1I6WA 4M9PA 2BEWA 1NI4B 3P73A 4ODSH 3FXAA 1U4OA 5IVXA 1KCVH 2VXVH 1MREH 1XRLA 4Y9UA 1H1TA 3FOBA 3DP9A 3DUUB 4YR6A 1M2KA 5EHZA 1JHVA 4PCTA 1G7QA 3CG4A 5J13B 3QA3B 4GG6B 2OVFA 4UU9B 4OCWL 3ISVA 4GRIA 1HU8A 1BS9A 2YQ3A 3ETLA 2WJAA 3ZCXA 2Z4QA 1MHTA 1I8UA 1IQ0A 3GMRA 3H4TA 5LP6A 2ZR9A 2Y6UA 1N10A 2E4UA 2WWWA 2ENUA 5K9QG 1XA3A 3VCLB 4CN6A 1VPEA 3S97C 4HAKA 4YWGH 4DN4H 3US1A 4HDNB 4NQEB 1MB9A 4E70A 2BW4A 2XYRA 1SEQH 4XOCA 2GAIA 2Z91B 1VADB 4HUKB 4P57B 3OF3A 1BE1A 1T20A 2OE2A 1A8ZA 4D9JA 2ZQKA 1CGVA 3E23A 3O21A 4C88A 5CVCA 4N2MA 3P0JA 4MWFB 2G5CA 1M2VA 3QJFB 2FPPB 1II8A 2W6PA 3I04M 2AHOA 1WSST 3C60C 2XQGA 1UZUA 3LP5A 2X2OA 3MACL 2D7JA 3F8UB 2PF6A 5JYLA 1WZNA 2AZXA 3D02A 3FCTA 3TQCA 3HLTA 1GPJA 4OFYA 2MINB 2EP6A 4U2FA 1SLVA 1CDCA 5CGZA 2OCAA 1FDRA 4BQ6A 4AJOA 1MOSA 2HNAA 3NVAA 1ID1A 3BAWA 4X24A 1XSOA 5DX8A 3IETA 2Q9BA 1QKZH 1YVLA 3UKOA 4XLZA 2W4MA 1E1KA 2DLDA 2PMWB 1T1WA 2NX5E 4HF5L 2BNQD 1GN8A 3IFPA 4OLHA 4WFED 1HKLH 5IB3B 3I9MA 3UEQA 1GXSB 4FP8L 5IQMA 1DBIA 1MB0A 1G9XA 1VB5A 5EJ5A 1TT7A 3VB9A 2EYSA 5AUOB 5J1AB 2DQUL 5KYYB 2XYCA 4TS9A 3ZVMA 2J1XA 4KTEL 3PHCA 1LQBC 1N9ZA 4KXWA 2C58A 3AI7A 4JEUA 2ZFUA 4XN7A 3QZOA 2VYNA 5J6GB 1MCJA 2QR5A 5FK9A 3U4AA 4DK6A 2I2AA 2VDLL 3HJBA 1O5PA 3KLSA 4LY3A 1RU9H 1Z5OA 4ZI7F 1R5OA 3SR4A 3O1HB 1KOJA 3G0DA 2Q5EA 3QG7H 1QXSA 1UM6H 5BV7C 2YXVA 2HFFA 1N2XA 2UVEA 2X4TB 4TQUS 3VG0H 5ICXA 2AF4C 2J4WL 1YXMA 3KAJA 3VSVA 1J1IA 5BSGA 3RVUC 5HHOA 1A66A 1Y7IA 2FHSA 5JDIC 3U9LA 3BGFB 4QYIB 2EKPA 1E6JL 3FD8A 3Q2LA 2DMBA 1O6TA 1S7SA 2E49A 4U6TA 3OXSB 5EERA 1A9EB 4RKRA 2B1AH 3KJ6H 1E7YA 2AFHA 2HTKC 5EUOF 4KCGA 3A7DA 1HL3A 5FYKL 4RPJA 1ACYL 3AREB 3T5TA 1Q3TA 1G1YA 3VXMA 3NOVA 1F2XK 4YHYC 2F8TA 1W8EA 3IEUA 2FWNA 1N8OE 1TTAA 3GGPA 4F4FA 3H1EA 5ACMA 1UWXH 3IE4A 1U0JA 3N2YA 1AGEA 3QJUB 1XALA 1GZUA 1W47A 1IC4H 5JMOC 4P3CH 5HP4A 1BVNP 2AG5A 2HIAA 5IVOA 1J0AA 1N1MA 2I4LA 1IZ7A 3FMIA 3RIMA 3OCZA 1KLFA 4JYZA 4BAUA 2XWTB 2BTQA 4CDRA 3LZNA 4QJ5A 4KQWA 1USIA 5AW2B 4E08A 1MG0A 2J8UA 1WE2A 3JD2A 5A2GA 1TEXA 1Q0YH 1OF2B 3ECVA 1IAMA 1P0MA 2A14A 3LTEA 4AG5A 4NJ9H 3SQBA 2FR4B 2YZ8A 4FA8A 2BOCB 4QJ4A 3UAXA 4ZD3H 2ZCLL 5DNDA 3QQNA 2IPAB 5EN2B 2HSJA 3Q9UA 3DVGA 5D7HA 2VQ4A 3N1MC 1I51A 2G5BA 2BWQA 4ZFOL 1CURA 4EAAA 1FHNA 4K2HA 2VDUE 3PF2A 3C6LC 4MWDA 5C0OE 2I66A 4JRXA 5LXTF 4ZVUA 1FLDA 4I50F 4I18C 4P49A 5IVIA 4DBVO 3RPIB 1VBMA 1B6TA 2RKOA 2ZRAA 5GGRB 3MLZL 1UJ5A 4PCLA 5BN5B 4F1SA 3VKGA 1SA0B 2H16A 3KEDA 4LOUD 1TZAA 1WCBB 5F72S 3TZLA 1ADBA 5FAAA 1VDZA 5IFAL 4I4WB 1UC4B 2JJ2D 5DYWA 4NZRH 1OAZH 3PS9A 5FWAA 3AOEA 4JB9L 3SKVA 1YOVA 1HYSD 3WLHA 1GSHA 5IWLA 4UU7A 4QFCA 4NPJA 3TLJA 5FFGA 3BIKB 4Y2DD 4EJMA 4FULA 5I9QB 2JCVA 1KY2A 3IGLA 4NY1A 5JQGA 1O9BA 3RYCB 1WV7T 4ACPA 4ZD6A 1HLPA 3SZMA 4DUWA 4AUKA 3CWGA 4WDRA 2R4RL 3TI7A 2UUAB 2GQHA 1DHKA 3B1XA 4IXMA 3VO8A 1QIDA 2VNSA 3LX8A 5GS1A 3LVBA 1FTNA 4MGZR 1JXGA 5F7MC 1C1XA 1DRVA 5IKEA 4ZG1A 4U2CA 1QHNA 1E20A 2X9NA 3L5IA 2WXGA 3MWEB 3AHEA 4AQDA 4BKMA 4O51B 3M1IA 3VFOA 5MEOB 3PAZA 1SNRA 5JNLA 3OKDA 4ZMAT 2D0PB 2EIEA 5DLDA 2AVFA 3L5WA 1RYFA 3V0VB 5KBYA 3FT3A 5LO7A 4CBVA 3AY6A 3HHPA 4LOAA 5AM0A 1EZVY 2XWEA 5F7LB 3CUPB 3RUIA 4H0CA 5BUSA 3W6UA 4O4LB 4CKCA 2CXHA 2ZTMA 1FTYA 5E7QA 1ZRNA 2JLWA 3AY4A 4EFKA 4ZZ0A 4YSCA 1HYQA 3TFBA 3QPXH 3MHTA 5FCDA 5E6IC 3T3DA 2WBJA 1XWIA 3H1TA 3HUUA 3DVAA 3TBTB 1ESOA 4B9KC 2VDMB 2FP4B 4B8YA 1ZIBA 1I1FB 1E1MA 1U93A 1G0DA 4MGYR 2GO1A 1XI2A 4EECA 4YFLF 4ODUA 1KJZA 1T1YA 5FKPA 1V8HA 2DGDA 1EO8L 4M60A 3DL7A 2H26A 4GWGA 3MJ8A 4NZ9A 2UWEE 2X6QA 1GGMA 3FFCA 2OZEA 4MUYA 3PA8A 1YVUA 2AI0H 4GLOA 1X9UA 3AAZB 1K75A 4GSDH 3HZ3A 3K70C 3H9UA 4N2BA 1J1XH 3QS3A 4P23B 3WGUB 4DKTA 1YGYA 1IM9B 1Y8RA 1ZGZA 4I4TB 3L84A 3V4UH 4HOYA 2HKIA 2E46A 1PEWA 4PFJA 2GDZA 4ZPXA 4MLPA 5KOVC 3CS3A 3BUYA 4OYHA 1B4DA 1CL7L 4DKEH 3JWJA 1N4XH 3KTDA 5IBPA 2OXIA 4QQKA 5LQAA 1NL3A 1KFJB 3L81A 1ZISA 3H9SB 1IE3A 5F8RC 2C1OA 4IKPA 3CM0A 3HG3A 4JBLA 2ZXBA 2DBQA 1HI9A 2QHXA 4CTNA 4D9QD 4HCJA 2Q87A 3QI7A 4KK9C 1BEYL 4NYIR 1KV7A 1V8BA 1J2EA 4HN2A 4R1SA 1E3DA 1I6LA 2OD9A 2WM2A 2LFGA 5CGBA 1Z4PX 4TZ6A 4HKXA 1I2MA 2OSWA 3IRVA 5CDFA 3M6LA 1YV9A 2R29A 3BX1A 3KL0A 2VJMB 4CIBA 2JB5H 4L29A 3IKCA 4N03A 1YRYE 1F4WH 1GITA 1MJJB 3DXXA 4KQ2A 1DJYA 4RGQA 3F83A 3DX4A 3V4OA 1T26A 3GSUB 2XVZA 2NY6D 4NQXA 4NRXA 1T0PB 4MTMA 2EFJA 4MW6A 5FUMA 1M56B 3BJEA 5LAXA 1Y81A 3WNLA 3L17A 1O0CA 3JWNG 2PRIA 3GDOA 4UV7L 3UAVA 2WZAA 4KR3A 3OWXA 3TPKA 2J6HA 1LBHA 4NP4L 4Z86A 1SC4A 5E2TL 3W3AD 4MKTA 3LL7A 3WV5A 5JHGB 4Q7MB 2NAPA 2OXTA 1LP9E 4PYKA 3C2AH 2GN6A 5E4TA 2B4KA 4G8EB 1KI8A 1M1ZA 1MWAA 3CPSA 4AV5A 3KEMA 1OA1A 4RD6A 4PZZA 3HI1B 5DW3A 3IO5A 2VSQA 1Z32X 3B3QA 1YH3A 4JM2D 3PIDA 5AENA 4PGGA 2IS6A 4KHTH 4DUGA 1QSFA 1CKEA 3ZU5A 2XCQA 5IWAB 1CUSA 3E3NA 1SXCA 4X94A 1M34B 3K81A 5LQDA 5TQ2H 3GSNA 2DH3A 3WLAA 1QFJA 1P7WA 1VLHA 4N6RA 3DPBB 5KQGA 4Z5RA 4PFSA 5JPMC 2VXQL 4A4DA 2ZAHA 2ZOLB 5DPMA 4F27A 2OQIA 1T91A 1SJHB 3DHNA 2D2OA 2JJTA 5EP3A 2EJWA 4G11A 2UXTA 4IU2B 4JI7B 2IXBA 5GHWL 5EQJB 1R5NA 4DTGL 1XROA 5FDWB 1TADA 5EZLA 1I9JH 3IU4H 3UAYA 4AY5A 3IUEA 1PSWA 4EG8A 2BEVA 1IYZA 4AURA 4LHEA 4ZVKA 3INYA 3WWYA 5JU6A 1HKUA 2E4VA 1X1AA 5HYEA 4ETYA 1BA2A 4OZIA 1NCAL 3HB0A 2GJKA 1NMSA 4D4LA 4QUDA 4LN1A 2XZOA 2DCUA 4PWKA 1OX5A 2D8AA 3JWNC 3SSNA 1FVFA 3QUYA 4ODXB 4GDFA 4XM2A 3G2OA 5B7QA 3ZTJH 3D4IA 3H0EA 1IEXA 3JR7A 4IIHA 3NJRA 5LLTA 4Z3DA 1UD8A 3E1KA 1KF9B 1PTJA 2OR3A 3V5KA 4ER3A 1H9CA 4LQ4A 3B2QA 4AMKH 1I9GA 4B6OA 3QWQB 1BPVA 3A0UA 1L3WA 4M8LA 1UPFA 4E32A 3L3IB 1N5MA 2PCPB 2UZIH 2X1OA 3Q8EA 4JODA 3THWB 3NJMA 3UC2A 4FTVB 2BIPA 2RCYA 3BZFA 1MBZA 1P9MC 1ZBQA 5IJ0A 4LMQI 1TJYA 1YZQA 2ZI5A 3NYIA 3U6RA 3C8KB 3I2JA 1FA4A 3E7XA 1NU6A 4JFSA 3TL5A 4FF9A 4JO2L 4CM9D 1EHAA 3M9XA 4CQMB 4OTXL 2FX3A 1WISA 4IBQA 3DCJA 4HNSA 4XI5D 4NSNA 1KRWA 3NA9H 2DSTA 1B1AA 2VF7A 1QFWM 1TTBA 3UAJD 2O8EB 1Z6ZA 2I8LA 5IMMB 1BPLB 3QENA 5JPCA 4P2RE 4MQEA 3WHXA 5KAQG 2P9BA 1K86A 1L5MA 1T0MA 4BFIB 2HK9A 5FTNA 3M0EA 1U2RA 2D7CA 3N04A 3BT2L 4DETA 5IZCC 1BD3A 1NWOA 4HJSA 4O9HH 1AGNA 3TFKD 2O5EA 1LDGA 1RVV1 2OP1A 1GKLA 4Z8YA 2C4KA 4BWTA 3RFTA 4ACAA 2FWSA 3U09A 3CFQA 5E2UL 2O1SA 4AICA 2EDCA 1Y0LB 4FLRA 2NV0A 2IQAA 1E2DA 1N3NA 1UZLA 3QYAA 3FGPA 2Z2XA 3V80A 4IOIB 5CVDA 4KGXA 5G4KB 1NVFA 4WAUA 5EZYA 5TE4H 2JI4A 2OENG 5CBAA 1EESA 2GJ6E 4L8CB 3FMGA 1J9EA 5AOKA 3LGAA 2Y7NA 1T5HX 4KI5E 3TF5A 4ZVRA 1YDEA 3ZZMA 1Z16A 5F3HB 4RTOA 2JFNA 3GS0A 3UBTA 1RXLA 3CHOA 2WVJA 1JHAA 5HHXL 3O4OB 2YC1A 1Z38A 5DJCB 5B38B 3NCXA 4XX0A 4GG6E 2VK2A 2A1TS 1HE5A 5IDVA 2W2QA 3A4TA 4CMAA 4F8YA 1ODIA 4R8RA 4XVJH 1PN3A 1U3CA 4OJNA 5JWHA 3DPDA 1DUSA 4PIPA 4FHEA 5HW0A 4KGDA 5DUPH 2B21A 4L75A 3M8KA 4LSRH 4OAPA 3PV6B 4RQQA 5KOHA 5ADVA 3OM0A 3AQXA 3IS1X 1L8LA 2ZSDA 2P5YA 2O72A 3THOA 2ZX9A 3E8XA 3C6KA 4WY5A 2VTDA 1GPLA 2UZ1B 2X8JB 3R7SA 2LABA 2P35A 1WPXA 4R2XA 2KI6A 4HDIA 3UM9A 3LTVA 3ESZA 3AVYA 4LEXL 2P77A 3UGTA 1C7TA 1G7IA 1VG1A 3RVVC 4HUJA 4QHLB 4WLCA 4ZK6A 3W4IA 1N2CA 3CKYA 2AZMA 1T5BA 1AD2A 3W2TA 1MHEB 3H85A 2WSSA 3A3OA 3KSZO 2PO6A 3DX8A 3KXFB 3H5TA 5K6AC 2G3MA 4CW7A 2NUTB 4K3DL 4MGHA 3LXBA 4B83A 3DAPA 3LPLA 2YZ7A 2D2CC 5AVYA 1W52X 3GHEH 3R7DA 4OBXA 5TQ0H 2PYZA 3GRUA 5F93C 3QIBC 1KVRA 4QJIA 4JVMA 3TV3L 1R3IL 2GXAA 2XXAA 5HZGA 2NXWA 4BKUA 4BFWA 1KF0A 4JGBA 1RZKC 2EICA 2C5BA 2VDPH 1F12A 2M1ZA 1VA4A 4M1TA 3WMSA 2CMDA 4KI1A 1YG9A 1SF5A 2GJ9A 1ZJBA 4PZLA 4AL8L 4GAYB 4RCZA 4K7PL 3H6HA 3FT2B 3KDAA 3UBGA 2DJUA 3AY3A 4JFXB 2AG1A 1JE6A 1YVRA 3GMIA 4M3JA 5JOEA 1BJ8A 5GGSA 1PU2A 3N2KA 2PLWA 5B1SA 2JLZA 1DBAH 1PTZA 1CBVL 4HLEA 1Z5LB 1DKLA 3P2DA 3NEPX 1I6KA 4IBZA 4QAWA 4GZ6A 4JR9H 2XXGA 4AGOA 5IAKA 2NQTA 2ICWJ 4EO9A 4H16A 4MLCA 1NI4A 3T2OA 1QFSA 5EIHA 5HJ7A 2PT9A 4KZ0A 3DUUA 3BWDD 2C97A 1UIRA 2QX8A 4OB5L 1UDCA 1GPH1 3GXIA 3QA3A 4Q9JA 3TEUA 2IT1A 2G40A 4EKGA 5F35A 4H1LG 5TRTA 4TQ8A 3NYKA 1DKNA 3GMNA 4O2CA 3LPDA 3KBOA 4UUPA 3GEMA 1VZGA 1MFCL 1PY9A 4NZTL 3O8QA 1PQUA 5A3SA 3UUGA 5AKZA 3BC1A 1CFZA 3T9CA 2GD6A 1GNVA 3VCLA 3OT1A 1Q9LB 3OTQA 5JYDA 1OY1A 4I1IA 1X87A 1EUCB 5AYVA 4YUVA 3AVPA 4HDNA 3NLLA 4K7JA 3DX2A 4NQEA 5SX5H 1F1BA 4JHXA 3X1GA 5IK3B 2Z91A 1B0PA 1VADA 4N0QA 1QCZA 4MVJA 1HORA 4K9EL 2EW8A 4LXXA 4XSHA 4C56B 5LLIC 2IANE 2ZUWA 1JNNH 5HBBA 3Q6IA 3QJFA 5HHVH 4TVPE 1GFIA 1OHHA 4PG8A 2OKMA 3QHZH 4PJCF 4AWAA 4RTNA 1M10A 2BGRA 3AHCA 3RIFF 3RD5A 2AFVA 2PT5A 3CFUA 1SYSA 5FX3A 1T0JB 1GNTA 2W2XA 2BS71 4Z6AT 2BZCA 2MINA 2NTSP 3JQ8A 3FONA 4ZOLB 1E1CB 2Y1CA 3OMLA 3OF6D 4WKZB 5C0DB 2FF7A 5A3QA 3SVLA 2MYPA 3BYYA 3N0AA 2CUHA 1YCSA 3RFZA 3K2IA 3M6FA 1I7LA 3WNOA 3FZQA 4JLAA 1J05B 4RFOH 4HRYA 1J00A 4F57L 3TBBA 4D0BA 4PJBB 3D4BA 1F7VA 4XCYB 1GXSA 1PX3A 4JFQA 4FYTA 3PCYA 5DHRA 4KVZA 1TAGA 1H23A 1NCDL 2O8NA 2CHWA 5KTNA 3WBKA 5J1AA 3GELA 3VO9A 3MNZA 2AMLA 5DRNA 3GBPA 5DR5H 4GRLB 3RIXA 4UUJB 4DHWA 1EWYA 3FF7A 3C98A 1EGVB 1GG2A 4ZFGH 2B78A 4U7DA 3BHNA 2V3VA 1L1QA 4AD8A 3PC8C 3WJ2A 3C45A 5AESA 2RAMA 5DSXA 2I33A 2G07A 2ZBGA 3MCYA 1X2BA 1DV2A 1KDTA 5IZ4A 2QQGA 1S2NA 3GDWA 3FUFA 3DTVB 3NIFE 2HYDA 3WLSA 3ZV3A 2X4TA 1JHZA 3UV3A 1X7XA 35C8L 4NHUB 4LSQH 3IXLA 4M7JL 4X7MA 4YPGB 1VL1A 2JJSA 2NY5H 4FG4A 5IC6A 4ND1A 2K6WA 5SZJA 4XPGL 5E94B 1TYBE 5ID0B 4QDUA 4DPKA 4HCGA 1Y98A 1NVKA 2WV3A 1IT9H 2WBWB 4XEUA 5IHUL 2Q4BA 3HI6L 1G3RA 1F3DJ 2QGFA 4AQ1C 4CRPA 1QF7A 4J2HA 2O4CA 3MRSA 6PAZA 2V7UA 4KITB 4NJAL 1T2XA 5AJTA 1SCNE 1NMAH 4C54A 1IUOA 1IMJA 4KMTL 3OBAA 2C42A 1I94B 3N40F 3PGMA 4RTLA 5AAMC 4ZUSB 4RKYA 1TAHA 1ULZA 1XLUA 4QXQA 5D7LD 2ZAMA 4P7GA 3BRCA 4YTEA 2NSDA 3I39X 5AJHA 4CM1A 3F6BX 3AREA 3VDMA 3CFKB 3EFFB 4X90A 5F2OA 1OAUH 3HAEA 3PWLB 2Q86B 4IIBA 4RMRA 1AS3A 2LUOA 3P3UA 1GMEA 4HO1X 4J1TC 1XQ6A 2ECQA 3GI8H 2LW3A 2YD4A 3H7IA 4CKVX 4TTDD 4E2YA 1EWQA 3RP1A 3NACH 1WT5C 4FX5A 3FB5B 2GKIA 1XA4A 2ZT6A 4PBSA 1ZGLB 4YALA 3ZBMA 5AW2A 3LHDA 2AV7A 4ZFZA 4L5FL 3T34A 2ZAYA 1W8OA 4DVBA 1JEQB 3C09C 3Q3CA 1IWOA 1GLGA 2FR4A 2V3DA 4OQTH 5EN2A 2NNXA 3T2NH 3P0YL 3AABA 5FUXA 5B4MD 1LCIA 2D2XA 1A6UH 1XFAA 3I2HA 2GJ8A 3RJDA 3T5GA 3CVUA 2OJZH 2Y1WA 3D0LA 3A6EA 2ZRBA 3KKMA 4H17A 4P5EA 4QY8B 4J7XA 1GNQA 2C83A 3GH1A 3GRKA 1JALA 2CMRH 3AR5A 4XB7A 3OHPA 5JARA 5CMLA 4DCTA 3N8KA 1C7IA 4NICA 4X8LA 3CZ5A 4YASA 5BN5A 5I8EB 5L6LB 1SA0A 2V6GA 5JCZA 1H6EA 1AU9A 2WTBA 1PJZA 1E2JA 4GZMA 2QZQA 1HNYA 4J3OD 4I4WA 4NKOB 1YJDH 2B8OT 3NH6A 2QT6A 3EJRA 3GKWL 2ZSVA 4QARA 5CJJA 5GRJH 5FPPA 2B82A 3A4LA 4AB1A 3RYCA 3ZE1F 1U2HA 3AVVA 4DFDA 3L2MA 3EC2A 4KV5E 1EWHA 1PWEA 3ADKA 4EYOA 4QLAA 1P4GA 4HDKA 1DEHA 3EPPA 1E40A 2PR4L 3QVGB 2PSFA 3RM3A 2P65A 1AVAA 4CF5A 5JAQA 1KB3A 1U2YA 4HU8A 1L7TH 2OXGA 3JQFA 4ZJYA 1C80A 1CCZA 4TL5A 2XA8L 3OJMB 2PE5A 3MWEA 4Q01A 4BLWA 2WXMA 2YBDA 5FYLH 1SD5A 4LUCA 2BVQA 2ARJB 4IDLA 5MEOA 3LYRA 4S0HA 2FMFA 2QGZA 1ZNXA 4G97A 3V0VA 3N7UA 2H5LA 1V96A 1OLZA 2ZI3A 2BC4B 3LYAA 4GO6B 4MMYB 2F3PA 2V0AA 3THML 3CRMA 5G0SA 4WUTA 3S35H 4MDIB 4UTZA 1ZH8A 4IKIA 3I64A 4BFRA 4HIJA 3FH7A 3UMCA 1BN6A 1VLJA 4CMEC 1N6UA 3EXFB 1R3JB 1K88A 3WEXB 4FS3A 2PTGA 4LZKA 1JG6A 5BT8A 1JXAA 1FPTH 1M34E 1SSLA 1RP1A 4HAXA 3N41B 3G5LA 1RTKA 4GSRA 2BBTA 2HRQA 3NAGA 5JSYA 1GGTA 3ZOZA 4L8SB 3VC7A 1QEWB 5BW8A 4GSUA 4JQIL 1P6QA 4WIAA 5EZOH 4IBSA 3T1NA 3WGUA 1AQUA 4BV8A 4AQEB 5BORA 1MX9A 4UPDA 5THQA 1UZGA 4I4TA 3SJVE 3TD2A 5DHDA 4LI3X 2ANCA 2GPTA 2B0SH 3O11A 5IB2A 4KNYA 2ON6A 4NK5A 1EFVA 2OO3A 2CBMA 5DUJA 3VNVA 4XAKE 3H9SA 3UV6A 1R18A 1N36B 1KBWA 2DKMA 3JTMA 1PJRA 2VAAB 5JWRA 4TUJB 3HN8A 1OUMA 4FS0A 3MUGA 4LOUC 4PNHA 1UFUA 3IB3A 1BCSB 4PJXF 1HYSC 2VDNL 2FXVA 4RJKA 4RZIA 1BZ7A 1OTXA 1N19A 2D3JA 4Y2DC 1GJUA 3H9ZA 3CIQA 3U7JA 3A9SA 2CNWD 1NCWL 3K2EA 3CHPA 3VYWA 1HAWA 1HDZA 3CVYA 1JBKA 2PR9A 1X7WB 1BDYA 3S37L 5BMFH 5IIEB 3KPRB 3DZGA 1N8SA 4YHBA 3FWNA 2VLBA 4HX5A 5EJ4A 4P2QD 5C0CE 3U3JA 5GAJA 4WKGA 3BK2A 3GSUA 1JDZA 2V7NB 3OO1A 2WWIA 1XMSA 2IH1B 1T0PA 1E3EA 2O3RA 2XQKA 4NAVA 1U28C 4PJ7A 3AKEA 1DX6A 2BRUA 3RQIA 3AF4A 1U33A 5IHWA 1N1DA 3Q13A 3GPSA 1Y6NR 3NHYA 5BN3B 2R7MA 4JQVC 1D1QA 4MH0R 1MW2A 1PZBA 1GWNA 1J87A 1NULA 5SYAA 3KQLA 4F3FA 1ZT1B 3MV7A 1SN2A 2VL7A 4G8EA 4UQBA 1XEXB 5F9FA 1JLRA 3VM5A 5I15L 2CHFA 2ZI7A 3HA2A 3NBXX 1FVXA 2C3PA 4RA9B 2ZCVA 3IJ5A 1GAJA 3AQIA 4K1XA 3HMXH 1VE9A 1DEDA 3EHBB 2F19H 5T5FA 4HS8H 2FJHA 4KO1S 1RZFL 4K7FA 2VP2A 1PVDA 1UAGA 2AJCA 3NJIA 1VBKA 4OF6A 2PX2A 4DJFC 3EYSL 1L7PA 2QN2A 2YHIA 5JDJA 1JPFB 3DPBA 3H4IA 4J7UA 3KD2A 4KGVA 4RESB 2DKUA 3FLAA 3V4PA 4Q9IA 3QCVL 1G21B 1JCVA 1IPEA 4IU2A 4D02A 4MHTA 3V6MA 1FQOA 4P5RA 1AS6A 4XN1A 4BNWA 4KW7A 3OKNA 3Q2VA 2XTMA 4FQXC 2VAPA 4Q9HA 3I5YA 2C9AA 5FUYA 1JAHA 1ODAA 3QH4A 1XGUB 2BO0A 3F7YA 3WJJA 3B8EA 1ORRA 3RS9A 4YQXH 4HAOA 4ZJUA 4PLFA 1VCOA 3CWQA 5KSZA 1KXQA 4L4VA 4IUCS 2RB8A 2XJ9A 3FRPB 4IKLA 1UPUA 4ZEMA 3OTGA 2M1XA 5JD5A 5CB4A 3ZGVA 3K0SA 4XWOA 2LOEA 3MLSH 4US2R 4ODXA 3GMTA 2HF8A 3APMA 2DFLA 3MD0A 1YS7A 1UOPA 3C3WA 1RERA 4G0MA 5HHPB 1BXAA 2NQDA 3IR5A 3RRFA 2VN7A 5B7MA 2X88A 3DB2A 2V5AA 3L3IA 2QMHA 1DDIA 1JMVA 4LNHA 4MX7A 1QX3A 3WL4A 3Q85A 4EQ3A 4JEGB 3WNKA 4LKRA 3VXTA 5DSZA 3ANMA 3N07A 4FTVA 3NBMA 1F8YA 4BCDA 5HZHA 3OZTA 3H9BA 4QUGA 1JP7A 2EE6A 2AXJA 4N4AA 3MTDA 1U5BB 2NY6C 4B35A 4GM0A 3C8KA 5HVNA 2BK8A 4Y6OA 4N3BA 1CUCA 3KKNA 1ZKMA 4URWR 1A4KA 3HTLX 4CQMA 4S1QL 5JXAH 2C92A 2XIDA 3ZU3A 5F70A 2QORA 3SLGA 3SY6A 3EGCA 4JLWA 4NYMQ 2KHAA 5EE3A 1F86A 4D9EA 1HV8A 2O8EA 2XUPA 1FSPA 4U1HB 3JVVA 2V5UA 4KQEA 4UT6A 5GSRB 1USUA 5HYSB 1ML3A 1CEYA 2WQVA 1Z18A 4FNTA 4QUIA 4JM2C 4ECAA 5HFAA 3W9UA 1HQDA 2B2XH 3L1JA 2O6LA 3M3HA 3G68A 4C0JA 3QQDB 1BCRB 4LYEA 3L2NA 5M3BA 4FGWA 3ZGZA 2X0RA 3P9MB 1D7FA 4HHAB 2YIDA 4AKEA 5E0OA 4GPBA 5BVJA 2CO6B 5DFVD 1IMOA 1Y0LA 2IU3A 4MINA 4JFTA 3HYNA 1I3RB 4Z3JA 3RAFC 4HH9A 3BVUA 1QHHB 4RA3A 4QU5A 4IOIA 2GZAA 5G4KA 2CE6A 4NKDA 5K5YA 4JHBA 1QWNA 4L8CA 5ICSA 2GVZC 8AT1A 1EJ0A 2QMUA 4D9CA 4MZXA 3DSNB 4UTVA 5F3HA 3TNNB 1JIQA 2CVZA 1YDPB 4MA1B 2OR9L 3HUJF 1VB9A 5DJCA 5B38A 3E3MA 4E5XG 1KO4A 4UTBL 2V4MA 3FMVA 1B9KA 1S3KH 1Z4KA 5LNGA 3ABKB 1CYDA 3DE4X 3M1OA 4IXWA 4IVRA 1NQUA 4ITVA 3K7EA 3IR7A 3IDUA 5C5DA 4U49A 5E70A 3SDXE 3N3EA 2DQTL 2YUVA 1UBCA 5B1JA 2Q7YB 4QYTA 2ZB4A 2J9FB 3WIDA 3DECA 2QSCH 2J6IA 1OF1A 1QB8A 1Z8NA 3BUSA 1CE8A 4YK4B 1XD9A 4I0KA 3TTXA 5SY6A 5MHSD 1XZPA 5I0YA 1DZ3A 3C1TA 3TO4A 3P02A 5H0IA 1NP7A 1EJ2A 3WMRA 1P0FA 2GSIB 4C56E 2UZ1A 4RFEB 1DKRA 4MQXD 4P5MA 5DT1H 3OC6A 3DB1A 2PNFA 2HPTA 3SC3A 4BNFA 4G0QA 5E0QA 1AXEA 4B4WA 1XXHB 4QHLA 4UNPA 1CZUA 5A2BA 2AT1A 3MBEA 4EB6A 4Z76B 3SZRA 2IXQA 3R5KA 5HX7A 4XH2B 5HTSA 2WICA 2I5PO 3KXFA 2CMFA 2FYYB 5A3JA 2NUTA 4XI5C 5EL0A 2ZXGA 1E5TA 4EPWA 5E1GA 4HLUC 3UAJC 1WB5A 5JHDB 3P4YA 4O8ZA 1MW1A 1U7WA 4TUYB 5AQ1A 2PWEA 4A7TA 4AN4A 1Z74A 2UYLA 2PRJA 2CF5A 4WNQA 5C07E 1D7AA 2JAQA 4V0LA 1VKZA 3VMPA 1Q19A 4OW6A 1OB1B 1M7DB 1BXZA 3D4LA 2UZXB 5M5BA 1XTMA 4K05A 3IRZA 1UCBH 3WN6A 4YCCA 3A67H 3CFEA 4AIEA 3U7HB 4B41A 4OAOA 4H88H 1V7MH 3WJLA 3DMHA 3VYPA 5FYJD 5KVFE 5J6HB 1NBMA 3FT2A 1ODJA 2PQ6A 3CJRA 4HWOA 4JFXA 5DYOB 3WKCA 4I5DA 3ZW3A 4JHLA 2AN5A 3GO1L 1N78A 3TNMA 3MXWL 2A1UB 2DJSA 2X09A 3WFHB 3B2UD 2H1VA 3ZQWA 3PEUA 3AGPA 4B96A 1UB5B 5E99H 3MJ6A 4QSHA 4P34A 2MRYA 4FFYH 2SICE 4IHJA 4JR0A 2BEWB 4A66A 4YXWD 5IVXB 3S44A 2E4AA 1YR3A 1DC8A 4KJWD 4ZXBD 4AWBA 3NJKA 2CK3A 1F4XH 4QUHA 4MIEA 3ZWNA 5EPMA 3OECA 3BZ4B 4ZTEA 1Z39A 4Y2LA 4GE0A 5FWQA 4RWYL 5I6MA 2OZLB 3OAZK 3UGUA 2I4MA 3GLAA 4GP5B 3SM3A 3TUJC 5IF9A 1UFQA 3D3JA 2BFPA 2P6PA 2BGTA 1FVEB 2O5NA 2K7PA 1Q0XL 2QFPA 5TDNA 2L19A 5LP6B 4UOQA 4ID9A 1H8ED 3CN9A 1F56A 2G4GA 1KTRL 3GZNA 3NDJA 2C7VA 4A0QA 2UX7A 1S78D 3PNWB 2DKSA 5IK3A 1QGED 4RF5A 1Q14A 5GQSA 3Q01A 1JPJA 5KVQA 1R10A 2IYAA 2IH9A 5E08L 3EF0A 1Q3KA 3W1ZA 5HOQA 2E4ZA 2MYUA 1OIVA 3C74A 1T20B 1P61B 2Y3AA 1AAJA 4HGKC 2A0UA 4QNMA 4AQ8C 1NUQA 3BJIC 4Q7QA 3RTGA 1JXJA 3GEIA 1II8B 4FNMA 3Q8AA 2JEOA 3A9RA 4IJ6A 2CBTA 1EUTA 3N5KA 1O9VA 1P5ZB 1QOZA 4B43A 1OAXL 3UWDA 5M94B 4EHFA 4RM3A 1SXZA 4ZOLA 1BOOA 1E1CA 1H1LA 1FC1A 4WKZA 5C0DA 1T1GA 4FC6A 4RV4A 2O2JA 3EEBA 3MBWB 1XRPA 2A9VA 4PIBA 4Q03A 2ECOA 1A9YA 5DTQA 1O54A 2ZQ5A 4BE6A 2X0WA 5THKA 2ZE7A 3IETB 1J05A 1ZLVH 3PEWA 2K9FB 4PJBA 1RZJL 5K0ZA 1T1WB 4XCYA 1R9MA 4WW2F 1NCJA 1O0BA 5EIWA 3IFPB 2CXRA 4DIBA 5CIQA 1W36B 4E9LA 3LZ6A 1AO7A 4IM7A 1TQBC 3USES 4BNZA 1YDMA 4YQFA 2P6UA 1B0WA 3MRRA 2W9EL 4GRLA 2KS0A 1XVLA 4UUJA 4IKEA 4OZGE 4R0LB 1KIMA 4OIAA 2X9ZA 4LXYA 4JFPB 1IGYB 1FNSL 5FK9B 2AANA 3WOHA 3BUQA 2F62A 1YFLA 3Q5TA 4DKDC 4LNRA 4YRBA 1R6BX 2CLVA 4YDHB 1M71B 4OY9A 2XMCA 4I66A 3DTVA 3GGDA 3MTGA 1WH0A 3U9UA 5FQOA 1BAFL 4NHUA 4JJAA 1WDAA 4RD0A 2R8SL 2P4AB 4PLZA 3RY5A 1UJ3C 1ZTMA 5ICXB 4CM5A 5CIWA 1BG6A 1DCEA 2JANA 1RWXA 5SWQA 3FZGA 1Z2EA 1V47A 1NXXA 1Z28A 1R3HB 3IXMA 3MSXA 1TGVA 3NMEA 1AURA 5J12C 2RI6A 1JPNA 3B53X 3F7KA 1RJDA 1L9MA 2BR3A 1CGSL 3H2BA 1PVVA 3NHBA 4ZN6A 1LV8A 4GUOA 4HMPA 1UZ6F 1DVTA 2W0LA 1OBVA 4CIVA 2FCBA 1TQ8A 3KKKA 3CFKA 5MI0B 5FR3A 3PWLA 4FD0A 3QVUA 1SMOA 2Q86A 3CSBA 2XMDA 4KO2S 2CFTA 3VXMB 2FP3A 3FQNA 4EL5A 3HRHA 4TKVA 1FE8H 1LWHA 1OGIA 2PCJA 1NW4A 2WEKA 4URTB 1E5YA 4CKWB 1L5QA 3RY6C 1R3LB 1NAIA 3IILA 1NDMB 1FFCA 3FB5A 1WWAX 4G1FA 1WLSA 2J32A 5FL7D 3DEYX 4EMTA 1ZGLA 1OWNA 3RC1A 4DB4A 5C0GB 2BTQB 4ONEA 1QI4A 5TY0A 1HURA 3VR1A 3OEHD 4DT2A 4N65A 3TT3H 5I66A 1XCOA 1SXSA 2J8UB 3LMJH 1CRQA 1Q44A 1PF3A 5F9WC 3OIYA 4K5MA 3H11A 2CLRB 3CUWA 4QOKB 3KKZA 1T13A 3PHGA 5EIIB 1L4BA 3S81A 4DGIH 5FT9A 1MJUH 2C04A 3CIFA 3KZXA 3DVGB 4N5LA 1AY1H 2A1WL 2RHWA 3HFRA 1J2RA 1LO0L 4X8OA 1YJQA 2L7QA 1X5JA 4BYGA 5FF9A 5C37A 2ITFA 4QY8A 4ZJZA 4LG1A 5KYUA 1WXFA 4X7CC 3V2UA 4JRXB 3RAJA 5D5QA 4FNAA 4LRIC 4AG4L 2QVBA 1IAIH 4NZOA 4E31A 4W8HA 2K4MA 4FR5A 1OA0A 3PCRB 1RAIA 1A9QA 4LHUB 4X1OA 4D4GA 4P9HH 3GMLA 3DVLA 1XB8A 3V8PA 4NKOA 1N68A 4JG0L 2O0KA 1YQ2A 3ETJA 1AC0A 1EE2A 5H5JA 1FO0B 1KJ2L 4DZ8B 1KZQA 3GZPA 4R3NA 4G23A 4LC0A 5FFOA 2YYZA 1F2QA 4IDFA 5JNVA 2ONKA 5JQGB 3HVUA 1MQ9A 3QBTB 3GMMA 4RTSA 3QVGA 3KPRE 2YWYA 5H70A 2EILB 3DARA 3HJHA 3NIDE 2WV9A 3U80A 4LSDA 3K9HA 5KBDA 4IHOB 5GS1B 1GW0A 1T1RA 5J4KA 5FW7A 1HEHC 1DEAA 1M5TA 3OFND 2F3QA 3P0HA 5A2IH 1RU3A 3QXGA 2B1JA 4YHLH 3TSOA 3VFOB 3N8DA 2C4FT 4MMYA 3VGGA 5HY9B 3FT3B 3UPDA 4MDIA 3DEZA 3N06B 4BKPA 3DJFA 5F1SA 4B4UA 4B4KA 4E09A 1OQAA 2E7LA 2VJBA 3AJ8A 5JMPA 4EKJA 2ZYUX 3DF7A 1T3HA 1NBVH 4CKCB 3EXFA 1HXYA 2AK2A 1R3JA 3LFTA 4PJFF 2PP7A 4M9RA 3WEXA 4TTDC 1LX6A 2P9GA 4JLDA 1O9GA 4ZK8A 3DVAB 3EPLA 5K09A 3TS1A 3RS2A 4LCVA 4RLFA 2I26N 5J4MA 1Z4LA 4JJ7A 3GP5A 4L8SA 1RHFA 1T1YB 5FKPB 2O0MA 1V3VA 1QSED 3MJ8B 4YDZA 1KPUB 3NFSL 5DCLA 2VTVA 2RGXA 1NOAA 4A1OA 4KOCA 1G21E 4M0LA 3FFCB 1E3IA 4JXJA 2J7PA 5AJYA 1EVZA 4OKVA 1OP5H 2WKGA 1TIUA 2REBA 5B4MC 2PT6A 3CLFH 2X4NA 2OMEA 1AKMA 1K92A 2HIHA 5CCKH 3GGJA 1KGYE 2BGGA 3KL2A 2DAPA 4UTRA 2Z0BA 3BUYB 1XG5A 3Q3IA 1VESA 2HFKA 2Z57A 3BXHA 3GAAA 4WK2B 4F9TA 2VAAA 2F61A 3WFEH 3QKUA 4BN5A 3BKJL 4ANXA 2OL4A 2C1OB 5ECYA 4J3OC 5I19H 2WY3B 5DQDH 5JAHA 4BMNA 2QRLA 1BCSA 4EDXB 1SVCP 3SQOH 4Y6RA 1KDIA 2IY8A 3HCDA 3BAYA 5I24A 3DO7B 1KDRA 3BUDA 3OAZH 3MW8A 2QQKL 4A8JB 3L16A 1P39A 5JOPE 3EX7C 4WASA 2G5GX 2J0QA 1X7WA 4KO7A 3IFLL 4WLVA 1CR4A 1TTFA 4NBWA 1CF9A 1U7UA 5DX0A 3BBLA 5JY1A 9CGTA 2PVPA 3NTRA 4FYWA 4F04A 4X54A 1YC5A 3LT4A 3H1PA 4HAIA 3V4FA 3EPRA 2VC2L 12E8H 4BFVA 1PG7W 1OILA 2I5YH 15C8L 3CVHL 2ZJ2A 2XVLA 4P3XA 4WLFA 5C5EA 5JHMA 5IP4A 1E89A 5K59F 5LC1A 1G6VK 4NQXB 1CS4C 2WMDA 3PXDA 2ZIWB 4NRXB 5C97A 3DOEA 2J4DA 1KFKB 4OU4A 5LAXB 1JAIA 2QP4A 2CW5A 5K99A 1ZPLA 3A1UA 3O9VA 4B47A 4D9FA 4MB0A 1IXYA 1ZT1A 5EEXA 1F60A 2JVUA 2PETA 1KENL 4QEKA 5EU6A 3LSOB 5DMGC 2PZFA 2VUOA 1MWAB 4HXAL 3O1IC 3EYWA 1NOLA 3C08L 3SIXA 1Z2OX 2DHDA 3RX7A 3IBSA 4ZGBA 3QPWA 4M0UA 3I8SA 5A7FA 2FEEI 5F88B 2JWHA 1TQUA 2EDHA 5L0QC 3UBXG 3IDYB 1IJEA 5IEBA 2Q1UA 1E6EA 1JPFA 3OJOA 5DZ9A 3HG5A 3GSNB 3S36L 1XQWA 2ATPA 3I9V1 2CO1A 2F1EA 1QU3A 3RKRA 4N6RB 4PI2A 1J8QA 1SXJE 4JPWL 3OEEA 4AGQA 2QRVB 2R2GA 4G36A 4GAEA 4Z5RB 2HH9A 1IJ9A 2VJ0A 4F3NA 2BSBA 1I3KA 1O6BA 3NHZA 1RZGA 3C5ZD 3JVGC 4P05A 1XGKA 4WW1A 4N5ED 1Z3RA 2D7PA 2Y9RT 3IT0A 5KOMC 2WPDA 2RBGA 3OX8B 2OCLA 3OQIA 5EZLB 4F9PA 3LKVA 1HZZA 4E9QA 1XGUA 2XIBA 3AU1B 2H4HA 5JA8B 2BEVB 2KI5A 2NPOA 1HFUA 4FFZA 1T3GA 2C9OA 2H06A 4EM6A 2E85A 3QIUA 1PBTA 1WUIS 3FOCA 3NJLA 3FE2A 4Q3EA 3MR9B 4B8WA 4OZIB 4KHXH 3FRPA 5AWNH 2OQVA 4DLYA 1N6KA 3ZE2F 3LZFL 2CPCA 1PV1A 2QP9X 1EG7A 3VOBA 4CMHA 2BZGA 3GUZA 4NWTL 4UNQA 2DQJH 1BG1A 3VTZA 2ITEA 5LLSA 1ZE3C 3TUIC 2GDJA 4Y1SA 3ZIDA 3QUYB 3ZBQA 1GQQA 1H3NA 2DFVA 4M37A 3GSQA 5F0PB 2EFDB 2ZXEA 2ERXA 1J1UA 2OTPA 1K85A 1U0OC 4IJWA 4HPYL 4KHPB 2VQ6A 3O6FD 2PAFA 3V5KB 2ATXA 4PJ9B 3LT5A 2JKJA 1KWGA 2NV6A 3OZGA 3LPAA 3KCQA 5B3NA 1JDNA 2CL7X 4EJ2A 3NAAL 5DBEX 3VNRA 3RTLA 1QP1A 1SU6A 4KZDH 3DBLB 2Q9UA 2XZQL 1XTPA 3NTUA 2WKSA 2TRSB 4GKVA 3BZFB 5IJ0B 1E3FA 3EVFA 4DBLE 5AVXA 1TF5A 2DPHA 3WLMA 4N7RA 4LQLA 3WMWA 1PZDA 2XWDA 1E6CA 1W85A 2WFMA 3H42L 5IAJA 1Q0TA 4WBNF 4RXUA 3V0EA 2WF8A 2Q3MA 3O3NB 2YC4C 3FCAA 4RRPG 4W6ZA 1JEOA 4DYVA 1CW2B 1XP8A 2ESVB 5D71H 1UPXA 1XR9A 3S68A 3FYEB 5J5EA 5IBRA 2FFAA 4WHMA 2CDCA 2XQVA 2P26A 3GBSA 4LPSA 4GS7B 5GSRA 3RYIA 5HYSA 4WUKL 4GG1A 4G85A 4FQ2L 5IYZF 2A5DA 1C9EA 5JG7A 1KY5A 1MAAA 1E3ZA 4MQEB 4N28A 3FJYA 4Q7DA 2HOQA 1XMXA 1OF0A 4PJEA 4ND5A 4YL9A 1T36B 3BMOA 4DHLA 3D3VE 3P9MA 2B1OA 3WLIA 1E1LA 3E05A 3BS4A 4FHJA 3DZKA 4LOJA 2FW8A 1GKKA 1I3RA 2I7TA 1YEEL 1P73A 4B9PA 3FH8A 2DQGL 3NALA 5JCOA 1XU4A 1NVMB 1JYFA 3EH4B 4CHGA 4AM0B 3QEHA 1YE5A 4CV3A 1CULC 3GXUB 1JW9B 5CBAB 1LLFA 3KE8A 1CG9A 3TNNA 3LRMA 1KP3A 3GAFA 1HE4A 5IVXE 1STOA 2WO3B 3VD1A 3DUFB 5JRZA 1TNDA 4XMLL 2FQQA 4MV7A 4FERA 3M33A 3O4VA 5BW5A 2WE7A 4P5TD 1PAZA 3HXLA 4LXTA 3KUCA 1VJCA 5CBPB 2F6RA 3GXOA 1JFHA 1CQJA 1Z0IA 3D1VA 5EESA 2IVZA 5H9WA 2VOJA 4ELDA 1H22A 1DQPA 4KAJA 4MZ2A 3PKJA 3OWOA 4ZMOA 3D8SA 4X1YA 1RZVA 4HB3A 1ZESA 2VJCA 2FX2A 1S2LA 2EP7A 4X7SH 3AXIA 1QE3A 1NM5A 2PXHA 4RQQB 5KOHB 1P74A 4UTAH 3DJZA 5CDYA 4IIYA 4J3NA 1ZD1A 1AOHA 3MOGA 5BS0A 4F8OA 1OFIA 3A58B 4RFEA 3HPJA 4Z0HO 4AUJA 3MXVL 1SPDA 1KG0A 5DURB 4IWXA 1VIYA 3LVQE 2IP2A 3F8SA 3KLMX 1PS9A 2QMKA 3BAIA 4HMCA 1U7DA 4J3SA 2J55A 3DVSX 4OFKA 3T41A 5AXDA 1H6AA 4NG5A 1O1YA 4HDIB 3HL0A 3VYUB 1RJYA 1G7IB 4F2FA 3AF3A 4BV2A 3IT1A 2OXEA 5IVZB 2EXSA 4XH2A 1N2CB 3NUKA 4JPIB 3ABOB 1YL5A 4OCLC 3G08B 3LVRE 3HBGA 3DX8B 4F1JA 3VACA 1HOXA 4GUDA 2JD2A 5CT5A 2VRWA 5JHDA 4TUYA 1ZGLP 1EFUA 2DM4A 3VPSA 4LKXB 5AVYB 3KS0J 1Z4JA 3LV3B 1I75A 2ZYTX 1C5BH 5DE3A 2UZXA 2EUXA 2ZRDA 2YJ4A 3EXJA 2XXAB 4E0RA 4OLBA 2PKQO 2RGGA 2W6ID 5SX4I 4M9CA 1E9QB 4GBMA 2BP8B 4ZDWA 3VPBA 2V7PA 4ZRNA 3NO4A 5DFVC 2YQGA 3PNPA 3ASOB 2O5VA 1PKEA 3HS0B 2X4PA 4NOJA 1HZKA 3C3KA 5GGSB 2K2QB 3EY9A 2A1UA 2LXNA 1EUDA 3WFHA 3NDIA 4YBRA 1X7GA 3ET5A 1OAOA 3DV6A 5EU5A 2YRXA 4POOA 3UFIA 2VCEA 4Z1OA 1AI1H 9ABPA 3WKNA 4RA0C 1WPQA 4K1LA 4QU9A 2KLSA 5K5EA 3IMRA 3CN3A 3PL6A 4AT1A 3A04A 2Q3XA 4LFHD 4H2CA 3NRCA 2RK3A 4XPTL 4RTQA 2UXGA 3EN0A 1PU0A 1PG7X 1PZNA 3K4PA 3BZ4A 4IY1A 4CJ0A 1XCWA 4BH8A 1Z68A 3FFOA 4H4NA 3RVOA 2WNGA 4FHGA 5HHOE 4NBKA 3NHWA 2OZLA 4FGUA 4RZUA 3TRIA 3GMNB 4O2CB 5CD1A 1DSFL 4PW9A 3D59A 1FVEA 2NMSA 5FPYA 1NGQL 1ACXA 3BDBA 2VPPA 1XP5A 4G1UC 3GVCA 3O8QB 2NADA 1TMQA 2QTCA 1BM3H 2WHPA 3LEYL 3OT1B 3PNWA 2R6DA 5I73B 2GRJA 2AFHE 4P54A 4DADA 3TAHA 2DBJA 3M9LA 1KGUA 4PSVA 1J8SA 5AQ0A 4EATA 4J23A 4U7TB 4A2LA 1MU0A 4WSJA 1FNBA 1OZAA 5B58C 3VXME 1CRPA 3DDSA 4MQXC 2O59A 4M4RA 3FHOA 5I51A 3SGDH 3UYRL 3RRQA 3CUVA 4HX2A 2B16A 2I4NA 1SQGA 2BE7A 1UDRA 1G7PB 3C5JA 2OV4A 2CUKA 3OLYA 3ZCRA 5KUMA 4ZTUB 1SRRA 1SYSB 2PD6A 1DCTA 2I6GA 2XOKD 3MBWA 3ULUF 4URYR 3L4XA 3JQ8B 2E27H 1XH1A 3FONB 1K0FA 3TVTA 4ERXA 2J8UE 3CB4A 2D2EA 4W1SA 2EC5A 4YXHH 3RFZB 3RJ9A 3TG8A 1GDTA 2FOXA 4NPKA 3V1UA 3PGJA 1ZJ4A 4MYWB 4BVGA 1SD1A 3EIFA 1B3RA 1UF9A 2Z65C 1COWD 4M02A 5MP6H 5BRNA 4D0BB 2OZ4A 4DNFA 3EVBA 4JFQB 3JQ9A 2Q0QA 3BTUA 4FMDB 1OWPA 1WSBA 3CZPA 4CIDA 3CFCL 5BT9A 4EW6A 4TNEA 2WUCL 3FFBA 4XXWA 3MNZB 4R0LA 1W59A 2WV7A 4JRXE 4XB8A 3FETA 5DRNB 5FV7A 4LAQL 2M6SA 4ARUA 3SBDA 3KK0A 5L3VA 4JFPA 4OGFA 1IGYA 1NVTA 5BV0A 2VYRE 1GILA 1P77A 3T8VA 2UVDA 1K8YB 1SVZA 5GRVK 2AQQA 3IQXA 3B2UC 5D1QD 4N25A 2EDNA 4CSTA 4P59L 2HREA 2PO7A 5KWSA 3U9TA 4KPYA 2QN7A 1M71A 3UMVA 3G9QA 4N5MA 1V37A 1T5WB 5BMVB 2AKAB 4OJFH 2IWEA 3BE6A 5CCDA 5JW3H 1TCRB 5DBHX 5AVTA 2UUOA 4C8XA 4KJWC 4ZXBC 2JIPA 3W8EA 3QJRB 3RF6A 1X7XB 5F7DB 3C75A 2NSYA 2V55B 1MAML 3KVYA 1X1CA 3N6RA 1I13A 4K28A 4C3VA 2AQRA 5JQIB 1R3HA 2G9VA 5J5AA 1ML4A 3DNMA 3OHSX 2PGNA 2QJFA 5L88L 3CU7A 5DNUA 1GSOA 2IDJA 2BOLA 1SEBA 3UJIH 4HH4A 2PWFA 1ZGLM 4DR3B 3BF7A 1EJOH 4JI0B 3MUHL 4PVNA 3UG5A 4HAVA 1B0UA 1S78C 1BEXA 3ONWA 3HC0A 4B31A 2VLRA 5AXCA 3ZQXA 2X0JA 4GWKA 2XUZA 1Q72H 4MV6A 5KQSA 1UFRA 5E5UB 5FM8A 3UBHA 3IUJA 4WV3A 3HAEB 1TA9A 2WFZA 3CZCA 5ACZA 3QG5A 5BUQA 3L0IB 5K8VA 3RIFK 5LVEA 1SYVA 2EQBA 4IDGA 3AR4A 3PAYA 4X6CA 4UV4H 2EUZA 1WCIA 7ABPA 2EDXA 3DWGA 1WZMA 4CKWA 1IL1B 1R3LA 2OSYA 4BX2A 2FUG1 4MPRA 3T6KA 1NDMA 1PR3A 4XWTA 3EDCA 3HC3H 3OD5A 1JDCA 4RGBA 3SBWC 4PYHA 1YSCA 4AMWA 4UB0H 5C0GA 4N8DA 3AP3A 3PDUA 3KOZA 2AV7B 4ZFZB 5KEIA 3T35A 3N42B 3JYNA 1BYPA 2TS1A 3W8NA 2EX4A 4DVBB 5KVGH 2VR1A 2C9CA 3PDWA 1X9HA 2CLRA 4UTPA 2HWKA 4GYBA 4QOKA 3FFCE 3V4SA 1L7NA 1K5WA 5EIIA 1WICA 2QT0A 4ZP1A 2RKWA 3TUZC 4HUTA 2AK3A 4N20A 5K9OA 3QKTA 1XTZA 2QRPA 2DG2A 3NCYS 4F56A 4XMWA 3D0LB 1D03A 5HYFA 1IY8A 2YRPA 3I6ZA 4CTKA 4TV8F 3GBMH 3EGDA 2I67A 1D07A 4LHUA 4ZX3A 3FQ1A 1CP3A 4OEHA 3IV7A 3WNIA 5KINB 4EN3D 3P54A 2CYAA 4H5SB 3WNMA 4NPAA 5B6PA 4YV2A 4DJMA 3M89A 2DEXX 1TM2A 1FO0A 3JYOA 4DZ8A 1XLWA 2GAFA 3T3EA 4C07A 2ZSVB 4M5ZL 3R4RA 1T9AA 4ZMSA 2J7LA 1XWWA 2JJUA 3MCG1 3WTTA 4MD0A 4V2UA 4ECEA 4FI8A 1U7TA 2D00A 2X8BA 5DT2A 3QBTA 1EO7A 3F1KA 3LBIA 3MNMA 4TRRA 5CDFE 2WG2A 3H1GA 4HDKB 4YAKA 2EKSB 4J94A 3HYTA 2ZI4A 4H6VA 2NY0B 2J88L 4IHOA 1EX7A 4OFQA 1GPBA 1N2HA 1WW3A 2DLEA 4D92A 2OXGB 3MFFB 1HYHA 4HMOA 4MW7A 1BFDA 3O8XB 2J5QA 1H8OA 3T06B 3ZHQA 5C1DA 3ILEA 4DP2X 4EQ6A 1EHLL 1Q77A 3TDMA 4OQEA 2QQEA 4PJAF 4JYAB 1YPZF 2BVQB 3CFTA 1MV8A 5A9RA 4PM4A 5L4NA 2DLIA 5HY9A 2OMKA 2P3LA 3O81A 5LBTA 1HT3A 2AC4A 5ITSA 4LZJA 4F8PA 1HK7A 1HNNA 1AK2A 4QXPA 3LNEA 1SEPA 2F43A 3QH3A 1G6RA 3V5DB 3KJGA 1FBIL 4HIJB 3NCWA 4RMWA 3QOYA 3QPVA 1NG1A 3H1BA 2DI7A 2QKSA 2AUMA 4M87A 4GPD1 1QSFE 5AVSA 4JDTH 3KKQA 1T5XB 4JC8A 3ZJAA 4R1QA 2J1ZA 2GBFA 5JJ5A 1C7FA 4PC1A 5H83A 2ATIA 1Z6XA 3MN8A 4YNYB 4LPUA 3KXLA 3B51X 1FXWF 1KPUA 3UTZA 3LY7A 4FNQA 5BJTA 1XEFA 2P2NA 1PJ9A 3RE0A 2YR0A 2NSHA 4M1ZA 3JYHA 2C5DC 5SWSD 2DMRA 5BSKA 4X9BA 2DWOA 2VLIA 1JQBA 4AT6A 4H3KB 4FQXD 5AKSA 4MBRA 5I6XB 6TAAA 3O11B 5IB2B 2OA0A 4FNLH 4YIKA 4Y8AA 2EABA 3X1XA 4E4TA 1CGWA 5F7XA 1EFVB 4Y6SA 2R7NA 1LILA 3IFOB 2GUOA 4OZIE 1NXQA 3G13A 4DOHB 2G17A 3F6SA 4N3GA 2ADFA 4JBNA 5ECDA 3ETEA 3HDVA 3HYLA 1SN7A 3MUGB 4EDXA 3UBFA 1HT2E 3FQ2A 3Q7IA