4Z7OB

Integrin alphaiibbeta3 in complex with agdv peptide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-IIb
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
total genus 115
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4z7oB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4z7oB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4z7oB03
1JEQA 4O02A 2ODPA 4UM9D 4WK0B 1MQ8B 3HI6A 1SHYB 1M1XB 1U8CA 2VDNB 4NENB 4Z7QB 4O3UB 1AO3A 1T6BY 4WFQA 1U0NA 4G1MA 3HXQA 1MQAA 1NA5A 1XUOA 4XW2A 1DGQA 1FE8A 2VDRB 4Z7NB 4MMYA 3OL2B 1MJNA 3EFOA 1N9ZA 4MMZA 1QCYA 1V7PC 3BQMB 3IJEA 1RRKA 3AFCA 2WINI 5LN1A 3EOAI 2UZYB 5E6SA 2IUEA 4IXDA 1BHQ1 5KYWB 1IDN1 1IDOA 1LFAA 3EH1A 3TXAA 3K72B 1QC5B 1IJBA 3V4VB 3EG9B 3Q3GE 4HQKA 1SQ0A 1PD1A 3NIDB 5HDBB 1T0PA 3E2MA 3FCSB 4DMUB 4GZ8A 4NEHB 3VI3B 1ZOOA 3F78A 3K71A 3AL8A 3GXBA 1MF7A 2VDMB 1N3YA 1M2VA 2NUPB 4UM9B 1JV2B 3ZDZB 3N2NA 3EOBI 5KYXB 2O7NA 4MMXA 3OKYB 3EGXA 4HQLA 4M76B 5ES4B 3EGDB 5E6RA 3K6SA 4WK4B 1ZOPA 4K3JB 1SHTX 2VDQB 2NUTB 1JEQB 1MHPA 5KYYB 4O02B 1XDDA 1AOXA 3V4PB 3ZDYB 1U8CB 1M1XA 5KYUA 1ATZA 1YVPA 4O3TB 3TCXB 1PT6A 3VI4B 3AL9A 4MMYB 1AUQA 2WW8A 4F1KA 3OKWA 4MMZB 1FNSA 3BQNB 3FCUB 1U0OC 3IJEB 4CN8A 2VDOB 2P28A 2XGGA 1CK4A 1M2OA 4HQFA 1L5GA 4IHKA 5KYYA 5E6SB 2ICAA 4G1EB 3ZE1B 5BV8A 3TW0A 2B2XA 3TVYA 4UM8B 1JEYB 3ZQKA 1OLZA 1IJKA 3NIFB 3RAGA 1OAKA 5E6UA 3K72A 2VDLB 3EH2A 1RD4A 4HQNA 1YVRA 3ZE0B 3EGDA 2M32A 3FCSA 3K71B 3AL8B 4C29A 1RS0A 1TYEB 4A0QA 2NUPA 1SHUX 1RTKA 1SSLA 4NENA 1YUKA 4G1MB 3EGXB 3PPWA 2XWJI 5HJ2A 3T3MB 3HXOA 2NVOA 3ZE2B 2X5NA 2ADFA 4HQOA 3PPVA 4FWWA 3EFOB 3PPXA 3IBSA 3OL2A 1XDGA 1PCXA 1M10A 1Q0PA 5KYUB 3BN3A 4C2AA 2I91A 1PD0A 3M6FA 4JDUA 1M1UA 4CNBA 3ZDXB 3NVQA 1CQPA 1ZONA 3QA3E 3T3PB 2QTVA 2VDPB 1BHO1 1L5GB 1QC5A 4Z7OB 3EG9A 4CN9A 5KYWA 4WJKB 1DZIA 2XWBF 4WK2B 2I6QA 4G1EA 3NIGB 5KYNA 4C2BA 2I6SA 1MQ9A 1M2VB 4BJ3A 2VC2B 1JEYA 5HGJA 1JV2A 4MMXB 4IGIA 5KYXA 2P26A 4JX0A 5E6RB 5E6UB 3K6SB 1JLMA 3F74A 3PPYA 4FX5A 4F1JA 4PN7A 2ODQA 2NUTA 1UEXC 2VDKB
chains in the Genus database with same CATH superfamily
2VW6A 4DYVA 1K8IA 1EXWA 4IDLA 2AQPA 2IALB 1GKYA 3RVXC 4Z3FA 2XB6A 3EYAA 2ZJ6A 4IDNA 3FVVA 1VSTA 4V0QA 4WY8A 5IT5A 5D7IA 3VX0A 1ZHBA 4Y4FA 3H87A 2JLYA 4M6NH 1I51A 5LAXB 2CR6A 2JIPA 1QLHA 3CF6R 1G1YA 5GRJL 2IDZA 2K87A 5DURB 1BGXT 2Q5IA 4MV4A 4N25A 5C0AB 3U36B 2AJZA 1IATA 1AIFB 5ISZB 1MXGA 5FYKE 3DOUA 3WWEA 4CM4B 4OCSL 3RS4A 3IAEA 2KZWA 2ZBQA 4B3BA 4BFLA 4XXDA 5KVEL 2H7XA 2DCUA 1PT6A 2PFSA 3HDGA 5AW1A 4K9JA 2XB8A 2CNWA 1PJZA 3F1LA 3RFUA 1XZNA 1UXKA 2AKEA 3S35X 3QQ3A 5EZJB 4YX9A 2MOVA 1G59A 2OO5A 1AK2A 2JFQA 4AWBA 4IOLA 1HWWA 5AZ2L 5BPFA 2VBCA 3EJTA 4U6SA 4U1MA 1JFTA 3VO0A 1KEML 2MQGA 3BWAA 3EIUA 5KAQG 1SY6A 4K3EL 3G17A 5JO5A 1FBTA 3R0XA 4PJ8D 2O5RA 4JDZA 4UAHA 3S4YA 5GVSA 2BMKA 2BFCA 1KH1A 3KKLA 2OW7A 2P7TB 4UPDA 1STOA 5GGVY 2I34A 1U5BA 3PY9A 4IBZA 1E3IA 1HKLL 4D0LB 2Q0HA 3PT5A 1L8QA 1OLXB 4DGWC 1TZAA 4OM1H 4MAUL 4GRWE 3UAOA 3A3NA 3FU7B 4KXZH 1TR7A 2GSWA 2HJFB 4EW6A 2VXSH 3KAQA 2B7BA 5DCLA 3RGWS 3B2MA 1Y3DE 4AWJC 5P21A 1P7PA 4E9WA 3ET4A 4M9OA 1PR2A 4QUIA 3WGGA 1ZGGA 4FOLA 2EQ5A 4DV2B 2E4WA 4YAJA 2Q3AA 4HXBL 4MROA 2EFHB 2IL1A 3FNQA 1Z6ZA 4BO7A 2JIZA 4X5XA 2WWRA 3CHOA 3TJZA 1MHPL 3SFVA 2WLZA 3BMOB 4OA8A 3LXBA 2RGWA 3MLSH 4ZMPA 4QHNB 1WP9A 3V4PB 2K7PA 1NJGA 4ZMNA 1U63A 1TCMA 4C22A 3TM4A 3EZ8A 4EI5A 2W88A 2GI4A 3UJ7A 3LDBC 4ZU6X 5L3VA 1IBMB 5BMOA 1YS1X 4WTXA 3WIHL 1OGTA 2XIIA 5CEEA 3MRMA 1XRJA 4IJKA 3QBJA 4EDXB 5CU7A 4XXCA 2IHNA 1I9IL 2ALAA 2HRLA 4P32A 3TT3H 3MR9A 3TQIA 3T7KA 4FXTA 1NFQA 3HN2A 5EIIA 4YECA 4LSTL 1VE9A 2EL9A 1DCMA 4FKBA 4EQ2A 1SYVB 3RE1A 1D04A 1SQMA 3OXSA 4L5AA 2RFLA 3IURA 4OHBA 3AP1A 5FUCE 5L7XL 3Q6FB 4PLTA 4CIYA 2QHXA 1F9EA 3A32A 1F5NA 3B8EA 3KCPA 2X4SB 1W72B 4XE0A 1L7IL 5I7SA 1SURA 3DXAD 5TY0A 3V8RA 2ZUQB 2YL2A 4PJGA 2VG8A 3O45A 1A7QH 1JIBA 4HY3A 2B5VA 5KJCA 4GW1B 5HS6A 3U0WH 3VNRA 2WHRA 4NO5A 3IP8A 1QSEA 2CCWA 3ARDC 1P1IA 4J3SA 3DLAA 2WT8A 5A5VA 5AKSA 4R2GC 1O4WA 3MXVH 2JKYA 3HBAA 4KXQA 4RELA 2IH3B 1U9JA 3STWA 3U9UA 5KKAA 1BMZA 4K07A 3IDGA 3TEXA 3KQSA 5EU5B 1VMEA 4UARA 4A6YB 2YQGA 2D0DA 2CZNA 2FEAA 2VDOB 1R2QA 1XD2B 4C6TA 3HXMA 5DEGA 4AEIL 1PU2A 4U2ZA 3AVEA 4BP9A 1QR6A 4LCWA 3PUUA 2R87A 1S9WB 4U49A 4ZYWA 1J0IA 4WJG3 1PJ8A 1QHHB 4HDNB 4A0RA 2FAUA 3HZKB 3T6QC 1INLA 1DL5A 3KLPX 4B0OA 5HIAA 3VMNA 4AUMA 2GF9A 1Y3CE 3MBEB 3T0DA 3ZYOA 3WIHA 4GNKB 1UXOA 3S1LA 1JNYA 3BDYH 1IOZA 2D00A 5FOSA 3UN1A 1U6AL 3M82A 4TV8B 2AZMA 3KYOA 4BP8A 1J9TA 4FXGB 4G1BA 4E33A 4RGNB 3F74A 1G3QA 3O8BA 4HAFA 2WN3A 3SJ7A 2QUBA 3IU3B 1TQCB 2WXJA 3VOSA 3ZMRA 4KQWA 2FFHA 3FUKA 2ILVA 1W94A 1T5DX 1WRFA 3AERA 4JLPA 5ETUB 4U6XA 5KTEH 1J1XH 1NSNH 4RIRB 2P11A 2PGLA 4IKPA 1DXYA 2Z92A 4YHLH 1QB7A 2JGDA 1JVSA 2X6BA 5ICZB 4I4CA 2HB6A 1SCJA 4TYPA 2DM6A 3HUEA 1TAHA 1O95D 3KYDB 1K2DA 2LU3A 4HIPA 1A8JH 1ZGLM 2F8MA 3BMQB 2IT1A 5LQMA 1JKFA 1V27A 3SHTA 4J3WA 2BSXA 5AD0B 5AM4A 3S3CB 1X4YA 2WYHA 4YK4C 5DP2A 3S8EA 1D6EB 1DMSA 4HQNA 3N6VA 2R69L 4DJTA 2AKAB 1IQPA 1RS0A 3PE4A 5DD3L 2NXEA 3L0PA 4XX0A 4JR2A 4DDWA 2A9ML 3OP4A 2ZIAA 3IHLA 4CGTA 4TUOA 1G66A 2W8BB 3C6LC 5KVCA 3GMNA 1XTKA 1E89A 4OOFA 2YIVX 2YXWA 1VAHA 1AQJA 3VNZA 4BQ9A 2VP0A 4ONEA 1Z2PX 3PXCX 1T13A 2B4CL 2E6PA 5ICXA 2EVIA 1PL0A 4KPHH 4N8VB 4HQ6A 3KJ6H 5D1QA 1N0LA 5BO1L 3KHSA 1VL2A 3OT5A 1ADYA 3QT2A 3BULA 4XGRA 3NCBB 1UBFA 5G02A 4UILL 1ICEA 4LESA 3QPCA 1OBOA 2H3HA 1ZEAH 3UAJC 1N26A 4K0OA 3FUHA 3ABQB 4RUKA 1FW6A 2XY1A 3IH5A 4XCNA 2R27A 1TA0A 1F7VA 3HRZB 1JZEA 4AMXA 1N5DA 1F3JB 3LGSA 1JYNA 1FUUA 4R0MA 1QGUB 2NUPB 5I6XB 3T9WA 1TK2A 3CFKB 1A98A 4TKLA 3CDYA 1HORA 3DT8A 4M9PA 3O8XA 3P3TA 5BRZD 4E68A 1P0FA 3BZWA 2X86A 3V6FB 1IUKA 1DADA 2GD0A 4QC2A 4BVLA 4I3RH 2BJML 4JUFA 4HKBA 4XE5B 2VS1A 4Z7AA 1ZVQA 5DRWB 3L6UA 3S70A 2AXGB 4CKVX 3ENWA 4R1LA 3RCBA 1XH3A 5CLYA 1U92B 2GJ6A 5DFVC 4PJ7E 5HJGA 4IFEA 5EOQL 1QLJA 4MARA 2WR8A 5DJDB 1R5BA 1GGHA 4ENZA 5DGQA 3QZUA 4ODBD 4HA1A 2CIKB 4OU5A 5CA1B 4KVCH 4AEFA 1K6XA 1MEEA 4WW2F 1FNGA 2EHDA 3NAAL 3P3SA 1OFUA 2R69A 4OLYH 1K68A 1OASA 3VAEA 4X44A 4FOTA 4PRAB 1L5YA 4AIXA 5HZMA 5K39A 1TO4A 3EDKA 1BCIA 1FFOA 2RALA 5IKCB 5DHYA 1D2RA 1Z0IA 3S2SA 4OKVB 1PLLA 3ED1A 3WTXA 1TIBA 2XVMA 4IICA 4ZI7B 2DIAA 1BX3A 1QFSA 4BRWA 5JY6A 1YRLA 1WR8A 4LX8A 1KB5B 1KEEA 3UGXA 4TQ8A 1MWOA 3KTDA 4UAVA 5B3JF 3G08A 4FEGA 4JPSA 3A3OA 1DSFL 2W9DL 1HNXB 5BMVF 4MQ7A 1EVQA 3DUUB 4I50F 5MN4A 4OQTL 2HWZL 1XZDA 2EE9A 4K8RD 1OLUB 3UYRL 4MCHA 3FB6A 1NGQL 2KZKA 2H5LA 2EEZA 1ZDMA 1XF4B 4IIQA 4M1DH 1CEQA 3ZDXF 3QXDB 5A9SB 1R24B 1SD1A 3V7MA 5MENA 1A9XA 4ASUA 4J3XA 1JFSA 2GEBA 2QLFA 2ZTHA 1FZOA 1RD4A 3MTJA 3IFNL 4GAYB 3LS4L 2ZT5A 4AKHA 4KZEL 1JL8A 1SUIA 1TVBA 3K8YA 3FTZA 1KGJA 1VJRA 3ABRB 3AQIA 1TZKA 4LOEA 1CQWA 5LSAA 1MOEA 2JAUA 1I4FA 1ZHKB 3BWVA 1MB9A 1J23A 2JLSA 1Y6JA 1KZ1A 3PTLA 5HHVL 5IM7A 3OZAA 4HZUA 1RFGE 4BUJA 4B34A 3NALA 2DV6A 1IC4L 2VN3A 2BCEA 5DEJA 4KK4A 4PJ5E 3RSZA 2UVFA 2VLKA 1MH5A 4L29B 4A0GA 1GPOH 2FO4B 4PXSA 5L4FA 1H2BA 2YXMA 1E2MA 1UM6H 3V48A 1TZHB 1DBVO 5A2KH 1HHGA 1T8RA 1UJNA 1KN2H 1F4YH 4XNZC 4NPHA 4GO6B 3WEXA 5I1JL 4LAFA 2WZQA 2CHDA 1JVLA 1EEHA 1NBEA 5D1HA 4X99A 1QAMA 4EIWA 2AK4B 2EBWA 4JFYB 4K87A 4AB1A 4L8FA 4CKCA 1E2FA 1Q1QA 5BVJA 3BW9A 4E07A 1YRKA 5DQ9A 4ANFA 3OZ9H 2NY6D 4GW4B 3NQIA 3GMDA 1GPLA 4JFHD 4NDMB 4PB0H 2ZIZA 2DR3A 5ALYA 2EGHA 3OZWA 2W48A 1YQXA 5LJLA 3U9TA 3IRUA 2QDKA 3DO8A 4DIMA 2AHRA 5EMKA 1E6JL 1GCGA 2IXEA 5PNTA 4JFED 4OQTA 4P2OB 5KTYA 4C29A 1UH4A 4P3XA 3UO1H 1NCBH 4WTZA 4EO4A 1RQ7A 4RAOA 1L5HB 3R0NA 3E6FB 2Z8XA 4BC0A 3L07A 3IFSA 1P4BH 4DSYA 2X2PA 1RWVA 2E8ZA 4JB8A 5DYIA 4DERA 2AFHB 5I8CA 3TJHD 5SZJA 4HT1H 3GEFA 4YLBA 3LNEA 5EPMB 2XTAA 3UL4A 2PH5A 4MNHA 4M8KA 2V8BA 2C5HA 4I9WE 2GEEA 5HHOD 5EJGA 4Q56A 3MTAA 2SODB 2OCIA 4IRSB 4F2FA 4LWPA 4ZPVB 2HFGH 4BZYA 3GYGA 1XZLA 3TBWB 4F5EA 2DQHH 2Y99A 1YUBA 5JZBA 5JXWA 5TQ2L 3IJ5A 4NKRA 2BTQB 4F7CB 1J97A 2H3EA 4NONA 3EYOA 1A2BA 1KQPA 3N0VA 1Y7TA 1J12A 5IYZF 1CD1B 1M1YA 2NSDA 3EDJA 1VFAB 1ZSHA 1VKZA 3IVKB 4P2RD 3N2NA 4M21A 4KCGA 1THTA 4D3ZA 2XE4A 3PAVA 2W83A 5CJQL 1UM5L 4QRTA 2C34A 4BCDA 2JAPA 1IUNA 4ZX5A 3LKZA 3MZGB 5B8CC 5KVMC 3KSZO 1DR9A 4UAJA 3ROOA 2F8SA 5M95B 1ZN7A 2A9PA 4AOFA 3VZRA 1X19A 4TSAL 4RACA 4ACAA 2IADA 4ETIA 4O4LA 3TFOA 4XMVA 4P92A 2O0MA 3LAWA 2IUUA 2YPLE 4NY1A 2AUMA 5LQBL 3MS4A 4DA9A 4IRZH 5IJAA 4LQLA 4X1IA 5JC1A 2X0FA 4DWWA 2XA1A 2ZBGA 2H1RA 4COKA 1Q9OA 3E3NA 1WUHS 4EKGA 4C56E 1KC1A 4D98A 1R5WA 3K9BA 4B3GA 3ZNPA 2IE0A 3RWCA 4IDBA 3PGCB 4Y1AE 1CS4C 2J0SA 4NUMA 4ZQTA 3TL6A 3CKLA 3MHTA 4X4ZA 4K94C 3VI3A 1AANA 2FIRT 3QHAA 3ULVD 5JQ6H 1UPXA 3O95A 4UT7L 3NC1C 2JSFA 4W6WB 1ISPA 4TLSA 2QYSA 4RXTA 4WW2C 5AOJA 1CU1A 4DUPA 5H70A 1RZVA 4DTGH 4BQOA 1OTUD 5JZVA 3SU8A 1J0YA 4IVRA 3VYRB 1L4BA 4J3BA 4Q1BA 2GKSA 2W60A 4QRIA 4NN5B 1YI8A 4QXGH 3IA2A 3VC7A 1MJJB 2QQLH 3GEWB 5FTMA 2UY7A 3UJHA 2WHQA 4CMGA 3MV8B 3VFUA 3TRIA 3UROR 1IBGL 3LHDA 2VNCA 1JZSA 5KI6A 5FGCB 1QO3B 5CT6A 4WI0A 4MS3B 1E66A 5TQ2A 1TTRA 3GFGA 4XH2A 4DCSA 5CVEA 1POWA 1VBNA 2F6AA 4RD1A 3MNVA 1YR2A 4QRUB 4FI3C 3HM9A 4N0RA 2B6NA 1PHPA 4ZU1X 4KO8A 3KZXA 1WS7A 5HF6A 4Y2YA 3W2DH 1FGVH 5D7SL 5F8RC 4QXRA 1YNTA 2H4JA 2JIZD 4YSOA 5HUJA 5A3RA 3QXVA 2NXCA 3FB7B 1Z47A 3PIRA 5I9BA 3TQCA 1MFCH 2XWJI 3BBLA 6REQB 4BUHA 4HIXH 3HN5A 4PYKA 1NDMB 1MCOL 1SMKA 1ZSVA 3L43A 2OECA 3GN2A 3BWZA 2D8AA 5BYAA 4M8QB 1R27A 4O0MA 5J11C 1A9ZA 1QGED 3CURA 1CZKA 2WJZB 1W6LA 4B4KA 5CB0A 1Z9LA 3S44A 4UXIA 1VPLA 3AR5A 4Z4GA 5D71H 2Z31A 3H7BB 4WESA 3R40A 1SVOA 1JLMA 2ZR8A 1BX2A 1Y80A 3NHRA 2AVDA 4PX2A 2BVQA 5L3ZA 3EYUH 5IUKC 4JUBA 4P9ML 1UT5A 4HIQA 3M6LA 1G291 4CADB 4FFYH 4G5XA 1J5PA 4DM7A 4GRAA 4Z4EA 4QRRA 2WU0A 2Y23A 2G2PA 5FYLL 3COWA 1F41A 4XWOD 1L4FA 4JWTA 1KCBA 4XO4A 5JQWA 1UJ3C 1J86A 4I14A 3U44B 2PS3A 1ADQH 3TI9A 1E5LA 3ORRA 4QHKI 4NXSA 4Q1FA 4W6ZA 4MI3A 2XN0A 4BV1A 4UTAH 2NTFA 1X1DA 2Q0ZX 3QE9Y 4BUCA 3BXHA 2GTZA 2P5PA 5ER6A 1U7UA 2I2AA 3DTVA 1WUTA 4E9LA 1FDIA 1H6CA 4DEYA 3GRUA 4N2BA 5F1OA 1W2KT 2IUSA 4KQKA 5I5JA 3KLHD 3CVIH 5AEAA 5KX5A 4Y2PA 2VW4A 3BWSA 1JF6A 4MMYB 4AUKA 4ZZ1A 5I76B 2A6PA 4CGUB 5CEYA 2JIRA 3DEJA 1ZNXA 3KYIB 1MJFA 4RKRA 1LY1A 2CBGA 3S36H 1Q1BA 1QSED 3JD0A 1D1PA 3TSWA 2MEJB 5JRZA 3RQ3A 1EO8H 2NNAB 5GJWC 2OCPA 1Q9KA 1QBGA 2N75A 3Q9SA 2OLJA 3GN1A 5B3JE 3MMZA 4G42A 5JIIA 4L4TB 4OKDA 1D5WA 3FY4A 3WG7B 3TOPA 1LDYA 5EUCA 3OTOB 5EL0A 3B38A 5AM0A 4N0UE 3SHQA 3SB3A 1K0UA 1YYLL 1TJIH 4PJFA 1YSCA 2ZRPA 5KSAC 3VFMA 1E4EB 2HQSA 2WFMA 1W44A 4Q9RL 4JDPA 2C5AA 4FFVD 1JDPA 4TMYA 5CJBA 2BBWA 1RWPA 4CC0A 1R75A 3BWUF 3NCTA 3PP8A 3PXXA 4EELA 4OI7A 4EOWH 5IVXB 3IJHB 1NPTO 3UO8B 1ZY9A 1NUQA 5AVXB 2R47A 1QHQA 2DF3A 2E8YA 1RHUA 3L3BA 4A7QA 4NBRA 4ENVA 5DZLA 4B2LA 3BGFB 1YY8B 1ZN2A 3QHPA 3Q7PA 5I1KL 3KFXA 2IEGA 4RK6A 3TNLA 3DTUB 1X7DA 3WEOA 1HXMA 4N5DA 1CLZH 4C4AA 4GMXA 5IC5A 3U0TB 1OV6A 3UB3A 5DBEX 2PLRA 4IDHA 5EUOB 2DFLA 3TRDA 5T7BA 4CW1A 4C0SA 3VGAC 2PO5A 1A95A 1YEJL 4L1DA 1L5GA 1PV2A 1E6LA 4X80L 2H3XC 1IZYA 5SV4A 5C5DA 4ELMF 3NRPA 1LPSA 3GUFA 2HRZA 3MLRL 4OO3A 4CC1A 5AVKA 4JR9L 4H4EA 1C1YA 4B6FA 4XP4L 5E08H 2CDAA 4DDUA 1ZGJA 5AVSA 4Z53A 1WXIA 5HHTA 4YC7A 2FR8C 5CNIA 2O6HA 2IZOA 3WDKA 2HZBA 3OMWA 1GT6A 4Z7OF 2VM9A 3DEAA 4JDUA 2GIYA 5ADOL 3V1LA 1CFTA 4MS4B 4OUUA 3EXFB 3LECA 1P18A 5LLTA 1EAYA 2G1KA 3HJBA 2HT4D 3NFYA 3GI9L 5AAMC 3S0JA 2UZ1B 2RA1A 5JW4N 1Q38A 4FFWA 1WLSA 3PREA 1AF7A 3Q8EA 3GGGA 5BPPA 3DO7B 2WXOA 3O2WL 2XUGA 4DQUA 4JRXB 4DVRL 4EFKA 4CCWA 5BOZG 1UB5A 4DZTA 4KQGA 5SY4A 1NGZA 4RV9A 1ND0B 4MJJA 1OFUX 1XQWA 3G9UA 4M7OA 4BRZA 1RWMA 3LKRB 1OPRA 4DJMA 1WIUA 2AJ3B 2VVTA 1R3KB 4XOUA 1Z3GL 3IDUA 2QP9X 1JF1A 1CY4A 1ORQB 2A99A 3D69B 2YXEA 4K28A 4MI9A 4OQQA 5LDGA 2A3RA 4KWHA 3NDRA 5CGZA 2JI1A 5GJTL 3GMOA 1ENYA 3ZGHA 3Q5DA 4LOUD 3MRKA 2VQSA 3I5AA 4TGLA 1ZH0A 2A35A 5HJ5A 4EI6A 3NOQA 4LFAB 4AKOA 4N01A 2WZ0A 2ZJ3A 2JFHA 3GO4A 1M7DA 2MSKA 3FNHA 4ZVRA 3Q8MA 4JI3B 3VM7A 4BE6A 1OWLA 1W0VB 5IIEB 4W7HA 4PJAA 5BZDA 5AI8A 4S0XA 1UATA 3BA1A 4F4JA 1LO3H 4IR7A 2WZ5A 4F6LA 2LFEA 1TQDA 1P80A 3ZL4L 5TMDA 3EJ6A 5BV7L 3O8XD 5IMMB 4KQ3H 5J12B 1RDFA 3EFOB 4M3HA 1ZM3A 4WHCA 2FPIB 3ZD7A 1YBVA 3E9UA 1V1JA 2I8LA 1LF5A 3DLTA 1P2SA 2C9RA 4APQA 4BZWA 1P1ZA 1YECL 1WKBA 1TL7C 1CIVA 2DY1A 4XXHA 4G8EB 4M9QA 2D0IA 4D0SA 1IFRA 5DHPA 5FBRB 2GJ6D 4ZTUB 5ALZA 1AD9B 5DU7A 3MJCA 3QPXH 3S4SG 4KGXA 4MSUA 3OA2A 1Z5NA 5EIAA 5T1KA 5FBKA 1DBJL 2HHCA 4QBGB 4LRNL 1P1JA 2XTMA 3O1IC 1JR3E 3MHPA 3SEAA 1M1ZA 4U4AA 3CHYA 5KUTA 5F9FA 4UU8A 3L1VA 2MWMA 4ATNA 5GISL 2P4AB 1LEGA 2Y06H 2IPUG 2BNRA 3KU4A 5I17A 1KK1A 3E8VA 4Y1RB 4KXCA 1PTJA 2WF8A 5AJWA 4YR9A 1XZCA 1E1QD 4H3VA 4ZV7A 2HDWA 3ZE8A 3B6SA 1ZOPA 3AZPA 4MYRA 5I8EB 3QI9B 2KERA 3VSUA 4G63A 5HQ3A 1FDTA 2BTOA 3HZHA 2PK3A 1SOWA 5B1CA 4TMWA 3NJNA 4YRQA 1F3LA 3I5YA 4FQCH 1KIUA 3DFIA 2EWWA 1PFUA 1S8NA 1L3NA 4ZMTA 3QFDA 5CSGA 5H35A 3TWCH 1XAIA 5TPZA 4JFOA 3V0JA 5AJTA 3STHA 2DQKA 1YKFA 4FEAA 2R2EA 3ZHYA 2R25B 3PWPE 4HVBA 2CVOA 2ZETA 5FLKA 3TLGB 3QIUC 1CQIB 2B3IA 3R3JA 1V71A 3X1GA 3NKFA 3DP7A 3TLMA 4HNRA 5MEND 2O93L 4ASUD 2Q2NA 3UJ8A 4UULA 4EI2A 2BWIA 1HOTA 3W9DB 4LHJB 3SEFA 4PE5B 5AVVA 2A7XA 1JHAA 2YD5A 1ETZA 1YQWA 2BE7A 4GG6B 3QORA 1U99A 2WD7A 2J6WA 2AEWA 3U30B 4GPAA 2E59A 1JEAA 1ZC4A 3R06B 2OR7A 2JJMA 3IKVA 4B47A 4NYLB 4ORGA 4KHXH 2PS9A 2DERA 4W1QA 2CXGA 2F53A 2TRYA 4M8SA 3D3VA 2G8NA 4RISH 3M1CA 1K3UB 3UTTB 3PXBA 1K08A 3KVVA 1OSEA 2Z5LA 4GWKA 5LZ4A 4WRRA 3W2TA 2VLKD 5JORA 1JA0A 1I9JL 3R77A 3F9RA 4RL4A 4C78A 4TQIA 4LDRA 1M1XA 1E1CB 2RAPA 3QEAZ 3C3YA 3P0JA 3U7AA 5GHWL 5JHLL 3CH1B 4QRQA 3R4VA 5LDDC 1GUFA 4MKTA 1E5CA 3GJFH 5J3JA 3NXSA 4FTVA 4P99A 1X94A 2WLIA 3CU7A 3N2JA 3ND6A 1GPAA 2EF0A 3VSBA 2PBFA 4XMPH 2NAFA 2PWBA 1NH6A 3A27A 4DRYA 2APTA 1MLBB 2PX4A 4AL4A 1LW6E 3FNEA 4FQHB 1S96A 2NADA 1MDFA 4MRSA 4NZRH 4LO9A 3IMUA 5ELMA 1QR1A 4D1YA 4CM8B 3USCS 3TXXA 1D7CA 2K6WA 4FQQB 3A4NA 3TZVB 4OSUH 2BSTB 2H8PA 4TPRL 1I4OA 2PMFA 2Q9BA 1JGVH 4W9EC 3NMUF 3DZIA 3MLAA 3NZEA 2VSFA 3HKDA 3C8KA 3C5VA 4NZTH 1KBKA 2HF7A 4E31A 1DJGA 1SC9A 4N5ED 4DV3B 4HLZH 3MTRA 2NR6A 4JN2B 5KBLA 4NU8X 1QZZA 4B6SA 5D4QA 5I3CA 1IQDA 2WLNA 3C08L 3NA9H 4LU5H 3H56A 3TQQA 2F08A 3WQBA 4EQ3A 1QUNA 1B73A 3UJ6A 4LJLA 3WL9A 5FFFA 2BWDA 1KY3A 1I0IA 1HXHA 3US1A 2OPBA 4XCCH 4RSHA 5HGAB 4Q15A 3RKSA 2C9YA 3DVGA 2OTPA 5JROA 4RKQA 4G8FA 3EDOA 4MVJM 2ITCA 2PKEA 3BE6A 3WFIA 5C2BL 2D7PA 3FUVA 2CBMA 5AUPB 1PI3A 1FFXB 1WFUA 2OMKA 3GRRA 3ZTNL 3CXUA 4K71C 2PWGA 3RSOA 5JHLA 1XN1A 4K26A 5T33H 3ZIYA 2E6JA 4QGFA 3P4MA 4UEOA 2HBRA 2OXRA 4K1LA 4AV4A 4X5RA 3MT7A 2B4RO 3GLFB 3QF4B 2JATA 2QQNL 1NUAA 5JSUA 1T1GA 5EC2A 3B82A 5FL7A 3ELQA 3OVUB 1YAHA 2ZSDA 3AFNA 1X8LA 1DKRA 2WJ4A 4EJSA 2BDTA 3UMBA 4A2MA 1R4NA 5K9JH 4TT3A 2X4PB 2IANA 2PCFA 2MMGA 4I55A 3QTLA 1MRCH 2EIEA 5CS7A 4GI5A 3FTQA 2ZIEA 3O74A 1CR4A 1PNCA 2CCLA 4FMDB 4O2BF 1U81A 3QY9A 1H0DB 5HILA 5HYIA 1TKAA 4L8SC 4Z7OE 3DSRA 4MVJH 4ZAVA 3V4VB 4G6ML 3OM0A 2PSSA 3DX6B 3U26A 1TTTA 2QX6A 2W6MA 3FHQA 1YJDL 3GUZA 2YLHA 1QH0A 3D06A 1IONA 2PUBA 3M2TA 1YGPA 4Y9SA 3QPDA 4U63A 4Y19B 2QDXA 2PPCA 3CG0A 3O3AB 1UB6A 3GDGA 1N6QL 2WHVA 4XKJA 5DVOA 3U7YH 4PZ0A 1F2VA 2G5GX 2PD4A 4AY5A 3BTSA 2FBRA 4FE9A 5I15H 1CDZA 3QTBA 1J33A 2BFDB 1BECA 3TTWA 1G7JA 4LZKA 3FMOB 2YGOA 5K9OB 2YBRB 4MB1A 2E9WA 1NXXA 1OVMA 2AQ8A 3HN7A 3L6OO 5CP3A 1PLGH 3GIZL 3IF1A 4KRPB 3VVBA 5IQOA 1UA6L 2VP9A 1B93A 4FFZA 4FNAA 3U3JA 1KGDA 5I74B 3DLPX 3QVKA 1H8OA 1U4EA 1D07A 2BF4A 4HGZA 5FO8A 4AJ1A 1UUFA 2K7QA 3WDIA 1IZ7A 1GZDA 1SBIA 2NUTA 3QELB 3T4AC 1H6EA 4LYAA 5A2FA 3SWWA 4J9VA 1URPA 4WFQA 3GLHB 1DEDA 4YRFA 3G0GA 2MOQA 3MV01 3MJGX 4PG7A 1XLTC 2G1JA 3HNSH 1M6VA 5L6YL 2R7EB 2V7HB 2JJ8A 3AJRA 1CE1H 1A22B 3FUDA 3BAXA 2G0LA 4JG0H 1YXMA 1CR1A 1Z9NA 5HGBA 2Z31D 4PX5A 1I7QB 1BF2A 1KBVA 3OO1A 3D85A 3LUKA 3P52A 3GD1C 3OKNB 1KPUB 5EC1A 3SD7A 1EE2A 3G1UA 3FO0H 4TOIA 1C8KA 5DR5L 1CFSA 2JD1A 4YHML 2ZANA 1KJVB 4QRRD 3QYFA 1SXJE 4LSQL 1WV0A 1MI5B 3I75B 3AFOA 1EFPA 1OTHA 2QPAA 4R8SA 1RLIA 3T0GA 3K4PA 4KRMB 4P9HH 1C3JA 4RZ2A 3V7YA 4BX0A 2D13A 4TRRA 2VHEA 3PQ6A 1IM8A 1EAJA 4KR7A 2P9YA 2FQWA 3KXFA 3BAEH 3DTVD 4Q02A 4PJHE 4DJDC 4MYDA 4CVXA 3IV6A 3WJ2A 3FFTA 1S4MA 3TF7C 3PC3A 2DLEA 4A0SA 4ZOCA 3HY6A 5D5MF 3HSKA 3LSOA 2Z04A 3PFHA 3TECE 1DVFA 2ZU6A 4E2XA 4F27A 1VZHA 3TD6A 2J87A 3K4DA 1WXFA 1XO8A 1S7VB 4NIYE 3A4EA 1L7BA 1PVHA 2W93A 3C74A 3DDSA 5I7OA 4TRJA 3EAGA 3CRNA 3C3JA 4DP0X 1Y7IA 2EUXA 1HNYA 4ZJYA 4L3VA 2FJUB 4RDQF 3QVTA 1CBUA 3SXUA 4UXHA 4MS1B 2B1QA 4AG6A 2GESA 4MDRA 1N6VA 4UM5A 6YASA 4QYWA 2AA3A 2VLJB 4HQOA 2N1KA 1KGXA 3SC4A 3LQZA 3B7SA 5ANMA 2PL3A 1MJ8H 3T71A 1E7MA 2WD0A 5C53B 3EMKA 1OAQL 1VLXA 4TRPL 3BXEA 2OL3B 5FW7A 4L4YA 3F7TA 1O2DA 3R6DA 4QRHA 2XCRB 4FBGA 2OC9A 3WEBA 3DSFH 4XVTL 3HOGA 1CZOA 5EO1B 3G0HA 3BH6A 3SDAC 2AX4A 2ZKLA 3MJ8B 4JPVH 1KCRH 4G86A 2OM2A 3FCUB 1Z29A 1ZH6A 1WFNA 5IW1A 4MQEB 1YB5A 3LVBA 2VRAA 4RVNA 3CSPA 1YMQA 5C3UA 2WP0A 5I7EA 3O9MA 1EM8A 4KIWA 1QI5A 3NBMA 4MD0A 1LO5B 2VDLB 4G5ZL 1JGLH 4XVRA 5E99H 1KLUA 2ZB8A 4IH1A 3L0YA 4LVUA 4P23B 1DAGA 3WO1A 4UEQA 3QWOB 5LGHL 3NBYC 3QQ5A 2HBZA 2QQFA 3MTXA 2DMKA 1NQ5A 3DONA 3CEMA 3TA4D 2GF0A 2XWTB 4BFJA 1NCWH 1IKFL 3LXCA 2J3JA 3BFVA 1LEKA 2SNIE 3T5CA 3KJHA 3R3ZA 1QR4A 5CFHA 1WNTA 1YHZA 2WFAA 4OI4A 4Q4JB 1PDWA 2FSGA 5KCMA 3SKNB 3A25A 1ES0B 3Q3HA 1NY6A 3AEYA 5MP6L 1PMYA 1YOVA 3EXLA 1WW3A 1QRNA 1T21A 2IYLD 5FGBA 3CRMA 3GLDA 4JS0A 3UZQA 4QCIA 4TVSa 3M5PA 2Q8BL 5BOJA 3MRFB 3S7GA 5E8PA 1HQKA 4FEMA 1QUEA 2PGIA 1CBJA 4PNPA 1BQUA 1RBZA 2O30A 1LC0A 4CVWA 1FLVA 4DVBA 1NYLA 4FFWD 1Y34E 2RCYA 1EDOA 5DGXA 4I48A 2WB2A 4X7DC 4FEYA 3UJ9A 2R66A 4URXR 2BVOB 1I1AD 3C8UA 1K66A 1A5TA 2Q5EA 1RUKH 1Z63A 1G7TA 4BL5A 3A6KA 4QXUL 3NRQA 1FNFA 4F84A 3FVTA 3TUIC 3IGAB 4DGIH 2IXQA 5D1ZB 1DXQA 2EKZA 2Q1SA 1R0YA 3HC0A 4EVSA 4JDTL 4MJ2A 1F11A 3PUXA 4YQEA 2BHYA 2PLNA 4UHEA 2D4AA 3ZYZA 1LWNA 4FHJA 3VD4A 1T5XA 4YDIL 1K4MA 3FUWA 5GS0L 4DKFL 3QIWC 1FLNA 1GGVA 4R4JA 3VWJC 2I8CA 2XT1B 5ID1A 1NUNB 2EKSB 1XPOA 1I5EA 3ZY7A 3JTEA 4MH0R 2NY2D 1XZWA 4QGTA 2ZS7A 2B4QA 2X7LA 1NLZA 4F92B 2G5CA 3AITA 1KUMA 5B58T 1ZCZA 3IDJB 3SYNA 5LA6A 1BE0A 4TZTA 4ABVA 3ARFC 1UWFA 3FQTB 3P1VA 1ZV9A 1N36B 5IJKC 3I50L 2EH7L 1ZITA 2OK8A 3TO2B 5DHVB 1W15A 1NC4D 2JVIA 4DT2A 4ZS7L 3EX7C 5B4MC 3KDPB 4APQD 2MRYA 3DF9A 5FQOA 4CKBA 2QNBA 1A2YB 3BREA 3GVIA 2FHBA 2QADD 5G4LA 1ZVYA 1YUMA 3ZHZA 1HV8A 1U3UA 1UM4L 3FOZA 1YEDA 1L5LA 3L95A 2A6DB 4TULL 2IVFA 5D6OA 2EQAA 2EEDA 5CEXB 3DFKA 2AQNA 4PLJD 1P61B 1QIDA 2A2ZA 5AVQA 1VA4A 4LLUB 1GIGH 4HMDA 3BRWA 3CPSA 5FPKA 3STVA 2FEWB 4NJ9L 3UKDA 1TAUA 3TJHC 3IAQA 4NCHA 3H2IA 2NO4A 3ZL1A 4KGJA 6FABL 4KXLA 2BNRD 3NDIA 3RYIA 3UJDA 2WKLA 2QL7A 5EU7C 3NGBC 4DK6A 1K97A 2YFQA 5LZ2A 3I0ZA 1XV8A 3DBSA 2Z4QB 2R00A 3HXTA 2A4MA 3UFIA 2R39A 1SHKA 3L46A 4BE4A 5K01A 1XSJA 1PS0A 1VHLA 1OGAA 4K5PA 4UUPA 1GOGA 2YIDA 5IKPA 1QEWA 2I9LA 1TYCA 5JIPA 3GO1H 3ADBA 4LXFA 1UXSB 3IPFA 4IDCA 1MIOA 3UC5A 1YNKH 2FPGA 1UPUA 2FWSA 2A9OA 3FFWA 4KEAA 1B0RB 3F4LA 4EATA 2E1RA 5DC0A 1JSZA 2D9CA 1QE5A 4LOVA 3AVWA 3S8WA 5TPZD 5CINL 4D8WA 1KAHA 2ISSD 3A1NA 4K46A 2COUA 4LMBA 4UMSA 3U4HA 2R85A 4GT7A 3PR1A 3SDXA 1G9NC 3TZLA 2VXQH 3KR3H 2ZJ1A 3MGOA 4UQ2B 3O9WB 4PRHB 2V0NA 5B6JA 3EOAI 3IR6A 4RJTA 5DGRA 3STUA 4W9HC 1QUFA 3GCDA 4LPKA 1Z0MA 3LUFA 4ZI5A 4G5YA 3H2KA 4Z3JA 2YNMA 4K6KA 4KNVA 2RAMA 4TMTA 4JMLA 3QORD 4JA0A 3V8BA 3P40A 4XP1H 4YHZH 4YC2B 2RK4A 3PU6A 2NSLA 4P58A 4IIXA 4MNQE 4KXVA 3UK7A 1EDYA 4BNFA 1ELOA 1MFPA 3K0BA 1II8B 5LFAA 4JLSA 1LO4H 1VL6A 4JLUA 1BWPA 1E2WA 5T67A 2F53D 4PRIE 3FN0H 3B37A 1JDUA 3WCYA 4XC3L 3D3VD 3HJTA 2ZIDA 5E4YA 1WEJL 5EDXA 3TFQA 2IHVA 4G8DA 3ZXUB 3FMGH 4H0CA 4KBFA 2DLDA 4WUUE 4IQGA 3ABKB 3GRAA 1ZM2A 1OTUC 5IROA 4WF7A 4LLWA 5CLQA 4BVFA 1NLBH 1U9IC 4EXKA 2VIRB 3L4SO 3T1FB 1E2NA 2AOTA 4LGYA 1C0EA 4APXB 2PLWA 4NM8L 4X7BA 4FTVD 2OQRA 4QXAA 1N5MA 3BKWA 1GUYA 2AHOA 2Z35A 5JXAL 1AVTA 1XFDA 3UJCA 2VPYA 1HESA 3GWZA 2WYVA 3HG5A 3ZTDC 5AHWA 3GQBA 3BH9B 1P7QB 1JZIA 2CALA 3UTSE 3V5HB 4FULA 3EGVA 3KJEA 1VLVA 3C7AA 4DW2L 3QP3A 1CCWA 3ETNA 1MOPA 3AS0A 1H3VA 4L3CB 5D5ME 5GGQH 2YA0A 1JALA 3F2VA 4GGMX 2BKXA 3FT9A 4CU5A 2D54A 5DK0B 2R23A 1U8LA 5FWNA 1EVZA 4HYTB 4HPOH 4KL8S 4L5IA 2OZKA 5JH7F 5BRJA 2CHFA 3VBEA 3VOBA 2QWXA 1VGEH 5AL0A 2HTEA 2IBZX 2KW5A 2Z8VC 3BSGA 2HB0A 1GMIA 4KZPA 1XR8A 2C84A 4WKNA 2EIMB 2IPLA 2PPVA 2R0ZH 1T9AA 5TH2A 5EY5B 1UFKA 2EDWA 4Q9QL 4WDQA 1MB2A 3E2HB 4WQOA 3DWTA 3NEXA 1YRBA 3AADB 3B3IB 2C1XA 5FUXA 1OPOA 1P9MA 1YCSA 3DVLA 1SXBA 3TNMA 1GR0A 1Q8MA 1IGML 5HBBA 2P1YA 4AIRA 6LDHA 4GE0A 5DMGC 3WKCA 5FV4A 4DP1X 5A6LA 3M8OH 3I01M 5L7YA 4KI0A 4US0R 2QY9A 2OM6A 1YHYA 1GGKA 2FCRA 4WY5A 3ARGA 1U04A 3IDNA 5BMFL 2GN1A 2Q4DA 5E8OA 4WWNA 5HKKA 5D93B 1YKGA 1J1UA 4IBWA 1KC3A 1BH2A 1G5PA 4X3OA 2H48A 1QKJA 4GFTB 4YO0A 4TYUA 4RM2A 3T3DA 4JLMA 4Q6IC 4CKZA 1OTSD 4FZ3A 4LRIC 3C09C 1QC5B 2ZUCA 3DE1X 4LBEA 4IK7A 5KTNA 3GEPA 5BOVA 2BP8B 4ODUA 3FB4A 4PQRA 4HWZB 4F7TB 1NIFA 2UVPB 2OSXA 4OXYA 1U2RA 1WCV1 3RS9A 5CXUA 3BUSA 4TT3D 3M6DA 2X6MA 2IAND 1GIAA 1V11B 4BFCA 1K4YA 3UA4A 1Y18B 2P48B 2QXTA 1FP4B 1CUDA 2ODIA 2YY5A 3JATA 2REQA 2APBA 1AHWA 1KJ8A 2H6PA 4U3SA 4XCYA 2IEPA 3UZVB 4HALA 3WY2A 3SHWA 4C7VA 4O5LH 4F12A 2HX8A 4XN5A 1WNFA 2FP4B 2XQVA 1J20A 5DMXA 4NBXB 4MPRA 3DKIA 4FFVC 4LGCA 3NJGA 3PGFL 4BWFB 1LLAA 4Y2LA 2RDMA 1UL1X 2BEUA 3PFWO 3QPAA 3M4ZA 5F4ZA 3HC4H 1Q0EA 5JRJA 2ONYA 1L8LA 3JYCA 3A6FA 3Q2WA 3KZVA 3KJ4B 1FNCA 5T3YA 1VJDA 3ZV5A 4R6XA 1BDBA 4GYBA 1HE2A 1GUZA 5JALA 2W0FB 4JL6A 3QUYB 1KDOA 3O8DA 5DD5H 4GGPA 2ZSVB 1BZOA 2WF6A 1JVNA 4MV7A 2HRHA 1DQDL 3U4BH 5C0IB 3CBKB 3SKMA 2IEZA 1CICC 1ZNZA 3NYWA 3RZWA 4RVUA 1XDUA 4ZVLA 2WLKA 2XXAA 2QG4A 4FABL 2QYTA 1HM5A 3B9AA 8ABPA 4LE0A 1GPWB 2C9UA 4JANA 4YHYB 5EPUA 1VADB 2DTXA 3I64A 1GGNA 4EX7A 1YCGA 5EOTB 3SN6N 3PFBA 4B7CA 1A9EB 3V4ZA 4EYGA 3UJNA 4GSYA 5IRCD 4BP3A 1DEKA 4J43A 1KYFA 3USES 4AC2A 1KHTA 4UMFA 4XPAH 3EA5A 2H65A 5HR5A 1OJ7A 1OKKD 2ZAIA 4GUDA 3FSEA 2AI0L 4B7IA 4E22A 3A6JA 3FZYA 2C3VA 2WMYA 2ZPAA 4N3AA 5TDHA 1B0GA 3W5DA 1NOJA 3BZ5A 3HE7D 1QLRA 1H3PL 4ZOEA 1ZDQA 1H4QA 4D42A 4PLNC 4LSVL 1K5NA 4Y16B 4MCYB 2AE2A 4KRXA 2PN1A 4UDUA 4X7TB 3DYIA 2Z95A 5HK9A 4EITA 2PCXA 4DG5A 1CZ8H 2YA1A 3CHQA 4C47A 3CHRA 3R3SA 4CLXA 5C3LD 4X5WB 3VYTB 4MUMA 2V1UA 3ZLBA 1OBHA 2X9XA 3FHTA 3SIRA 4BQ8A 3KXFD 3DAFA 5J40A 4WHDA 2C8VA 4LF6B 3QRGL 1QQBA 2FYYA 1EFRA 1J0HA 1FTWA 3FQRB 1FIGL 2J8HA 4QL3A 1HETA 2FX7L 1HHJB 4IV0A 1DVFD 1JK8B 1I1YB 1IDOA 4L75A 1IBBA 3AU8A 5K4AA 4ER0A 3N53A 2FWRA 3PQ2A 4S1VA 3WIVA 5IK3B 2BKEA 3R0JA 4E5DA 1MO5A 1NCOA 2ODWA 1M57B 4EA8A 3IU4L 3CBGA 1RM0A 1X2BA 2DQIH 1F6AA 1D3CA 2KMWA 1E3SA 1FFNA 2JFPA 3C3AA 1QU2A 2FO1A 3M3PA 4BFEA 2D1YA 3OQNA 1T5SA 2CHQA 1R8SA 3O4LE 5LBUA 4KYVA 2P9TA 1HKUA 3HPRA 1HZLA 5I1LA 2XDAA 2P5WE 2QUAA 1JG6A 2RHDA 1T20A 3L8MA 4ENEC 4UDYX 4WADA 4EF6A 3FN3A 4P46D 4PIMA 3VXMA 4DGSA 4JBIA 2NNCA 3THYA 4OFYA 1VE3A 2WSYB 3ANLA 2VF8A 4MNGA 4JGIA 1TJGL 3FI0A 2YFOA 3QUGA 1JHKL 1FE8L 4M0FA 3DLBA 3QUKA 1WT5C 2BI8A 3ESQA 1DINA 3I6MA 1FL3A 1VMAA 1N6HA 4LFHD 2FXVA 2H52A 5C1DA 1N9GA 2HBQA 4NC1E 1V16B 1C2YA 2ZB7A 3MUGB 1G42A 2FWOB 3I2FA 3SY0B 4YJ2A 1UXJA 3HS9A 1EVIA 5AYQA 3AH8A 2ZRLA 3HPLB 1U5AA 2WDPA 4PAWA 2Z3ZA 3NORA 4UU0A 3IE9A 1ZAKA 1QHYA 3JQRA 4YI5A 1E2BA 1YR3A 3Q3GE 4ECEA 4B45A 4DKEH 4CVUA 5JAQA 1W73A 3U9LA 5KG9A 3KEOA 4XPIB 3FTGA 1Q16A 1BFOB 3PC8C 5FADA 1FFAA 4KBGA 2WAHA 1OZFA 4CODB 3RWEA 4X5PA 3HUTA 3WE6A 3I42A 1IOLA 4ZDIA 4Q89A 4L6CA 1WTGT 3G0IA 2E9BA 4FKMA 4PQXA 2WWWA 1BRTA 1WW2A 2VQ3A 1HNWB 2H54A 2IHZA 3RIAK 5I0ZA 4JDVA 1L5VA 1V54B 2XDYA 1BCRA 3PQYB 1GVIA 3L08A 3GJSA 1Y1SA 4BBZA 1SIUA 4GPBA 3D9AH 2AEJA 5CFZA 1NPUA 4E2FA 3T4EA 2PZAA 3NWEA 4O4JA 2M98A 1MCSA 2RGEA 2XN9B 3FUXA 3QWNA 3VNAA 2HWYA 4F3FB 5ETJA 3GAMA 5A2IH 4Z51A 3O1JC 2GHQA 2GY7B 3FCOA 4YDZA 4U9IS 1AYRA 1WAAF 1FLRH 5A2JH 2C2YA 4DRXA 2WHPB 2QX4A 3B3GA 3FAXA 1NWHA 1G4HA 3DMTA 3QSYA 3UPRB 1FE8A 2PR4L 1D1SA 1XFPA 1OPGL 5CN1A 3PJEA 2BEVB 4BV2A 3CRRA 4RGVA 5HTKA 1Z5ZA 2LCFA 1GD1O 4YNBA 8OHMA 2OCXA 3D7NA 5JYEA 4MCJA 3VGGA 1W6UA 4E5PA 2F8OA 3PFQA 2RQ8A 3HMQA 3KKPA 2IU0A 2IHJA 4AAYA 1JZFA 1ULVA 3KNBB 2EDBA 5DYTA 2XMDA 4LP8A 1RZRA 2CHZA 1J8YF 2I66A 3CH4B 3L18A 5JHDE 2JIOA 3DPSA 5J2TF 4G3XA 2PN5A 1CVSC 3VCLB 3IR7A 3I6GA 3E3LA 4WINA 2CC2A 4QO1A 4K0RA 2QDVA 1M7BA 1MX1A 3URKA 5EJIA 1FP7A 5E6UA 2XTJB 2Y3IA 4ER7A 1CVLA 1Y5NA 4JMNA 4KTVE 1OFGA 5IW6A 4CF3A 1D7BA 5DJCA 4N9WA 3WGIA 3I85A 2UYYA 4I50B 3HCAA 4JY7A 3O6FC 4LC1A 2IPUK 1XVLA 3IS0X 4YRSA 3BRWD 2X15A 2IQ9H 1LVGA 3ZDXB 4NN6B 4N65A 4FBMA 4PIPA 2W5PA 1B4DA 3VD2A 2WUCL 1IBCA 3VD5A 1NMCC 4YRNA 3DIFB 5BZWA 4MLPA 2GMWA 3EPKA 4TVPL 3QJZA 2GZSA 4PJ7F 5HGJA 1H3EA 1O1YA 3FYEB 1I4DD 4YGXB 2MHCA 1X0VA 5F3HA 2J9ZB 1BXAA 3UMCA 1T1IA 3QEHB 3KOMA 3B9PA 2P3OA 1LA2A 3BN9C 1MC4A 1J5OL 1NBME 3MILA 1A1OB 3ES6A 4NUJB 1KJJA 3RIEA 1CR9H 2BGNA 1Q0RA 5HZGA 1SXHA 2ICWA 5LQKA 4EUPG 4QG3A 5EIXA 1RHFA 1AYOA 5KBMA 1PD6A 3DD1A 4ZCIA 2H0FA 3IT3A 3W9SA 5D2LF 5GS0D 1WGVA 3TX6A 4K3JB 1QWNA 1CF1A 2C97A 3WFCL 1OVZA 1D7AA 5B39B 2WXHA 1NWPA 1V6SA 3LPNA 1PGRB 2JB6A 2W9XA 5ADPL 4LDEB 5EU6E 4U2FA 4B71A 5IWCA 4BUZA 2QPLA 4PLPA 3SVLA 1NGYA 5HM8A 5ESAB 1EHIA 1JYVA 2JJUA 1NWCA 4NP6A 3UACA 1RIHL 4EUPH 3FFAA 3ZQKA 3QLTA 2PX5A 1FFHA 1X5GA 4GP6A 1NYTA 1CLOL 3DD5A 4AG4L 2A5FA 4D99A 1UZMA 1XD9A 3KEGA 3HCRA 4ODVH 1A6UH 1AUPA 3GJFK 5TE6H 4JFRA 5EI5A 2ZJBA 2WIJA 5JZ7D 2QVBA 5F3FA 2BUCA 2VR1A 1G9MC 5FHAL 5G2OA 2XWPA 4EDHA 5DZPA 5IEHB 2X5PA 2K2QB 3DG9A 2VR9A 5I26A 1XLVA 5EH1A 3PAYA 1PF3A 1OT4A 5EESA 4WZBA 5IROD 1ESDA 4ISVA 3N28A 5HPYB 3RIHA 3VVLA 4BFIB 4PR5B 5F7ZA 1ZKMA 3ESXA 4Q9IA 4HAYA 4Z18A 4ZOLF 4WKZA 1ZHLB 3EFFB 1B6GA 3FRUA 4YI3A 1E67A 2X4UA 1G18A 5F1NB 3MGGA 4RZCA 4PYIA 1OAKH 1ZKAA 3FUEA 3Q6IA 5EWMA 4UNUA 2HFFB 2Q6VA 4V3BA 3K6RA 3MO1B 2ZWLT 3VFTB 1ONOA 3C6XA 2I65A 1D2NA 4G9DB 5AAPA 2VDQB 1PSDA 2CL6X 2EDJA 3B5IA 4MZRA 1E9CA 2IEIA 3FWZA 1YLBB 2QMHA 4R4BB 3X1KA 3G5XB 3WJMB 3VYPA 2R56L 2O3UA 2FYVA 1GFIA 4G7VL 2K4WA 3DHNA 4L3FA 4U6YA 3L2NA 3L9XA 5IYZB 1JRHL 1TZJA 2BLFA 1PN3A 1I7TB 2LDBA 4ZYKB 1YVLA 2HV8A 3F6YA 4WLOA 3ZRSA 5L4SA 4URWR 5LGKA 2J7LA 1ID5I 3TGLA 1TZCA 4HUWB 2FG7C 4YAKA 3JV5A 2V97A 4UT6L 1G41A 5LZ9A 1MHEB 1QH8A 1FTSA 2DQEL 3KWWA 2VTBB 2HJRA 3H2YA 1XR3A 3G5VB 1UDXA 2ERYA 2MYNA 4UQOA 3JWDL 1JOIA 3A6HA 3OC6A 4OP1A 1JSLA 1KTCA 3MPUA 4NZPA 2DI9A 1IHPA 5CLXA 1IAOB 5CSZA 4BN0A 3M6WA 1JI0A 3QUXB 4LY3A 4WFJA 5L53A 4TMKA 1P4UA 2FK9A 1BZ8A 2XLBA 1KIAA 5DNWA 5LKAA 3IJPA 1SUDA 1TTGA 1W36C 3CLSD 5F0LB 5BR4A 3OZDA 1Z4IA 2PKDA 4LI3X 2ILLA 1HL7A 4B3IA 2V37A 3V55A 5DEOA 5AXCA 1W0YT 3U56A 1M6NA 3EODA 1HEZA 4KIGA 1F00I 4DKTA 1NGXA 2G60L 4HKXB 1WKVA 4MCAA 4ZAGA 3ARGD 3BFOA 1MHPA 4BWGA 1FCJA 2P49B 1E65A 4N5LA 2YY6A 5HKKD 4IJMA 2XC8A 2OUIA 2WM2A 4LJ7A 3VD1A 4ICIA 1L4HA 2IOOA 3ACCA 5EF1A 1ITZA 4R69A 5E7BA 4WNIA 4CMIB 4FDWA 4M6NL 4GGOA 3W4KA 2UXGA 3VXRB 4MA8H 1LS1A 1KYDA 3UYLA 2ALJA 1ACZA 4OMDA 3W2GA 1KNOA 2XDQA 3E23A 5FO7B 3PWPB 1ZA3A 5DXWA 3S5LG 4OFZA 5H1YA 2OA9A 3VAZA 2TECE 4FP8H 5K6RA 1SDDA 3MBXH 1P6WA 3L48A 4YJGA 1MFZA 3DAYA 5E94B 5CLWA 3OZIA 4D0BA 2CKMA 4JP1A 2JAXA 4H5SB 4KLZA 5C0DA 3ZDBA 3I6LE 1VF5C 3BE4A 3Q5EA 2XMQA 3AR2A 2EDLA 4EY5A 4LL4A 3OWRA 4I0PC 4MI6A 4HZGA 3P7MA 5CD1A 1H22A 4UT6A 3HVRA 3REFA 1HT1E 4F6RB 4LMAA 3GSOB 4RKFA 1I1QB 2F4VB 2NW3B 1CQZA 2RAFA 4G4IA 1VCIA 4N24A 3NBAA 5BN4A 2LRHA 1E1RA 4FXKB 2LQRA 4NP4H 1CF4A 4U7KA 1M6UA 3HCEA 1KVSA 4OM1L 3TLRA 1KGCE 4LPWA 1W8EA 5C0BA 4KAXA 5E6ZA 4AMKH 5IVZA 4FYRA 2C3MA 3TCNA 2HK9A 2ANBA 3K6FA 1H2RS 3QVOA 2YGNA 1C9YA 4FFOA 2UWEF 5B1YA 1WAAE 1KEKA 1Z3IX 1TLLA 1IHYA 5KOHA 1MA0A 2JIXA 2NG1A 2VPQA 4GO1A 5M7EA 5JW4R 3RWIB 2NZ8A 5FUOH 3FF7A 1PT5A 3PHSA 4HJTA 5C7ZA 4WUKH 1MFUA 4Q39A 4Y9BA 4OTZA 3IFPB 3ZE2F 1DZ3A 3H3BC 3NYKA 1W87A 4OZIF 3M4NA 3MLSL 2JA2A 2J5LC 2YK1H 4JP8A 1ZCJA 4PWYA 3STXA 3AJ8A 3IDIA 1NF2A 5BOSB 4QXTB 4KX8A 3AUUA 1HR0B 5KVFH 2I78A 2V3WA 1ONQA 4B4DA 4GKBA 5LXTA 4R2JA 4Y5YB 3P9IA 4XEHA 1AMNA 5H0IA 4HNVA 4L4VA 1DDOA 4UM9A 3G89A 1JUDA 5LC1A 5MEPB 5E7QA 1OSZB 4L0MA 2AR0A 1J8RA 3CVHH 1I1AC 1ORSA 4BJLA 1RKQA 4YIQA 3H9GA 5EWJA 4OD2B 2IV3A 5E7IA 1ZVSB 1YJCA 4M4RB 1HLDA 3LVTA 4KSYA 1JD9A 3FONB 4GI1A 1X1SA 4KTGA 3DSNB 1QDUA 3OLWA 4AL8H 4GQPH 1J05A 4O02B 4U0KA 2PQ2A 4WFGD 2Z83A 3I92A 4EN3A 3BXXA 1E8ZA 4P2YA 3UTZA 3JQAD 5DISB 3T38A 1A7QL 2HT6A 1EFRD 3ORQA 1L2TA 4ETYA 2EDCA 5BYBA 3U0WL 3Q9UA 4C06A 1QP4A 4HQFA 3MA9H 3IDSA 2NY2C 1TE2A 5CB4B 1FO0L 4QUJA 4Q1DA 1Y07A 4HQRA 3MXVL 5DS8B 1NYQA 5EBLB 2Z93B 4FCAA 3WYNA 1UBLS 4B6GA 1DMRA 4F5WA 3JWOC 5JCXA 2ADIA 5D2LE 3J2PA 1SPBS 4D5EA 3PB3A 2BIHA 2GNOA 4QJ3B 3T5MA 3U2SB 1D1TA 1MENA 3TSOA 4QGHA 2DD8L 2O1WA 2W98A 3ZJ5A 4C58B 3CF4G 2VHYA 4QKTA 2VH1A 4ELMB 5C1BA 2QADC 1I7NA 4IV5A 4X62B 2B7LA 3NHMA 2Q0XA 2ZSKA 3S0PA 3F7VB 4OFYD 4FI3F 4MVWA 4MQMA 1QPZA 3LPOA 4LNRA 1ONBA 3LCUA 4PICA 2XUQA 3B2EA 3WSTA 3TB4A 1M8FA 3BDYL 3IEPA 3C3MA 4QGYA 3NZHL 4XI9A 3VWKA 3E1F1 5CGQB 2J56A 1LFAA 4LDOB 4E11A 2CJUL 1C29B 1KTDA 2QELA 4EMZA 4JO1H 4NI3A 1PKQA 2OLDA 1PY4A 4ZO6A 3ZT6A 4AJWA 3L81A 2ZJ8A 2ZONA 4M61B 5K9KA 1HE3A 1HT0A 1LQSR 4WOCA 3TOSA 4D9GA 1GEGA 3WYDA 2F2TA 1GLGA 1BN7A 5KDDA 3LXMA 5DM0A 4S1RH 3VH4A 3QFCA 1JXJA 1UH2A 5KQMA 3ELDA 2IW3A 3PGKA 4ANVA 2EYUA 2DQ6A 3DX4A 1Q4NX 1RIIA 2WIBA 1KKUA 3WMWA 4WCYH 5KTEL 1J1XL 2B98A 1NSNL 5EFIA 2CZCA 4IGKA 4YHLL 3RRBA 1X6VA 1JEOA 1JGDA 1PE0A 3ANYB 1A2OA 3FQUB 3N59A 2ZU0C 4IINA 4QTHA 1AD0A 2J7KA 5C2JB 1O7JA 1TG8A 1MELA 3MRSA 3NKLA 1SJ9A 1MABA 3TKAA 2LVEA 4IF4A 2HXAA 3SQRA 1E3TA 2R84A 4GB9A 3X1WA 3NUKA 5E24E 2RCSH 1FO0A 1LJUA 3U4QA 1JECA 2RE8A 3HTXA 1PZMA 2HMYB 4QTXA 2AF3C 1Z0DA 5TTRA 4IDFA 3FSOA 1TMGE 3FOWA 1PQZA 5LIRA 3N75A 1X39A 3AFIA 4L7QA 3EZFA 3ZKXB 2QVXX 1MQKH 4R1PA 1WUKS 3W1WA 1I2AA 1IM3D 4NQEA 5JV5A 2GK0A 4EB0A 3QKTA 4J3FA 4Q52A 2GA9A 1FSKC 5K3DA 4O08A 3D31A 4AENB 1NBAA 3W2IA 1VCOA 4P04A 3KHQA 4NZUH 4WU7A 5IV2A 4DK3A 5T1DH 1ORVA 2OYMA 3T5WA 1EXDA 3GGWB 3EYQD 2BNQB 4O3MA 5IR1A 3WXBA 4XM1A 4X6EA 4C4KO 3D30A 3B1UA 3REVB 2G2RB 3WI9A 4KPHL 3VX1A 3KJ6L 1MV8A 2JKVA 3IIKA 2C9ZA 3C1TA 1HEIA 2APXA 2G76A 4Y9FA 2V5VA 2HG0A 3EAFA 4NQRA 1ZEAL 4I4WA 1CSEE 3Q1LA 4AGOA 3CFDB 4LF8B 1XGYH 3TVMC 2Y7NA 5GTDA 2Z91B 1OIXA 3BH8B 3C2SA 1EUZA 3L1JA 4FGSA 4M48H 1SB9A 3A6CH 1INEL 4PREB 3SDCB 2LUOA 3ZX1A 1AJEA 2Y77A 3LU1A 3MV7A 3K0AA 2CW5A 2ZFUA 1RZRD 2MHAB 2XODA 4H16A 4I3RL 4G4GA 1PWZA 3C5SA 2G25A 4IKIA 5IVDA 3GT7A 2XCSB 2YQZA 1AQMA 2CRIA 4CMAA 2BX5A 3D2BA 5KYNA 4OP3A 2EIZB 4MMXB 5PGMA 4HH4A 5IBRA 4ZREA 1PAUA 3TBYB 2QKIB 2HT3C 1JAHA 3ZWPA 2ODAA 5HA5A 3PQ7A 5GSVB 4Z0XA 1LWJA 3SCMB 1FL6A 2DQ4A 2QRUA 4QQNA 2F64A 2WSMA 4KVCL 3T7IA 2D1QA 4KJWC 1LDBA 4PHCA 4XTRA 4OLYL 4BGIA 3K6DA 3VQTA 3M45A 4Y4FD 9MHTA 3MROA 4M8RA 1CYGA 3OAWA 3GGDA 1BQ3A 1OU4A 3OKYB 3GI8H 2AQTA 4GOOD 1A3RH 1IGYA 4JN6B 2DZDA 1XQXA 4PYGA 5DHMC 1PDVA 2R7MA 1TF5A 1Z2DA 3H5OA 1J7JA 4LFCB 3KAPA 1EA7A 5DHUA 1DFXA 1H19A 1ECZA 2CNWD 4OAOA 5BNTA 2ICEA 3T5GA 4Q82A 1AGEB 3HZYB 1DAMA 2NU8A 1UFGA 4CDGA 2VXCA 3G2JA 5AUMA 2D5BA 4UCQA 5JMOC 4YRGA 3H9EO 2AG0A 3RJMA 4C04A 4H4CA 1EI9A 4PC3A 4TUJB 2RFXB 5E70A 4M1DL 3FCAA 4G4SP 3SKVA 3L0SA 4KO7A 5LWQA 2ID9A 4GW5A 2UWEE 1QK5A 4IMKC 4QRPB 2Z2XA 4FU0A 2DJ4A 2AZTA 2F48A 1JDDA 4JFAA 2V4MA 5FNVA 3IFLH 2Z6AA 1AE6H 3N40P 5I01A 4JX0A 1A3LL 2GBLA 1DKQA 4F37F 5HYQA 4TV9A 3ZE2E 4BBPA 2HW8A 4MUXA 4OBWA 4B3XA 2HH0H 3VFSA 1OB1B 4OZIE 4TWBA 7ABPA 4PGBA 4NQVA 2P2CA 3NTCH 4AJ4A 3MRGA 4H1LG 1WA1X 5IVIA 4EUKA 6PFKA 1GA2A 3HS0B 1LNZA 1HRDA 2WF9A 3VR1A 4LXGA 4NCAA 4RESA 4MWZA 3BIKB 1CXZA 2QPDB 1UKAA 5E9AA 1SFRA 4LIQE 1M2VA 4KN6A 1MH1A 3ZDZB 1PK7A 1G7HA 1JNNH 4D6XA 1GPOL 3ZGNA 3A26A 1UM6L 1QFMA 4S24A 4PZPA 1VL1A 3IMWA 3O4FA 4MKHA 1EKXA 3FSGA 3NVDA 4JZJC 1GZ3A 2QAGB 4H1LH 1MCKA 3NAMA 4BA0A 1KN2L 2DEXX 3ASWA 3GBNH 1F4YL 2XKSA 3ISVA 2JF0A 2NO6A 2XICA 2KSQA 3AF5A 4EI5D 1E0AA 5KSYA 2GEDA 1QPBA 1DRUA 5AVYB 4RZQA 1P81A 1W88B 3ARBB 4XSHA 521PA 1Y1TA 5I9QB 2VAPA 4BVGA 1KB9K 4XJTA 4B74A 2II6A 1NVMB 2A9CA 2NY3D 2X4GA 1UP4A 1EB9A 4BFSA 5HOEA 3MV9B 2W4QA 3T5BA 3OKLB 1ZH4A 3HYTA 2YHIA 4DC1A 5JS6A 4KIFA 2REXB 5AKGA 5H3LA 2UV8A 4XCEB 1I80A 1ZN8A 4IIUA 1DAHA 4XMWA 5F9HA 5TDOB 1CUSA 4PJEA 1FPTH 1XF5A 5DO2C 4KFCA 2OCDA 2D7DA 3AAZB 2RHCA 4A55A 3UO1L 1NCBL 1DGQA 3VH8B 5J2UF 4B33A 4OZHA 4V33A 5MI0B 3BAIA 2W2KA 5FI1B 1P4BL 1AHNA 3OR7A 3VI4F 1X3LA 4BRUA 5F2EA 4N1AA 3A4VA 4KYTA 4HT1L 3R1IA 1IUZA 5J1TB 2FSSA 3NK4A 4WGWB 3DE4X 2Y0SA 1OI4A 4HFMA 3HR8A 2FZLA 1LD9B 3HFJA 3PDCA 1J99A 4LBZA 2CWDA 2O06A 3G8AA 2HFGL 5JA9A 1JU9A 1AZNA 3ELWA 5I1AA 3IVAA 2G3YA 5DYOB 5EIBD 1AH2A 2DQHL 3CZKA 1YEKH 3AHHA 5J0BA 5EVCA 3F90A 4A73A 3HE7C 3KWJA 4YDNA 4KUCD 3FT0A 1QSFE 4XN1A 3SSAA 1Z36A 3M3DA 4O2BB 3EVCA 2I2BA 5F77A 5F97E 4FYJA 1E2DA 3SFZA 5H9VA 3LLUA 4YHHB 4UIKH 3KOUA 4UINH 4LCWD 2EJCA 4EFNA 1JA9A 3OKOA 1YE5A 1VFMA 1ACYH 2FZ4A 1YRWA 4WENB 4DC9A 5JW5A 5ELLA 3BJEA 5ICUA 1BZ9A 3D6HA 1LCIA 1X14A 1JYFA 3IQXA 5G0TA 3CXFA 4RD2A 4P7KA 2Q2WA 3IBTA 4BA8A 3I6ZA 2BRRH 4HNSA 4O4IA 3L06A 4PGCB 4LGPB 4G3YH 4DMLA 1A7BA 4IRZL 2X3YA 4H27A 4A1FA 3FSJX 5MEQB 1XVIA 3RVRA 1TJHH 2CJ3A 3F4KA 1AS7A 3K05A 3F3MA 1KJWA 1GNTA 4HPJB 5T3XH 1E3MA 5E8DH 1EXUA 4JZKA 2FWLB 4FINA 4Q6BA 3K9WA 1CWVA 2VM4A 3FDZB 3UK0A 1KKMA 1VLLA 2IZ5A 4JHBA 1T0NA 5JQ6L 3O26A 4NCIA 3ZHRA 1I7UA 4P46C 4H0FA 5DDHA 3AR8A 2YO3A 1AZRA 3UEOA 2Q76A 5J4HA 4EGFA 4A2PA 1MEJA 1OBCA 1GL9B 1EUDA 4I1RA 2DKFA 3GL9A 4BO4A 4QXGL 2HOQA 2QQLL 1DBRA 2WLMA 4POZD 1VDGA 4ZMOA 4URKA 4ETQA 1SFDA 2A59A 7FABH 3WISA 1EVYA 2WTRB 2CHVA 3MRCA 5C0BD 3F3SA 5A9TA 4F7EB 2AV7B 4BV8A 5HGHB 4H2DA 2V9ZA 1WBXA 4OEHA 3DHVA 2B7DT 2J21A 4KRGA 3EJYD 4AM0A 1BW9B 5E2BA 5F64A 1FORH 4J3VA 3W2DL 1FGVL 4HDCA 4CEJA 3SBOA 1BGVA 5K8UA 3VNQA 1FYTE 1HTWA 4NO0A 1LV8A 3MS2A 1G8KA 1SUFA 5FWXB 4MA0A 1MFCL 1NG9A 2AJVH 1BC5A 1FZQA 2J71A 3FSWA 4HIXL 2YJGA 4NYJQ 4HSEA 4JA2A 1OTXA 1AKYA 2E6UX 1SJHA 3OSZA 5D1QD 2FPLA 4PRPE 4AK9A 5LYJB 4OBEA 3VX4A 3PIQB 2FW7A 4X1OA 3OJFA 5GRVK 5BUPA 4AGQA 1RI3A 5D71L 2J41A 1NKSA 1IFXA 4IRZA 3B53X 1R9MA 4DNQA 3QEUB 3HBZA 4FIDA 1R15A 4DCTA 3V0VB 1THZA 1RMYA 3MAGA 4RA9B 2WYZA 3RF7A 4XRGA 4HUVB 1REQA 1A3ZA 3EYUL 4QASA 4EDFA 4Y8DC 2NQDA 2G5RA 3V46A 3ZW7A 2RTTA 4XBPA 4FFYL 5INDB 5MHSD 1MQ8A 2HD4A 4C3UA 2EW2A 2I55A 2NQTA 4ZHSA 2YBEA 1WFMA 3HEAA 3UX9B 5ALNA 1BX1A 1HLPA 3OJEA 4EAEA 4OOEA 5DWPA 2PYDA 3JQBA 3OZSA 5K0BA 1JIIA 3BSSA 5C09A 4ZBJA 1W4BA 1GTL1 4NZFA 4UTAL 1AM4D 3ZQ9A 4KBYA 1LMKA 2JVUA 3B7PA 3MCZA 4CUJA 3KS0H 4Y7MA 4EN3D 3RDPA 1T4KB 1XYVA 5E9QA 3CVIL 4EG8A 1VLHA 3LUPA 3VB8A 4N85A 3PNWA 2QXUA 2ZR7A 4NU0A 4MCMA 2SKDA 2JH8A 2SCUB 2YBGA 4YLGA 1OK0A 1NUPA 3S36L 3W11D 4QHUB 3ROTA 4PV1C 5KWIA 1EO8L 2ZTUA 1GL6A 2GEUA 3B9KB 2PUJA 2ERXA 1K3FA 5ELXA 1S2DA 2RMNA 1XXFC 4ONGH 3BG5A 4DUWA 4HHAB 5KVGE 4PJHF 4FD3A 1TEZA 2HREA 3VFNB 4RL6A 1M71B 3GDFA 1NKGA 1XMJA 1UBMS 4JMPA 4W9MC 2NP7A 1TJIL 2VISB 2Q9CA 2J3KA 4QIRA 1WCQA 4P4GA 4WWKC 4NPYB 4NQQA 4Q16A 4I2XE 3F47A 2BO0A 4D7PA 4E5XB 1CYXA 2YVKA 5ADWA 4AX8A 2E21A 3TIGA 3ATAA 3LZOA 5BQDA 3RILA 2ZE5A 4A04A 5THQA 3D1JA 3HH8A 4EOWL 4IV8A 4O1MA 3AX6A 3ZHCA 3R0MA 2CHNA 3IJEB 1OXSC 4GVLA 1D4ZA 3AHCA 3U7QB 3KLAB 1G21E 3ER6A 1CLZL 1RRMA 3R6LA 5ALSA 3LJ3A 3QTTA 1S2OA 3IAXA 3ICEA 2NX5E 4HIIA 1OXUA 4MB4A 2YUXA 1E77A 2BM0A 2PM8A 5BV7A 4Y7OC 3T8VA 5CTJA 2QQKH 2ZRDA 1Y6KR 1ONNA 4LCUA 2QT0A 1GPDG 4HWPA 2X9QA 3K8MA 3E9NA 2ASVA 5IZCC 4U1NB 4B9JA 2QRZA 1SUSA 3HU1A 2DI8A 4CEIB 1DQSA 1YEGH 1TSHA 1DTEA 4UTAA 5IKEA 4K2UH 3A9TA 3TO4A 4CJ0A 3QCVH 4L15A 1M72A 1JG4A 3DVFA 4RIIA 3X43A 2F8XC 5IJVB 3PNQA 1N32B 5E08L 5JSKA 2K4AA 4M8NE 2V9RA 5GGRB 4OGWA 1R1CA 4U1IA 3N0PB 3N2LA 1T5LA 1N6IA 3STTA 3DARA 9LDBA 2GVYA 3CCHA 4Z7VE 4PJ8C 3MRTA 3P2IA 2I2CA 3RFTA 4MLIA 4GY4A 4ZYLA 3UMJA 2C9XA 2JKZA 2IHTA 1PNVA 2OMZA 3LNTA 2CVPA 3IQIX 3WN5C 3ORSA 2ORYA 1AGRA 4XZ4A 5C1PA 1P6XA 1SWWA 1G7IB 4B80A 4NQED 1T0IA 1LJ8A 3LKDA 3WKNA 2X4QB 1MA3A 3KJGA 4PBRA 4GFDA 4P7JA 4DR2B 1UT8A 1QLEH 1LTHR 3BL6A 4S2UA 2YMMA 5DN6A 3VI4E 1DVQA 4I89A 2QTTA 1R6VA 1BDIA 3NNSA 5K9ZA 2KI5A 1NSTA 2BE9A 3O92A 4HLZG 1YVEI 1XGQA 4M43H 4EZLA 1E42A 3OPYB 4XODA 5EHQA 3DVAB 2O4EA 1RZKH 1EP2B 5TPWB 3EDDA 5JYBA 1KU6A 1S3KL 2F1KA 3LRKA 1K06A 2WB4A 5DEFA 4CN4A 4F9LC 1T6NA 4KO9A 3RF6A 3HRHA 3RFZB 1T0UA 3K9FC 3HZMB 3LF1A 5KOJA 1PVDA 4KKBD 1LO3L 4QOKA 1DLJA 1FPMA 2EIJB 3DBIA 2O8FA 3W37A 2ATCA 3V4RA 1PKEA 4DLVA 4KQ3L 1P7HL 3RTAA 2JD2A 4M3KB 2XQBH 4CM7A 1S7SB 1D2CA 1BVHA 2LGJA 1P84K 1QG3A 1ZOXA 1NF8A 2Q3DA 4QT5A 2QSCH 3CLTD 1CUJA 1K5GA 4JHLA 2A7QA 4PB9H 3JZFA 1F8UA 3IFOA 5EJFA 1R5IB 2ESVA 3CUTA 3BCHA 4UBIA 3WC4A 4MLZA 3QPXL 3K0CA 2AE1A 3RUGF 4HIHA 3ZU8A 1B76A 4Z77A 1RRFA 3FCCA 3LKBA 3O21A 2QLNA 1S9XA 2EKBA 1WZ2A 4U0RB 2JIBA 4XTRD 2RI0A 5CX1A 3I05A 3LQ4A 4O00A 4P4SB 2Y06L 3KPPB 2BR4A 3GD5A 3IVMA 3V9EA 5DB4A 1N8KA 4FWIB 1C2TA 1EE9A 4BMDA 1T83C 1Z6QA 1RAEA 3DCNA 2E4FA 3FXAA 3LZRA 1MIMH 2YN0A 4MVJG 3LY9A 4BH8A 5E7MA 4ZUTA 1GAQA 1IIKA 1H2EA 1VBFA 2X3FA 4ZALA 5TE4H 2AD5A 1E9QA 4DQDA 4M7RA 2WBJB 2FMUA 2GPJA 1MPTA 1VENA 5AVWA 3R7LA 5BQPA 1CN4A 3UWSA 4N0MA 5KDLA 4ZQFA 2Y0PA 3WNOA 2HJKA 4W81A 3JZDA 4KREA 3CLSC 1IRIA 1TD1A 3I2KA 3ITNA 3TWCL 3STYA 3ICWA 4BKOA 1V1RB 3CHXA 4OHCA 1ZR4A 4DWOA 1L1RA 3PDOB 4OGKA 2NSMA 4HGKC 1Z28A 3ZWWA 4PRNB 3MJ7A 4BKLA 2QW8A 4E5NA 4KH0A 4R96B 4KAAA 1S7GA 2P28B 3FH0A 3MTIA 1WTCA 3EQ8A 1KY5A 3Q3GB 1KS2A 2XV0A 4IVQA 3D6NB 2JBAB 4JFXB 1XFAA 3L1UA 1GOHA 1OTTD 2PTTA 4IOSA 1UK8A 1QHNA 2PO6A 1CYEA 2ZSEA 5BVGA 1JQLB 2ONZA 2QV0A 3LT2A 1I6LA 1IN5A 2O8DA 3US9A 5DRZB 1UPFA 4BHUA 1PBYA 2AB0A 3BUYB 3DEFA 3H6KA 4HH9B 5C80A 4KHXL 2JB5L 4RA6B 1M0WA 3SVTA 1IG0A 2BP3A 3OQMA 5L51A 4RISL 5CGYD 4FA8A 4AROA 3Q2OA 5DQJB 4HDMB 5ACLA 3X3FH 2J2ZA 1PG7H 1PY9A 4HZLB 1RURH 2J9RA 3A1TA 3K2QA 4OY3A 1ZH2A 5C8XA 1XCTA 5JFGA 4IHOA 3WENA 3WTBA 1Z22A 3H2SA 3P02A 3PGMA 1O95C 5EIOA 3I02A 5JH7B 1DZBA 2F17A 1H3FA 3AKZA 2ITEA 5G4MA 3TKYA 2K8MA 1K75A 3HE6B 5SY9A 1KPRA 3QWFA 3HA2A 1F6WA 3D5OF 1YN7B 4IBTA 1O89A 3VHXB 3ADDA 1FNEB 3FVWA 3E8UH 3S4SA 3AFMA 3M9WA 4CM9A 5BUQA 3IVRA 2WV3A 4XMPL 5CJ5A 3X13B 1RP1A 3GCXA 3WN6A 2VDKL 1XMPA 1GG5A 2YHGA 2W42A 1RZFL 3VXUE 2VHVA 4QDZA 2CL0X 1DLHA 4NZRL 3WFBH 5HY9B 1RRKA 4J03A 3KU1A 3TJEH 4YDHB 4Y9GA 3A6LA 4E0RA 2KPWA 2I60H 3F5WB 4MB2A 3GHPA 1U2GC 2KZBA 1DC8A 5LQNA 4NI5A 4URTB 4OSUL 2AQHA 2XE7A 4MJ5B 1JHOA 1YK1A 5CTAA 2P3YA 2YFYA 1SHSA 3WLBB 4TUYB 4Y7CA 1NBVH 2DB8A 3S96B 5AW5B 5FECB 4UI2A 4NZTL 5D9SB 4AYEC 3KPNA 2BWJA 3QNXB 2GFHA 5F21A 1EXGA 3M6MD 4AKEA 4PJDA 3DVQX 4N5NA 3P54A 1XO1A 3SC2A 3NA9L 4LU5L 4L6IA 1AKJB 3CSYA 2XOTA 3THRA 3PHQA 2H11A 4MNTA 1WSBA 4XQEA 1L0BA 3P19A 4WDRA 5CJXA 2FSPA 3GKZA 3WD5H 1EDEA 2VKQA 4BWYA 1F8TH 4XC1H 1KVRA 1XA3A 3PFKA 4FCTA 4AQ1C 4XCCL 3CLRD 1NZRA 3BVNA 3I3EA 4NB7A 3WHXB 4U6HA 4L4XA 1NZJA 1RZJC 1WVGA 3KGTA 4ZCSA 5EC8A 2ZKXA 3IETA 2F1RA 5D4IA 4P5TB 3UTQA 3FT2A 2F59A 3VTAA 4PW3A 4NJEB 3G6DH 4W99A 1XZMA 2QGNA 3SZ3A 5T33L 4ETMA 2BEKA 1SZPA 3UBMA 3GZJA 2EH8H 4UE2A 4F8EA 1MFNA 3IBFA 3TONA 3RAJH 2KDGA 4HVTA 1C8PA 3A06A 5CP8A 5I1IL 2F3UA 1ZAYA 1HQDA 3MAWA 5KBDA 2PP8A 2OD9A 4OQ4A 1P4IL 5ESQA 4QR7A 1C9JA 5K9JL 4JJKA 2ZSUA 4AV5A 2FPKA 1YQGA 1U8CB 1MRCL 5F6HJ 2BZSA 5C5CA 4YK7A 5KC9A 3I28A 1YJQA 2H1PH 1HZHH 3QULA 1W4AA 5FYLD 2FX2A 3UBXI 3MJHA 5DK3A 4PCVA 4QRAA 3L6EA 1HI6A 1C5CH 3VDAA 4TQGA 1UGNA 1BNCA 2C9AA 2C1OB 1GNVA 2DGDA 4YSAA 2ZYRA 1P0MA 3GSXB 4GRWB 2VF2A 3F3HA 4OXQA 3GYBA 4OGFA 3ZDQA 2O2EA 2I3AA 1Z0JA 5ITWA 4JFUA 4PW4A 1G4UR 1ZVMA 4K8RC 2K5UA 4WLEA 3FT4A 3VYVA 3QZBA 4CCYB 3U7YL 4IF6A 1V8OA 1BU8A 4RAQA 4MR9B 3A2NA 4JHVA 3MMPA 4GI9A 4GX1A 3IKKA 3GSWA 1DKOA 3D4ZA 3SZMA 5BRZE 3IB6A 3KKQA 2XN1A 1W5BA 2BHZA 3CFBA 1DJSA 3TINA 5LDUA 4B7UA 5KQGA 1PLGL 5DBGA 4L8CB 2HTFA 4DIKA 1SPDA 2ENQA 2B59A 3APFA 3OKEB 4F21A 3OV6A 1O96B 1XGUA 2VXTH 4NO0D 3H5IA 4CLHA 2HRPL 4O33A 2IOMA 4ZZFA 3O8QB 2QSJA 4TVSA 3BJZA 1EBBA 2FIKA 1ZLEA 5D72L 2OXFA 2VDML 3QSGA 4FG2A 3LEXB 2D1SA 5CBAA 2PAFA 3WZLA 4DIDA 3HNSL 1N2RB 2N9UA 4Y4KA 1KXHA 1UOKA 5DNAA 1CE1L 3VXQB 2H1OA 1CTQA 2WOJA 4JG0L 3VSQA 2PNJA 6CHYA 3KQWA 5JVDA 4L9WA 3SE3A 1SC1A 1VSVA 4YMLA 3UT0A 4L8BA 4GQBA 4I0KA 2HADA 2B20A 2R2BB 4YL9A 3DFZA 3FO0L 4WNYA 3FRIA 4ZX3A 2NGRA 3K2UL 4GP8B 1JD7A 4C6HA 5IGXH 3FFCA 3RUGE 3PL6A 3ZKSD 5D4JA 1Z4KA 3JWHA 3HWRA 2XNHA 1KXTB 1BQLH 4Y2TA 1J4AA 4E2ZA 2NY6C 4HDRA 1ZY2A 2PR7A 2AJUH 2C07A 4ZPJA 4P9HL 5C09D 4RTLA 2D06A 4G11A 4DPBX 2IEBA 3DEZA 2VITB 1TQUA 3UM9A 1C14A 2C4VA 3QPKA 4IXWA 3OIGA 5IBLD 3BAEL 2DM4A 5IMBA 5AOMA 3GMPB 1TCAA 2NO5A 1MF2H 2X4LA 1FP5A 4L9DA 2WHYA 1T36A 1NM4A 2FDBP 3Q7JA 3UZEA 1E58A 1XPUA 3IXTA 3MRQA 5T1KD 2ICES 1UJBA 3QA3A 3HUJA 3SQLA 2FPMA 3TAHA 1JH9A 2WO3B 2CSXA 2P1ZA 3UF0A 3ECWA 4J8RA 5I1GH 3I9OA 4AG5A 2ORBH 4QY8A 2ZRGA 3UCXA 2I33A 4Z0HO 7CGTA 4PX3A 1TDQA 2IH9A 4BVBA 4ESOA 3EGSB 1Z6PA 5C7OO 1NULA