2VC2B

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist l-739758
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
461
structure length
457
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 126
structure length 457
sequence length 461
ec nomenclature
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vc2B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vc2B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vc2B03
3BQNB 1JEQA 1AOXA 5KYWA 3AL8A 1N9ZA 2P26A 1IJBA 3E2MA 3AFCA 1M1XA 1M2VA 3VI4B 3OKWA 3HXQA 3FCSA 1OAKA 5ES4B 1FE8A 3EGDA 4BJ3A 4UM9D 1V7PC 4DMUB 2I91A 1IDN1 3K6SA 4NEHB 3OL2A 3N2NA 5E6SA 1QC5A 1RTKA 3EG9B 2VDQB 4HQOA 1M2VB 4HQNA 1MF7A 4FX5A 4MMYB 1OLZA 3NVQA 2ICAA 2XWJI 4G1MA 1JEQB 1UEXC 1DGQA 3ZDXB 3QA3E 1XDDA 1QC5B 3ZQKA 2I6SA 2VDLB 3PPXA 4C2BA 3HXOA 2O7NA 3M6FA 4HQKA 3K71A 2IUEA 2M32A 4WK4B 3FCUB 3EGDB 4NENA 3EOAI 3TCXB 2ODPA 3GXBA 1XDGA 4IXDA 3V4VB 1FNSA 4CNBA 5KYXA 1M1UA 1T0PA 3ZE1B 1YUKA 1U0OC 1L5GA 3EGXB 5E6UA 1BHO1 3PPVA 1MJNA 4G1EB 4CN9A 5KYUA 4WK2B 4HQFA 5HGJA 4G1MB 1JEYA 1LFAA 1YVPA 4O02A 4C2AA 3Q3GE 1PCXA 1MQ9A 2VDMB 3K72B 4JDUA 3EFOA 3TVYA 3AL8B 3PPWA 1CQPA 2NUPA 3BQMB 3F78A 3PPYA 2VDPB 3K71B 1IDOA 1PD0A 4IHKA 4F1JA 1M1XB 1QCYA 2UZYB 4Z7NB 1N3YA 3BN3A 5KYXB 4PN7A 5KYYB 1DZIA 1T6BY 1ZOOA 1M10A 2VDRB 1XUOA 1TYEB 4NENB 3ZDYB 4K3JB 1SSLA 1JLMA 3IJEA 2VDOB 1RD4A 4MMYA 4WJKB 1SQ0A 4WK0B 1U0NA 4XW2A 3EH2A 1ATZA 3EG9A 4HQLA 3NIFB 4JX0A 4O3TB 1M2OA 1PT6A 4MMXB 4MMZA 3V4PB 1RS0A 3ZDZB 1JEYB 1Q0PA 1IJKA 1AO3A 3RAGA 2NUPB 2VDKB 1U8CB 4UM8B 2P28A 4A0QA 2WINI 4O3UB 3K72A 5E6RB 4WFQA 3AL9A 3IBSA 1SHTX 1SHYB 4MMZB 1PD1A 3NIGB 3F74A 3TXAA 3HI6A 5BV8A 5KYYA 1MHPA 5E6RA 5KYUB 2WW8A 4UM9B 3T3MB 2ADFA 1U8CA 4FWWA 3EH1A 4O02B 2X5NA 4CN8A 3K6SB 4IGIA 4M76B 5KYWB 3ZE2B 2VDNB 2VC2B 1JV2B 2NUTB 2XWBF 3EOBI 2I6QA 3IJEB 1ZOPA 5E6SB 1ZONA 1RRKA 1AUQA 2NVOA 3ZE0B 3NIDB 1L5GB 4Z7QB 1MQAA 5LN1A 1BHQ1 4GZ8A 1JV2A 2B2XA 2QTVA 2NUTA 1NA5A 4F1KA 5KYNA 3VI3B 5E6UB 3EGXA 5HJ2A 4C29A 1SHUX 4MMXA 5HDBB 4Z7OB 4G1EA 3OL2B 2ODQA 2XGGA 1CK4A 1MQ8B 3EFOB 3FCSB 1YVRA 3T3PB 3OKYB 3TW0A
chains in the Genus database with same CATH superfamily
3ZWMA 1M2EA 4M3HA 4BNXA 1O7JA 2CVPA 2X6TA 1KCRL 5LP1A 4HIEB 2YRWA 3CLKA 4NVRA 1Y6JA 4HMPA 3Q6NA 2Q49A 4AN1A 2AZMA 1FLDA 4YO0B 3KXFD 1X7QA 3KJZA 1JP7A 1SBHA 4OSEA 5ALBH 2Y4NA 2JVKA 5JVDB 4A7GA 1ZD3A 2QP4A 3QJGA 4P4TA 5CT6A 1JTTA 3GHBH 5TQ2L 5KBMA 2JLXA 3QWQB 4HLEA 2PT5A 1KI3A 1YJDH 3GEHA 2WOYA 3BILA 3LX9A 2HL6A 3M9WA 4RFSB 4HB3A 3TEWA 5FUMA 3ECSA 2RGEA 4WI6A 2V6JA 3CC8A 2WAOA 2CWRA 5IROA 1W9HA 4DARA 2X7LB 5AUPB 3BW9B 1EUYA 5KJEA 4PICA 2QQ0A 4EY8A 3TBYB 3HHSA 1YZQA 1VA9A 4R97B 1T9GR 2BF4A 5FYDA 4OQYA 2RMKA 4MCZA 2Y7MA 1F4PA 5BSVA 4DEYA 3MLBA 4RTLA 2IYFA 1B0RB 4OF3A 3KPPA 4EKJA 2YWXA 4Y98A 2BR4A 3QEQE 1VQ1A 3BAKA 1A1OB 1LXMA 3QKWA 3MW8A 5HHVH 1Q9KB 4GRLB 2BKLA 3O4VA 1OTSD 3ROLA 3SPXA 5EIIG 3GZNB 2XKSA 4WFEE 4BFRA 1CS0A 1JWMA 4L8GA 3T4EA 1E9QB 4B3VA 2C7VA 4YXKL 3QPAA 3S3PA 1FNNA 5B8CC 3U61B 4PBSA 2P5WA 1F0YA 5I1KL 1K6QH 3WE1A 2C2YA 1YUMA 3QIVA 3LPGA 4GXVL 3MLPA 2ARKA 3K6NA 1NGPH 2ST1A 2Y92A 4XM0A 2Q1WA 2Y1DA 3IEUA 4D45A 3MGGA 1OTUD 1PTKA 3D5QA 1CFJA 5MN6A 5D1ZB 3KBFA 1RKQA 4X5XA 3NC1C 1P2UA 1GIAA 1OLLA 4QJ3B 2CUKA 2BMWA 1E4HA 4UV7H 3FZGA 2VNJA 1F1GA 3P2MA 3DAYA 3K1YA 1IC4H 4NAHA 4BSWB 3GJEA 5KNCD 4GFDA 2F7SA 43C9A 2QVKA 3HM9A 1FTGA 4AWAA 2HT4C 3VHQA 5DTEA 3IDIB 4K9MA 3U7QB 3QA3B 3C85A 3BTVA 2X09A 4LYJA 4BA0A 3ESYA 1Z0FA 2BM1A 5AW9B 1TKRA 1OV4A 2WKOF 2WNGA 2RGGA 5BNWA 5I9SA 5JZVA 3A4IA 1BZQK 1V2HE 2V6HA 3ICPA 3W56A 1E6OL 3L2LA 3TBKA 2CO1A 1J6UA 4LPCA 3KLDA 2TMDA 4HNQA 5IG2A 4YHPA 3IMCA 1J0BA 1LPNA 2IU4A 4JFPB 4UUAA 4HNVA 1KJ8A 4RGBA 3RFZA 2V65A 4XB8A 2GN6A 4J6EA 4NU5A 5C0DB 2I27N 4JBWA 4O25A 4F7PA 2G17A 2WBXA 4F9EA 3QBDA 1FMLA 2PXYA 2YOHA 4XVTH 1RMYA 2QPSA 2QSUA 3UTZA 3WP1B 4RTNA 2ZUSA 1IBSA 3DAPA 1T83A 3ALWA 3ZHDA 3T6KA 4YPVA 5P21A 3T1HB 1W4ZA 3QPWA 3ZL4L 1S8DB 2B14A 5HPMB 4II2A 2VYNA 1CRPA 2WP0A 1T5TA 3H19A 3F7VA 2IBBA 2YSTA 3T1TA 4QOKD 4HEPA 2ODHA 5DCWA 5EZ5A 2KH2B 4ZFQA 3SQLA 4HF5L 1OGTB 3I6SA 2O0MA 1ZPDA 1OWOA 4HADA 3BZEA 3EIWA 3OIWA 4YGVA 4X6YA 1RP8A 4R3SB 1AMXA 1LEGA 4DANA 4XJTA 1V7CA 3I9KA 2NU7A 3DDGA 1EA7A 1H3PL 4HXAL 1U6KA 3L02A 3H4HA 2NU8A 1PO7A 4MYHA 2QSQA 4UT9H 5FXCH 4JD5A 1XF5B 1YQTA 2VT6A 2UYQA 2OMYB 4H25A 1EFXB 3G9VA 4ODTH 2R7EB 3I0ZA 4EQ3A 4LJSA 3RY6A 3Q2OA 3V1YA 4NPCA 3I02B 3UPUA 1ZKDA 4PJIB 1OBOA 1TJXA 4PJGB 5C9JA 3BEDA 4IEIA 4PQYA 2CHVA 1DUZA 2FOLA 4X00A 4XBGB 1GSOA 2I2FA 1YEGH 4TS6A 1UBJS 1ZFNA 5ANME 2VDJA 3KH4A 3D50A 1G21A 3QFSA 3MTEA 5EUKB 2O8EA 5ES4B 4L4YA 2YQZA 5F93C 3GTNA 4IWYA 1YI8A 4RVSA 1WS7A 3MSCA 3K0YA 2ARJQ 1CKEA 2Z57A 5T4BA 3C3BA 4X6UA 4NH0A 4J76A 4DM4A 1HE8B 1OFIA 5HFAA 3F12A 1M4KA 2FIKB 4J0EA 4WNAA 3PNWA 4L1SA 2Y07L 2FNWA 1XQ6A 5KW9H 3KKKA 1Q1AA 1AH1A 4RK7A 4D6XA 3MR9B 4AGMA 5J4YA 2LDXA 3RL2B 3AVWA 4I5IA 3HFMH 3DVNA 5FUCC 2ZSBA 3SZ6A 4JFEA 4JQZA 1DHKA 4DZBA 3PFBA 4HUWA 1Q3HA 4INPA 4N8SA 1G3IA 1VE5A 1QO3B 4IEFB 4XPTL 1PZSA 2GIYA 5FYLH 1QVVA 4GKNB 5I01A 2DRUA 2MTAA 1S9HA 3THYA 2QXTA 3GZ4A 3PWUA 3V48A 4G0YA 2F43B 2AEPH 1EIWA 1QA9B 3JZMA 4L4VE 1ACCA 4W81A 4YMHA 1QHFA 1GPDG 2AZ4A 5I1GL 1QCCA 3CVJA 5DN9A 3SIWA 1JHVA 4L8BB 1HH6A 2QG4A 5GZOA 4BNLA 2VMEA 4LSUH 5HQJA 1FS6A 1YS7A 5GGSY 2F8IA 4BEWA 5AKHA 1T3SA 2D1YA 4HLJA 5LDSA 3U7FB 1UM4L 4C05A 3GSVA 1XVIA 3TZVC 4EF5A 3VPFA 2V5VA 1W35A 2C9PA 3ZV7A 4LVHB 4LNAA 3U9TA 3TGPA 3C5SB 3W2HA 2JZNA 3MRGA 4MR9A 5IW8A 3RB5A 4AGNA 1XCMA 3RVTD 1GGIL 1NXVA 3MXVL 3N28A 4H3HB 2VIIA 2QMOA 2YV4A 3RZWA 3LNHA 4HUMB 4YSTA 1SC3A 3QIWD 3JWDL 4GL2A 5T5FH 3ZE7A 2DFTA 1I24A 1BQLL 1X86B 1X5XA 4KKPA 1OSZB 3TVMB 2I3ZA 1MLCB 3S3CB 3ID6C 3TVMC 4YXWD 2EYSB 5IVZB 4C2AA 4Y1AB 3N8NA 3I04M 4TZKA 5DRZA 5B38B 5K1VA 2XTLA 1J1XH 4M6OH 5F0PB 1LEKA 5FJJA 2LVCA 1VHDA 5JW6A 2W38A 1E0JA 2I6TA 1C4XA 1ZOOA 5K5YA 1XCLA 2A8YA 1P72A 1XAJA 4D0SA 4H0HB 4EI9A 4BLUA 1YB1A 2QRNA 3VGEA 4NGHH 4BQFA 4ZUSA 4ITUA 3OKEA 5A6LA 2XN9E 3WKBA 2YJLA 3A6ZA 4Q9RL 4PWEA 1E9EA 1ND5A 1P77A 3GDGA 1C08B 4HTFB 5HIMA 4W6WB 5JDSA 4D3DA 3F62A 4CKWB 2XWBF 1G4UR 1DQRA 4YFLF 2OYRA 4MYWB 1E4VA 1PAUA 2I55A 1AMUA 3UYRL 4PAOA 1UWFA 1RURL 1O9BA 2J0UA 1BM7A 1G55A 2QM0A 5GISL 3IMGA 1UOOA 3LHPH 1L9OA 1IXKA 3CPLB 1NQ5A 2IHUA 1UMDB 4WJLA 1BJ8A 4EDXB 1Z17A 1ONOA 2FJHB 2P8PA 1T4KA 3QO1A 2NQCA 2BY2A 2EYRB 5F0JB 2JLAA 2OL3A 4Y5YA 2VDRH 2BSXA 2HH9A 2ZTHA 3DM9B 5LQCA 3QS2A 4MIOA 3EFEA 2G4EA 4Y4HB 5HOQA 2BFOA 5C92A 3KVVA 4M6ML 1ZA1A 1KFEB 1NC2A 1A82A 3DXAE 3D8SA 3D4IA 1YF3A 3TNDA 3T04D 1L5QA 5LB2A 3L1EA 4WHYG 4X45A 3VQ1C 1VFNA 1QRTA 5CJQL 2POQX 1X7WB 4KY1L 3CPUA 2E5EA 4L4TE 4PRDA 3IMBA 4RZKA 3CJTA 5C07D 2GYSA 4LBEA 3RC9A 5IN4A 3CNNA 2QRKA 2D1SA 2O7RA 1A6TA 4ARUA 1BOGB 2XPYA 4Q4HB 3T3EA 4J0KA 2X86A 1IFHL 2WSSA 3RPEA 4PX5A 4JVSB 2Z92A 2QMQA 3PFQA 3NFYA 5JDIA 4OAOA 3MV8D 4P3YA 4NKMB 1IGYA 3JQAD 5ISZA 3T7SA 4FFYL 3VXSE 4PLWA 3BSZL 2CMFA 3DXAA 5AKGA 3BRFA 4E31A 4U9IS 3GEDA 4F2WA 4L3OA 3ZGLA 1E4JA 2X7HA 4R7DA 3DCNA 4WV3A 2Q0XA 3N40F 4R31A 1GTNA 4HIXH 1X38A 1YFZA 2G09A 3E0XA 1JAHA 3L5HA 4HMDA 4TXJA 1IV8A 5D3ZA 3WLWC 3NXKA 4RABA 4D9EA 1LLUA 2AOVA 1NCAL 5K0JA 2OUKA 4WFGD 2YINC 4KRYA 3BP5A 3CHOA 1WDAA 3H99A 4G7RB 2V7HB 4GYBA 1X19A 4ERSH 3ZOAA 3I02A 2SECE 3AK4A 2ZR8A 2WAHA 2ZQZA 3MBED 4QT4A 3ZIDA 3ARDD 4XOAA 3U0WH 2WHYA 1NLBH 1A2BA 3D4GA 4DDUA 3BZFB 1H2BA 3CH8A 4RFNC 1Y1KE 2QRHA 2C2WA 4XXWA 3A6HA 3GD5A 3R74A 1Y1UA 3G82C 1HFUA 3BP7B 3IB4A 3TM5A 3DSNA 4XLZA 3PPEA 4NQED 3SBWA 3L7EB 1EIZA 3HJUA 5JS7A 5BO1L 4WCYL 1JQKA 3ENQA 3I4FA 4W9HC 1U0HC 4B0MB 2VQDA 3LPOA 3TBWA 1DMRA 3IDYC 15C8L 4FCHA 5LP6A 4UQCA 1PEYA 2JD1A 4E42B 1VFBB 4TOIA 4E9VA 4JROA 3T1VA 4AM8A 3UXMA 2QW8A 2QB5A 4TPRL 4F80A 2ADJA 1MG2C 1B0ZA 1V7NH 5ENZA 3G5VA 1GZ6A 2DUNA 2LIVA 2PN5A 3QPXL 1Z5OA 4MS4B 2PYZA 2W9LA 3X1MA 1M76A 1N6QH 4F06A 1N2RB 1JXFA 4MTMA 2UY7A 2IU0A 2ZRHA 2FPGB 1ZA6B 4ZAKA 3EO0A 3V4OA 4EG6A 1JHDA 1R3HB 2CRZA 5SYAA 1YNTB 3WK8A 2BH9A 1UMBA 4XC3L 1VKZA 2B0SH 1PFOA 3ILYA 5ANRB 3T09A 1VM6A 4P23A 3CBKB 3GS7A 1OD6A 1BG6A 1NNEA 2PAFA 1UM6L 2QOEA 4YZWA 4NONA 2IP1A 2PS1A 3QW9A 3SR4A 1T0HB 2MOKA 5IASA 4MR8B 5ABZA 3WIOA 2VBFA 2DKFA 3AI7A 1J18A 3B6ZA 2GCEA 3RQIA 4AUYA 3VISA 2BJML 5THKA 3QWNA 4CKZA 1CQKA 2E7HA 3NCCB 4QRIA 3SB3A 4RMJA 1SUSA 4RJJA 2LABA 4C1NA 1QYGH 4OZ4B 5G1OA 2EH7H 1N57A 3AP1A 4F9FA 3GPLA 2YD4A 1NVGA 3TVYA 3S6JA 1EXMA 3U7EB 4HZLB 1CB4A 1DV2A 2FX2A 2CD0A 3E35A 3KSMA 5AVKA 2WHEA 3QMWA 2BGJA 5CLFA 2J9YB 2FDRA 3HLAA 2PUEA 3FQXB 2NLJB 2G5BA 1D5XB 2JHGA 4DM7A 4MJLA 2G25A 2R9HC 1JH8A 1X2BA 1G60A 5TEVA 1E2JA 4UT6H 2BEWB 1UUNA 3LQRA 1I3RA 3WGLA 1L5ZA 1N5LA 3ZKMC 1Z4OA 4AY5A 4B3BA 3M1YA 2NZYA 4MAMA 4OFXA 1H5NA 2ZWIA 4IVQA 4QODA 5FKAA 3WRXC 1OM3H 4WTZG 3X14A 4FLRA 4MVJH 1CG9B 2HRPL 1V45E 1SURA 1JVSA 2PRZA 2ZYIA 1NINA 1DELA 4CHGA 1E4WH 4DJJA 1DJMA 3SDCB 4P04A 5IIEB 3OOYA 5L4MA 2CO6B 2OGTA 2VF7A 2CLFB 3U6RB 3TTTA 4WINA 3RFFA 5D70H 2PX4A 4J0FA 2VXQL 3ZZ0A 3EHBB 4P9HH 3C5HA 3R4VA 3PSHA 5AXBA 3EHDA 5EOVA 4D9HA 1KWKA 4FTWA 1AG0A 4FMDB 4K8RL 3ARFA 3V7UA 1WCBB 4EX7A 3MA9H 4EY4A 5EUOF 2RHLA 3ROTA 4NFHA 1GYQA 3S35H 1XF4B 2WIAA 4RPKA 3WB1A 3RAFC 3UCRA 1E5XA 2CH8A 1PW7A 2A9CA 2ZONA 2DH6A 2I2BA 5LCVA 1PK9A 4OSPA 4EG5A 1VF5C 2EHDA 4MVJE 4KK9C 3TBSB 3CVHL 2G5UA 2Q6WB 3KNZA 2VYVA 1GXSB 2WUCL 5HIJA 3FUVA 4UOQA 3HI6A 1MHPA 2FVYA 1A3LL 2CNOA 2OL4A 4HIHA 5A2LH 1AE1A 2Z8WC 4HCRL 4ALAL 2QAGC 3EJRA 4YBHA 2J9GA 5TF1H 3KQMA 3PUJA 4LJ7A 3UEZA 1WA0X 5FO7B 2JFVA 5KVGH 1NANI 5LPNA 1P62B 1IQDB 1K8DA 4L8DA 2YIJA 4Q7KA 2KM1A 3EG5A 2H32B 1T5LA 4XE0A 4IQFA 5ALWA 3BP4A 3KVPA 4HEA1 4LKCA 1AKUA 2YJ6A 3A14A 4GMXA 3Q1EA 5JO0A 1OI7A 4CUCA 1J8HE 3BWSA 3GJFK 1YYLL 3PABB 2JAUA 3UMTA 4NENA 2R0LH 1N8OE 1LW7A 1HE8A 5B8CA 4RC9A 3NFPA 4RKQA 5E1AA 3DEFA 1KTKE 3CK0H 2D0PB 2ZKHH 2JC3A 1X5LA 2OSYA 3PHSA 2MMCA 2BSEA 4U1NB 4C4KO 4NZRH 5I1EH 4WUKH 2Y1FA 5DS8A 1EB8A 3MV8E 3NDPA 1T03L 2XE4A 5IG7B 2JWGA 2FWRA 3TECE 1M1NB 4QUBA 1KIQA 2WD7A 5IB1B 1KTJA 4QWWA 3L6UA 3FIUA 3VXRD 3HTXA 1YJXA 4FXOA 4B3FX 4LASL 1KMHB 4E2ZA 1OP4A 4PLKD 2NQ3A 2WU1A 4Z54A 2CJXA 4N9WA 3QGMA 2ZUXA 4JUFA 2YGVA 2ZUUA 1U93B 4I0PC 2G0TA 4LGYA 1A64A 4JB3A 1O8CA 1Q0RA 2EDMA 3E8SA 3I5AA 5E0QA 3IAFA 2FGJA 1OSPL 3KE9A 3GRWH 4L8BA 5FOTA 4ZYKA 1PKEA 3SJZA 1YNKH 4P5SA 3S3JA 3M5PA 4TZ6A 3P96A 1D1PA 4FRWA 5HCNA 3L5IA 4JUSA 1XZBA 2A9QA 5K3FA 5CLZA 5BN3B 5DYWA 1W0KA 3GQFA 1N70A 3QRFM 4AZWA 3ZHRA 1CL7L 3X1DA 2E5FA 4RRPA 4RA6A 1JL8A 4I9XA 2QD4A 4DLRA 5GGTH 5L3VA 4AQ1B 5FFGA 4KRPD 1J11A 5BOJA 3IV7A 2YZ7A 1OHZA 5T41A 1OWPA 1OIVA 3HO6A 3OUTA 4JY4A 4GDMA 1CT8A 2VUSA 3UMVA 2A2ZA 3B82A 3GP3A 1U28C 3HSKA 5EP3A 2GRJA 4CQJA 4QBGB 4ZO8A 4AIEA 2PMCA 1MHPH 4QNRA 3SGKC 4OA5A 4M86A 3VQ2C 4GI5A 2YGQA 3GGWB 5E2VL 2IK8A 2OT3B 1XDBA 2DBJA 4FJ1A 3QW4B 2ZE8A 4O2FB 2EP8A 3ZVVA 1IAOA 5EXPA 3ICOA 3P1VA 4MRMB 2YK1H 2R4TA 5F97E 5IMKA 3WE6B 2HK9A 1JRLA 1IJKA 5CEYA 1IUOA 3QQ3A 4IBYA 4Q01A 3ZV3A 2DOCA 4GPZA 3G9AB 4KXXA 1YFJA 1RZRA 2Y3IA 2OBGA 1RLBA 4Z4IA 2IEGA 4G43A 1QUNB 4LIQE 3AESA 3IP8A 2HADA 3BSFA 1ECZA 3EFHA 2VAMA 3T35A 2F1IA 1I6MA 3E7WA 3RYCA 2QVGA 4OU3A 2PLAA 1J06A 1DBSA 4DP2X 1C3XA 5E4IA 2JAPA 2OAEA 1J1OL 3EZ7A 3N41B 1G9ML 1O89A 4WOCA 5B1KA 1A71A 1JAZA 1PNQA 1AXIB 5ALJA 3EF7A 1LDGA 4ZI7F 2NQDA 2PH1A 2WJGA 1H8ED 4OHZA 4XXCC 1RY7B 2V1XA 3R1GL 4YRCA 4FZ3A 2QEQA 4IDGA 1UWLA 2X1WL 3W4JA 2P75A 5DK3A 1H0RA 1GR7A 1D7OA 1EX9A 3S40A 1J7KA 1WBYA 2CFIA 2YIVX 5CFOA 4XCXA 3EB9A 4AVIA 4NZPA 3WB0A 1ZV2A 2CXUA 4L72A 1KHTA 3TFQA 4MCMA 2CHDA 1BMWA 2C3MA 3MZ0A 3LN4A 3ZDXF 2CJPA 4P5TC 4A2EA 2XDAA 4HAIA 3V0HA 4ZCIA 3TIXB 4M1DH 3MQIA 1DQQB 1KTVA 1TGYA 5FFMA 1EXUB 4IJ3C 3WDKA 1O6SA 1HR0B 2HHAA 3HAEA 3UYKA 7REQB 3P1JA 4OBXA 3OLCX 5ANMA 3G8CA 2VDKB 2BVNA 1MN6A 4XRCA 1GFZA 1AJ7H 1ZNQO 4XGKA 2VLJB 6PCYA 1A76A 3L3DB 2HVBA 5JARA 4KHPB 2HA4A 4YP6A 3ND8A 4NF2A 4LRNL 2DHDA 4I5FA 3CUVA 5GISH 3D39E 2QVBA 3WDIA 1KSFX 3AB3A 4GZ5A 4AW4A 4ZOLB 5AM4A 3D39D 3NDYE 4G5ZH 4QEGA 1E7WA 4FHJA 4U1HB 1DQLL 4MA7L 3C09B 4GRMA 4WJ5B 5IJXA 3H56A 4XOEA 4KFZC 1FDUA 4PPNA 3S4SG 3BULA 4GI7A 4WHCA 2OVBA 4N2HA 2WWMD 1QZ1A 4J6IA 4YAUA 1EE9A 1YB4A 4Y1GA 4OXKA 2MSLA 2AEQL 2XXBA 3OAZK 3M82A 4DLXA 4ZEWA 5T6BA 1M1YA 4Z95H 4EG0A 2ZAYA 4MP8A 2XIDA 2Q6IA 4HIJB 1RLWA 1JPUA 1NHWA 2KHAA 4GGPA 1ZWKA 3HA7A 4U00A 2V4MA 2C1PB 2OSLA 4ZDHA 3LRSB 1PW5A 5LN8A 4PGZA 1PLGH 2AE1A 1SK8A 4Z4EA 2NY3D 5D5PA 4IIFA 3T1WA 2WXGA 3MGKA 3D05A 3VXOB 1L6RA 3GFGA 1G6OA 1ZEJA 2G40A 2BS9A 2WA2A 3MJCA 4PVDA 4DEPB 5IUKC 4CZ2A 1U81A 4HH4A 1AKEA 3WKDA 4ND8B 2CJWA 4W4OA 3NEAA 1N8KA 2ZOSA 4UQLA 3FDZB 1BAWA 4JOQA 2FMHA 2LQRA 1CVRA 1KQOA 3PV6B 3UYPA 4QTTB 5ITFB 3HVRA 3PDIB 4G6AC 2NTVA 5DSXA 3TNNB 3IPRA 2NR6A 3AVOA 4EBQL 3R7DA 1CYDA 1U0JA 3HMXL 1WP4A 4BGLA 4YHHB 4DKXA 4IP0A 2APTA 5E4AA 5JPNB 2VP3A 1LP9E 4LCWA 4I8XA 1E3JA 2PZGA 1V55B 3SXUA 2JB6A 1AHWC 2H4EA 5DJ0B 4HWTA 3HGQA 2P9FA 2Q99A 3F3MA 3EIQA 1LDNA 4DAGL 3CGWA 5F23A 3GIVB 4YDIL 4CRWB 2ALWA 4R8WH 4L37A 1RJLA 5A2IH 25C8H 1P18A 5JNYA 2X4NB 1E9BA 3K92A 4D4KA 3L5KA 4YRMA 3Q6GL 4GPEA 4L0ZA 4BDVA 4F60A 3DSRA 1GL9B 1B6GA 2XZLA 1KGJA 3NZEA 5HSFA 2HPVA 2WN2A 1RZ8B 3KWLA 4I8IA 1H6FA 2E9BA 4NZUL 2QGDA 4LEEA 1JSXA 2RA1A 4J0JA 2VUYA 4I3RH 2NP6A 4TQUS 1QSFE 3KGRA 4J7AA 5AVTB 4Z0HO 1NJ1A 2DUMA 1DUVG 5IDXA 2GKIA 5LA6B 3KPRB 3RU8H 2EG9A 5CS7A 4LXFA 1DEEA 5KW9L 1X0VA 5IJWA 4ANFA 1P5RA 3THXA 3BBPA 1E90A 2FRXA 3FRHA 3MB8A 2PQ0A 2ZYGA 4G9GA 4BK5C 4QRSB 2P5EB 4WXMA 2JGMA 3AETA 2WE8A 1IAKB 1JFQL 3O4OB 5TH2A 5JO5A 3STLB 5F1KA 1E4OA 4ZKDA 3MLWH 2IHVA 1RHHB 5LB1A 2UXTA 3AUKA 1INQB 2OZVA 1H9CA 2HLAB 4Q9CA 3BJIC 5F7YC 5C0AD 1VPOH 4ABYA 2C59A 4TRNA 2PBLA 1LK0A 1JMYA 3GMPB 4P9HC 4PTYA 4JJEA 4MCYA 3VOTA 2WUEA 3HXKA 1I75A 5C5EA 1S7RA 4GM0A 1BXGA 3QDGE 2A5UA 4B09A 3JVGC 4R7XA 4ZRMA 1HCYA 1UPUA 4DP4X 3ZE2E 1XF1A 4H6PA 3ETGA 3B51X 4MXVE 4TVPL 2VR9A 3GJQA 3KU1A 3SC2A 3NEPX 5K1ZA 1QU3A 3AB8A 1A7JA 5JTTA 1DXOA 5AICA 2IMNA 2P80D 1OAAA 4FABH 4NR0A 5TARA 1SBZA 4U49A 1W7AA 4CIDA 2NVWA 2XY2A 4G42B 1MXHA 4U0JA 4J6RH 1CFNB 3BWBA 2HYIC 3LHIA 5A6MA 1ET7A 4WXRA 3T3MF 5JROA 3VH8A 5I15H 2GTIA 3GKWL 1XD9A 3EQ7A 2WD0A 1VLXA 4GOOD 2W43A 3VSVA 1GTMA 2Z2JA 4ODVH 3ELUA 3AJAA 5CJXC 4XE5A 3FQ4A 1KLFA 3HBZA 4X3OA 5LKAA 4JFED 1JJIA 4ND1A 5DGCA 3A1CA 3TLJA 3IDMA 4QXRA 1B6TA 4LEBA 4HQ6A 5TDOA 1ACYH 4NCHA 2QSTA 5IJBC 3AFNA 5D70L 4WNIA 2CVQA 4MQFB 1LNSA 1TYJA 3OETA 5GM2A 2BDTA 4RK5A 4PUBL 3KB6A 3JWOH 1DUSA 3BDIA 1ZH0A 1XRMA 2V98A 1MJ5A 2PIDA 5K93A 4BE9A 4M87A 1MTOA 1NUAA 3TGLA 3MLZH 3C7TA 3NJKA 1NOKA 3TBCA 5FGCB 4ER3A 4CLHA 2W37A 5BWMA 4MAYB 3NJ8A 5AUNB 3DD5A 3QPUA 4WY5A 4F5EA 4LUCA 2PXYD 1DSWA 2UWEE 2VQEB 4J0HA 2X58A 1DQDH 2PWDA 1Q44A 4YQFA 4DUZB 2X0UA 1DJSA 1TMCB 1B16A 4X8GA 2NYVA 1U3GA 5ALZA 3CH4B 2EWVA 3ZJ5A 4BLSA 3PUCA 3GSOB 4EI0A 1T3LA 1HWYA 2Z6FA 5C8ZA 3EYQC 3ARBC 4NERA 3LZLA 2DQFB 4KQ4H 3DOUA 3ECWA 4B71A 1UQSA 5FUXA 4XZUA 1FFNA 3M7IA 1EWQA 4RZHA 3ULVL 5C7YA 2FW0A 3TSCA 3ROEA 2NG1A 3Q9QA 4PG9B 1ZH2A 1DFBL 2JGKA 4BGVA 1KBWA 4EY3A 4Y2OA 3ZN6A 4F96A 3PXAA 3KS0J 5COBA 1FDLL 1M56B 1U3HD 2VJOA 3FYIB 2ZJYA 5EC1A 1GYRA 4FWTA 5J06A 3MNFA 3O3EA 4P3CH 4UM5A 1NSYA 4ZTOH 1UTDA 4TNWK 3BDYL 4MX8A 3ND5A 3NZHL 3TBYA 3KAJA 2HT4D 5D2NA 2J55A 1BQRA 4EXPX 2GBGA 3BW9A 1FNSL 4ZVQA 1E7UA 4F8PA 3EW9A 4XNUH 3VI3E 1O9GA 2HCRA 1L5GB 1IL0A 5ALCH 1NP7A 4B31A 5CB4F 3VGHA 5HYJE 5I71C 1EBAA 1CY0A 4XLTA 1ND6A 2R8BA 2OHOA 4BEIA 4P5KA 4AEEA 1FSKB 1VFMA 4JY5L 2RGWA 1UATA 2X28A 5KPDA 3VFRA 1I6WA 1WUNT 4BP8A 2VDML 3IUJA 3WL7A 3CYFA 4W9CC 4DAGH 3FQUA 1SUJA 1AYRA 2CNYA 3IUSA 4LXQA 4ZMBA 3C60C 1QGOA 3PHOA 1L9NA 3O92A 5E51A 1CT8B 4X6DF 1TZOA 1EE2A 3MT7A 2ZCLH 3P2TA 2Q86A 2QFRA 1ILEA 1FNSA 5CDSA 2X5OA 2HU5A 4EJ6A 1N8SA 3D0OA 4AYMC 4BKUA 2RI1A 2JCCF 2GI0A 1MKYA 1JUFA 4GWGA 3EEYA 3NTCL 1QVAA 3LHDA 3IVGA 3RD5A 5KZCD 5D4JA 4MA8H 4BSWA 3ZDYB 3G02A 1J56A 3EDOA 2V7EA 1XZ0A 3SKMA 4LP4A 4RF5A 5B7EA 3X1BA 4JFZH 1U6IA 4GQAA 1N5AB 2MMGA 2AR9A 5JY1A 4Z7AA 4NS0A 2BW0A 4WV1B 1WMDA 4N5EC 4H1HA 1AZUA 4EPYA 3TA3A 2Q1YA 2A59A 1ZLEA 1XTMA 4IMKA 2XUHA 3BQ9A 3EYSH 3R9WA 2Y4OA 5D7IB 3AL2A 2O2CA 4N0UE 1T1IA 3STLA 1R18A 3CVYA 2OMTA 4JRYA 1SQ2N 3H2GA 4BH8A 2JRLA 5GGSB 4G09A 3B3JA 1W88A 4MARA 2Q1TA 1PWYE 4YCMA 2KYIA 3M4XA 1SCJA 2QUBA 3W5NA 2VHEA 1Q72H 4Y2DA 3GC3A 5JR1L 2EUZA 4M7LH 1GADO 4PRIE 3OZGA 1A7OH 4IM8A 4N85A 3U2SB 5LBUA 2GN2A 4O2EB 5IM7B 1AK2A 3DZIA 4N8EA 2DHCA 4J2TA 2VH5H 1I4EB 5TLSA 4G97A 5LQAA 3FZEA 4JL1A 4LEXH 3CDGA 4UQ3A 3I2KA 4DLTA 5IW1A 2FH5B 4IDLA 5KOHB 4DILA 4LVUA 1IY9A 5ERYA 3BOSA 4WUVA 2QPUA 2Y1YA 3HCOA 2OQRA 1OX4A 2NAFA 4Z86A 3VG0H 4Y2DC 5I0YA 1N7IA 3BIKB 3ABQB 3MV11 3D4OA 3PEVA 4GAAA 2QTGA 3CF6R 1FDIA 3PQ2A 1FL3B 3L6BA 1LCIA 5E7BA 3AIIA 1BFOA 5CAEA 1P4IL 5CFMA 4C4UA 3ETCA 3G08B 5IEKB 4W1SA 2VK4A 3ZY4A 1RACA 1BOFA 5EKTA 1WZEA 2L4OA 1XLTA 2NDFA 4LOHA 1I80A 4P2OC 2Q8BH 4HOXA 4OIAA 4WEUD 3Q2CA 2ZCZA 5JMRA 5EESA 4OBSA 4L8VA 3N44F 5L2JB 3QIBD 1V7ML 5BW6B 1J42A 4EGFA 3B1JA 3DECA 4W6QA 1N3BA 1JZ6A 3BD7A 3DE1X 5B4TA 1K72A 2I07B 1IJBA 5DBGA 5EEWA 4RGNC 1SJEB 1XQVA 4JFFD 2YJQA 3MVEA 1G9NL 3UGJA 2Z5GA 3KMDA 1RYYA 3BXHA 3DAHA 5DXFA 1PKQA 2GAAA 1TU2A 3GSQA 4CL3A 2IDZA 3WHKA 4YK7A 3VH3A 1KYWA 4X97A 4P0PB 3MB5A 4L1HA 3CFUA 3T4YA 1N4DA 1FBIH 3FWHA 1IGFH 4P5TA 2XQ0A 3QFJB 4AY3A 3P4MA 1TZGH 1GYPA 1YEJL 3HSSA 4KJZA 5HJBA 5FPQA 4K07A 1DAEA 4W9JC 2CIKB 2NVUB 4JB9H 4M62L 3JWDH 1DO0A 3UAVA 3H2PA 5E8NB 2ZXWB 1JQDA 3HKZA 5C0EA 2IY9A 3WBJA 1KCVH 4UTPA 3LKQA 3HVDA 2VLRA 5F8QC 1XKTA 5A9SA 1WAAF 2RKWA 4M1QA 3EY4A 1T9GS 4XGRA 1BQKA 1B43A 1LDPH 3LT2A 2QZPA 4AVYA 5DVPA 3DYVA 1PL7A 1EZUA 1YAHA 4ZFFA 2OZ4L 1CFVL 2XCSB 1DCEA 3Q48A 3TNFA 5E38A 3JQ7B 4UTCA 3FQTB 1MENA 3GW8A 3SXUB 3QG7L 3PNOA 4EGAA 3O2DA 1Q0YL 2QVFB 4DOHB 5E08H 2ONJA 3M0EA 1RUML 3R3ZA 3KJ6L 2EL7A 4KUCF 4YMGA 1Z7GA 2HH0L 5D7HA 3UGTA 3BSHA 3K8OE 1U6JA 5JA9A 1UUSA 4JELA 2Q8QA 4PW4A 2ZRQA 1FFOA 2AV1B 4YLBA 5FOVA 5K0SA 1HOCA 3RJZA 2IYXA 2OGSA 3SQBA 4F7WA 1QKZL 2BVEA 3DUUA 3OCYA 3FNHA 1RZ8A 3MCLL 3V80A 4M46A 1YIOA 1GZQA 4R01A 2SKEA 4TLLB 3EW7A 2IYLD 4R2GC 2JIRA 1ZS2A 4NWTH 1Z62A 2WTRA 3ROFA 3FE2A 2CUMA 5DKFA 5CGQB 3T2NH 2H2IA 4QRTB 2HXSA 1TVMA 4Q3AA 5AKSA 4S1QH 3HR8A 4B6EA 1GTG1 1XF3A 3MAAC 4L9LA 2PR7A 5DJCA 4BQIA 3D4YA 3AVTA 5GJSL 1HKHA 2Q76B 1Y0LA 3RWHB 3REQA 4IJKA 5IFJB 3ZN2A 4BK8A 1MAVA 4IKEA 1ESOA 3C6MA 1JXGA 2R4SL 3AU0A 1M7GA 5JDIC 3PG2A 4U2GA 4DDWA 4XWOD 4DXAA 2I1VB 4JQYA 1PD6A 3OF5A 3W3AD 2HA0A 4K46A 4L3CB 4DGWC 1OXSC 1N5YH 3IJEB 3PXHA 5IKPA 1OXBB 4WW1B 4NYIR 4BS9A 2PWAA 4M1MA 3H1TA 2FOIA 3BJRA 3L3GB 2FR8A 4YSOA 3PC6A 3Q3EA 4N26A 5FPTA 3OMIB 3M07A 4LE8A 4HSQA 3RDTA 3WSTA 5IHLB 3Q7RA 5IFHH 2FXVA 4AV5A 1BXGB 1FPTL 1OPXA 4KWIA 2XMZA 4RETB 1ADQL 4LCYB 4A1FA 4HXAH 1MH5B 3M7OA 4JEGB 1Q2XA 4CNQA 5HVGB 5I18H 4KKVA 4LHEA 1E28B 5LOVB 1KMIY 3CPLA 2B8JA 4OQLA 2CLHB 1MIMH 1A9BA 5AVJA 4CKQA 5TMBA 1A0OA 1F9EA 3S70A 3HDYA 4UEJA 2XNCA 3TL2A 2FJGB 1DLJA 4JUIA 3OCUA 2IV9A 3HC3H 3WFHB 4J8QA 3WYGA 3BHIA 1I4WA 3R0VA 3F8TA 2O61A 1FQJA 3NBMA 5KWVA 2G82A 2PL3A 4YIQA 2YAEA 4TLUA 3BT2L 1L0XA 4JRYE 4LGPB 1XEUA 1UBGA 2WCSA 3IDMB 2A83B 2ZU0C 4V0ME 5B4MD 1GQSA 2FO8A 4U1GB 4IPTA 2F53D 1YNLH 8MHTA 2J3IA 3DB1A 4URWR 1XU4A 2AHRA 3FONA 1EGQA 5KVMC 3HU2A 1ZJWA 1RJWA 3L1HA 3R5JA 5EBLB 2CLDX 3STVA 3FPXA 4Z3HA 1M5UA 3K6JA 2YMXH 4RS4A 3LUGA 4O2BA 4LLMB 5DPMA 4G1EA 3VTMA 3N5CA 3E0QA 2G3ZA 3CNKA 3U4QA 4ADJA 3QORD 3UWKA 1ICIA 2Y9PB 3C1TA 4DT1A 1UZ8B 5B37A 3NX4A 1DCLA 1PGJA 4C7KA 4AQDA 3PQFA 4HNAB 3U3MA 1SCNE 2VL7A 5DH9A 2GYWA 4CE6A 1RZ3A 4BX0A 5C0GA 1L5FA 3IB6A 2BNRD 5LC1A 3FUHA 1KL7A 1EKXA 1D04A 2QV7A 3RNKB 3ULVH 1MOQA 4HG4K 3KJ6H 3GFFA 5TY0A 2PUTA 4KXVA 3MRHB 4N6OA 4RX4A 4JX8A 2OM6A 2QBWA 4KFSA 3BZFA 5BOSB 1UADC 5JPMB 3OTHA 1BLNB 1U0EA 1K3ZA 3ROXA 1PT9A 5ECWA 4HRAA 3RK4A 1Y4SA 2NO9A 3JQAA 1HS6A 2OO7A 4Q3BA 5CT9A 5B7MA 2P5WD 1PX4A 2JLZA 1TVDA 4JRYD 1EDYA 1EJ6A 4YAFA 1NR7A 5ENDA 5DNCA 3EF1A 1A6VL 4YXLH 3TBWB 3IO3A 5E99H 3K1AA 3O3CA 1K6QL 3E1ZA 3V4PA 4HYTB 4CMHA 4KN8A 5JYBA 2AJVH 4FSXA 1Q57A 4URXR 4B79A 4J3JA 2P46B 1G9SA 4B4KA 1FW6A 3H2JA 3VTKA 2IV8A 3FN0H 5IP4A 1C9DB 4D4HA 6CHYA 1FAIL 1TEXA 4RFOL 1F8UA 1D5WA 3BXEA 2XA1A 4DOMA 1Z6JT 3LEVL 4AVJA 3I42A 4YRZA 3AM3A 3Q88A 1NFKA 2I7XA 3Q41A 4DUGD 3RL1A 2F8SA 4JVOA 4RQAA 3FQUB 4P1ZA 4K81B 4JQIH 1V43A 3PWNB 2AVNA 3GNMH 1UA7A 3CPEA 1SCUB 4YSAA 4RD4A 3EDCA 3G9XA 1BVNP 1A5SB 1G9TA 4W9GC 1ET8A 2I24N 4R7ZA 5AYQA 3RE0A 4R2XA 4MR8A 1SN5A 2FE0A 3BYYA 4NNJA 3NGMA 2IITA 2CE7A 3NNDA 4YRTA 1I8KB 1ZQ1A 2DF3A 3OFKA 2PPFA 3D1VA 1YJDL 1KY3A 3H4MA 1XCBA 2XWEA 4P3PA 2DM4A 4NAQA 1OA0A 2BY0A 1PY0A 5JAMA 2CCWA 1WMEA 3MT0A 4ZUVB 2WB1A 3I9V6 1NL0H 4XCCH 4Z7VA 1BCSB 4YYEA 2VRNA 1PHRA 4HWUA 4BCZA 2O2XA 1U2QA 5A7EA 5E9WA 5BO1H 1D2MA 2WV3A 3QZOA 1CK0L 2HKFL 1FGVH 3HDVA 5HIAA 3C97A 2AB0A 4NHEA 1NP6A 1U7XA 2NXNA 2YAQA 5K59F 1T3ZA 2B1QA 4UASA 5BXFB 3GOHA 2WYWA 1H1TA 3WEOA 4HEPG 4HLDA 2AK1H 3SYCA 4UINL 4D0NA 3MOAH 3T7TA 1QPBA 5M3BA 2QTHA 1L3CA 4X6CB 1I82A 3KZ1E 3CF0A 1BEZA 4KVAA 3OQJA 1WCXA 4UMDA 3ZOKA 2OBMA 4M4PA 3MD9A 1V27A 2F7QA 4RU1A 5DI9A 5LYYA 4F4CA 2VABA 2QMJA 3B9KB 4G5SA 4WW1A 2H92A 3QDME 2MQ0A 1SFDA 4PPQA 2DUWA 3F7RA 3D2LA 1G6VK 5H59A 2BZ7A 2DMRA 3RSOA 4Z7NE 1QLJA 3CX5J 4GLLA 4Z2AA 5BW8A 2GJZA 2SCUA 4UPEA 4Y0NA 2IC2A 3U1PA 1NTRA 4RD6A 2ZCKH 4X6DE 1OGAD 1Z6YA 3L9XA 1OT5A 1ELOA 1T1ZA 4B80A 1IBFA 4JDUA 2H8GA 3IB3A 1WG8A 5TK2A 3BIKA 2WT8A 1SXCA 1UL1X 4L5FH 1T04B 5DP2A 1BHSA 4I6JA 2FETA 3HI6L 4LSDA 4MS8C 5DHDA 4PRHD 4WJKB 2GA8A 2VKXA 3RDJA 5A6VA 2P1ZA 3IPFA 5CGYD 2ID8A 3SBXA 3I3EA 2RB5A 3OLYA 4KSBA 2Y06H 2FECI 1XOIA 4UM8B 3BMXA 1SUFA 2I26N 3ETTA 4BNVA 3ZI0A 1GKOA 2JRCA 2WYHA 1WV0A 4OGLA 1FU4A 2FHCA 3FFCB 4YJKA 1Q7GA 3IELA 1P39A 4HDOB 1SPDA 4F4UA 3MV01 1XMEB 1RVV1 2AGVA 2G60L 1H5QA 3I53A 1KQFA 2K45A 4AXWB 1E1KA 2ZT7A 4WZBB 2FH6A 1LQ2A 1C5BL 2WP8J 3MODL 1JPNA 4K3UA 2ZJ4A 3WO4B 3L0BA 1N77A 2VM4A 4BAUA 1KQPA 3UFIA 5AQ1A 1X6LA 3JSXA 3VNRA 4DMKA 4PJHE 4LPSA 5I5IA 2HIGA 4V0RA 5D8JH 4F8TA 4YX9A 4H8WC 4JYBA 1T22A 1QHOA 4AL4A 2W88A 3KVRA 5EBLA 1N0WA 4WKOA 3K2EA 4HFNA 3DX7B 2PANA 3GUCA 2RGSA 1E4KC 2ZVDA 1P5UC 1JJBA 1CJSA 5IAJA 1GW0A 5D5MF 3U3XA 4F5ZA 3W1VA 2VDPL 1S6YA 4J16A 4KDCA 2L04A 5C97A 4DJDC 3C6YA 1S9YB 2W6OA 1YCSA 1HHHB 3ILPB 4APXB 2VMCA 3FHTA 3VV2A 3GELA 4EB6A 1K68A 2O0KA 1ZH4A 4AW7A 1XTLA 5CPFA 2O5ZL 1BXRB 4NCAA 3DLBA 1V54B 1Q7TA 4NN6B 3GG9A 1P5HA 3A24A 2F1OA 2OMXB 4XNZC 3BE8A 2O6LA 2R15A 3PXXA 4RJKA 4EDFA 2RHGB 3ECUA 4KYIB 3CCCA 2WOOA 3IP3A 4HUQB 1Y3HA 4RISH 4JXJA 4DRXA 4BE6A 3PYLA 4P5PA 4A2FA 4URUR 3ZVNA 1J9EA 3E8XA 3MU3A 1IZYA 3BH9B 5I6XB 3NJMA 4NJ9L 1B4DA 3R0QA 1XA0A 4KXNA 1V5FA 2AI0H 4JS7A 3N55A 3NCJL 5BT9A 5I7UA 4JT8A 1F9AA 3VO1A 4KDTC 1A27A 2CK3A 5FYJL 2GCGA 3FWYA 3P2JA 3VR0A 1VE7A 1YBHA 1YBAA 2XB9A 2ZOKA 3TYGH 3BGFC 1M1XA 4IRZL 4RDHA 2DGDA 5FYKD 1O2DA 4ODHL 4LRQA 2QN6A 2DLFH 3UWPA 1H1LA 3L1OL 3A36A 3DDUA 4K94C 1NQBA 3AGWA 2VW7A 2EXWC 4G5RA 4NZDA 1OT3A 1SXZA 4PCUA 5CM8B 5FKPA 5F7UA 1PLAA 1UVQA 5BRPA 1SOQA 3OFNA 2PO6D 1MWAL 2FO4A 2I7OA 1XF9A 1MDAA 2WA1A 2H54A 3QBTB 3T7AA 2XOEA 5CYFA 3SSMA 4IFTA 4RPHA 4RK1A 1U2YA 5ICXA 3T9WA 1QG2A 1X5KA 4GUOA 3CMMA 5DHVB 3VU9A 4Y16D 2GD6A 2I9LA 3B1KA 3PCXA 5C1OA 2F4NA 4ODBD 4XYMA 1TUBA 1UBCA 1O5IA 1IN5A 3TYXA 3L16A 4GG8B 5A7FA 4Y88A 3WTBA 1BXXA 1SPBS 4X0EA 3FTYA 4M8KA 4DEXA 5JNLA 4EQZA 3G5ZB 3ZDZB 2QSVA 4KQ6A 3I85A 3QZPA 4YQEA 1SGKA 1DKUA 1YDHA 1LZKA 1S7QA 3LAWA 1E5LA 2F67A 3MQ2A 2JI3A 3MCUA 3I6BA 1X3DA 4EQ6B 1GM5A 2OFPA 4MMZC 3GVPA 3X2FA 5D1ZA 3I9GH 3T3MB 2IUYA 4MRMA 3CAFA 3RWIB 4BUGA 4Z4HA 1N2CB 2QGNA 2ROQA 3OZXA 5EYPA 4OAQA 3CG8A 2X9YA 4P7KA 2FDXA 3H0KA 1O9VA 3A1SA 3E9UA 1O6BA 2VHYA 2RCYA 5I15L 4AZUA 2H5IA 4ZRNA 2A6DA 3DKHA 2FF7A 5IB4B 1WFIA 3C2AH 2WYUA 3L6EA 4Y2UA 1KPUB 4LV6A 4IIDA 3RI5F 3SM9A 5JW5A 5A7HA 4JRLA 4GX2A 3KSAC 2EVIA 2H65A 2DETA 1WG3A 4FXGA 5E2VH 4TT3D 3QFDA 1E28A 1IL1A 3ISYA 2CBOA 4B48A 5ALXA 1AXRA 4L4ZA 5KSAD 2C5GA 2WMPA 3BB4A 1W5BA 4ZPVB 2ZVQX 5AW4A 4IS6A 3SYAA 1E9OA 5G0SA 2GBPA 3C4VA 4KDVA 3FTXA 4FOPA 5TMPA 5HKKA 1D0IA 1M1SA 4QRRA 2FB9A 2HMTA 5BOVA 5DD3H 3U0WL 2BTQB 1UXIA 4YHLL 4WI3A 1SJHA 5IV2A 4LCUB 4F2HA 2P40A 5ALFA 2H7XA 4EPRA 2ZX7A 5IK2A 3WDHA 3QUXD 5HIIA 2ZIEA 3HI6H 1CYWA 3VMFA 1E5VA 2X9LA 4RL4A 1MF2L 3ZCSA 4JSYA 3BWVA 4CF3A 3S5UA 5FWRA 4JCCA 5L6YL 1PKQE 1OLUA 7YASA 1P1FA 4QYOA 1MABA 3NO4A 3T5WA 5HM8A 5K7SA 3EJPA 1T1SA 3U6BA 5KOMC 2Y76A 2H4YA 2VK8A 1AKRA 2FEKA 2CV0A 3P26A 4F7KA 1FJ2A 1OZHA 2XT0A 3MMZA 4PPFA 4Z9BA 4Z3EA 2VK1A 1S5IH 4JB8A 3KLHC 3K0FA 4WDIA 1DJPA 4MCZB 4UOW1 4Y5YC 4BLVA 2H57A 1DJGA 5AUOB 1EFTA 4YHZL 3UP6A 1N1EA 3MNWA 1BJKA 4BZYA 5IS2A 2DSNA 1SN2A 1HX0A 1C5CH 4I46A 4YDLC 1MNUL 1KU6A 3AKDA 1N5KA 4PVBA 3CFMA 1P7WA 3AG3B 1C8VB 2NQ2C 4Z9KB 4W8OA 1HX7A 1CFTB 2UVFA 4O02A 5G3YA 4FTVA 2XCOA 5JRDS 1PG5A 1ADJA 1P7QB 4JHVA 4LF3B 2BSSA 5C9JB 4PJ5B 4GXQA 3SSNA 2UZYB 3BTOA 3P32A 3QRBA 1YZTA 3EHEA 4C2UA 3RLSA 3I12A 5E3JA 3PA6A 4UNIA 4Y9GA 1UBLS 1ECBA 2N0MA 2HLEB 1SVLA 1BDMA 1CNFA 2AZTA 4I8DA 1KJMB 4Q0MA 4LJKA 4LI3X 2V3FA 3GSWB 5E94A 3LWDA 1T10A 4KO6A 2N1KA 2YGOA 5CR9A 3TXAA 3Q85A 4BVKA 2J08A 4LHSA 1H8LA 5F1KC 1SBSH 3F7YB 2HWZH 2HTLC 4MRNA 2X89A 2VDNB 4KNVA 4V2CB 4BB6A 2C8NA 4TL6A 4CFSA 4DZ8B 3V00A 4K86A 4LYEA 3HY4A 4XGZA 1YEKL 3RL2A 4PYGA 4R4FL 1HQRA 4Z7UB 3C2SA 1VCIA 3C75A 5F3DA 1KJVA 3UC9A 3RWMB 2IYPA 1F1BA 1MGOA 3F6PA 1L8QA 1CQJA 3FSGD 3G0BA 5B53A 3TRKA 5JCJD 1IUZA 2X2HA 3Q8AA 4X4YA 1W25A 3GUFA 1Y9EA 4TRMA 2IOFA 4G86A 4JB9L 4M62H 1HQ4A 4PR0A 2WPNA 5LBGA 1JX6A 1KXVA 1OIWA 2XPZA 4WSOA 5C6WH 2BBOA 1F90H 4CN1A 4N03A 4JREB 1B3BA 3WJ7A 2PA0A 1V35A 4ITRC 3ZHOA 1DOHA 4FQIH 4BE4A 3OB0K 1I32A 5TV2A 3GDOA 2XQYG 3S28A 3MLSL 5TF4A 4D8OA 2AK4A 4JCLA 4NV1A 1S1MA 4D0DA 3TNJA 4P58A 2EFJA 2B9BA 1U7TA 1YN7A 4I4TF 1NVAA 3NV7A 1LTHR 3MYZA 5TGDA 3SHQA 4NYLA 3GJFH 4JM2B 1DEEB 3MXVH 1LTXA 1NURA 4KOBA 4G01B 1AK9A 4OD3H 3QEOA 3AAZB 4JKLA 1W73A 2C2GA 3DFKA 2KC0A 4M48L 3RVOA 4LSPH 4TQEH 2BFVH 3AETB 5LWQA 4CU7A 3KLOA 1L4EA 4ZDJA 3II3A 4QGFA 3O47A 4U3XA 1YUNA 4UTNA 2P41A 4REOA 5J13C 2X8AA 1NC4B 5E5MA 5DXJA 4IRMA 1J0EA 2QW1A 3WD5H 1WQ4A 3BA6A 2DWOA 3AR7A 4BNJA 2HMVA 3HABA 3ZKXB 5ECYA 3GLIA 4ZUSB 1KEGL 4MCYB 3KYMB 4M6MH 2O07A 2ZDGA 4JR9L 4FP8H 2B2XL 1QAMA 1WF5A 1ZUD1 4LXGA 5I9TA 3R06A 3P9YA 4NXNB 3QJUB 4L8SA 4LU5H 1QP8A 3JV0A 4Z7WE 3N2LA 5CB4A 1MU0A 1XIWA 4OD0A 1KEPA 2KBFA 5IJ0B 3OAYK 3NWOA 1GDTA 4CCYA 4LARH 3WBFA 3U83A 4OZIA 3RFTA 3IC5A 3F4KA 2A0YA 1AHPA 3IJ9A 4MPRA 1P2TA 2Q27A 4CM8B 4PJGA 4CM7A 2A99A 2XTNA 4HYEA 2RD2A 1T0MB 4G1CA 1JLMA 4O4YL 2RGYA 4G5QA 1MC1A 2FY8A 3MILA 2BWIA 1LLCA 4OJKA 4J3NA 4JFDA 2VR7A 1EDZA 1IN8A 4HS4A 4ODHH 4IRZH 2KQNA 3KG5A 4EATA 3KKMA 3DWEX 4A8TA 3F74A 5BV8A 3UV7A 1FYEA 1PNVA 4D9GA 3UQZA 2ZXBA 5FM8A 3DPIA 1DBAL 2FATL 4WNAB 4MQ7B 5ADWA 4GUDA 3O6LH 1RC1A 2GNAA 2CBXA 1L7XA 3LLCA 5B57C 1WWCA 4GKAA 4YCNA 2Z6UA 3JV7A 1XYGA 3BX7C 4UU8A 1EH9A 4OCXH 2JI2A 4KO4S 1WVIA 2NSQA 5TE6H 3NHAA 1N26A 4XNAA 3WL5A 1YDFA 2OBFA 2I6SA 3G0IA 3CVWA 2XQGA 1F86A 1YA6A 4KH9A 1YYMH 2NY3C 2C98A 4LX0A 1N4XL 3DBLB 5AUMB 2PJUA 5ACLA 4BNDB 3KR3L 4NCXA 5IR1B 1KJJA 5TGBA 2WBWB 4MTCA 3OPVA 3IL2A 5KQRA 4OF8A 4QOEA 1F48A 2DMGA 3QEUB 5DT1H 3AHDA 4P81A 2Y0PA 3VKHA 2QRJA 1IEVA 3FYSA 4ENVA 1VGKA 1H23A 1W6WA 4HWNA 4HSAC 1LO0L 2HFTA 5DUJA 2JLSA 5DTJA 4G9DB 5I8KH 2IEIA 3ZKAA 1KYOK 2R8ZA 5JZOA 3A2LA 1DU4A 4BQ9A 1CEEA 1C9SA 4HNSA 1ORHA 2ZXQA 3SJAA 1DBRA 3BVXA 1CLOH 1MQAA 3CN2A 5DGQA 5E99L 2L2QA 2H08A 5HGDA 2WKOA 4ONGL 3EWAA 5KBDA 1XK7A 3SZLA 3T77B 5DMYA 4ZS6D 5FDFA 3BERA 4AQYB 1MDFA 1PKOA 2VDOH 4HSEA 4CIAA 1RAGA 4A2CA 3BKWA 3OPYB 3KYDB 5DWQA 2O8DA 4BV9A 2P48B 2OLEA 5EBGA 4EH1A 4NLHA 2ESVA 5DLPA 4JPWL 4NYJQ 1L2TA 1UT5A 2CNZA 3R41A 3FDJA 3BT7A 2IQIA 2H1WA 4W5JA 4DYHA 1YEGL 5E9QA 1Y48E 2GSDA 3BC9A 1AXSB 1J39A 3M6VA 1KFJB 4GECA 3ZXAC 1JR3E 2E9WA 2O7QA 1WXGA 5FV2A 3P0JA 2P6RA 3RAJL 1FFGA 2Y66A 3TUIC 2L7JA 3TX4A 5DWVA 3WY3A 1G41A 3IAS6 5IJZA 2QS9A 1VJSA 1UWKA 2XZQH 4X5WA 3BXZA 4LY9A 3HMQA 4TKUA 4UTBH 3KYOA 4UUNA 2BVOB 4A7TA 3EBOA 4E2FA 4JL8A 2Q6VA 4S1SH 4OFPA 3PGA1 4E5SA 2G71A 2X77A 3MV7E 1H4QA 2EJWA 2W4QA 1HHJA 2H51A 1G7CA 5ICZB 2VP4A 4AS1A 4ZGGA 1JUFB 4U6YB 3MUZ1 1J49A 2ZIUB 1Y8QA 2J9FB 5COAA 2OTUB 3A6LA 2F8VA 5FUBA 4CGZA 1X7WA 4M5YH 1C7QA 1H2XA 1C5DA 1WETA 2WV7A 5EUOB 4TTQA 4A7PA 4CIXA 3QUYD 5B1EA 3ATDA 2GEVA 2AABH 3EFOB 3ELAT 2LGJA 5EORL 5AT1A 5BN4B 5EZOL 3VR4D 4MLPA 1OCRB 3LZRA 3KHSA 1V8BA 1NVDA 3E2HC 3ZJTA 3KPNB 2BNQB 2HCZX 3DX3A 4FFSA 2YPLD 1THTA 3E9NA 4FMVA 5IW6A 1GGHA 1BKDR 2C83A 3HN3A 1XMWA 1UEXC 3HZKA 2OQIA 1G21E 1LEHA 3NJ4A 4OHPA 4FXGB 1Y1QA 3DKKA 1LTKA 1XIWD 3EVZA 1PX2A 1UJMA 4LF9B 1HAUA 1I53A 3CH5A 4YP0A 2VZ8A 2VCEA 3UAFA 2BR5A 4HRVA 4BX2A 1XKQA 4F1ZA 1G4HA 3FCAA 2PS0A 4MAZA 2I80A 4X2UA 3FPBA 5AW4B 4ZQCB 3ARED 1VJ5A 1SVUA 1RNLA 4R1SA 5B39A 5BWNA 4QTYA 3AREA 1DR9A 3VXSD 4R7NA 5AAMC 4R97C 5IFHL 2FFHA 4XXCA 4GKOA 1JZFA 4IW3B 1BQHA 3TD9A 3TPUA 1EBUA 1XIWB 4Q4JB 4PJEB 1C14A 2DMKA 3V55A 4P35A 1QLRA 4TUKL 4HS3B 1A7QH 1GNSA 1H9BA 4FJ2A 3R7FA 4JVLA 5BSMA 2Y0DA 1Y34E 1Q2UA 3VSEA 2X0EA 1XZFA 2A1IA 4EZBA 1D9KC 3FU7B 1R0AH 1VMDA 2ADGB 5K8VA 1Z74A 4KVZA 1OLUB 2CO3A 3EAKA 2ZT8A 1GNLA 4B7LA 1QORA 4G07A 1Q0ZA 2OYMA 2A6IB 5HIKA 1C9EA 1Y5LA 2XMDA 3PHLA 1PJ4A 1O97C 2ZRAA 3OLDA 1E7RA 1B2RA 3HB3B 3NACH 4L5AA 4EHKA 4N8CH 4DLLA 3SHOA 4E9LA 4KBFA 1CPUA 3RASA 4HD9A 1UFKA 3UGQA 1MVOA 3EOBB 1NE2A 4UNNA 2RE8A 2JIOA 1F0LA 3WGVA 1RP9A 1U2GA 1BS9A 1C16A 4Z0BH 2A0LC 3T38A 2HCJB 1TAQA 3G5LA 4MCHA 4QNPF 1XTIA 5HYQB 1IHXA 2ZW9A 3JALA 2OL3L 2H4JA 4GNKA 3M6FA 4NZ9A 3FPJA 1QSFA 3VO0A 4MLZA 1ECPA 3AP2A 3QC6X 3LXMA 3VNUA 3WBBA 1JQ3A 3FHLA 2ATAA 2Y07H 1OGAE 2XBZA 2ZRKA 4AX4A 5KS9A 1HPLA 4BFVA 2EHJA 3FOFC 4QSHA 5FBHA 3VJKA 4LYGA 3JZFA 4PJIE 2CHFA 4PR5A 4EI5B 5B1BB 2RG1A 4O3TB 1NASA 1QQAA 3CSFA 1AR2A 5DBIA 4I81A 5KC8A 4QPDA 3O2VL 1GCIA 1RUMH 2YMQA 3WMSA 4AMBA 4BNGA 4OLZH 3B6SB 5I23A 3CZKA 4OZHF 4ECNA 5K05A 1OH7A 2EAEA 2NXYB 1IZ9A 3JAMA 3KPLA 3E84A 4QU9A 5CLXA 3D0LA 5AVVB 2KS0A 1G3MA 4A0HA 2JB5L 4H4CA 4AIZB 1QQ6A 3NA4A 5B39G 2VN8A 1Z7WA 1LDPL 4OT1L 5EG5A 1CUJA 4FN5A 2O4EA 3E3OA 5K9OA 4Q16A 3WNPA 1SG9A 1UPAA 3ILVA 4I7ZC 2IODA 1YMMB 1BCRA 5BRAA 4TL4A 3D8HA 3W5SA 4LOIA 4J1UA 5KTYA 2FF5A 1O7VA 3RX9A 3FCYA 4QOIA 2P91A 4LBWA 5TE9A 4C2BA 4DMFA 1RMQA 4X3PA 1C7ZA 2Z9BA 4AY0A 4M0DA 3ILEA 5JAIA 1Q1QA 3BWEA 1XTUA 3O9WA 2DHEA 4FUQA 3FTQA 4NSNA 1ODSA 3TM4A 1H3XA 4NBRA 2XA8L 2P6OA 4BWFB 3I5UA 1IHYA 2BEUA 3CFTA 2DN7A 1M6UA 3ZT7A 4ZYKB 2EFCB 1IJEA 1WXXA 1A9SA 2PKYX 2HGZA 1NIBA 4XBEL 1VKRA 4NULA 3MQFA 1HHGB 4R9UC 3UK0A 1D9ZA 4RHEA 1SVWA 1KVTA 4K9RA 4FW8A 1PLKA 4JOBA 3QW2A 5HDQA 1S2EA 3WHXA 3JQBC 1I9JH 4LSQH 1ZEAL 3CXRA 4YMPA 1JWLA 1XF3B 2CM6A 3G2HA 4B4WA 2GRAA 1Z7BA 4GBXB 2QTZA 4FL4C 5T33H 5HYSG 4WI0A 1ESZA 4DFHA 4S0HA 2YCLA 2C1ZA 5BW7C 1MCWM 4YR6B 5FB8A 5JZBA 2HI0A 2J6HA 4G8FA 4E5XB 1PV2A 2NR6D 1S8NA 2QL7A 3H0EA 3L6OO 3FUKA 3RM3A 4P2QA 1RXLA 3FQWA 3CVXA 4U6YA 4D9FA 1RU3A 1K2WA 1TTCA 2BFPA 1XTZA 2G9HB 3DT9A 3ELQA 4GPVA 2NZJA 1M7XA 1CY1A 4UDTB 4IZ6A 2W80C 1JK8B 5KQMA 1U63A 5JSHA 1ZMRA 1MAUA 4BJ6A 4TXHA 2ZE5A 1FZOB 2EILB 3QZLA 2WV9A 4GMSH 4X6BA 1HMPA 4RRPG 1GCYA 2OK0H 1B1CA 1U2DA 2X2UA 3RWGA 4CLRB 4MCJA 1R5BA 4DC9A 4A9AA 4BKQA 4C01A 4LT7A 3KB1A 3WLLA 2BKXA 1A7OL 4A8JC 1SUHA 3MCKB 5CBPB 3MWEB 1PR5A 1E1QA 3HK2A 5F9JB 4AKGA 4Y1AD 2NZ8A 1AGYA 1HYEA 4AEHL 2UYYA 3RWDA 4EL0A 4Q7LA 3IIIA 4N90D 1SBQA 1NQOA 4OSUH 1D2NA 1A4CA 3R7BA 1CJCA 3N8IA 4KNQA 4ZFGH 5F64A 4FEAA 2QTEA 4EUFA 3GU3A 4R7NB 3QIBC 4LDAA 2VKTA 2BFMA 3V4VA 1E2KA 3L6RA 1JXMA 4UDXX 5MDHA 5C0CA 4OP2A 4Q03A 1CP3A 2LW3A 3OQ1A 4YHNA 3U1VA 1YNSA 1NFDF 3J8F7 3JUYA 3VFNB 3E05A 1W8EA 4K7FB 4XMPH 1M9SA 4JQVA 4UMVA 2HR1A 1GGIH 1BVLA 5AKRA 2XWJI 3CFYA 4ETQB 4HJGB 2IYWA 2NNAB 2H2SD 3C3DA 2ONKA 3IFPA 1DO6A 2OXCA 1AH2A 1D8AA 3N0WA 3OFND 1C7EA 1GWNA 5TXGA 2BCJQ 5CD3A 3DIFB 2FSUA 4CLDA 4I18A 3R3YA 5HF5A 3BBLA 4AQOA 4ELMB 3UB2A 3DX8A 4QULA 3JARA 4EI2A 4LF6B 3ONDA 1WBZA 5T57A 4DQVA 4AV4A 5FAXA 3W9EB 4NLLA 3KSUA 3LP6A 3MTRA 1QSEE 5JI3E 4MVBD 3FVTA 2VLKB 4PJBE 1P1JA 2WZQA 4MD4A 4GW5A 2P28A 4P80A 4EAQA 1YZUA 1JW9B 3UTTE 5E7JA 5KSZA 3ARUA 5HCIA 1R5JA 1ZRHA 2C1PA 3JQAB 1PNTA 4W5WA 3OKOB 4ARIA 4ALIA 1JEOA 4N0UA 3U0VA 2YXVA 1QSGA 1RK1B 2DAPA 2PSJA 4L4TD 2ZE7A 5BQFA 5L95A 3BUDA 5C0OE 3MOSA 3A0OA 3RR2A 1SK9A 1NONA 3ZJVA 2GABA 4MV6A 4CIYA 2GR9A 1TQ8A 1TVKB 3D3WA 4LDCA 3A9WA 5LJIA 5TE7H 1JDZA 3FHAA 1P4IH 2HRGA 2G06A 3D59A 1CIDA 1E2VA 1E1CA 5TQ0H 3ZHZA 4NO5B 4WUKL 4XH2A 1H9VA 1RE0A 3TH3T 3GLHE 4XPFL 1CEQA 4XMVA 3FOLB 4ZEVA 4PZ0A 3NBAA 1ZM2A 4KFTA 5I74B 3H3KA 3B9PA 4Z76B 1QPKA 1EPFA 2ZRJA 1R1DA 5EHQA 4WBNF 4GP7A 3DULA 1TF2A 3CD4A 2YQGA 3IDQA 2AMGA 2PWGA 5JNYB 3STYA 3PWNA 5E03A 3BM5A 1X8XA 2ABWA 1QHIA 1Z34A 3K6DA 5IBLC 5L4LA 4OCRH 2QKYA 1PUJA 4G11A 2F00A 4FTVE 3KL4A 3FFTA 1REQA 4RENA 1FGNL 3JD3A 5FBQB 4ZD3H 4LARL 4URYR 2AA3A 1RZPA 3WJJA 3HZ3A 1RJYB 2GC4C 5C0DA 5IUJC 4G80B 3NA9H 1HHGA 5DW0A 1G19A 2ACWA 1NBAA 3DMTC 2Y1WA 2QTVA 1D2EA 2R8SL 1OREA 4JC4A 4RQQB 2QSCL 1F20A 4HFRA 3O3DA 2HFJA 2F1RA 2GN9A 4I3FA 4U33A 3QXDA 3KVYA 3KT3A 3UG4A 4WGVB 1JD9A 2PZFA 2IWKA 1XQXA 1P6WA 1WPCA 4PJGE 4MWEA 5TVGA 5DZLA 1GN9A 3PHQB 2EAUA 1DFHA 2B6HA 2PFSA 3WLMA 3L7LA 1TEGA 3VSTA 2OI9C 1Q4NX 5ANMB 4N76A 5LQBL 1FDSA 1NBME 3G0DA 1KP2A 4QDKA 3WO1A 3C2QA 3PIQB 1PGOA 4UQBA 4PSVA 5TQJA 4R6XA 3W5JA 5E2BA 2VA8A 4F58L 2D1RA 3GAMA 4L23A 3QRLA 2PTTA 1JPSH 4HATA 1K27A 3M5CA 5HFNA 5FF6A 4YCBA 3OTWA 2GK4A 3BRQA 3KYKL 2B2NA 2YGNA 2RFLA 1E8YA 3IQHX 1U4OA 3A1DA 3SFTA 1UD6A 3IVKB 4ANKA 5FHRA 4F2MA 1B6DA 3RVUD 4M55A 4E33A 5D72L 4HJ0D 2BNRB 2WNWA 4CTOA 4DCCA 1GTL1 2C54A 1LLDA 3NP7A 4FE9A 3WFDH 2GTQA 4LSVH 1XEWY 3FNGA 4C7XA 2BP0A 5IT2H 1BD3A 3GZKA 4KI5C 4EIZC 3LY9A 1DANU 1D9KD 1S3GA 4C0HA 3ZQXA 3TA3C 1CE8A 2DZDA 1TK3A 2LUOA 1CLUA 2QLJA 2OP0A 3V8PA 2HTEA 2V9RA 3LKOB 3BQNB 3EOBA 2BWJA 4PJ5D 4TVSa 4TWBA 5BQOA 1U04A 1ESCA 4U1KA 3RC8A 3HRZB 1CHDA 2FG6C 1E4XL 4MHTA 4PCAA 5DBHX 4ALNA 3P11H 3SEFA 4M4RA 2AK3A 3DXZA 1VACA 1KAQA 4BZ1A 3MS2A 2QD2A 3W2FA 4WU5A 4D79A 3ST7A 3WSQH 4DLYA 4OUUB 2WJPA 4X9XA 2QVCA 3DDNA 1TF4A 3M8OH 4MQTB 1E9VA 1PFKA 2R6CA 1NIDA 1NNLA 3ELWA 1E2ZA 5MEPB 3O4HA 3PPWA 5B3JA 4YVUA 2XZTA 3SVTA 3PQCA 3G6WA 4XP5H 1NJ2A 1SEQL 4RM3A 4FXGC 1HT6A 1OCWL 4G2NA 3CXUA 3KQNA 4YZFF 5E6IB 1W36D 5CSZA 4Q82A 2PPLA 1R17A 5BJTA 2HK8A 3V4UH 4ONOA 4LFHG 2X1LA 3PUHA 5DM2A 2GASA 4Y1AE 3K7EA 4KFRA 1PLCA 1L0BA 2QT1A 5BN5B 3QEGH 3B20A 4XZUB 5KYGA 3FTCA 1NV9A 4NE9A 3SPIA 4G4JA 3SPVA 2DQFA 3DTTA 1YMVA 1ZVNA 3ZU3A 1L0YA 4WO4B 3PFNA 4N8DA 4XGQA 2Q7YA 4ONHA 1MUUA 5BQ7B 4FFMA 2WIMA 3ILDA 4M00A 5IAKA 1LBHA 1M7IB 3HKEA 2H2PD 2XX3A 1YDPA 1ZD5A 3KBHE 1AKYA 1UM9B 2O6EA 2JTDA 2A58A 2JW5A 1CETA 2AQIA 1CL7H 2YWZA 4YPJA 1BOYA 3HB0A 3VFTB 3ENKA 1ACYL 1Q21A 2ZBPA 1G0XA 3H2ZA 4YSEA 1FNLA 2WM0A 4AENB 1IXRC 3PXJA 1KDZA 3T71A 4P48A 5EO0B 3ZHYA 3ZZTA 2VLME 4ZK2A 2PM8A 3V7FA 4C43A 1RWBA 1PLBA 3KVQA 3HPJB 1DYZA 1BFDA 4LJLA 3VOBA 2WAAA 2JQAA 1OWLA 3I61A 4U4BA 5CCEA 3ZXIA 3CZ4A 3TN0C 2LU3A 4G0PA 2JHAA 2EIEA 3RT9A 4PS4H 2W6IA 5KHLB 1MZVA 2WN3A 2EQBA 1GNTA 4K7PY 5A1AA 4QDZA 1YVUA 3TQOA 2OGZA 4ZT5A 4NKQB 2GK3A 4RW0A 1EX6A 3FN0L 1OU0A 2ADIA 5KSBF 1M6VA 3FJOA 1UZNA 3P9MA 3F6BX 1P4GA 4QUAA 1I33A 3BMQB 1XTQA 4FYQA 5DMGD 1IWBB 3BVWA 3STZB 3DBHB 4V3CA 4RLSA 2OFFA 4EFLA 1MPAH 1KY6A 5J6GA 5E3IA 2Z09A 1SJXA 4XODA 3S8FB 4JO2H 4J9UE 3BRCA 4PVNA 4HZGA 4OAPA 2V3WA 2KZWA 3CV5A 1F4HA 3HFFA 4BZ1L 4LMRA 3TZKA 3FFCD 1S0UA 3O6KL 5IUSA 3JQOB 1P7VA 2K1MA 4MV0A 3SE6A 3W2GA 1Z37A 4W9KC 4PO9A 3MPUA 1PGPA 4LW8A 2ED8A 3BZ4B 1A0QH 4JUTA 3DGEC 2BDEA 1USZA 1MRCL 1N7MH 5CTJA 3FNEA 4D3CH 3OCXA 4LY3A 1E43A 1GSKA 3ZTNH 4JPIA 4KKCD 2HBQA 4B17A 1ZVVA 1V41E 2RQ8A 2A0LD 1F97A 3LWNA 4MWFA 2I2AA 2YPVL 4CMAA 1QASA 3FUWA 4TMWA 4K26A 4BJ5A 5LMNB 4QFMA 5CBPA 1E9OB 1BX2B 5GGSA 4HCJA 1LB1B 2PUVA 1M34B 5MEND 5I9MA 5DEJA 3BAEH 4K2AA 4WO4D 4E08A 12E8L 1WC7A 1I5EA 5CGZA 3IXTA 1Y80A 1YZGA 3DUWA 4EIUA 5IKXA 2VMDA 4QBFA 5DYTA 1RURH 3I5MA 4IIUA 3TM6A 1XHFA 32C2A 3QWOA 4HWGA 2H1HA 1GC1L 2NT4A 3LG2A 4BKOA 1E1QD 3WB9A 3QYPA 4NKDA 1FUKA 3A4VA 1FF9A 4C6SA 4H7FA 4LSTL 1WWKA 5IT9A 1Y7HA 2YVUA 5HTSA 4WFFE 1M2NA 2ZJ7A 2I33A 4EFNA 5T1DH 1E67A 4AZSA 2HKFH 5FTLA 3MBXL 1SKQA 3UFXB 4HNUA 4YPGB 2LVEA 2H0JA 3TSAA 3A25A 1L5NA 1XKXA 1CEYA 3OX4A 2X3YA 1YL5A 3QQ4A 4I4IA 4DETA 2YC1B 4KV9A 5T3ZE 1DUYB 2NO6A 4OIFA 4AICA 1WRFA 1TETL 2Z9CA 1OGSA 3DOHA 4KC3B 4J1TC 3AOEC 4G1MB 3MHZA 2W00A 3AREC 5I17B 3ERXA 1GAJA 3VDQA 4KN6A 2PETA 3OQOA 1XG5A 3NWBA 3GAZA 2EDTA 3LV3A 1VL1A 1YI0A 3H86A 1A2YA 4DH2A 4LOEA 3ULUH 2W9EH 3QPQC 2C5SA 3MI6A 1HDOA 3KDPB 3M6UA 2RIPA 4XP9L 2CLEB 4AH2B 2R1ZA 2OPCA 3DHNA 2QORA 3W9UA 5MENB 3TCTA 3VFOB 1U58B 1C81A 3WZLA 4L8DB 3EDQA 1P0QA 3OEEA 4R69A 1IAIM 2A73A 3MRLA 4MK4A 3DTXA 5ARCA 5IVNA 4EEXA 1M7DA 1LPOA 1N2IA 1YL6A 1BOOA 4BQEA 2EH7L 3DFUA 5BJTB 2OZEA 2IU3A 4TM9A 4B82A 5B7GA 2VN6A 5C0AE 3GHHA 2QRVA 1B74A 5CDHA 4R0LB 3BMCB 4B7XA 4BQSA 2AW3A 3AL8A 4Z8XA 5DGDA 4QLBA 2MWMA 2IG2H 3QXTA 1JMKC 4EP1A 1U8HB 3KQOA 1IEAB 3H4VA 1L4MA 4GMKA 4Z4GA 4CN6A 3R9XA 1QVRA 3H7BA 2JCXA 4NUMA 4H0FA 3EIHA 4G7VL 3VKGA 1OLZA 3GXDA 3MMEA 1UHVA 3U9PL 4FULA 1KYFA 5A2JH 1BHJA 2BC4B 3THWB 4JFSA 2D5LA 5TPZD 5JLJA 1W0WA 3VMNA 1FYXA 1HTYA 1XH0A 1JDVA 1GL6A 2VAVA 2ZJ3A 4CBPA 1CSEE 2F4VB 2CLZB 3QYJA 3PHGA 3KPSE 2X42A 1WCIB 3AY6A 3I6LE 4OGKA 3BI9X 1KY4A 4OQTH 1KMHA 4KAFA 1HOCB 4LE2A 2CDAA 4P2RD 1KOAA 3CGTA 1ZGAA 1HNGA 1C12A 1RLUA 1CD9B 1GXEA 1UK9A 3OGCB 1N6IA 1EEUA 2H3XC 1NLZA 3UMNA 4BZ2H 5IKCA 3BYTA 3C5ZB 1LDEA 4FT2A 2BRUC 1QLFB 3V42A 3UXEA 4DCVA 1AGPA 2ZUFA 5EQDA 2CFCA 5CM1A 2A0XA 1SWVA 3WLBA 4AFNA 1Y9AA 5KYUB 5JC8A 3M4YA 5LBSL 2WKLA 3X3GL 3WIVA 4JM2A 2X9XA 1MJ8H 2FSVA 3BTSA 1L3IA 3OLXA 1MJUL 3K81A 2NU9B 1PYOA 3RWOA 5AOAA 3KXKA 4E9SA 4Y67A 2R6HA 3O03A 2GDZA 2ENJA 2RH9B 4NQCE 3TXYA 1N78A 3M45A 1G2OA 1QD0A 8FABB 1ESEA 1B1AA 1QBAA 1E2IA 1T5HX 1IN7A 2EDRA 2KPOA 4POZD 1M6VB 4NOKA 3V8MA 4PNEA 2IGFH 3WIFA 1PR2A 2XLCA 1JWAB 4DCGA 1UJTA 2HWKA 1NXTA 1NAMA 4YL4A 4AQ1C 1MRDH 4H13C 3UBXA 2GXUA 4Y16A 3LO5A 5CXPA 2GM9A 3BKJL 4G7YH 2ZR0A 5I51A 1BX3A 5B3SB 4A6YA 4ZFOB 1T0IA 1ORQA 1VZIA 2WWMC 3CZFA 2BE9A 2KE5A 2IOOA 3WTYA 4M8VA 5D1ZC 3IE4A 4F7MB 3QXVA 4OQNA 4YMVA 1I1AC 4BO3A 1TFPA 4P08A 2CUNA 2F9BT 4G1FA 1DBJL 1ZL2A 3RTGA 2X1XR 1N25A 1ZP6A 5KC9A 3DV6B 1OI4A 1VHLA 4IFEA 5JIIA 1H9AA 5AKZA 2B83A 1DBKL 4Z7IA 3T4UA 3K5RA 1HL3A 2OO3A 3DAGA 1CURA 2BZDA 3SCMA 4JPIB 1OOAA 4UEOA 1R5IB 4IL5A 4EPSA 3IU4L 3HTLX 4X4MA 2Q20A 5I9LA 2IYNA 3KGUA 4W9RA 4OQTA 5KTRA 4GOND 3BAXA 5FOSA 5K51A 3TAUA 1RZVA 1Z9MA 2ADYA 4IS3A 4IH1A 1DE4B 4I5EA 4G9EA 3AFLA 1ZM3A 3IAHA 1C7RA 3KR9A 5FA6A 2EH8L 2WFLB 1HBJA 1ZHBA 3P0RA 1E9DA 4K9SA 4XMKL 3NDZE 5DCYA 3FKSA 4FN4A 1OP3H 2JKZA 4H18A 1I1HA 3SOBH 1MW0A 4UD6A 2C3HA 2VR6A 1HO3A 3RV4A 1WT5A 4GAFB 3VG0L 3L84A 4MVJM 1B88A 2IPLA 2OE2A 1ZVJA 1KZ4A 4QXUH 4P2RA 1T1WB 5HF9A 4L8LA 2JVJA 1JS4A 3ZDWA 1ZGGA 1A9EB 3FTPA 1GGCH 3ZDFA 4KN9S 3AU1B 1ULVA 5CHNA 3GGDA 1K2DA 4G8EA 3T0ED 4BQCA 2Y36L 3E9QA 4ALJA 3TUZC 3KPOA 4I48B 1D6NA 4GKJB 3KQVA 3A3YA 4XRCB 3GRAA 3UO8B 4WI4A 1EJ8A 4DV4B 4P59H 2VZLA 5CA1A 4I4TB 1OHQA 3L3DA 4FHBD 1JDCA 1XX6A 4KG7A 3WY4A 1JOIA 5AYUL 4I0WB 1Q9LB 4BLRA 1WMAA 4NJMA 2VZ9A 3OZSA 1JJFA 3DL2A 2ZYWX 4MYRA 1R00A 3VNSA 4K3EL 4L85A 3W9BA 4U1HA 1TCRA 4H35A 3BPNB 3HXMA 6TAAA 1KXJA 3HLTA 5AL8A 3IAUA 4CV2A 5A5DA 2DERA 3IQDB 1Q1JL 2PMBA 1LRKA 1N59A 3KTAA 4GQIA 2C7GA 3QEUA 4GAJL 1BGXH 2AI0L 3LD8C 4YS4A 2JKVA 1ZWIA 3VYUB 4N2KA 2EVWX 4PYMA 1N68A 1HG1A 2OM2A 4GG6A 3IIKA 4ZTBA 4AQ1A 4Q4LA 2Y1LA 4RAUB 1WBJB 4FQ5A 4IDCA 4HIJA 1TDQA 4M1YA 3JQCA 4J23A 3EO1B 1JHUA 1G0YR 4U2KA 2FW6A 4M7KH 1VRWA 2J21A 3FULA 2O5EA 1XVAA 3GSXA 1TM4E 5L3SA 4H4EA 1FYFA 1QB8A 1P19A 2X9NA 3KEFA 3EJWA 4G6KH 1XNJA 1X15A 4MVJI 2WHRA 3H1AA 4NDAA 4Q66C 4QE3A 1ZJJA 2Z30A 3MMEB 2C9OA 3VB8A 5A7BA 3GNTA 4E5NA 2BC4A 4F33B 4LLQB 1Z9SB 4HDSB 5LYJB 4DEPC 3QIWC 1QWNA 3MJ6A 3TH5A 1XKLA 3UANA 5L45A 3QKSA 3HJFA 2AEPL 3PP3K 5C0AA 3LIZL 3KH3A 1PEDA 4QDGA 1Y7VA 4Y1EA 4OLXL 3NALA 4HPHA 3FSOA 1KI2A 5LD2B 3PHIA 4HWBH 1BWSA 1LHZA 3UIZA 3NIGB 5JS8A 3GB7B 1R19A 2VSFA 4Y0GA 3NRPA 3D54D 1GW6A 4QICA 3RS3A 3OGCA 4P4SB 3JVFC 4LEIA 3A1WA 1S9WB 3TZQA 4A91A 4BMXA 4H15A 3C70A 3B70A 4ZD3L 5SWQA 1O5OA 2N9UA 2R6ZA 2QLTA 4FQCH 1A8SA 2WT4A 4IU3A 4E88A 1TD9A 3NRBA 3G2MA 2L8AA 1Z4NA 3PAYA 2Q5HA 3PUUA 5JJBA 3HE6A 3LPNA 3R5FA 1JBEA 4WESB 4Z7VB 1U8JB 2GYVA 2LU5A 5F3FA 1OBVA 4UBMA 2WQ8A 4MUMA 4IXTA 5H35A 3DBIA 5AJYA 1IM9B 5IJVB 4RNCA 3MWYW 5GAJA 4BQQA 1OTUC 2P1DA 3F7TA 3QXSA 3OQMA 1DQIA 1HGXA 4PJDF 1E6KA 2OMZA 3ISTA 5C5IA 3N70A 3PX3A 4U4AA 3U3DA 1U41A 2O5YL 3H9ZA 3W05A 1HU8A 1WW8A 1ZK5A 3IUEA 1F11A 3G1TA 2A7XA 3UAXA 1LBIA 1L7PA 2GNPA 2EQAA 5AVWA 2CL7X 1JZHA 5FEMA 3PNQA 3MRBA 3I04A 2C3GA 3FC8A 2FHPA 3UJHA 4GMHA 3WLPA 4MX7B 2GPYA 2FUG6 4MR7B 1NFQA 1T29A 4JJFA 2BHFA 5E3HA 4NBKA 3SX4A 1X9HA 4GRMB 4WJ5A 4FIZA 2CE2X 1SKUA 2BAGA 3WMFA 1KYVA 5JALA 1E3ZA