2VC2B

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist l-739758
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
461
structure length
457
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 126
structure length 457
sequence length 461
ec nomenclature
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vc2B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vc2B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vc2B03
4NENA 5KYYB 3PPVA 1T0PA 4HQKA 4CNBA 2NUPA 2VDKB 4UM9D 1M2OA 1N9ZA 2ADFA 3EOBI 2VDNB 4G1MB 4UM8B 4Z7NB 3K6SA 1IDN1 3T3PB 4WK2B 5ES4B 3Q3GE 4WFQA 1PD1A 3E2MA 1JEQB 1JLMA 5HJ2A 5KYNA 5E6SA 1FE8A 3EFOA 5KYXA 1OLZA 2NUTA 3VI4B 2ICAA 2VDQB 1AOXA 2XWJI 3EG9B 4G1EB 4O3UB 1ATZA 1AUQA 4O02B 1M1XA 1MQAA 1MQ9A 2VDLB 3ZDZB 1BHO1 3ZE1B 1M10A 4MMZA 3FCSA 1QCYA 3IJEA 1U0OC 1DGQA 1U0NA 2I91A 1U8CA 1PD0A 1XDDA 2VDPB 3EGXA 1JV2B 3NIGB 1RRKA 3PPXA 4JX0A 4A0QA 3EGDA 1IJBA 4IXDA 3ZQKA 4K3JB 1T6BY 3QA3E 4HQFA 2M32A 5HGJA 1IDOA 1M2VA 1ZONA 4C2AA 3IJEB 1LFAA 1ZOOA 1L5GB 1JEYB 2P28A 1M1UA 1FNSA 4MMYB 5E6UB 3BQNB 4IHKA 4NEHB 5E6RA 1N3YA 1M1XB 3OL2A 3AL8B 3AFCA 1SHTX 1SQ0A 3EG9A 2X5NA 4F1JA 1TYEB 3EOAI 1MQ8B 1RS0A 4DMUB 2VDOB 3EFOB 5E6SB 5KYXB 4C29A 3AL9A 1JEQA 2VDRB 2I6SA 2XWBF 3IBSA 3PPYA 4G1MA 1PT6A 1NA5A 1MHPA 3ZE0B 2NUPB 3OKWA 4NENB 5KYYA 3F74A 3AL8A 1ZOPA 2O7NA 3F78A 4BJ3A 3OL2B 4WK4B 3OKYB 2UZYB 5KYWB 4C2BA 2ODQA 3RAGA 4MMYA 5E6RB 5E6UA 3ZDYB 1SHYB 1L5GA 1JEYA 5KYUB 3K72B 3VI3B 3NIDB 1M2VB 2I6QA 3HI6A 3FCUB 5HDBB 4HQOA 1XDGA 4M76B 2WINI 3N2NA 3EGDB 4O3TB 2XGGA 3GXBA 3PPWA 3ZDXB 2NVOA 3EH1A 4F1KA 2B2XA 1JV2A 5LN1A 3EGXB 3HXQA 4PN7A 1U8CB 3K71A 2ODPA 2IUEA 1YVPA 4MMXA 3TXAA 1RTKA 1AO3A 4GZ8A 2WW8A 2P26A 1BHQ1 1CQPA 1Q0PA 1YUKA 3FCSB 4JDUA 4MMZB 3V4VB 3NIFB 4O02A 1MJNA 2QTVA 4CN8A 4G1EA 4WK0B 2VDMB 4FWWA 1SSLA 3HXOA 3M6FA 2NUTB 4XW2A 4Z7QB 1UEXC 4CN9A 3T3MB 4IGIA 3BN3A 4MMXB 3K6SB 3K71B 1OAKA 1XUOA 3ZE2B 3EH2A 1IJKA 3BQMB 3TVYA 4Z7OB 1CK4A 1RD4A 4HQLA 1MF7A 1YVRA 4UM9B 1DZIA 4HQNA 1QC5A 2VC2B 3K72A 5KYUA 3TCXB 4FX5A 1SHUX 1PCXA 4WJKB 3V4PB 1QC5B 5KYWA 5BV8A 3TW0A 3NVQA 1V7PC
chains in the Genus database with same CATH superfamily
1RWXA 1QK4A 3BZFA 1G7PA 3LECA 5KOYA 1TZ8A 4R0NA 2FB4H 1ZRMA 3QQDA 4MCNA 4HIQA 5DBOA 3DQZA 2GBLA 4Z8XA 1MPAL 3CFCH 5HKOA 4NQXA 1KCRL 5JXIA 3ZUCA 3ETTA 2VL7A 4FXKC 4OGAC 2G3ZA 3BVXA 1FAIH 4DGYH 1XMXA 3TJHD 1HE8B 3KEGA 4GDFA 3Q1KA 3BE1H 2DJMA 3V2HA 3QUZB 3NATA 3AF3A 1BYUA 5HF5A 4AP6A 4DNLA 1HDMA 2BY2A 4EUPH 3S81A 4W9JC 3ZQ6A 5KBKA 2NX5B 4ICWA 1RC1A 3BPCB 1IBBA 1PT6A 1S78D 3AAZA 5AEAA 1KARA 2FWIA 4OHUA 1DRWA 4YDIL 1EU1A 2H08A 3S99A 3QPQD 2O2SA 4W4NA 5DDIP 2HA0A 3QXJA 1IWOA 4LVHB 4YSUA 3B2VH 1XP8A 3C2QA 1IJEA 2ODPA 2RIRA 2YW9A 4O5AA 2OJ1A 1C3VA 2OJEA 2BJMH 1XU4A 3ZHUA 2D7PA 1NCNA 3AR2A 5IF9A 4YO8A 5BWLA 2YYSA 3PJNA 1P2UA 3WELA 3WGVB 1IYZA 2QAGC 3HZKB 4A67A 4PBDA 1OXSC 3SPVB 1MX5A 4JFDD 1VTKA 1H3PL 4YP7A 2AVNA 2N9UA 3VR5H 3CLUD 1EHAA 1KB9J 4WFEE 2XBUA 4AM8A 1I1AD 4PRLA 4WV3A 1S4IA 3ETJA 4G83A 1DIBA 1QLEH 2BSTB 2VDQB 1MXFA 4QDTA 1T8RA 5E9JA 2X5PA 3ANLA 5LJYH 3GFFA 4OJKA 1KOLA 1V7ML 2DM3A 2CCVA 2OGSA 4KQ6A 3AXHA 1KVTA 4NARA 3MJVA 5IMBA 4WI1A 1YT5A 2X6AA 1C1DA 3RQ3A 3HS0C 1XF9A 4KXZH 2OMWB 2E9IA 5CU9A 4ZSOA 1JERA 3JRXA 3KJIA 4B47A 3F04A 2HJLA 5KWIA 2YWJA 4XPTH 1QIMA 2DPHA 4ZDKA 3H7BA 5FW8A 4TYWA 1M05B 3K3QA 3PCXA 1BAWA 3QRLA 1TQ6A 4FPXA 5FYLE 3THXB 1L6IA 3U36A 2WINI 3OM8A 3N06B 4NO2A 3D7RA 1NC2B 1PT9A 4YXWD 1KYFA 3B3JA 2CO7B 4HB0A 1RYZA 1TUEA 4Z2AA 1LL1A 4YMIA 4D98A 3LCRA 4HWEH 3FPGA 2IMMA 1R1CA 4NQEB 2NU6A 3NNDA 3PR2B 3PBKA 1MD9A 1E65A 3RREA 1KO4A 3K9LA 3G7TA 4CW1B 1CPYA 2QGZA 1Q9KB 3HR5B 2J4WL 1YA4A 3KSDO 4OBSA 4PS7A 5GSVB 2DL2A 2EACA 5KYWA 3TZEA 1EFPA 3F8UB 3C6SB 2Z1PA 1G8SA 4PTUA 1ISJA 4PIMA 2G08A 4AIZB 3L4JA 4K87A 3L1EA 3SYRA 1JLMA 3HTLX 1SFDA 3WTVA 4MR7A 2WBLC 4U49A 4ZFGL 4Z0BL 2F8OA 1EFDN 4J6IA 3O2VL 1O0VA 4UATA 4JG9A 3ZZUA 1F8TH 1A65A 4O4JB 5JPDA 2POCA 3UCXA 1BAFH 3GGDA 4L8YA 4PQXA 1XFDA 2A1IA 4BV3A 3PHIA 3HG5A 3SMQA 1E79D 1IAKB 4LBZA 2BHFA 4CKQA 4ZVRA 4KNTA 3DEJA 1IGTA 1XSJA 2IH8A 3X13B 3ZWPA 4FQHB 5IYZA 2QPFA 3GOHA 4IINA 1K89A 2IV2X 3BFOA 5LKRA 4C4OA 3MO1A 3FTNA 2X9GA 3DWTA 3VXSA 4QRIA 3HBNA 2OBFA 2D4HA 3Q2LA 1KVSA 5L4LA 3H2QA 4J0EA 3UHJA 3NUKA 4TLSA 1JYWA 2G9KA 4HUWB 2HEIA 2NXYB 4AF8A 2FO1A 3SDAB 3ZTEA 3ZIAA 1X5ZA 4F37F 1KENH 2YQZA 5LA6F 3VTKA 4Q97A 2Q0ZX 5AXDA 2W9DH 4GX0A 3T0EE 3UCFA 2W37A 4Y5XC 2CB9A 3OX8A 3FHQA 2DMBA 4MDHA 4IFIA 3ORJA 5CAEA 1GO2A 1BBDL 5K0GA 4DF3A 1FPQA 1DN2A 1Z5PA 3A1UA 3M3HA 4K7JA 1CYDA 2QD5A 4TTPA 4QODA 2ZXBA 2FN4A 5AQEA 4BFUA 4O4LB 5TQ2H 4LE2A 5JSKA 2WWFA 3P2KA 2YXWA 4O2LA 3BEDA 3BFJA 3AKYA 4F60A 1ET7A 1YMVA 4ND8A 3L7KA 2ADGB 2YDXA 1DTWB 2VR5A 1GHFL 4KLZA 4M7LT 5D8JH 1AIFB 2V7TA 3RPEA 3UCQA 2LTAA 4I55F 3ZMEA 5JW6A 4YDLC 2IITA 3VR1A 1KFGA 1UOWA 2DMHA 2B0SL 4XVJH 3WLLA 2PMEA 5G2NA 4JK0D 3PPYA 1D2EA 3D2UD 3HCAA 1X0VA 2R2HA 1B2YA 3OP1A 5ITBL 1ZJJA 2PLWA 4GOLD 5DRXB 1GLNA 2AOTB 5KKAA 1HN1A 2A5GA 2Q5OA 3MUY1 4HJIA 4FXTA 1YRYE 3EMKA 3OAAD 4ZCIA 5I1CL 5ERWB 4JLDA 2GD1O 1EGAA 2HBYA 3WB9A 4L3FA 4ZJZA 4CR8A 5DMJB 1N5IA 4PV9B 4GAJH 3LRSB 4WN9B 2PWDA 3PF2A 4QQFA 3T1HB 5B6JA 4MGKR 1WQ1R 3O0TA 3MLVH 4FDTA 2HVKA 2VR7A 5EZLB 1KMGA 2Z4SA 4JJ5B 3NTUA 1JTPA 1NUNB 3S27A 1Z0JA 3V8NA 4L8WB 2N4IA 1KAMA 2YXVA 3OBBA 1CQYA 2QSJA 1P5UC 3QRBA 3ZW3A 3PHJA 1MENA 4B40A 4NN7B 4R9SA 2O2YA 1LD9A 1I4FA 1JF1A 1N0LA 3HG0A 4UU9B 4B75A 2OCLA 1QP4A 3BJEA 4XVJL 2KZKA 3JQAA 3U0WH 1U1EA 4UT9A 1XB8A 1H0HA 3MUHL 3WDMA 3LZPA 1QTIA 1THGA 1JJFA 4KK4A 3V1UA 3AXIA 2DHEA 2MOKA 1OFGA 3VR4H 2EDFA 2XTNA 5CNHA 2QMEA 4PO8A 1S7RA 4AJHA 4URTB 2I80A 2VP9A 2YXLA 4YSOA 5L3RA 2GAZA 2Y0DA 3INOA 1XTMA 2BMEA 2QZZA 5DURB 2C7GA 4FKHA 3BD8A 2GF2A 3G89A 2YRLA 3JYPA 3EB9A 1S2EA 3PL5A 1GNTA 3DV4B 1W36D 3ACBA 5BXFA 2DI9A 2VXOA 1MIOB 4HI0E 2X9ZA 4L0ZA 5IH7A 5T3ZH 5F1OA 1NEZB 4CJ1A 5I4IA 3KPSA 3DMNA 1EDZA 5A16A 1CB4A 3OX8B 3ABLB 4EO5A 5KG9A 4YFLI 4OBWA 3HVKA 3ANSA 1E3LA 2BP5M 5EJ7A 3VXUE 1Q7TA 3Q3HA 3LLCA 2ZONA 2BI4A 3RTEA 2E4VA 1VGQA 1JGLL 3EPLA 1CVRA 4DETA 3ARVA 1G7RA 2SEBB 1ZLUK 3K6NA 4R68A 3BYYA 4QFBA 2BSSA 3OMLA 1KULA 3FB1A 2SBTA 3W5MA 1W5FA 1A5BB 3JQCA 5KI6A 3VNUA 4AQAB 2QKIB 1NGPL 2EL7A 1I4WA 3LXMA 1G7MA 3MO1B 1AO7A 3IQHX 3DTXA 3LUCA 3O4VA 5CBPB 2YKGA 3CNOA 3EMVA 2BEUA 3UTTD 2X8LA 1GGIH 1IBMB 2H6PB 1E3QA 4CIWA 5LGHH 1NE7A 1HHKA 1HYBA 4FG6C 5G0WA 1M75A 4BMVA 1YD7A 3AYXB 2J6WA 1FBNA 2FX8L 3FZGA 2ZAOA 1IM9B 1DO6A 3NZHH 5E6IC 4MQSB 5IROA 3INUL 3SR4A 1SQ5A 4PAQA 1DQJB 2F7PA 3QOFA 1BOOA 1Q91A 3E7XA 3H3FA 2KDYA 5DM4A 3AF1A 2XN2A 1J8HB 4EYGA 3EUWA 2PTTB 2R8OA 4UAOC 3I04A 2YH2A 2ZIXA 1M53A 5IVIA 2WRZA 3N1PC 2JB5H 5IWLC 3VFOA 3DBIA 3VNSA 2Q2QA 2QROA 2YN0A 1G9SA 3D7PA 3ACDA 5KYWB 4FXGC 3FHJA 4FFDA 5IVDA 5PGMA 2QMZA 2Z7WA 3M5PA 3MBXL 3A27A 1CFJA 4XIJA 4N3AA 2QGFA 3FF4A 2N01B 2GUWA 4G5RA 4JFDA 2GJ6D 1NEPA 4IKJA 1EM6A 1AQHA 2LHAA 2PDAA 4PAZA 5IHUL 4OCRH 4UOJA 3VR3D 3HPLA 4KI5E 4BCCA 5JMTA 1GGIL 3RIAK 1F2TB 3DYVA 3VWKA 1L5WA 4M0UA 1C3OB 4IDFA 3TOVA 3DTXB 4QVGA 4FYIA 3E3QE 2A9ML 4Z9AA 4IKOA 3F46A 1TVEA 4HUUB 2C7VA 1L0QA 1H8OA 4NF2A 2VNKA 1Q3TA 1F3JB 1GTG1 2G5PA 2ZOKA 5EJMA 3IEVA 3M46A 2ZRKA 4AY3A 3NJNA 2VI5A 4XIYA 3DLAA 4DKEL 3RVXC 2CHUA 4HCFA 1INQA 1C1DB 3CFYA 5FTMA 1WXIA 2OS7A 3MS2A 3BKCL 1V7MH 2RACA 5JCOC 4AI7A 3LTNC 3UTSD 1WX1A 3L0YA 5FYKE 4UAHA 2CL5A 3THYA 4OGXH 2XQBL 4KDTA 2VSOA 4BJLA 1DG1G 1B4DA 1PR1A 3KPLA 3BWUF 1A4KA 3EQ6A 2GJPA 5I8EB 5JMOA 1L0YA 3C08L 1R64A 2B7DT 2HIMA 3FB4A 2JBWA 1R0YA 1OP9A 2MSDB 1Z26A 1CD8A 1XMEB 5CDHA 1V2GA 2IPKB 5B57C 5AK6A 3QZUA 4RKRA 4HVTA 4IYKA 4MYRA 3D0QA 5I30L 2IT1A 4OUDB 1COWA 5DO2D 3VFTB 3JQGA 1XCMA 4IWYA 2NVUB 4FOSA 1T3GA 1SC9A 1XV5A 4RA3A 4PGGA 4TLUA 2Z95A 4YDMA 2P2ZA 3K5IA 2ICWB 2VN4A 1RZKH 4PJ8C 4TKUA 4DZ8B 2CO6B 4ZUTB 3MWEA 2F1AA 4V1DA 2XCTB 4GP4B 1UZUA 2Z3VA 3Q43A 4L15A 5ENVA 1JF1B 1K9TA 1N0LB 3T7JA 3PP4L 4X71A 2Q86A 5C8VA 4RCZA 4PHHA 2VRKA 1NPNA 2NXZC 3VYTB 3EKCA 2ATAA 3PSHA 4BFTA 2WLZA 2P79A 2YLKA 2XT6A 1KS2A 4B3FX 1SYSB 3N8DA 2VPQA 1ILEA 5FUZL 4GICA 3RS8A 3QUZA 2B2XL 2Q0HA 4GDMA 4YCAA 1PLJA 4RHYA 3RS7A 1CICC 3LXBA 5EFIA 4U6VH 1VBKA 4NCJA 4LKCA 4GAJL 4Y16A 5AJUA 2VQEB 2BI8A 4KUZH 4NQXB 2V3WA 1F2QA 3OKDB 3U7IA 3T6VA 5EJ4A 5M34A 4PWGA 3EJCA 1T5SA 1P80A 3VC1A 1UGNA 3FLAA 4N2DA 3AF6A 3P4OA 4IDOA 1RZ8A 1U8IB 3IFLL 2GHIA 2W2LA 1WCIB 3R7BA 1YLBB 3LVRE 1EE9A 5IMMB 4PHFA 1LMIA 4CMIB 5HVNA 2XQVA 1RI4A 4NOLA 1VLVA 1T36B 1DJPA 3JQRA 1ZBDA 2HFKA 4MTCA 2ALWA 4R1MA 1HR0B 2DLIA 4R81A 1ILSA 4D9NA 5I5EA 4RGNC 4PRPD 2AK1L 4JFZH 3UTPE 1E1RD 4TZTA 5H1YA 3WS6C 2KBFA 2OL3H 2C3GA 4U6XB 3GLRA 3IUYA 5TQ2L 4AJLA 1PEZA 4M8VA 2L19A 3FUCA 4MCMA 2W65B 4JANA 3HJFA 5KQMA 1C0LA 1TUBB 1DSWA 2B1JA 3P2YA 1C3OA 4IBLT 4E5SA 2PWYA 5CAEB 4BKLB 4FOLA 4J0DA 4QVKA 4RJKA 1YEKL 4EZLA 5DX0A 5KWSA 1NLMA 4IWNA 3HBZA 3M1IA 1CUYA 1KY7A 3L16A 4GYBA 1XCOA 1JZ6A 3NJMA 1W6UA 4YE4H 1FDWA 3CY6A 1GQ2A 5JDSA 3EIEA 4IDDA 1NOIA 1LSUA 1SOQA 2ONJA 5JUWA 1DX4A 3GW8A 3ZH2A 3SVLA 3MMSA 4L4XA 1V4VA 2IOFK 2TMYA 4BLVA 1XB2A 5IN5A 3KSUA 1RJZB 4KY2A 4NOMA 1Q0QA 2ZG2A 3EDOA 2IW3A 1AGFB 1JKJA 4UV4H 3IWVA 1XTIA 3TW8B 3NEJA 5GGYA 4KX7A 1VLQA 4WJZA 4PJEE 2SCUB 5M2QA 2NUPB 2Y3AA 2PJRA 4PP1C 5F12A 1MSPA 4WQOA 4MUHA 3N28A 3WGIA 1E40A 5IYZF 3CU7A 5DQJA 4HKZA 4TLDA 3L2MA 1ZR2A 3SKOA 4XDGA 4WZAA 3HG4A 3KHOA 3UJJH 3QPCA 5D5ME 1UBEA 2QL9A 1ZD9A 3ZRCC 4NC2B 3I75B 1HHKB 1UT5A 3HI6H 1KJMB 4MR7B 1NCWL 1LLFA 4IX1A 4E03A 1T8UA 4QOGA 2XOKD 3L8YA 5DUMH 5EWJB 4BEWA 2Q6KA 5CUQA 1NCBH 2RI6A 1MHTA 2WMPA 1N7MH 1W8NA 2IPMA 2E47A 2B08A 1NJFA 4EXKA 2EHDA 1WFMA 2R1YB 5DSCA 3VVCA 3Q5TA 1VIYA 2NVWA 4JFOA 1BGXH 3N5CA 3G2LA 4PWKA 1ADFA 3IBYA 3N7AA 4E4RA 4HKXB 4HC1A 1E0DA 2C9YA 2Y5TA 2GTHA 5GJSH 2PMZA 2G09A 5CHEA 5H81A 2ZNWA 4KQ0A 4NQEA 1WA5A 3HSKA 3FNKA 1WVZA 3TJEL 5KG9B 5DWUL 3K15A 1MV8A 1RHQA 1EIBA 2CO7A 3BEWA 2Q0SA 2YUTA 2P78A 2IOYA 3IQXA 4L4ZA 3PIQB 4MX8A 4P2RD 4MAZA 3LIZH 1KQ3A 2A6PA 2YJ4A 3L4BA 3E35A 1KTLB 1G6RB 1UWGL 3KLOA 5IEJA 3TECE 4N0UE 5DQDL 3QDMD 4EMUA 2J3HA 2GLUA 3E22B 1WCXA 3PC8C 3TQSA 6ABPA 1Z25A 3ZVNA 4WUVA 3ND9A 2JGJA 5K5EA 3S1AA 3HVJA 4IK7A 1JI3A 2BGTA 4TV3A 3CKLA 2PJZA 3N9GH 2D3LA 5I75B 1P4AA 5DXJA 5FLEX 4G9FD 4BNGA 1U4EA 1MTOA 5IANA 1UDRA 2Q46A 2R6DA 4XWGA 4O4HA 3JQAB 3CB4A 1EVQA 1FHGA 3SX4A 4Z7QB 2EDYA 2ATCA 2O3RA 1U0SY 5E7FA 3CH8A 3EOTH 3QUZC 2ZM6B 5E03A 4F7DA 5JCJA 4P5SA 4C4YA 2EEPA 4TOIA 4WLOA 2HF2A 4NOJA 4S1PA 2AJDA 3DVAA 5KTRA 2IAND 4UTAA 4KZDL 3MGCA 3ISWA 2VS1A 3UTSE 4OVUA 3KYMB 3FUEA 2WFLA 5A03A 3Q8BA 5KSOA 5E7QA 1EHNA 3U46A 1ZR4A 5JVDF 4G1MB 4RQQA 1IEBB 2BP8B 1T8WA 5JSFA 1OW0A 4YP5A 5HJ2A 1ZN2A 5A43C 1UXWA 3B51X 2O8BA 2WZBA 4HDRA 4LHZA 5BPFA 4LLYA 2OOKA 4KYVA 4WXYB 1XRPA 4FCHA 3PS6A 4XLLA 4UILH 3HZMA 3TPCA 2D4FA 4ZXBD 5EUKB 4R1UA 3LY8A 4KMTH 5IQ9B 1J7JA 3C6LA 1YPZA 3L3OC 4NIKB 3B1ZA 5DT2A 3VFPB 5HYQA 2CU9A 3CZQA 5GPBA 5J6SA 2ZK7A 2TRHA 2DY1A 3EW3B 3IM1A 4LFHD 2OWEA 3V1YA 1JRLA 1ONQB 4ONHA 3H6HA 2VDOB 1TTQB 5GISH 1RZ3A 1GZSA 1S9YA 4FYKA 5L3QA 3U09A 4EUEA 5LQAA 1QOZA 3QIWA 3QFFA 2EJVA 3FUFA 4AY6A 2Y36H 4MWSA 2R5FA 3WLNA 3RFRA 1HE8A 3ZBPA 3STWA 1BLNA 3BRSA 3WYRA 4DTGH 3N2NA 4UQLA 1IARB 2R6R1 1FI8C 1T04B 2VWQA 3BWUC 4RD4A 2Y2VA 2I6XA 3VNRA 3L2NA 3DTNA 2Y2YA 4CJXA 2JD1A 4MLCA 3IJYA 3PGCB 5DK2A 2K45A 4V2BA 1CUSA 3RSHA 2YPKA 1CZRA 5AVYB 4XXCC 4G6KH 1U63A 3GRWA 5C0BA 3VG0L 5ECJE 2FMXA 2XMBA 4GRLB 2VXUH 4BZ1L 3QPVA 4PY7A 2F7OA 4QHLB 2HN7B 2I3DA 1TIKA 2VQ4A 3EBHA 3WIVA 2BEVA 3QPBA 1JHPA 1PFYA 1YB7A 4W9EC 3G04A 1S5IL 1FDLH 3HYTA 4HRXA 1GNQA 1HOXA 3ROGA 2AW2A 2WNKA 4HWGA 1A2QA 3R8XA 2GITA 3CXDL 1IG0A 1IC7L 2A6DA 1PX8A 4WFHD 4WW0A 5HKAA 3EEQA 1OJ7A 1NCHA 4Y7MA 3QNYA 5K01A 4FLSA 3OUTA 2I91A 3ER6A 2YVUA 4YDHB 3NP9A 4F3TA 3ZKND 1W8IA 1N7ML 2Z31A 2XRMA 4B7AA 4A6PA 4C3VA 4YMVA 3JYLA 5JAUA 4DGSA 2JWHA 1G8HA 1FEZA 3QHPA 4N0RA 5JI3E 2Z8VC 2WE7A 1D5BB 1I3RB 3H9SD 3DW1X 4DHLA 5AVZB 3RUHA 4RKFA 4HAVA 3X2EA 5CGMA 1VHJA 1A4JB 4I13B 4ZOCA 3LEXA 4IIQA 1A47A 1L4IA 2XWJB 2D13A 3UBXG 4XPHH 1K4CA 1AA9A 3F01A 2F3PA 1E9SA 1VAHA 1OFUA 3ZYIA 3WA7A 1I7LA 4F7CB 3V8BA 1ZANH 2JLRA 3B9BA 5HXAA 2NN3C 4XD2A 2UYHA 5IROC 2P5WA 4B7UA 1E3WB 2GJZA 2Y1OA 4WKPA 2MR6A 4GKJB 3AL3A 1IRAY 2JFGA 2CXUA 5BJTA 1ERNA 3LQQA 4XPHL 3BSYA 1NW6A 1ZLEA 1Y33E 4Z3DA 4HIHA 4JY5H 1A69A 1OI2A 4LJ6A 3WGYA 3TGXA 2E6KA 1JLSA 1UA3A 4GI1A 1KNOA 4H1WA 3EXHB 3HR5A 1KKMA 1EWRA 1SHWA 2B5VA 9PCYA 2J2ZB 3RSFA 3NIGE 5G40A 3O2DL 2PP7A 1AKEA 2L8AA 2DSTA 4WQMA 2G06A 2Z6FA 5T5NF 3M8KA 1SOWA 1TU3A 4NO2B 3LUPA 4BNMA 5KKCA 1JNHB 2GI0A 1S9VB 1SUEA 5BR7A 1IC7H 4DTIA 2V9QA 4MJJA 2C8NA 1UJTA 4YLEA 4AURA 2AZUA 2CYBA 4LOIA 4W8GA 3C60B 3ZCRA 3FNGA 1HNFA 3QZLA 1ZOPA 4KFRA 5EERA 2JZCA 4QTFA 4AVYA 3GMTA 3G5VB 4MUIA 1ODTC 4B80A 3QX8A 5C08E 3CLSC 1XEUA 4PAGA 3J8F7 3G6DH 4GOMD 3SO3B 5GS0C 3EFEA 4RDXA 4HXFB 3R19A 2I55A 1MRDL 3BHIA 2CGRL 4XOAA 1NKSA 3AXTA 3HWX1 1G6OA 4YI5A 3HN5A 1A3QA 3WXWL 4GBXB 1FPMA 2UVEA 2HRBA 5IQLA 1MJ5A 1OCCB 2BIIA 4X5QA 4N03A 4ZVMA 5LG6A 3IDSA 4G3XA 1H5BB 4XJXA 1UA7A 5GGSB 4KO3S 2ZKLA 4K9OA 4E46A 1P6WA 1XR8A 2AQ3A 4D0CB 2X76A 3RTAA 4NUQA 3Q72A 1XG5A 2BERA 2VDUE 3B1JA 3AVVA 1I3MA 2YHGA 3O4OC 3QIWC 2VM3A 4JEHA 1QAMA 1OW3B 2BE7A 3ZJ5A 3MNFA 2FHFA 8FABB 2XXBA 1QF6A 4CMHA 2PUEA 3HOGA 4HQFA 3VYPA 5D2CA 3QXTA 1CFSA 1NE2A 3GJFA 1B90A 3UZEA 5IBLC 3BWCA 4D57A 3IBFA 3TN0A 3W3ZB 2I8AA 4RDQG 4WI7A 5H4YA 2PUJA 4JZOA 1GXEA 2ZTSA 1NGXA 2J0UB 1QOQB 3QMVA 4DRZA 4NBVA 2VDVE 4GPIB 2BP0B 5IFJA 2D59A 3JZAA 3FFOA 1A7BA 1CTQA 4M6MH 5EIQA 4LJYA 5DM60 4OOEA 2DQYA 4I36A 3B6IA 3I73A 4OFQA 4YDQA 3EE6A 4EKDA 2A4EA 3BPOC 4IIJF 2AXJA 3OPQA 3OLEA 3TLJA 1A98A 1FNSL 1WAAE 4FVTA 2HF9A 4KMSA 4FXGB 3ZGOA 1KCVL 4RTKA 1CQKA 4L85A 1FDSA 1ANUA 3B8SA 4R0LA 3I2YX 1E5UI 3BEVB 5BYBA 2BFGA 3VXMA 1J5DA 2ZITA 1FL6A 1KAHA 5TT1A 4U1IA 5CSBA 5AW9B 2BELA 3LIZL 4RMWA 4AO8A 1Z0FA 2C2XA 5BPPA 2A1WL 1FNHA 3TO2A 5AYVA 2EYQA 2FZGA 2WN3A 1YU9A 2JW5A 3OXSB 2H0QA 3MLUH 2LRHA 5EUBA 4FINA 2K70A 4TSCH 1F8XA 3DE1X 4TV9F 5L6LB 3NAQA 3G5YB 3T71A 2PKCA 4TTTS 2BJWA 2CJ3A 1V3QE 2QYTA 4Y5VA 4G8CA 1VDZA 4WZZA 3DH0A 2WWKO 3ZCSA 3P0EA 5FV1L 1NVDA 3RIEA 3MBOA 3MRLA 3UJTH 1J2RA 1ZP6A 1NFIB 3KPRB 2A9RA 3VSCA 1FORH 3P0JA 1OARL 3TXYA 3S8GB 4L5YA 4FDAA 3GSRA 3Q85A 1XCQA 1QYWA 4JHZA 2OZ4L 3NFNB 2O20A 4WOBA 1M42A 3T4UA 5F3BA 4PLGA 1US8A 2BIPA 2WIBA 3AXLA 4N47A 3IN2A 1ORDA 1SH7A 4K6OA 4XO3A 5FBZA 1OSZB 3RBGA 3QIUA 2H8PA 3GUVA 1YQDA 4CQJA 2NNWB 4LNHA 2QL5A 2NSJA 4BX3A 3KQQA 2EP6A 1TYAE 5K1ZA 1MCHA 4JO2L 4F2FA 5FOVA 4XNYH 4HXBL 4DIEA 3UP6A 3URMA 1R3DA 5CBEA 2VJCA 3VKVA 4Y9SA 4AWAA 3JQEA 1YEFH 2HCZX 1RIVL 3PUUA 3T0VA 5BUGA 5KYYB 3ZWQA 5IG2A 3E61A 1WNFA 3CZAA 3GMNB 3ZGIA 4JM2B 1OAYH 1Y34E 1QBGA 4QICA 1II4E 2MDTA 1GSKA 4FCTA 4QU8A 5F7EH 2MRYA 5C8YF 1P7BA 1G0YR 2J1KA 2R1VA 4JHXA 3MRGA 5B2ZA 2R4SL 4ZUSA 1FU7A 2FSVC 2VTFA 4WW1A 1VJGA 1F45A 3QS3A 1D6JA 4BZ2A 5CR8A 3S96B 1ZTXH 3TPFA 4LYYA 2JFHA 4FP8H 4JSTA 1JAZA 2AC2A 1PQWA 3VYOA 4ZYUA 2PL1A 4NDZA 4QO1B 3EOYG 4AL8C 4INJA 3R8CA 3TBYA 4BQQA 4TWAA 1P8JA 1CY8A 3PC3A 2AEEA 1E61A 2DBJA 1I7TA 2BNRE 4Z1MD 3LRPA 3UTZA 1SKAA 3THWA 1MHCB 4R54A 1BEUB 1NR5A 4K3DL 2VUKA 2AS5M 1BSVA 4W1RA 3X1FA 4LJ8A 1K2WA 4YHIA 2BZ1A 3OPVA 4G8GE 4YN3A 1YBHA 3IXLA 4ZHQB 1FNDA 3T3GA 3K6JA 3C8ZA 5CXSA 4LDLB 3MR9B 2YWHA 3P54A 3IMGA 3SNHA 5E99H 1ZWLA 1KTVA 3GLGE 5LZ7A 3D0OA 1F4XL 4K4KA 3RVBA 1WB5A 4KXBA 5E08H 3TU6A 4J43A 1HYEA 4XMLL 4DKTA 4TVPL 5BS0B 3T08A 3GRWH 2QVFB 4V0MA 5CIWA 1EJOL 4YSAA 1AE6H 4XNDA 1UA6H 2VDNB 4K0RA 4G7YL 4NNJA 1N3BA 3MJ4A 4YMUA 4YDLB 1DJLA 3QEHB 4QAMB 1UMBA 1EDQA 1FVCA 2J5RA 4GBJA 1JGDB 4XPIB 1TJIL 2PX4A 2F53D 5FI0B 4OQDA 4WY7L 5D2LA 1KFEB 3U7AA 4JPWL 3NHBA 4BVLA 4LVEA 3FYTA 5K93A 3CFQA 2QMYA 4C5CA 2Z31D 3G6JB 3DMMC 4CCAA 5CB4A 3LQMA 4X20A 3Q87B 1M5TA 3KYIB 4YT2A 1GOTA 4B0MM 1L6ZA 3UB3A 4MVJH 2IAMA 2YARA 4U3CA 4WKGA 1KGSA 3PHAA 2OM2A 3AL8A 2AFIA 5BOSA 1Y4DE 4JC4A 2MU1A 2MSEB 2RI0A 1IEQA 2ADOA 3IUQA 4H1LA 5JNVA 1RXUA 2PTHA 4X1IB 3R0MA 1GFWA 3EGXB 3T09A 4XI9A 1KGYE 2R8SL 4F4CA 4FQLH 3W3AD 4HV8A 3NHKA 4WNJA 4RK0A 2EHJA 4IH4A 3R7QA 1GGTA 4IOSA 1P4LA 2H7XA 2AX3A 2HHCA 1BG6A 1NM4A 1QI3A 1UJ3C 3GZTB 3CM0A 3RGVB 3LQ1A 1BH6A 4H1LG 1PZXA 1ND5A 3RHFA 5LDUA 4B3GA 2B4AA 5IREA 3LCCA 4LECA 5DTFB 4GWKA 3WLFA 2QL7A 4EITA 2XF2A 4BL5A 2NQDA 1KAGA 1L4BA 3VE0A 2RARA 2XAAA 4IBSA 4LSVL 5G0TA 1E4XI 2YBEA 4WW2A 3DMFA 2GAFA 1K7EB 3WLBB 3IDIB 2CG9X 4TRPL 2D6FA 4HWBA 1OGIA 3M07A 5HZKA 3HFMH 2J3JA 4URZR 4AEHL 1F0LA 2EQAA 3DUSA 4EHHA 5AOVA 1T9GR 4Q1EA 1UFGA 4LGSB 4BQOA 4D3ZA 2YINC 1ZUWA 1JPUA 3EIXA 4EN3D 3Q4GA 2QW1A 1OLOA 3L5KA 4GAYB 3QJSB 4NFBA 2LE9A 5T8IA 4QYIA 4GG6F 3C5ZC 3L9RB 3K2BA 5E8PA 2H2PD 2BFNA 4RM2A 1N1EA 4OCSL 1G63A 4TVOA 3GMSA 4ZK6A 4IU2A 1KXVA 3B5TA 5DJ5A 4CETA 3P52A 3BW9B 2I6GA 2EICA 5K51A 1NIAA 1IVYA 1UR5A 5IJ0B 1CUCA 3C3KA 1NN3A 1IM3A 5M7EA 3UUFA 1PDKA 3G8YA 4ZVNA 3FCTA 1UPUA 3A06A 3R3XA 1F8UA 1P4IL 1WXGA 1W7AA 4L02A 4COKA 5FECA 2HYIC 5M95B 2C3XA 1E66A 3IGKA 1OBOA 4JI3B 2JLQA 3B3FA 4KGDA 3PRKE 2WLSA 4WUUD 2J3KA 3PQYD 3CWQA 1N0VC 3U48A 4CF5A 3U0TA 1QFWI 4YXWA 4DCVA 4K3GA 1VZ2A 3UVEA 1DZ0A 5IKEA 1P4LB 1QHGA 1CRLA 4OAOA 5GQSA 1SYVB 2VDLB 4LF6B 3LCUA 2PCXA 2VR8A 2NY3D 4BUZA 4J3OD 1OYWA 1JQEA 4IJQA 5TV2A 1RPAA 3AREC 3G0DA 3NWOA 4DIUA 3L8ZA 4EB6B 4LXIA 4FA6A 3OCXA 2IEDA 1T6YA 3HACA 4I3RL 4H8UA 4MLZA 1CG6A 2PO6C 3SE3C 3APNA 2IAMB 4RS4A 1U0FA 4P8QA 5E56A 2J6EA 3FHTA 1S7VA 1SVUA 1U8TA 4BYHA 1K8IA 3E0XA 1U8FO 4CLHA 4Y6RA 2Q7XA 1RRCA 4XC3L 3OKKB 1J8YF 2VDWB 2JK1A 4CL2A 2NT0A 2W48A 3BHNA 2DT5A 4FOPA 3QE2A 4P0QB 1J70A 4XPTL 4FABL 1YA5A 4NDMB 3OU6A 3ZPDA 3I4FA 4MWCA 3H5TA 5I9NA 1AY0A 1RNLA 1U8QB 4G7VH 1WJ3A 1EVUA 2IPUK 1KY5A 2VDJA 1BCIA 4FYRA 1KH2A 1O4WA 1Q7EA 2CBXA 3L6BA 2WBJB 3RLFA 5HGBB 4PZYA 4M5ZL 1D6SA 5A7HA 3HABA 1SQSA 5JYLA 2AZMA 3K0FB 3SC2A 3VDAA 5CDSA 2DSNA 4BGUA 2GCNA 3EYQC 1PDOA 5JFTA 3B9KD 5JQGA 2WU3A 4RY9A 4P4RB 3BD3A 4YS4A 3U61B 2R9VA 3N74A 1E6OH 1BQRA 3OQHA 1A1NA 1GJIA 1YQUA 1F60A 1GPMA 2WIIA 5ETUB 4X1YA 1IFHH 4JPQA 1R0BA 5HR5A 2CLCX 2C7UB 2DWDA 1IC1A 3T6XA 3WIIL 3CF2A 5B1JA 2O5YH 4A0RA 3KTDA 5DNUA 1K1EA 3R6GA 4X97A 5EIOA 1SGKA 3FSAA 2CK3A 3DE6X 1QZ1A 5CINH 3QWRA 3ECBA 3GC6A 4N5HX 4LSUL 5JT1A 3GGGA 2XAUA 3BZEB 4NHEA 4JMLA 2X2JA 2DQHH 3BH0A 3EARA 4FULA 1RURH 2A86A 2ECPA 5HJ3A 3GB7A 4B3VA 4R1SA 4ODUA 4LPYA 1G8GA 4X0EA 4JM4L 4PJHA 4BN0A 4CMMB 3OIYA 1THAA 1HXKA 4K9JA 1KEEB 3A3PA 1KHTA 1AKRA 1PDWA 3MWYW 4LJSA 1WLSA 3KYCB 1XD8A 2NWQA 2FF7A 3ABOB 1ELOA 4FHGA 5FTWA 1S2DA 1I2ZA 1NQBA 1RJYA 3OWEA 1JFFB 3DWEX 1X74A 5BSRA 1YA8A 1D0IA 3G49A 4C04A 4MMXA 2ID8A 1FZTA 4GLLA 4B9YA 1NUQA 2R25B 2I3AA 3Q5YA 2VQ3A 2G76A 4BPRA 1YIOA 2R62A 4TYNA 2Y6UA 1AFVL 4QBIA 3ARQA 4N0FB 4BNJA 2E86A 4DGYL 1U1DA 2O6EA 3NEYA 2XDHA 3IXTB 2W00A 4L9RA 3W6OA 4AX4A 4KTVE 4OLFA 2CGRH 1SK9A 3AESA 5E7JA 2GWHA 1ADGA 2NU7A 3MS4A 2B4CL 5ICZB 3PPIA 5LIPA 5B53A 3MUGA 3K1KC 2R27A 5C0BD 3OJXA 3DVNB 2WNHA 3LUGA 1GL6A 5IJDC 2RH9B 4D9HA 4YX2L 4Z8FL 3DYIA 5F3BB 2MIIA 1V8DA 1VHTA 1A8ZA 1NTOA 5KSBA 3MX0A 2WVSA 3KE8A 2XZQL 3NFNA 4LUCA 3OKMB 2DHDA 2RCNA 2SKEA 4IF4A 2Q07A 1HSBA 1SXJB 1P0SE 1KU0A 2P43B 2BXZA 1H8NA 3DVLA 1O96A 5IJXA 5BO0D 3CDCA 3FTSA 1JR3E 3X0DA 2IX9A 2XETA 2WZDA 4ITVA 4X5LA 4PRHD 3TEUA 5AR1A 3MSCA 4JOBA 5T5NG 4RISL 5CGQB 1L5GA 1FNEB 5ITVA 1XZBA 3CMOH 4M56A 5H4HA 1EP1B 2X4RB 2DB3A 2ITCA 3FF8A 3N2EA 1HRDA 4C83A 2EXSA 5CB0A 4LDJA 1J2UA 1WP4A 5IB4B 3KWJA 5HE8A 1ACYH 4JJEA 4TTJA 2QS9A 1EXUB 2XIBA 3IMWA 3P2JA 1J8KA 3FW6A 3UW3A 4CJ0A 3O75A 1CUXA 2EKZA 1AGEB 4CMEC 5ADWA 3LLUA 3QJXA 1IZKA 1KCSL 2YMLA 2IP4A 5KU1A 4AT1A 4BFOA 5ARBA 2Y22A 1X77A 5EZIH 5IM4F 1YK1A 4DNPA 5BN3B 4D7PA 5LCVA 4BTVA 4YXFA 1EUDB 2BY1A 3GSQB 4HJEA 3LLSA 4IBVA 1F1JA 1OD9A 4P5TD 3HXLA 1NBEA 2VDRL 1GQQA 1U94A 2D2EA 2Q45A 4QRAA 1GILA 2WINB 4QIRA 3RB7A 5IDVA 3MJGX 4A0QA 3EZXA 1TQ2A 4FBMA 4P2GA 3B9KA 4G80A 3FOWA 2INGX 4K8OA 3DGEC 1BD2D 1L4YA 2IXDA 3U7GA 4BHUA 3RVVC 1ZITA 3GP3A 5B1AB 4BZZA 4Z0XB 3D6JA 3L1GA 3NZUA 4DCJA 4JPIB 3L48A 4QUAA 5F7DB 1DAIA 3JQ8B 3FN0H 5ALRA 3QYNA 3PC7A 2MH4A 5ADOL 1HKHA 2AH5A 5HUHA 2ISSD 4CVUA 2ZROA 1DJZA 4KQIA 1XRMA 2H8KA 4JJGA 4LC1A 3IH5A 3ARGD 1DN0B 4FGMA 2OO7A 2PZEA 3V3TA 2XI9A 3U30C 3QW2A 3U1BA 4R8WL 2CLDX 3K20A 4AKGA 3FULA 4QQRA 1RR6A 4KSYA 3E9CA 1M8PA 2WP3T 5HZGA 1SEPA 5JSUA 1BVLA 2P2GA 5IARA 1IT9H 2ZOLB 4CIYA 4I9FA 3NJ8A 1SDDA 3HLKA 2BZDA 4Y1AE 3AI2A 2L18A 4MJ5B 3RRNA 4HDAA 4CGZA 3LHAA 3JV7A 1T2QL 5TXGA 3KYOA 2V3EA 4ZHQA 1AZNA 3EHBB 2GN2A 1AI1H 2I8LA 1ADBA 4NESA 1GZHB 3GUCA 3IAUA 3DEAA 4EKGA 1SIWA 3O3OB 3G17A 2FXVA 1XGYH 2C9AA 1H0DA 2B4QA 4K28A 1A5ZA 3CMGA 2CKNA 2AXGA 3HB3C 4UMFA 5BZWB 5LBUA 2BGWA 2OI9C 5F0MB 4MJ2A 1UTDA 5D2NB 1YEIH 1G3MA 4HALA 2WSYB 1BCSB 5EMNA 1FDVA 4N49A 3H7IA 2C8JA 2OC9A 4N5NA 4AG4H 2OYSA 4WU5B 3CSFA 3NCXA 1FTGA 4PYMA 3RYCB 3L49A 3WKAA 3DL4A 2Y9MB 2B6HA 4JM2F 1YJAA 5JO0A 1JHUA 4MK4A 2WQUA 5A6VA 1EK1A 2OQ2A 1ZMTA 5L4SA 3C6ZA 2P7TB 4IJ3C 4QG3A 2CFTA 4EZJA 1CL7I 1EG7A 4TUKH 3KXIA 4I4TB 2VMFA 2ZREA 1KN4H 3G5UA 4BKUA 2J44A 2ZUQC 2FH5B 5C7IO 1M1ZA 2X70B 1N77A 4LAFA 1U41A 5LQUA 3UPUA 4QRQA 1X94A 3FHEA 3TTYA 1PD1A 3GM0A 1U2TA 3A6HA 5LQJA 4EPYA 4D94A 5LQNA 1W0KA 2P5WB 4LMAA 5KVEH 3Q8MA 1QBMH 1YEHH 1G9NC 3QJUB 2YQ3A 1I7PA 5HQTA 2IH4A 3GZKA 4QTTB 3RAEC 2IJ0C 4QPEA 1QW8A 4GSDL 3NBUA 4A5SA 4HCRH 4A27A 3QXWA 1QF7A 2ZJBA 3B3QA 1VSCA 3OKEA 4Y2LA 3JUYA 2ZJYA 2DWEA 2K8MA 3ZGVA 4UU7A 3CDGB 1IH8A 1JXOA 4LDNA 2FHPA 1MC1A 3INGA 2IGFH 1TZIB 1QLRA 4HV4A 2EECA 3Q7JA 3G85A 4HTFA 5C07D 3T3IA 4U02A 3VM6A 1T10A 2DKMA 3KLBA 1GTRA 5TF1L 1YVEI 1MU0A 4ON9A 2UXFA 4QA9A 4MRRA 1P9NA 1FG2B 4KXNA 3GS0A 5C1OA 3RWDA 3T41A 3QUXC 4LLWB 1RU9H 1VB3A 2DUNA 1EQ2A 4KXWA 2VQFB 3W8DA 4XWYA 1DIOB 4OMUA 3OE1A 3NBFA 1CLOH 2X6TA 3NEOA 4I77L 3KO8A 4N0YH 3KYOB 1GKIA 3F12A 5DC9B 5CM9C 4FFVC 3COYA 4N6GA 4O3MA 4AK1A 1FG2A 1HZJA 2GVZC 1IGFL 4NPJA 3OKFA 5CTJA 3VU0A 2NZ9C 4LOKA 1CT8A 2ZVQX 4B81A 1GR1A 1LJ8A 3TYGL 2C7PA 1OGPA 1UKQA 4CHGA 7ABPA 5C0CA 1NMEA 1LFDB 5GRYA 3C9NB 3BK1A 5LYJB 4O4YL 2RHBA 1TZMA 1TVHA 4Y2OA 4R4BA 3HHPA 5FOSA 4RX1A 3G9XA 3E7WA 4U5QA 4BKQA 5JFGA 1WF3A 4UBIA 1YWGO 4P9ML 1RHJA 4GOSA 1DIAA 3EXAA 5HILA 2EQ5A 4YT4A 4DUGD 4QDOA 1M6OA 3LKNB 2IK8A 4BHTA 1OAZL 1ZHHA 5F7DA 3JQ8A 3OEWA 3PHOA 1RZFL 3NH7L 1NGXB 2J0UA 1T1SA 3L7IA 3KLAB 1XLVA 2QZ4A 1MCSA 1Y5NA 1UZ6F 5MI0B 2F53E 5DJ6B 1SB9A 1S3GA 4NE2A 4OHZA 4IXTA 2XJLA 5K3SA 3WADA 1T0OA 4RXUA 1HM5A 4MROA 3GRAA 5KTMA 1ETB1 2WLHA 4U1KA 2Y67A 3KB6A 5EUKA 2UVPA 1PEAA 5F9HA 1D8TA 2W98A 4O25A 4HGWB 4DCQB 1C8BA 5EIHA 5DPMA 3VO2A 4NS0A 2NQCA 1Z4KA 1XC7A 3QF4A 2Z6UA 1O9WA 4M8SA 2OYMA 2XJ9A 5HA5A 1ZDQA 2P9ZA 1U0QA 3FYCA 1U6AH 2GESA 4KLCA 2AZAA 3RZCA 3QDMB 1FYTD 1RXWA 5I1HL 5JH7F 4GP6A 1SZCA 3MHPA 4B85A 4CV2A 1MFCL 3G5XA 3A4YA 3P30H 4EOWL 4CVZB 4H35A 3D2UB 4US0R 2CNZA 2DM7A 1CBJA 5LOVF 4PJIB 1SBTA 2V7NA 1G1YA 2DKFA 3A21A 2DMCA 4LPSA 3BSWA 1SPXA 4LTDA 2XB2A 3N1GC 4P0DA 1IQUA 2ZDHA 4DABA 3VR0A 2WANA 5DD1L 3LHDA 4ARZB 4DKDC 4HMQA 2BVPA 3HKEB 1S9WB 1KDRA 4QEGA 1OI7A 4D9MA 3OKPA 1NIEA 5LXGH 3W0WD 3TWOA 1UANA 4YRGA 2CLEB 1Z82A 5FUZH 4B6SA 1MW3A 1J0HA 4PLJC 4AVJA 2R0QC 3E3NA 3EVDA 4KAAA 3NYIA 1YG9A 2GPJA 5CCEA 1EK6A 5I7RA 1TKRA 3UZQB 2EH7H 2GCOB 4GI6A 2GT9B 3THMH 3UBHA 3FN3A 1S89A 3PIIA 2AGJH 2NPIA 1ZVNA 5HNKA 1CQPA 4TQHA 3P0YH 4FRWA 2J56A 1YUKB 3UG5A 5J57B 4OHYA 1WTCA 3JWNG 4LCYA 1QGOA 3D4PA 1KTDA 4E5KA 5F70A 2XXAB 2P48B 1QZNA 3B5IA 5HDLA 5KN5A 2OSVA 1OKKA 3ZCVA 3APDA 4Z77A 2YD4A 2GCGA 2CY0A 2COQA 3W7AA 2I7CA 2OA0A 3FYIB 1XKTA 2EIKB 3I6GB 5I0YA 4YDVB 3O95A 1XTSA 3NJLA 4DG5A 3BFWA 1ZHKB 4QCIA 3ZHLA 3I2CH 3QEGL 1KQOA 2QADD 2FA9A 5CA0B 2BHZA 1AHKA 3O3EB 4X6FA 1DEHA 5U4XA 3RIXA 4ISCA 3B9KB 5HIJA 3TFQA 1HDXA 3R06A 5E95B 4GO1A 4WZAB 4XCYB 4WEUD 2OHOA 2YV4A 1CDBA 2WSSD 4ZTOH 2AK4B 2DHRA 3S5JA 1RCTE 3CSTA 2WBXA 2XMZA 2VK4A 2GCYB 2LNDA 3OM1A 3Q40A 2VH2A 2X1LA 1BJRE 4L51A 1A1VA 2P3OA 5GTDA 1IL1B 2CLIB 4WNSA 1D5BA 3AY0A 3GLUA 1T8YA 4JT9A 2Z0BA 4K03A 2EZ0D 4DSYA 2CXGA 4ENTA 4FI7A 2PX0A 1QZZA 1BZEA 2QUKA 2FN7A 2JDID 1GZVA 3TZHA 3U3MA 4NBUA 2OX5A 3F97A 2BJVA 3BWAB 2QLJA 1ISRA 4JZJC 1DDIA 4BB6A 1D7AA 1U3VA 3KJEA 3GGWB 1Z88A 3TXXA 4HIIA 2BZGA 1LLUA 2Z7ZA 5EESA 3BQUD 3RS2A 3KR9A 1NINA 3G04B 2V2WB 3W34A 3U4EB 1FNEA 3N53A 4AZ8B 5AK5A 1CJTC 1SCIA 4S12A 1C2TA 3HUFA 2F6AA 3F7YA 4KH9A 3HN7A 5T1JA 4ZW3A 5IJCC 1V1JA 4G01B 2YN2A 1WDTA 3K6SA 3G6AB 1D2CA 4U1JA 1P17A 3OWRA 1ZRHA 5JASA 4OZIF 2XNAA 3QJRB 1FSGA 2V65A 5JIDA 4FYHA 2ZYDA 2IGBA 1M10A 3R6LA 4LSZA 3LZQA 1CS0B 1UK7A 2QRLA 2I87A 3UYPB 4FW9A 3MRQB 1Y3DE 3KDPB 1XCTA 3SBQA 3VO1A 3CU5A 5L6YL 3ED5A 1TTAA 1MG3C 2VXTH 2GFQA 2R85A 5DVZA 1T4BA 1KS9A 4I6EA 4XVQA 1A9QA 4YPFA 3ATAA 5L0QC 3NVMB 3A1NA 1VSTA 1RZ8B 1U8IA 4JZNA 5FWQA 5EWMB 3A25A 1SFRA 5B7EA 4MP8A 2EIZB 3QEQD 2E0PA 1CETA 1L7EA 1RAMA 2QPTA 4JENA 1WIWA 4W6ZA 4YHHB 3K9BA 2Q5BA 2UUOA 4E2YA 3OR7A 3KKNA 4Y4FA 3D39E 4ZTPH 4HWBH 1FX0A 1QW9A 5JBIA 4GLRH 4NKQB 1L4NA 2WUCL 2QG6A 1S8OA 3KKZA 2ZRMA 3SJVA 1NF2A 4OQYA 4EABA 3DBXA 4J3OF 2IOQA 1LXCA 2V7WA 1HZLA 3ZHXA 2QTEA 2YD8A 2VP5A 1RZIA 3NCBB 3TUIC 1UBUS 4MMXB 4HRYA 4RQQB 1JDTA 4DO4A 1GG5A 4G8GA 1XF5B 4GE3A 2YYZA 3U31A 1HX0A 2GFBB 5KJFA 5T1KB 3STZB 3HJGA 1AVAA 5ELIA 1RWOA 2QLTA 1IN6A 4HQRA 5LDGA 1HZHH 4UNVA 1Q16A 4RYDA 4BS9A 1ZH6A 1H9DA 3H55A 3SO3C 5I7EA 5H8WA 2CO6A 2E4UA 2D5AA 3I9FA 4LKXA 4XNBA 4O02B 3GU3A 4F2DA 5K39A 2WHVA 5EA0H 3SJZA 2JIPA 2R87A 5IUKC 3RAJH 3FN9A 1E2PA 5DH9A 5ERXA 4ZQGA 3ZIUA 3RR2A 4DMCA 3GFRA 2CMFA 4HFMA 4ZXFA 2FPMA 4Q1BA 3CZMA 1NBWB 3FZYA 3OQIB 3FOFC 2B4KA 5C9ZA 3VZQA 3EHEA 4QYIB 1E42A 1TMGE 4G6FD 2LQRA 2DJSA 3TD2A 2DKNA 1D2OA 2BFVH 3THYB 3ZXSA 5G3YA 1IJ9A 3GS4A 4TLCA 2YFYA 3OAAA 1KNXA 4JJAA 1Z39A 4D0GA 2B1AL 3RHZA 3GHPA 3IF1A 1VBFA 2H4EA 4D6YA 1UQSA 1U9YA 1BX0A 3A4VA 1ABBA 2BHSA 4ZPVA 2IIQA 3N43B 2X4SB 5C0IA 2FPSA 3JQ7A 2P8SA 4YMTA 2IIPA 4HFWB 4UB0L 4J8QA 4MVBC 4A2FA 3D3QA 5C0CD 5DGHA 4JLSA 4X9IA 3H9UA 3N8NA 5IH3A 5I76B 3JASA 5A7FA 5AZ2H 4DKXA 2CVZA 2N56A 4P2RE 5IF0A 3K9NA 1PF7E 3P02A 1SQFA 3MXTA 5I01A 3ULUD 3KKPA 3EEIA 3PL6B 4LVOA 5D1XD 3HPLB 2WNWA 2AQSA 3Q6GL 3EIHA 1PY4A 1G9TA 2VIIA 2RJMA 3TYXA 3K0CA 1AJEA 1CB0A 2QQLL 2BNRD 1HQDA 1THZA 1ORTA 3SDZA 1NQWA 4OXIA 3NEAA 4HV8B 4AI6A 3MYJA 4EB6A 3JWOL 4JI2B 3GJFK 4A26A 5K9JL 4CQLB 2YQGA 3CN3A 2O5RA 3QORA 2W7TA 5F89B 1XZ0A 4OMFG 1NFDB 2AQTA 5BRZA 4G24A 1Z9SB 4JB0A 4H20H 5E3IA 5ESWA 4LEBA 1JD9A 2XFXB 3B43A 4LL4A 4X5WA 1GQRA 4HX2A 1AKVA 4R1PA 1HKLH 1DVSA 1J00A 4RF4A 2VPTA 4TSFA 3WGKA 4LJ7A 3B7TA 2D3WA 1OX4B 1SVLA 2K6ZA 4FUQA 4IGAA 4AUJA 5D7LE 4OFBA 3SDSA 1HDGO 2JB6B 1OXBB 3QIWD 4KK8D 1M2HA 4I6JA 1WHSA 1GGBL 1HESA 4I18B 4E12A 3GHBH 4HWNA 3BWDD 3AHHA 1RD4A 4ZAXA 2HT4D 3O8QA 3JVUA 4LYEA 2XWBB 2WXRA 4XDHA 3T9WA 3VWJB 3MA7A 2V8OA 3HLAA 4LDAA 4RENA 3U4BH 2LU4A 1AC0A 1XV8A 2OCFD 3DLBA 4NCBA 1I3GL 4M6NL 4REMA 4ME6A 3TWCH 1ORIA 7TAAA 5B4MC 1OT3A 3HG7A 3AEQA 4D4KA 2E1PA 3PXCX 1MFDH 4OLHA 1I2CA 2QUJA 4NFLA 3W8RA 4H7FA 4EXPX 1BWWA 3BVTA 4RPGA 5JTWA 3LCYA 3MRBA 5B22A 2EYTA 4XNQB 1XEAA 2ZIUB 1UM4H 4LW8A 5B39G 4J1NA 4B95C 1P7HL 1B4RA 2HJHA 1EQWA 2HT2D 1PR5A 4LXTA 4L4TB 2X6RA 2P7IA 3PDOA 3IA2A 1MN4A 4Z7IA 3HDYA 2PW1B 3MA9L 1GKUB 4JG1L 2FRXA 5DWPA 3QJTB 4WW2B 4A7PA 3L7AA 1Y8QA 4KWCA 4XMKL 5AKVA 4RVFA 1DKLA 4M0CA 4B3BA 4CC1A 2XBTA 5EZJB 1HYGA 1K6MA 1T1ZB 4JQOA 3JZFA 4F5CA 5D93B 4UUNA 1E2DA 3O5AA 2P4SA 5KS9A 1O7JA 2Y7SA 3I34X 2OO5C 2BSDA 4A68A 1NW4A 3MCKA 1Q94B 3PXHA 1GPJA 1P2DA 3X43A 2H1LA 1VI2A 3IETA 1F6AA 2A4ZA 3D12B 1RYFA 3KMDA 1C5BH 4XP6H 4GEKA 4BHUI 1I4FB 3WOVA 3UA4A 4B6GA 3A31A 3UTPD 4GGPA 4CIDA 1BJTA 4LY6A 4N24A 4C0LA 1AQYA 2TMKA 1JHRA 4RPLA 1RU3A 2V8LA 2C07A 3AGQA 2BPBA 1E5TA 4ZU1X 3O8BA 4FQ2L 5L7XL 1XLTA 4R4ND 4RE6A 2LE0A 3A11A 3MBIA 3SBPA 5AJZA 4A8JC 5HJDA 5COBA 2ODHA 3T0EB 2GTIA 1L1EA 1BEXA 4OREX 1X8XA 5AJTA 3S5LA 2ON6A 2CJSA 1JLLA 3OIVA 1JFRA 5KW9H 1N34B 4CM1A 3VPAA 2UWEF 5EY5B 3KQKA 4P5MB 3TJPA 5JPNC 1AC5A 1A7NL 1IB6A 4P4UA 2BIQA 3P0YL 3PHHA 3L9EA 3WZ2A 1D5MA 3IT2A 1V5IA 1LEIA 4FN4A 3RDTA 4TYPA 3T2NH 2IKQA 1Z32X 3OD1A 5CITA 3T9AA 1VLXA 2W0FA 5IHHA 4MW7A 1WZEA 4MRPA 3NA9H 3W5SA 4WCYH 4ZDWA 3O4FA 2EO1A 3TPKA 5HKLA 4D26A 1TFPA 3WEXB 4BM7A 2OHVA 4ZQHA 3DMDA 3GK8L 4WUUA 3LZDA 3RVPA 2D7NA 3OC5A 2D1TA 3NP4A 3OSZA 4RFVA 4XNAA 1CUZA 2AOWA 2WZAA 3F6LA 3TO2B 3ZJ4A 2X2OA 4HJJH 2XV2A 3KC2A 5BN4B 2W1NA 4JPKH 5A62A 3Q6IA 4GMSH 5U9CA 4GI8A 4LZAA 2GILA 3IPRA 4M29A 4LIQE 4KKAC 5JEDA 3GLDA 2WB4A 3S2CA 1Z6QA 2VF5X 4OHFA 4NYJR 4L2IB 1PEWA 3JV4B 1Z3IX 3GJZA 4RFOL 5JIHA 2FWLB 4F4IA 5HHOD 2BCKA 5IT2H 3PT9A 1J4AA 4DT1B 3ZU8A 3QH3B 1H9VA 2CL0X 4OQTA 4OI8A 3NDYE 4E08A 3QO0B 3CA8A 1ZIXA 2HRCA 4JVWA 2XT1B 2YJGA 3HL4A 2X7LA 4U1GB 2QRNA 3CIAA 3K4ZA 4JEUA 5LAXB 3NFSH 3MZGB 3CR8A 4YNBA 3CRZA 3CFDB 1DOZA 2DQUH 2X8BA 3IVGA 2AFHE 5DJAB 1HCZA 2UYLA 3S2SA 4QXUH 2EDXA 2PSDA 5KUTA 4JZOB 4YHNB 4DREA 3H1GA 1UXOA 4HIEA 3QYJA 2WB2A 2XNDA 3BA6A 1IGTB 4LOEA 3HE6A 2HTLD 4PJ8D 4P92A 1KJ3L 5JYMA 3SAJA 4P0PB 3IA7A 5BMFL 3WWOA 5TS2A 4QATA 1H2XA 2P46B 4XB1A 1JV2A 4K5NA 3IV7A 1UBHS 2EVHA 4AYWA 4MGXA 4PJIF 3DZCA 3U6KA 4S1OA 3C5XA 4OR1A 1NBMA 4CVWA 1OAYL 2D7CA 3CUSA 3HO6A 3M9LA 4H8PA 2VN8A 2IWHA 1IY8A 3EWNA 3M1BB 3IKKA 2QDWA 3KAKA 4FFWA 4PFEA 4Z2YA 3GDCA 3V2AR 2AX4A 4PJGA 4GI5A 1CZ8H 4H40A 3MM4A 3OJDB 1PLKA 4NYJQ 1KELH 4X42A 4R2GB 3SB3A 4DMLA 1YEDB 1EKXA 2O6CA 3LL4A 2EZUA 1IULA 2QSTA 4W6XB 1AS2A 2Y99A 1N7HA 2UYQA 1UJ3B 1U8UA 2VM9A 5IS2A 2OBXA 1TQSA 3B7PA 4OF5A 2NG1A 2P9EA 4YTEA 4P86A 1INEH 4YLQT 2F1IA 4QBHA 4P2QA 4EB3A 4G56A 3KPSB 3F5QA 1OARH 4QECA 3KVVA 3AFMA 3G3EA 1A82A 3PHGA 3HE7D 3QWNA 3VTMA 1MIOA 4WZBB 2ZXCA 3TUJC 3ASYA 1T1EA 4AUEA 4UUPA 1DUYA 4KTYA 2I7DA 3CXHK 1GKLA 4BAZA 5J0BA 4R4JA 1XD2B 1BE8A 1KDIA 2D06A 4U1IB 2R7NA 4F8QA 3V1TC 2ZWSA 3ZQWA 4JFEB 4IIJA 1OTYA 1SXAA 3Q0EA 1QYDA 1IIRA 1DKPA 3MGBA 4OM1L 4FFBB 4KVFA 3I2JA 2ATEA 2R39A 1UJ5A 4P1ZA 1KG0A 3O2DA 4BZXA 1A3ZA 2DCUA 3D06A 4NKRA 4Q21A 4E0BA 3GD5A 1G1MA 4D2NA 4I4NA 3D39B 3DX1A 5C1BA 4RTSA 2C5DC 2W91A 2F08A 4YAIA 4TV9B 4XE5A 1PJQA 3IP9A 3ZNOA 4C22A 1JHYA 2VJPA 1J09A 1KJYA 4DC1A 2PYED 2NW2B 4Q7JB 1EFRA 3HWRA 5IM7B 1KCVH 2OPHA 1ZHBB 3QUKB 2XVYA 1LBHA 2K2QB 2XTSA 3UJBA 4Z23A 2UXGA 3MZ0A 2AE1A 4IIUA 1JHKL 4FD2A 2DS4A 5ENZA 2B92A 1XQ9A 3FKJA 2BIFA 1OQAA 2QBYB 1N1DA 2ZYVX 2FE0A 4G59C 4HB3A 5SWZD 3P7MA 4N0UA 1UOEA 1I1FB 2NV6A 4C88A 3RP1A 5GZOA 2QXYA 3MODL 1OT1A 3VC3A 5B1HA 2C2KA 3ZGYA 4PFKA 5EEZA 4IW4C 5C53B 2GBPA 2UYOA 5GRUL 4ERSL 3RTQA 4AV5A 3FFCA 3JVGC 1CEXA 4XPAL 4L3EA 1JJVA 2O5CA 3V6ZB 2ZB2A 4V11A 3GIWA 3VUEA 3TSAA 2HJ9A 2LVEA 4RC9A 4QHSA 4OYHA 1SY6L 4C3ZA 1T8SA 3UTQA 1JU4A 3QUHA 1I2DA 2VSDA 3QISA 4PD4K 5FPTA 4N86A 1DKRA 3CRVA 5CG2A 3KKMA 5T33L 3SKNB 4KKPA 5FA3A 4EF6A 3T06B 1DRKA 2HSDA 5BW5A 4NQSB 1J5EB 3QJQB 1NWOA 2XA8H 4AP9A 1QNIA 4OD2B 4KN5A 1BQ5A 4DWOA 2EX0A 3NCEB 3PWUA 4HP5A 3DLQR 4MHHG 2R86A 2BJHA 1A5TA 1K27A 4DQAA 1MAVA 4FLQA 2A9NL 2RG7A 4I1RA 4Y19B 5KNCH 4XVRA 1VRCA 3ZE0E 3FTCA 4YR6A 1G8YA 2B2NA 1VHDA 3AFLA 2DEWX 3CZ4A 2HRRA 2IQ9L 5IG7A 4XB3A 3DLCA 4QR7A 1GPYA 3REQA 1U8YA 3VGAC 1JSZA 1RQXA 3MMXA 1E3IA 1P29A 1HE3A 1NG9A 4MX7B 1Q8MA 2BEVB 3T4PA 3JW8A 3BZ4B 1R00A 2J12B 2YIHA 4Z3HA 4PNHA 3V4PB 2HKFL 4HT1H 4B09A 1MIEL 4CR7A 2HJGA 5FPYA 4FR5A 3TVTA 1UZLA 3VW3H 1KAOA 3V42A 3KHTA 3BXXA 4TNFA 3H9EO 1DANT 1WMSA 5LMUB 4WUTA 1C1EL 1X87A 2ZXWB 3ULSA 5ESXA 4B96A 2LLLA 1CP2A 2FBJL 3KUDA 3U44B 3M6WA 4GRMB 5CVEA 2QR0B 4XC1L 1QKJA 4UXJA 3GG9A 3BRWD 4MUBA 2P62A 5A2KH 2FX7H 4ZEWA 1FTYA 2CDEA 4YQXH 2V7QA 3U82B 3PR3A 3AS0A 5CDGA 4JC8A 2XNDD 1RPKA 1PFCA 2CFOA 4Y7OC 3LZ6A 4YSCA 3HC7A 3SO5A 1TT5A 2OJZH 4WK4B 4P2CG 1X1EA 5F1PA 3OWHA 1WZ1H 4ZFOB 1HH4A 4JL6A 4JI6B 1KSJA 2QTWB 5GRVK 2J45A 4QHNA 4XXWC 1R5WA 3F7VB 3FZUC 3S36H 2IKSA 5ULLA 3GQBA 4XP5L 5I5MA 1MJ7L 4UCQA 4L07A 1D4AA 1DQVA 1QD0A 1F51E 3BRCA 3B5GA 1YZNA 1CNEA 2GJZB 3L93A 2HH0L 1VQ1A 1U4OA 4L4VB 1UT6A 1THMA 1E43A 5EAIA 4BFGA 3CH5A 4QULA 1ZD4A 5DD5H 3IPBA 1A6UH 5KQRA 1DAOA 2JTDA 3UFXB 4MWDA 1B4LA 1GAJA 3CG0A 3W5IA 1FAKT 3ABGA 2WJZB 2YIMA 3MCWA 4TQ9A 1NANI 4LESA 3MRPA 4IRSB 5E2VH 1RZFH 3NH7H 1QLEB 3ZHVA 3B7SA 1AQMA 3H2GA 1T0PA 3ETLA 3VYVA 1OB2A 1QUNA 2GN9A 4OSUH 2NZ2A 4NHCH 2WXOA 1WPQA 4MINA 2G7ZA 4BFIA 1IX2A 2ED7A 4U1LB 5I19L 2Y7QA 5I2IA 1UKSA 4FGKA 2ALJA 4UNQA 3BH4A 1Y9EA 3ESVF 1CTMA 3FWZA 1J1XL 1URLA 3VO0A 3QQPA 1DLJA 3N43F 4ARSA 3LPLA 3GSOB 4JWKA 5C0OE 5DMIH 4Y4HB 4M7RA 4QWWA 1U5BB 2WM0A 3K4DA 5LFAA 4IDPA 4FQPA 5DIFA 1KE2A 3KQWA 1VL2A 4MSWA 1PLGL 1T3LA 2PETA 4QVIA 4OATA 4BTEA 1U9KA 3N87A 3B89A 4MRSA 4Q00A 4JKLA 3J81k 1CLOL 3HUJA 3IRCA 3ABIA 5FCDA 3OZTA 3R09A 4YK4C 2H3KA 3QAZB 3RY4A 2IOFA 1U3TA 1ZM4A 4UMDA 2RC5A 4OU3A 3VG9B 3EZ2A 2IBZX 1FFTB 3N6XA 4YEFA 3ETNA 1LNSA 1L3WA 3GMDA 3FROA 2FJ0A 3D4LA 2XVMA 2K78A 4UT6H 4LRXA 4R40A 3QNXA 4ETIA 5KSUA 4ZYLA 4JBXA 4H18A 5BZZA 2C0QA 5F3HB 3RYFA 2OHFA 4JFOB 1SM3H 4TLMB 3Q0TA 3FB7B 2Q5IA 2FIKB 4KQHA 1HOTA 3EYQD 3PV6B 1UEMA 1K5GA 3K1YA 3UTQB 1YQVL 1N3IA 2CBZA 1RMFL 2XWTB 1AOXA 4TSRA 1RZKC 4OU4A 3IJHB 3A14A 5FUYA 2HWYA 1PQYA 3WGGA 3VFPA 3QGVA 1RKQA 3TV3H 3FO9B 3VGBA 2DQUL 3BWXA 1N7IA 2KQMA 1GPLA 5LBSL 2FQ1A 3RYIB 1OFIA 2C29D 2HCRA 3CG8A 4E5PA 5I1EL 4PVCA 4KR7A 2GFHA 2DR2A 3W81A 2W22A 1AD2A 5LBGA 1T25A 1IBDA 1U8JB 3V4SA 1RVFH 3L4YA 4N5MA 9LDBA 2SCUA 4IS3A 1EFVA 1RWPA 3OICA 2ZAIA 1T2EA 3CSYA 4BB5A 4A66A 2V0GA 5JW4R 4RZXA 5KTTA 4QOKA 2GVDC 4EN2A 3T3PE 3K8YA 4NXSA 1OAOA 4WD3A 5TE6H 4JFPA 2YVKA 1XD1A 4R8LA 2ZRIA 5YASA 4PG8A 3PUVA 4LSUH 4J0GA 5K1VA 3QH3A 1Z0UA 5DJCB 5LLSA 4L8GA 4BEBA 4EAQA 5I71C 4QEZA 3WSVA 3G0CA 2NYVA 1DJWA 1KIPB 2DLHA 4MPDA 2QSYA 2AFVA 4CAGA 2BMDA 3BZFB 4NV3A 5HVHC 4E70A 2BSBA 4NBSA 1E4VA 1KERA 4RXTA 2GPBA 4HB4A 3FZQA 2QK4A 2OEPA 1NI5A 2AG5A 1MKYA 3VFWA 1EWVA 3FI9A 4F2MA 1R0SA 3AXSA 3ZHBA 4GE0A 3CX5J 2IUSA 3EFOA 1UKZA 1KTLA 4PW9A 5K1JA 5D5HA 3ULVL 4I1VA 1G0DA 1O0BA 1NCIA 3T2NL 4R3UC 3QP3A 5A1TA 3HHSB 4BKMA 4HC1H 4WI0B 2NSYA 1T2DA 1XAGA 4LSRL 1UPBA 2DJ5A 3RODA 1M2KA 3MJWA 4MOWA 4ZFOL 5B55A 1QU3A 4GSLA 5MEQB 1KIQA 3P4LA 5AI6A 1IBGH 2J8UF 5D6NA 5KVEE 1ZOXA 4E94A 2PXYB 4KC3B 4KY1H 3US0A 5H5JA 4D9RE 1KI7A 4G1BA 5C6PB 5B3AA 4RZSA 2OQIA 4XVTL 5FW6A 5L9DH 2IC2A 3R76A 1BOFA 1V48A 4MA3A 2MEJB 4BAGA 1EO7A 1BJKA 2MQ0A 3KBHE 1Q72H 4Y2TA 3O0LA 3R0VA 4L8SA 1Z5GA 2GBIA 4XAKD 4M5TA 5BUQA 4ROTA 3BD4A 3HG1A 1REQA 3WHIA 4I3RH 3FB5A 4QXVA 5GS1B 3N0WA 1U95A 1DOHA 1KKLA 3BSZH 3B13B 4BWUA 2ZJ6A 2IE0A 5CLWA 3ATEA 3PWZA 4IDAA 3WK6A 3C14C 1BS9A 3HMWH 1EFQA 3ES6B 2PL5A 3D4YA 3PHSA 1Q7GA 2VUHB 1U2CA 5F6HJ 2P6PA 2YJNA 3I9KA 1KGXA 4D0DB 1GCFA 2GJ6E 3RC9A 5CJQH 3QWOB 3ZLJA 2NUPA 3H04A 1ECPA 4BVFA 2E4YA 2XRYA 3ZS8A 4D56A 1JZ2A 4HDKB 1II9A 2AVGA 2C8LA 2ERCA 1W85B 2IV3A 3FGPA 2UYLB 2RR3A 1RJZA 1UMCA 5HI3C 3QU5A 2YKLH 3C6LD 1XF3A 4PJBA 1DAEA 1S7XA 2E82A 2A74C 1U58B 1KU6A 3B20A 4AKSA 1M9WA 2XCSB 4Q74A 1XF4B 5BQ5A 4M3HA 3BQ9A 2Q41A 3EA5A 1FB5A 3DE2X 5ILGA 2CHXA 2DQMA 32C2A 2KERA 4K23H 4BH8A 2G71A 3GXDA 3QJFB 4UARA 3B5HA 3PDOB 5EMYA 3TLGB 4ZYKA 2AMUA 1VCHA 4JSYA 1FFXB 3L8MA 2MHAA 5LJLA 2HVBA 1SN5A 5INCB 5BV7B 1GSOA 1Y6KR 1PR2A 1OU0A 1GIGL 4GNKA 2QRMA 4XO9A 5CNKA 1YUBA 3TYFA 1E9QA 2CV1A 1NXQA 3ZHTA 4BGLA 4RD0A 5BV7A 4EF3A 1ZSDA 3SSOA 2HWWA 4MNQE 1FFXA 4QTHB 2BWQA 4ZYKB 1IOWA 2C61A 3FUHA 4TN1A 4TSBH 4KKXB 4KU4A 4WUUB 4QDXA 3L6CA 2JI8A 2QDVA 4KK5D 3OR6A 2PH5A 2HMUA 5CLYA 4PREA 2IYVA 3GSNH 4XFDA 5E24E 2DJIA 2QVXX 2VWEC 3VQTA 5A6MA 1FYDA 1KI6A 2A1TS 2GNPA 4B6OA 3HWWA 2SECE 1GSIA 3PENA 5L0QB 1M7DA 2AJZB 4CBVA 2H6EA 5F2FA 4GM4A 2DMGA 1H4SA 3WNPA 1UM6H 2J3SA 4WWHA 3SD7A 3DRQA 1OXTA 3BGVA 1YCDA 1K5PA 1Z75A 4JFDB 4IIFA 2R29A 5DFWH 1FMCA 1U58A 5T1LB 3W9UA 3IPFA 1DVUA 3RH0A 5JS2A 2XUGA 3S37H 1WA0X 4DQLA 4YHKL 3QI9A 4XCVA 5EFIB 4FQLL 4LPWA 3GJ8A 2GJRA 4JQZA 4ZGWA 1SYSA 4OUUA 5C2JB 1NIJA 2QQLH 4XXDB 3DX8A 4IMRA 1AKJD 4RSYA 4LSQL 1XJQA 3L08A 4XI5C 5C8XA 2G3MA 2R6GA 4A2HA 1AFVH 3OJVC 2VT6A 2PTTA 4XM2A 2UZPA 3AY4A 3CH7A 4KKAD 1OW0C 1MY7A 3QOWA 3RFVA 1NFDE 3T0GA 1ZO8A 2AHIA 2FECL 3WIAA 1AGXA 3RNLA 3IL2A 1RHRA 1R8YA 3NJ4A 3HZYB 3LKQB 4WSGA 1W5AA 3NIFB 3I85A 4A2DA 5C97A 3DV2A 2ERYA 5CD3B 4CSSA 2VJYA 1XZCA 4RNRA 1HE7A 3RAJA 1ADQA 3LSOB 3KT6A 4EY8A 3D30A 1VPEA 2DD8H 5SV3A 2BX5A 4Y1SA 3TTUA 1P7KB 1AE1A 3W1EA 5LMZA 3LV3B 5B38A 5M7QA 2Q7AA 1RURL 3K1ZA 2R2BA 3RNOA 1JBQA 1T2CA 2WJ6A 1Z2OX 1V37A 2C84A 3QKSA 1XPUA 3T38A 4Y89A 3W82A 2Q3LA 2ZUVA 1WEJH 4DFIA 2D9QB 2R1WB 4K9PA 2OWDA 1P69B 1NP3A 3I6YA 2KQUA 3BTSA 3EODA 4OXKA 3FSOA 1UFOA 2ZYIA 1IFHL 4B48A 1FFSA 4GVLA 4RFEA 3ONWA 1XL6A 2A5UA 2J57A 1U7HA 5I1LA 3MUOA 4A8TA 4ZU3A 1J1PH 3U9PL 1KH3A 3MQ2A 5AB0A 5FGBA 5BXFB 3NHAA 3JWNH 1HL8A 3L3GA 4ZW5A 3TFWA 3QE3A 2W6ZA 3B52X 2OMTA 3MXWH 4M7KL 3OE7A 1SVKA 3V0VA 3ANTA 3DBRA 2QHXA 4KO5A 4OZGE 1PBTA 5FM5O 3GF8A 4ER7A 2ACEA 1YTLA 3SQNA 1F00I 1IGML 2CBPA 4AJIA 2GAZB 2M83A 2OMYB 1A1MB 3K72B 1F3DJ 1JZ5A 4RJIA 4OLYH 2IPOA 5HBGA 3H1EA 3TBVB 1UEJA 1JTOA 2RHDA 5CP7A 2V9ZA 1W6LA 4PRNB 1GEGA 3AVUA 4OY3A 5KSAC 2OFQA 3QNWA 4B3XA 4TTDD 1ZGJA 1F1BA 4ILDA 3UXHA 5SX4I 4EFDA 5K0ZA 2F90A 3HS0B 3OWXA 5ELXA 1IUNA 4HYTB 1X1BA 3ARFD 1M8GA 3EO9H 2YUZA 1OT5A 4ESOA 2HMWA 3STZA 4J3NA 1X1AA 3LT2A 4KMMA 4G3YH 3GEPA 1JKXA 2GCPA 1CUWA 3GBML 3RG2A 1CE8B 2W2MA 4XNYL 2Q7YB 3H3PL 5DE3A 3GS7A 1XZ0B 1AB6A 2JANA 3VDCA 5L7YA 1QHYA 1XN4A 3G6WA 3Q8CA 1RYHA 3JYNA 5AHWA 3FPJA 3C5WP 3IDJB 3V4PL 4I48B 1S8NA 3T99A 1IM9A 3R1GL 3VOSA 4IOLA 5JWHA 1ZNYA 3FUIA 4PO3X 1TFRA 1HT3A 5EWLA 5DUBB 1B14A 3U9UB 1KOFA 1L7AA 2GNOA 2NO0A 1SDAB 5JVDB 3L2OB 5HY9B 3E9NA 3ASNB 1JPJA 3PV6A 1XQXA 4JLMA 4JZNB 4I3SL 1GDHA 1H0KA 3IP5A 3UTOA 1XJ0A 4XNZC 3D3NA 4N0DA 2BBOA 2FZ3A 2CNBA 4ZW6A 1V45E 3P2OA 1ENPA 1VM6A 2GZ1A 1FYWA 1ZSDB 4OZHA 2ZXGA 1FJHA 4FE7A 4PLNC 2A9CA 3NT0A 2X0RA 5DHRA 2I2FA 1FRGH 2CK3D 5L88H 3TS8A 3IF1B 5IB3A 4X1OA 2BKXA 2L3BA 3SX0A 2HL6A 2WKSA 2IF0A 4KDWA 3MAAC 2BSRA 2HWXA 1RK0A 3V0EA 1LH0A 2FHSA 4CTOA 3IDMA 3DX6B 3O8CA 2ZOTA 4FZVA 3HNVL 1GA6A 1BO6A 3R5FA 1G21A 3PDUA 4NNYB 4JL5A 1TYCA 1BF2A 3GGWA 4R6WA 4A6EA 1U6IA 1SHJA 2FZEA 1HJBC 2X4TB 1M8FA 2R66A 4PYRA 1KPIA 4X90A 5AKHA 4EN3C 4J2XA 2GUYA 2GY7B 5T6BA 4YIQB 4ZTOL 2NV0A 3KQHA 4BJ1A 4P4NA 3B9EA 1S7XB 3FPAA 4RVGA 1Y3BE 5D4QA 2M2DA 2FVNA 5DNYB 2J7LA 2P45B 1WUZA 2F18A 1AR1B 5LDDC 1I7NA 4NUMA 1DAHA 2JI7A 1EJ0A 4LL1A 3DKPA 3II6X 2Y5EA 2AN1A 2R6AA 1AQDA 4Z7VE 4Z7WE 1DG9A 3GTVA 3PD1A 2X5KO 1WHTA 4IKIA 5EULV 5KSWB 3QEAZ 5MGNA 4Q18A 5DCUA 4HEA6 5AHKA 3I2HA 2OGUA 3A2MA 4AVHA 2F8IA 3ES6A 1XKXA 4GRAA 3S34H 3BP6B 2MYPA 2O72A 3L01A 1L8LA 4MD5A 5IZ7A 1R50A 4G8DA 2BUAA 3SY6A 1QO3B 3VUAA 4HGPA 5EHNA 3GSUA 4LSMA 3SHWA 3A3YA 3FPXA 1QHHA 2IOIA 1FP2A 3V00A 1E20A 4CEHB 4YDVA 1S96A 3WS6A 4ALIA 2XG5A 4XWKA 3OR7B 3LNGA 3T7KA 2FSSA 1I8AA 3ICVA 2X2FA 4DA4A 2NZWA 1IO4C 5KCMA 1SD5A 2JFXA 3QC5X 5J13B 3WO4B 2FETA 2C5AA 3ZLTA 1W46A 1TQ8A 2XODA 4UM8B 4LRUA 3RBSA 4DK5A 3WKCA 3FONA 1NBYB 2D31A 3P3RA 4MW5A 1N2CA 1JZHA 5GGUB 3HR7A 1NUFA 1JQ3A 2BWIA 3VCLA 3RZCD 4KDVA 3K0CC 7FABH 3NTCL 1AIFA 5KOVC 1HOCB 2WYUA 5AI4A 3KSAC 4NNPH 3VH8G 3N0VA 5EC1B 3OOWA 4Z7OF 3B3IA 1Y1KE 3KB2A 2C99A 4L8VA 3C5HA 1EAPA 1NGQH 4YMPA 1CSEE 4OLAA 3IGAA 1E7RA 1P72A 4Y3UA 5FFFA 5JYBA 5E08L 5IP4A 3ESYA 4NOKA 1BZOA 1IVLA 4RSHA 4F6RB 2C26A 4J0CA 3DVGB 4J4PD 5TJ9A 4JN1H 1BFKA 2PLFA 2QSVA 4D9BA 5I1HH 5AW6A 2CE2X 1QPBA 3RUDA 3IMBA 2X0VA 4P23A 1CJMA 1PE0A 3OFSA 4BQBA 1ZRUA 5FUMA 5G4LA 3FQRA 4H25B 1CY7A 5DVOA 4B6PA 5AW4A 1RBYA 1KBGH 1U3HD 2O3TA 3KK0A 2CJUH 3WTXA 5FOBA 4HUNB 2CA3A 3MRTA 3K5SA 1WYJA 1IONA 3CBQA 3D25B 5B1KA 1PJRA 3SPVA 1W36C 3QQ9C 1MABA 3H8WA 5IUJC 4DVRH 5D6CA 1F9EA 3ZV4A 4NQEE 1GGCH 4JVOA 4KRLB 1ESCA 3KXFA 1P2FA 3QF4B 5L4NA 4JY5L 2VNAA 3I5YA 3PP3K 2ZF9A 1RVV1 25C8L 4PJFF 1T0NA 2IHNA 3PS9A 5D3QA 1F4YL 3I05A 4N8VA 4O4JA 5ICXA 1SK8A 2UY6B 3BYTA 5AHOA 2P9JA 4WNAB 3RRZA 1YJCA 5CHNB 4KXDA 1S5HA 3FO0H 1JIIA 1MB4A 3HEAA 4D7AA 5DJ6A 3W4IA 5BO5A 2ZUUA 1RM3A 2AQ1A 5CR1A 3OOJA 4GKZB 3C6EA 3KLAA 5LO7A 3I6GA 5IW6A 2E4AA 3UK2A 1MHPA 1T4DA 1K63A 1R0KA 2I2WA 1PZ2A 1NF9A 5D5MA 3QXDB 3LKVA 3PICA 3NJXA 3R24A 3ROMA 1ROCA 3EDDA 3SYNA 1MXHA 4JWTA 3ZLVA 1C9MA 3NSYA 1M6OB 1N64H 4G81A 1JSYA 3U30B 4LOLA 1U93B 3T1OA 2ZCUA 4WGWB 4A10A 3ZXUB 4ZFGH 1T7WA 3L5XH 1N5YL 3TD6A 4BD4A 2CMRH 3PEUA 4DQOL 3PGKA 1RUPH 1GCYA 4B0PA 2D0DA 4DCNA 4HOWA 3DAFA 3AV0B 3AU0A 3FDZA 3IDXL 4C0HA 1DEAA 2GZAA 2VHZA 4G9DA 4Z78B 1SG9A 2NU9A 3TGPA 3ZRFC 2WJWA 2EP7A 2JKYA 3LKRA 4G5QA 4NZUL 1MX1A 5HGGS 1VGVA 5I7SA 3THXA 2O5VA 2R1UA 4RK1A 3HUJB 1H85A 3DUFA 2P4HX 1JNJA 4RF2A 3VXUD 3C3WA 5TF1H 2EFYA 3V0WL 2BUCA 2ZOSA 2PY6A 3T5WA 1DKQA 1H42A 1T34A 3KQYA 1VL1A 4PGZA 4A2GA 4AN0A 3ZHRA 3I64A 2DTDA 4RL6A 2YJQA 1TVBA 3MSPA 4BZ1H 4WZBA 4G36A 3BIFA 5DHAA 2V1XA 4U6TA 2XN9B 4JT8A 1YQEA 5CPFA 5A71A 1IGIL 3P1VA 2FRDA 1RKUA 4LDZA 4XR9A 3D69B 5IC6A 4BLUA 2NPLX 4PJ7B 3VSUA 5CDTA 5I2IB 3U9WA 1Q77A 1RM4A 5TQ0A 2XITA 2QIOA 3NUQA 1EHLH 1V26A 4DJJA 1HWYA 3E8UH 4QHKI 3G2PA 1ZXXA 5DEFB 1ZEAL 1Z4NA 3PRZA 3GT6A 4PJXA 4MUEA 5E3JA 3NHZA 1EK0A 5ID1B