4Z7OB

Integrin alphaiibbeta3 in complex with agdv peptide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
464
structure length
464
Chain Sequence
b'NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-IIb
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
total genus 115
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4z7oB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4z7oB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4z7oB03
3VI4B 4HQKA 3EGDB 4MMYB 3F78A 4CN9A 4HQNA 1DGQA 2VDPB 4C29A 3EOBI 1IJKA 5E6UA 3FCUB 2ODPA 3HXQA 3EFOB 1ATZA 1N9ZA 1PCXA 1RTKA 4HQFA 1CK4A 3AL8B 1ZOOA 3EGXA 2NVOA 4WFQA 4G1MB 3NIDB 2VDKB 5KYYA 3ZE2B 3OL2A 4NENB 3T3MB 2ADFA 4BJ3A 4F1JA 1UEXC 4IHKA 1V7PC 4O02A 3NIFB 3EG9A 2VDLB 1MF7A 1M1XB 5KYUB 3NVQA 1U8CB 3RAGA 1YVPA 3QA3E 4Z7QB 1M2VA 2WINI 4Z7OB 2NUPA 4JDUA 4DMUB 2VC2B 3AL9A 5KYXB 1JV2B 2NUTB 2VDMB 4MMZB 3ZDZB 3BN3A 4WK0B 1TYEB 4C2BA 3TW0A 1L5GB 2VDOB 3V4PB 4JX0A 1M1UA 1T6BY 3FCSB 1IJBA 5E6UB 1QCYA 2X5NA 2XWBF 4FX5A 1BHQ1 1FE8A 1RD4A 4O3UB 3EGXB 1JEQA 5KYYB 3OL2B 3PPYA 4Z7NB 4G1EA 3AFCA 4K3JB 3E2MA 4C2AA 4O02B 4UM8B 3K6SA 3EG9B 3ZE1B 5HJ2A 5LN1A 2ODQA 1N3YA 4HQOA 4FWWA 1IDOA 5KYWA 1M2VB 3TVYA 3OKYB 1ZONA 5E6SA 2P28A 1NA5A 2QTVA 3TXAA 1SHUX 3GXBA 1BHO1 4MMXA 2WW8A 4WJKB 1PD0A 1RS0A 5HGJA 1AUQA 2I6SA 3ZDYB 3HXOA 1MJNA 3PPVA 3NIGB 1U0OC 3TCXB 1JEQB 1SSLA 3VI3B 4IXDA 1FNSA 4G1EB 1DZIA 1MQ8B 3BQMB 1QC5A 5HDBB 3K6SB 1YUKA 1M2OA 1MQAA 4WK4B 3EH2A 3Q3GE 4CNBA 1SQ0A 1XDDA 5E6RA 2UZYB 3N2NA 4CN8A 3IJEA 2P26A 1MHPA 5KYWB 4A0QA 1JEYA 3PPXA 3M6FA 5E6SB 3OKWA 2NUPB 1L5GA 4UM9D 3K72A 4PN7A 3K71A 1U0NA 1SHTX 3EGDA 4MMYA 4NEHB 4MMXB 3FCSA 3ZQKA 4F1KA 3F74A 3EH1A 4M76B 5KYNA 1MQ9A 4IGIA 1PD1A 2VDQB 2B2XA 3EFOA 1SHYB 1XDGA 3ZE0B 3AL8A 1XUOA 1OLZA 1M10A 1IDN1 4G1MA 1RRKA 5BV8A 2VDRB 1AO3A 4NENA 3T3PB 5ES4B 2M32A 2I6QA 1Q0PA 3BQNB 2VDNB 4HQLA 1QC5B 1JLMA 4XW2A 1ZOPA 4WK2B 1M1XA 1T0PA 4O3TB 2IUEA 5KYUA 4GZ8A 2XGGA 1PT6A 2XWJI 1U8CA 3V4VB 1CQPA 2I91A 5E6RB 1OAKA 3ZDXB 3IJEB 3PPWA 1JEYB 2ICAA 2O7NA 3HI6A 5KYXA 1JV2A 4UM9B 1AOXA 1YVRA 4MMZA 3EOAI 3IBSA 2NUTA 3K72B 3K71B 1LFAA
chains in the Genus database with same CATH superfamily
2YSSA 3IT8D 4G0UA 4AEHL 2B15A 3SY0A 3FCTB 3L4ZA 1H8SA 4HJJH 2JHCA 3RS4A 1MFDL 2PKYX 4OGXL 4RFNB 2PP8A 2R8XA 5EC2A 3LFHA 4KXLA 3TZVB 1PSKH 5I1CL 4TQHA 1L5KA 3E8VA 4ZAZA 4EJ0A 1KDJA 3OIUA 5IJWA 4BWFB 1ZQ9A 3BCHA 2VC2L 5DQJA 2NY3D 4HCFA 1MC4A 3NEJA 5ICZA 1IHDA 3O4OC 2P2GA 4JKNA 3TOSA 3MOQA 3DOEA 3D6MA 4MW6A 5CD3A 1KJVA 1Q57A 4LHEA 4Z99A 5K0BA 4W4OA 4FFVD 1ACYH 3AF2A 1WO8A 2W0SA 3EXEA 2VJCA 3KV3O 4NMXB 3QJFB 2A58A 4XSGA 3MGBA 5C07D 1J56A 2YJGA 4Y5YC 3UH0A 2JZNA 1MUUA 4U7SA 2JCCB 1TCUA 1UJBA 3HZYB 5HWSA 4YAUA 2LU4A 2H2IA 5F1KC 1ZHBB 1KVTA 4OAOA 4XDHA 1NLFA 3HG3A 5AHOA 3VGAB 4H8QA 3CQFA 1FNGA 4I55B 4ZOLF 4BKLA 2JGAA 1E1LA 5CDYA 4NQDB 1NASA 3COPA 4MV1A 2H07A 3ZI7A 3UMFA 4US1R 1WQ1R 3KDPB 5JIKA 2W6QA 3RKPA 2VTEA 3GF4A 1PFOA 4I9WD 1NCBL 2PL3A 3QDHA 4YV1A 1BM3L 1L9PA 5AG8A 5AHKA 1H0SA 4JZJB 4HF7A 4HIQA 4Y1AA 1C8LA 5E8EB 5K9OB 1G21B 2ACEA 3C5ZA 3OHPA 2F68X 4ISVB 1KIUA 1YEWA 3NUQA 2WO4A 2EE6A 3TRFA 1MB0A 4LISA 1IM3D 5JWHA 5ISZA 3I9OA 3G6WA 2FE1A 3OTTA 5CP7A 4DQDA 7YASA 3NHSA 4KAAA 2AV1A 1C30B 4DG9A 2OO7A 5CDGA 5CIPA 3MT8A 4NK5A 1U2TA 1HQYE 2Y22A 2JJ1A 1Q94A 1FRGH 2EGUA 1CTOA 3P0YL 4G07A 1RXEA 3UIZA 5LLTA 1IH8A 3PRJA 1KBKA 2Q9OA 1W4RA 2N0SA 3ONFA 4A03A 3QEQE 4Z7JA 1TNNA 1KCRL 1NM9A 5DMHA 5IUJC 3GHBL 3Q6IA 4HFJA 3UAZA 3KW8A 3QYCA 5A6SB 2TS1A 1VGEH 4UBKA 1OPGH 5ITBL 4A2MA 3LN5A 1DBIA 4L6IA 4ZI7B 1QFHA 4XCNA 2B7CA 2DYRB 3TV3H 4LF5B 2R68A 5DJAA 4OH2A 1T2DA 3DLAA 3A3OA 4B32A 1H0RA 5J2UF 3ILDA 4WE3A 2WLSA 3GBEA 3WHLA 5IJ9B 1Y8RA 5L2KA 4H59A 1V9SA 3R1GH 4FHGA 3RVMA 1P80A 3D0VA 3HJHA 1ZM2A 2HLPA 5BV7B 1QFUH 3SE9L 4MQBA 3SDZA 4RYDA 3ZXIA 1IBBA 4G1UC 3P77B 1KG0A 4HNAA 4R1QA 2IZ1A 1G5HA 4G09A 1CW2B 1I13A 1XTRA 3Q11A 1HC7A 1MZYA 1YB1A 4IKLA 2J3DA 5BQ7B 4X6DB 3QJSB 5H16A 4UINH 1V43A 2ERYA 1EIZA 5LG1A 3MR9B 1KUMA 2C2OA 1G20E 3MOAL 1WF6A 4Z7OB 1ND6A 2H9GB 1UB5A 2ZTSA 3AHCA 5CDFA 3R7BA 4RADA 1BFOB 2Z93A 3AQYA 3U4MA 1YOVB 1UWGH 4GJTB 2VWHA 4BXOA 2C58A 2ZUUA 3RUDA 4OXRA 4BDSA 3FUJA 1SVMA 4DARA 3FB7A 2IU4A 3OR7B 3EZGA 4PGDA 1T5OA 1GYWA 1JBJA 1TJMA 3H7AA 5CO1A 1I53A 2JHPA 4TXMA 4IGBB 1YQ2A 4HJGB 4DKFH 1F6BA 4FUQA 2XBTA 2CGRH 1B3BA 4ND8B 3HLAB 4NZPA 4KZKA 1TZBA 1OSPL 5DLQC 4RNRA 3STUA 3MTRA 2KZ1B 4UU9A 1X4XA 3R9WA 2VJBA 1HNWB 2X0WA 1BBDL 1T5BA 3DVAA 1P4IL 1A2KC 4GOXA 3CDZB 4F2WA 1BN7A 5E6ID 3WSQH 1URZA 5C0CD 4WUUE 3IBGA 4F33B 4TPKA 4FQXB 2DH5A 4KR9A 4FEAA 1C0KA 3QLTA 7ADHA 5JPCA 1RCUA 4Q6IC 5MHTA 1ZU4A 4EW3A 2F8LA 3OUZA 5JHDD 4CDHA 2W83A 3MRGA 4KW7A 2Y36L 3W0WD 2DQUH 2L3BA 3IR6A 1LA2A 3A26A 5FUYA 1BF2A 2WVVB 4Y5XC 3TSCA 2OMWB 5KNCD 3FKSA 3QUHA 3T3MF 4WY2A 1RWOA 1W1IA 3THOA 3TJMA 1M2HA 3OV6A 4JB3A 4RZCB 2MSDB 4PHHA 3OF3A 4LCJA 4ZTBA 2R8OA 4XDYA 5DI3B 3G0DA 3SEPA 3FCXA 3OAAA 3MA0A 4FQHB 3X2QB 5ENVA 1FFWA 5E9DD 3ED5A 1GCOA 5GRUL 1KOLA 2OCJA 2OP4L 1NN1A 3E3NA 1MLCA 3VW3L 1F8TL 4C0WA 2JLXA 3DQZA 4YHLH 2H1VA 2XT0A 3OPMA 5IP4A 1IAKA 1M7HA 2EEAA 4NJEA 1G9NH 1OLUA 4XYBA 3OTIA 4W1SA 4Q37A 3T6VA 4K71C 2OQJB 2ODQA 4R69A 4JJGA 1DTWB 5KTYA 5AVSB 1ZFNA 3KXFD 4KQ0A 2H0AA 1I31A 5DLML 3A24A 3ZHZA 4FIZA 3T3DA 4N8UA 3CRW1 5C08E 2JLUA 5CH3A 5FWAA 2VXOA 1H5BA 1XTIA 2A9JA 4X83A 1M9WA 1VJDA 5B2ZA 1J9RA 2WSLA 4AW9A 3SI7A 4MKMA 5AYVA 1QSFB 4APQD 4GKKB 1N6RA 1GU0A 4OZGA 2HQBA 1CRWG 4GI7A 2Q5BA 2V0GA 4IHOA 3EFFB 1FNLA 3CVYA 3CW8X 1FFRA 4P38A 1J2YA 3OCYA 2HL6A 1Z7BA 3NEXA 1U02A 5EJFA 5GRVL 3ZZ1A 1Q0HA 3S3JA 2ECKA 2DBLH 4Z9FA 5DYOB 1E2VA 2VPTA 2BSED 3QUMA 3K0YA 1Q77A 2IBZY 3FOZA 1BDJA 4KKQA 4LIPD 4JE4B 1XHFA 1AZZC 5IMOB 4P2GA 3VGHA 5AICA 2FSGA 1Y9DA 4AULA 4D9RD 3KZNA 2Z4RA 3G6DH 3W7AA 1MJJA 4FI3C 4UOZA 3JAKB 1R3LB 5C8XA 2A6KB 1SKBA 2OORC 4L3WA 4IHJA 3BDVA 1P4AA 1EEUA 2ADIA 1I4EB 3EXIA 2ZSEA 4MGZR 3CX5K 4KDRA 1R0AL 2OFPA 1PQWA 3EHDA 4AIRA 4G9FB 1P0IA 1AKPA 1KORA 5IH7A 5CLFA 1WK0A 4G24A 3KSAC 1NONA 3VXTA 1YYLH 3VFMA 3FULA 1PJSA 3BMVA 4E30A 3N7UA 2Y25A 4CMHB 1NM5A 3QJQB 4MVJD 2PPCA 2X7JA 1SFRA 4RFNC 3NORA 5BQOA 1BU5A 1UZ8B 2Z98A 3TZVC 1U8OB 4DVJA 1IB6A 1DKMA 3PDWA 5BNIA 5T5QA 4GG8A 2JFQA 3SPCA 1OFUA 2HWZH 3L3DA 2C29D 1MNNA 4HGWB 3QKRB 4G1CA 5CGMA 2VK2A 2GN2A 1UINA 1FYXA 3ZE0B 4I5BA 4RDQG 1RUML 5JVDB 5BPHA 3R18A 3UJNA 5DJXB 5IBLC 6ADHA 5EIBC 3AO0B 4HKJA 1IZ7A 3RTBA 2GPNA 3T6ZA 5K33A 2X22A 3K2EA 4L0PB 2TMGA 1QB8A 1ZCFA 1JHVA 1M8PA 4GW5A 4OCWL 1IBCA 5IMKA 4BFFA 3WKEA 5DTMA 2K6WA 3T12A 4AJ4A 5C0FB 1UWFA 4XMZA 4JCOA 3OMZA 4GY4A 1IX2A 3MMSA 1U8YA 2XODA 5BSKA 3VGAC 4DJ5X 1ADWA 3UAJA 5CIWA 4JM2D 1QRRA 5IUKC 4GE3A 2IXFA 2E9JA 3FBKA 4PBWD 3H9GA 1T6WA 5CD1A 4XASA 4JXZA 5FI1B 1DL5A 4WO4A 4WA8A 4TT8A 1GZPA 3CZ4A 2P9RA 4JLSA 4MZDA 5C09B 4RSMA 3HRHA 4LSWA 3I1YA 1PT9A 3LBYA 2WJHA 4YROA 9PCYA 2FLMA 4DCTA 2NX5E 4XMLL 3UICA 4N76A 4UB0H 4PAGA 4JZJC 1DFBH 1ZU5A 4YUAA 1FO0B 1J8SA 3ZE6A 3KPRD 3MV9D 5CZKA 1TUBA 4NZMA 4MGHA 3TW4A 3ZLJA 4JFDA 1H2RS 3BKCL 2P24B 2BR3A 3G0HA 2FUEA 5BO1L 4IDPA 1ETZA 4WI0A 3P0IA 1LSUA 3FDZB 3WNDA 3KCQA 3COOA 1TO4A 3SO5A 1DQJB 4Y9GA 1SEPA 3JCZA 1KQOA 3HHEA 3UYRL 3FMIA 3HCAA 4QUEA 4JFFE 5DUJA 1TB4A 1E6MA 1LX7A 3O3MB 5K0ZA 3JQFA 4FGKA 4OK3A 1PT6A 2A5DA 3EW3B 2RQEA 5TD4A 3QJFA 2G60H 2X1QA 1SOWA 3I39X 1P6AB 2R2EB 3CVCA 4WW1B 1LH0A 1E5VA 4YSUA 3QXUA 2BCMA 1F6WA 1H94A 3E1F1 3HYCA 3JQRA 1XMWA 3C5CA 3FTNA 1BIHA 3ETNA 1MR3F 1QR1B 4OQMA 3OT4A 2P91A 1EWQA 1KCSH 3VXQB 4IK7A 5KBPA 2NZYA 1I8LA 4B50A 5DS8A 2E47A 2DX7A 4MIKA 1ZPDA 2G2RB 1HNGA 2YNMC 4YDHB 1QHHB 4EGCB 1JAYA 1UKSA 1LI5A 2V58A 1T0JB 5LJIA 5BV7C 1OAZH 2ZBVA 2CXPA 3FQUB 4NXSA 4DNQA 3BISA 4TOYL 4Q7JB 1FL3B 2OXHA 2FJGB 4P5KB 3STHA 1TA4A 4ZXBA 3SXUA 2YN2A 4YXHH 5EN2A 4IMLB 4YT2A 3KD3A 2QN6A 4G80A 5K9OA 2G40A 1LK7A 3NYIA 4G97A 4YQZA 5DT9A 1I6MA 3PFQA 3LRKA 1U8HB 2O2YA 4NESA 1SXJB 1RSZA 5CFMA 4O58H 4Y16A 4P46D 4J1QA 5BRZD 5JS2A 2XWJB 2PANA 1U8QA 2Q0ZX 4EP1A 2WIJA 4L1DA 1KOGA 1OF1A 4AKEA 4WSKA 2J71A 3ZGYA 1E2GA 4R41A 2WVJA 4PYIA 3O7WA 4NARA 1WE5A 4KO1S 1HXMB 1OU4A 4IGBC 4L8YA 2ZSVB 1YA4A 2IBBA 2HRHA 2O2HA 5K9KA 3V4FA 3IUBA 4Z95H 1SBQA 4U3XA 3E8UL 3R7DA 3JD0A 4YBQC 2XWBA 1UPAA 1H69A 5BY2A 3RRNA 1MREL 4OEHA 4JI8B 4K9PA 1TQCB 3KT8A 4FQXC 1CG9B 1JDTA 4RHYA 1T6BY 3NZEA 3ODPA 5ENDA 2PGLA 4NBSA 2PUJA 1YNLH 1KPVA 4INJA 3ZW7A 4OJMX 1RQ5A 3G0GA 2XZAL 4XFDA 4Z6KA 1NQXA 4B7CA 2OHHA 2F2HA 4GOOD 4AKHA 1ORIA 2AI1A 2KT6A 2BY1A 3NN8B 3TD9A 3VHXB 2JH9A 3MRFB 3IDOA 4CUCA 2G1UA 4E4RA 4LQ4A 3VPDA 1I4FB 1JXDA 1XEXB 3P77A 1FK8A 3SVZA 1A5TA 2V6MA 5DI8A 1WZLA 3E2HB 3DZGA 4OLXL 5EC1B 3SSAA 4BX0A 1XMXA 1SUHA 3UO1L 2QNRA 3VXPA 3K92A 3VMMA 3WLJA 4B2PA 1CIJA 3DHNA 5BSVA 1N75A 1NUUA 2Q5EA 3FT2B 3E3OA 3K81A 4LKXA 4AMBA 3S5YA 4FB4A 4J1NA 2DWDB 4LE1A 5DLEA 2VXUH 4B97A 4PGEA 4IHAA 4MRRA 4R71A 1UXWB 1LGYA 4U2EA 4HLUC 3GT6A 1MB9A 4EX7A 3K0KA 4M0EA 3QKSA 3DX2A 1NCIA 2JB6B 3O6FB 2JIBA 2X4SA 5LYYA 4YZFF 1J9TA 1WTAA 1BCSA 5LR6A 3IDQA 1YHYA 3AIKA 1KCVH 4NBVA 4KSCA 4YZWA 2TSAA 5K3BA 4A2DA 4TUKH 4DERA 1Q4NX 3KTOA 1OOEA 1YCFA 1NL0H 3QWIA 5J4HA 3CDZA 4O4YL 5BUPA 2JIPA 1LTQA 2QVZX 3EAFA 5C3MA 3KQSA 1GNQA 3V4UH 4ZFOL 3CZPA 2UX7A 3HFJA 2VAPA 5AJVB 4H1LA 4QRPE 4GOKA 4PWJA 1I3GH 4N3CA 3RIEA 4BH7A 4MB1A 2DY1A 1BPVA 1JSCA 4OVKA 3DBHA 3ESXA 5F7UA 4LSSL 4X99B 3SX2A 4F7TB 1FMLA 1UM9A 4P2CG 2OMWA 4X66B 1SQGA 2AXPA 1K66A 5SWSA 2OEPA 1JE6A 3ZT5A 3FFAA 1YS9A 1QWHA 1JHOA 1X19A 4P92A 4DP1X 4AH2B 1WBBA 1TKCA 1XGYL 2Y76A 2WXNA 3BSFA 2JK1A 3NASA 3FQRB 1Z2DA 2ZBUA 2IY7A 4BB0A 4F4HA 2JZOA 3ZE8A 1ZEJA 3RSZA 4CL3A 3ENQA 4WRLA 3UJPA 4N39A 3HKCA 2ZXQA 1QS0B 4LMPA 4YP9A 2DGDA 3TDKA 4WX2B 1HS6A 1ZXQA 2X8LA 3ZL1A 3E9EA 2YMXL 4NQCD 3HE6A 2Y1ZA 3FO1B 1IJNA 3IODA 2IYSA 3ZZLA 3L7JA 1ZAYA 3DI3B 4BQQA 1KVRA 1YUHB 4K94C 5LCVH 2LU3A 5C0EA 2REQA 1DAPA 4Q52A 3E9MA 3L4BA 4Y1GA 1R5BA 2Y1LA 4CMHC 3CWCA 3MRRB 2EYSB 2C61A 3ER8A 3K6FA 5I1GH 3D64A 4X45A 4L4VA 3HZ3A 1QSFA 3BJMA 1W30A 5J47A 2BYTA 3BWUF 3MAGA 5DTFA 4GMHA 4E08A 1G59A 3PGJA 4KVPA 4QLBA 1AY1L 1U8MA 2GBLA 1P2TA 1R27A 4UTBA 3HADA 1FE8A 4FGZA 5FPHA 1N0LA 3ZGHA 3P11H 3OTOB 1JI3A 4A2CA 2OFFA 1FORL 3B3GA 5DO9A 3QTLA 1RAEA 2QZPA 1SJVA 4A6YB 1CVLA 2F3PA 1CVRA 5FI0B 4NJAH 1UF9A 1NXWA 1LEGA 4AG4H 3GYGA 5FJJA 3IM1A 5C3LD 4E42A 5PGMA 4QOEA 4DZBB 2BFDB 1G7PB 3HB1A 1DBAL 1IIKA 1BAWA 1INEL 5EU7E 1VL2A 3GJSA 4X6BA 1L6XA 4M1YA 4BQFA 4X6CE 3EFBA 2EDNA 2DQHH 4H2CA 4GKNB 2NUPB 3MG9A 1ESZA 4IFBA 2XG4B 2QMOA 2HTLC 4QXTB 5EULV 3II2A 3GSNL 2WINB 2BMWA 5DVMA 5EOQH 1FSZA 4KOEC 2QGEA 1Y7HA 3BORA 2E4TA 1E7YA 4MB2A 1V3LA 3QKIA 4QGFA 3DL2A 2FW6A 5FPYA 4XZ4A 1ZLDA 2E49A 3L40A 1AD9A 3ERCA 2ZXCA 1N64L 4IDAA 1EHYA 3TZKA 3W8NA 1CO1A 4CC4A 2QTWB 4MLSA 2ODNA 4O02A 4O2AF 4JFYB 4PJ5D 3Q0EA 2HFKA 2MSEB 5BN5B 3HR8A 6FABH 4MHSA 2BEJA 1FNHA 3S28A 1KYIA 4KLAA 1FF5A 4R2GD 4C4AA 1GTG1 4PRHB 2WSBA 3MRBA 4CQNA 4Z4IA 4PPYA 2G0KA 2ROXA 2BMFA 1OTSC 4ECAA 4KO9A 3F5WA 1ZK1A 3QX8A 3ZHOA 5TF1L 4NWUL 1J23A 3V8RA 3UM9A 3AJAA 4FXPA 5C0CE 1MLDA 5AW3B 2A0WA 5ICMA 3QGMA 4R54A 4FXLA 3B3IB 4EI6A 4ZU6X 2Y9MB 3AEYA 4E41A 3P0HA 3L4UA 2C2XA 3W0WE 1ZJ5A 4C56A 5F9DC 1YI8A 5HDBB 1D6SA 2QXUA 3N0XA 2ZAMA 1RQLA 2Z7UA 3PP4H 4HIIB 4J4PC 3IB4A 3MLEA 3T8MA 1G19A 2J3SA 3P52A 4H31A 2DWEA 2KE5A 2NCEA 2ZIDA 3VR5D 1PEYA 2BKAA 2UUPA 2JFYA 6YASA 2L7JA 1PZHA 4KAJA 3K74B 3VU8A 4LWQA 4WK2B 2BRRL 5JNLA 5ESDA 5T1KD 5CA0A 4Z7UF 5EBMB 5EFZA 1PFYA 4DDKA 1L7DA 821PA 1H2BA 4CLOA 3W3AA 2I7XA 2INGX 5DHYB 3ENVA 4PP2A 3DJSA 2Z3VA 5CT8A 1ZHLA 4I46A 1MI5B 1SXJC 4V0OA 1D2AA 4X6FB 1Z18A 3KXFE 4JVUA 3U2QA 5C4MA 1XSIA 2I60L 4HGRA 32C2B 1PLGL 2J5XA 5LDSA 3D5EA 5CGQB 4IIGA 2KMLA 3L2NA 4GKVA 3HWX1 3A6BH 4J3TA 3IKVA 4LCYB 5CK4A 3AILA 2EFJA 2IEDA 3CEHA 1MH9A 1QBGA 5DUMH 5HY9B 4H15A 4NMLA 1TYDE 4ZOCA 1XAKA 1WTGT 3C7DB 3ARSA 1CICD 1UP4A 1J4AA 2EIZA 5BNXD 3T77A 3QLJA 3ESQA 4U3HA 3F04A 1KJ2H 1MY5A 2AQ2A 3JR3A 4H88H 1XXHB 4J4HA 4M8VA 3JVGA 3FDFA 1X77A 1I7QB 1BTOA 2EEXA 4XVUC 1H2YA 3AG1B 4FP9A 4HYTB 5BVHB 1JF5A 3QJRB 1JK8A 4R4BB 5T6MA 4IQGA 5IVKA 5M94B 1YE8A 4FNGA 4PBXA 3IPRA 5BOJA 3ZR6A 3GQFA 2Q3HA 1C7RA 4NFCA 1TQCC 3CW9A 4DSAA 4GRAA 4JFXB 2HH9A 2GPBA 2BHFA 3D6UA 1O75A 4Z0XA 3UV6A 5FLKA 2R2HB 1RC0A 5E8RA 4BLSA 1RZ8A 5JCJA 4M62H 1X7GA 1F2QA 4YFEA 2WLLB 1HZLA 3O8NA 3AU1A 5KN5A 3PGKA 1ZC4A 1CRPA 2CE6A 3JSXA 1YJ5A 4KBPA 5JRDS 4PRDA 4O4LB 3WBBA 4X7SL 1DKNA 4PV8B 1K2DB 3ER6A 1HSOA 3ILPB 1Y18B 3A2KA 1BSVA 1JYWA 4MARA 1BREA 3E2HC 3V7NA 1VKJA 1ATZA 4DAEA 1XZDA 1XWFA 3Q8WA 3KVVA 1YYCA 1UPUA 1TADA 3QUTA 4Q3EA 5E2WH 3CUWA 9ATCA 1D6EB 1MCSA 4B6GA 4OD3H 1S7QA 2IHBA 2ZVDA 2OMVA 4G37A 1MJ7H 3Q7IA 4PTZA 1E6WA 1Q9OA 4GOJA 3UKJA 3IIJA 2IOFA 3RTLA 4RAVA 1L1EA 1BJRE 1B16A 3D7KA 1KY2A 3PX3A 5DXJA 5BMOA 3WO3B 2HDNB 1G7TA 3TLEA 1A8UA 3EBIA 1V8ZA 1VHWA 1T1EA 1RJWA 4J7AA 3O6FC 4Y2QA 5JEDA 1MW9X 4LDCA 3TOXA 3O1IC 3PXLA 4M6NH 1JR6A 3OBAA 2YSTA 2CLSA 2E4XA 5TE9A 2LDBA 1B0PA 2WBJB 4XB7A 3ZXAC 1TTCA 2CNYA 2ZIXA 5CX4A 3QNZA 2YVUA 4Z23A 3IJ8A 3CGGA 2CVOA 3V5KB 5DN6D 5LQJA 2VA8A 3UJTH 1Y3DE 5F2KA 3SYNA 4N0YL 4ZK8A 4FJ1A 4MKXA 3IT0A 3WJJA 5KYNA 1PUJA 3OMAB 1JDPA 1LTKA 2HIGA 4DR2B 3KQVA 3ESDA 5NULA 4FD3A 1NCTA 4HXAH 2P5WE 1Z4KA 2YRPA 3L5XH 2GXQA 1M10A 5AAWA 5HYQA 2C3VB 1KK2A 4II2A 3NN8A 1OX4B 4TWRA 4INPA 5I7AA 1XBRA 1CPYA 2O2ZA 4N5MA 1I4FA 3WICA 5IEKB 1HHIB 5ICXB 2P5YA 1HYSD 4XMXA 2OK8A 4LJ5A 2J9ZB 5F2OA 1KTRL 4HGPA 1PQ4A 4JUDX 1ACJA 3U09A 3HKBB 4MAZA 4J6IA 1TO2E 1NC4D 4BAUA 2VPPA 3D85B 5C0DA 3WLBB 4UDUB 4WZ6A 3NV9A 1YY9C 1FFAA 2ZX6A 3MF4A 3RZCA 4Y2DD 5I5EA 1G0NA 2EQBA 2HFTA 1J1ZA 1SCUA 4CTNA 1J0KA 1ULHA 1CY1A 3VRLF 1W2HA 3EXHA 4UAOB 2DKOA 3TBFA 4ETNA 2CJFA 1U5CA 4QHMA 5D6OA 1FSKB 2QELA 3P9MA 3O41A 2QAIA 5CXXA 1Y1TA 2NTNA 1WDTA 3LIZH 1IGJB 2QI9F 3HVHA 2CMDA 2K3TA 2Z7WA 4WGGA 1P2VA 1LBHA 3MRTA 2VP6A 2QJOA 4YXFA 4IBYA 1MZVA 1J1PL 4QRRD 3CB2A 3UT5A 5A4IS 2WTUA 3GSQA 1U7TA 4X5RA 3CCCA 1LYQA 3I50L 3CO5A 3K0EA 4RFSA 1ZH8A 2YFNA 1YN7B 4NZTH 2FD6H 1U91A 5IC4A 1KC5H 1NW4A 2FZ4A 4YE4H 3A47A 3OMIB 2HKHL 3TURA 7REQA 1GRWA 4IOIB 2W0MA 3EPHA 3NV7A 3E9UA 4X8JA 5AVYB 1YQDA 1O9VA 3CXHK 5F73A 2NU7A 5AOKA 4AZ8B 1K2WA 5DNUA 2OXCA 3FWNA 3ANYB 3BH8A 3TO5A 2O3UA 5AVKA 4RAOA 5JSYA 4YBHA 4RWZA 5JRJA 2IUEA 5EE9A 4R4JA 3WFBH 3RVPA 3FONB 3S8GB 3NRCA 1VL6A 3NTCL 3TSZA 3LPAA 2VDWB 3B2EA 4P5TB 3BREA 1S7WB 4G83A 1QOPB 1JPVA 2LGNA 5E4JA 3TKLA 5D5MA 3TH3T 1UBTS 3ZO0A 4B53A 3V4VH 1ULZA 3NZHL 3OH8A 3DEFA 2HVKB 5TVGA 2Q3FA 4QEGA 3HXPA 4PJBB 4IJKA 3AI3A 1DKUA 4D3FA 1EBUA 2ALJA 2R29A 2ZB2A 5C0BB 3C45A 3MBKA 4CV0A 3BAWA 1YC5A 4HLCA 3A14A 2GK3A 2AEWA 4XO3A 5F9JB 3RUGF 5JD6A 3OOWA 3GLHB 2WU8A 5EKUA 1OXXK 1ZR2A 3V1NA 5IHHA 5LLDA 4JP8A 4CMGA 2H5EA 5EZJB 1QQDA 2DY0A 4YEFA 4BFLA 3DEKA 5HGHB 3B2UD 1EO8H 2E6UX 3WWOA 1GZUA 3MRHA 3FQYA 3TVMA 4X5WA 1Z0JA 3DONA 4A2PA 2D2OA 1U0NA 1TM1E 3SKMB 2X2YA 1DQKA 3CE9A 4R2MA 3KKKA 3AM8C 4QHTA 4HS6B 1DAFA 3ZDEA 4ZMVA 3AACA 4RWEA 1NDGB 4A8JB 1N7MH 3DIVA 4XN7A 2CLMB 1AG9A 3UCRA 5LNK6 4POUB 3TZLA 4X95A 4YQEA 4MRCA 4EKIA 4RIRB 2BGLA 3MRQA 4PZPA 1T2VA 3L2LA 4QNPE 2NXEA 1GYCA 3L8DA 1OWWA 1GIGL 1G7PA 1Q22A 1GL7A 2NXYD 4OCXH 5FYJU 1A7OL 1I2CA 3D6FA 3HAEH 4OHBA 4G81A 2GFQA 4WJZA 3L1EA 2AJXL 3OGCA 1KJIA 4EG0A 3H4IA 1EGJH 2ZWYA 4DYDA 1ULSA 1W5FA 4EFMA 4GKNA 2NUPA 2GW5A 2OPHA 4P9MH 1Z4JA 5CUSL 4XR8C 1IV8A 1NW3A 3R4RA 1AKWA 5F7NC 4CKQA 1MNAA 2GAJA 4KC0A 3MMXA 1AHMA 1NKOA 4YJHB 3T3ME 1N8ZB 5DCYA 2FSEA 1ELOA 3G2PA 1DPFA 3TTVA 2QLBA 5KKCA 3P9LA 1FVOA 4G86A 2OFOA 4JVPA 2PH7A 4BTEA 3HG1A 4RSGA 1P1JA 2OL3H 5B1IA 3QQ3B 5KS2A 4WWID 1T5DX 3NEYA 2O2JA 4EJ2A 1OGYA 2WZ5A 3UC9A 3B2VH 2EYTB 2F62A 4UDNA 4LSTL 4YFLF 1GPWB 2HJKA 4OB5H 5GS0L 5DHVA 5C2BH 3AETA 4UBJA 4JFYA 4S04A 3FF8A 1WPGA 2CNWD 2D1RA 4E9WA 3IHTA 5IASA 2ZYDA 4I3HA 3KXIA 3DHJA 2RHOA 4PRHA 4ILDA 3PCYA 3SPXA 3S81A 1A6UH 3MCKA 3GCGA 1N2IA 2Z31B 1RRCA 3J80A 2ECPA 4ZICA 4HQ0A 4RA9B 4J9VA 4B7LA 3ZI0A 4N5ED 1NVTA 1SY6H 3CV3A 1MJ8H 4LCIH 2VLLA 4L4TE 1M71B 4L9LB 1B23P 2AVNA 1MJ5A 2QM0A 2CBXA 1WCIB 1YVDA 1SDDA 2OVFA 3I84A 1D1QA 5C35A 4BJLA 5EUOB 1JZDC 3LPPA 2FW9A 4KK5D 3G08B 1YEHL 3K6DA 1KEMH 5F8RC 5IF9A 2CJ3A 3IELA 2WFAA 4PRAB 1Z74A 3IMUA 4RPCA 4AY6A 5FGCE 3V8PA 3UFBA 5DYIA 3OSZA 3FCEA 3KQPA 3KJ4B 1FFDA 1W0YT 2I3ZA 3F5QA 5I9IA 4NC1E 4YSDA 1G6RB 2PZKA 5JSZA 4J43A 3EQZA 1R0YA 3EBAA 2FATH 4MZXA 5IROD 4LOIA 1Z2KA 5C6TL 3DMHA 1HLGA 4R84A 3UCEA 1Y3AA 1HEZB 4LRIA 3ZHFA 5BWOA 4Z7NF 4KK8C 2QQNL 2D3LA 4P98A 4ACTA 4P2YA 1GGIH 1J9ZA 4UIMB 3WN5B 1MFMA 5E24E 3MOBH 2XKBA 4JI7B 2FZGA 3GNQA 5B36A 3NDBB 2FOLA 2D7TL 3QPAA 1PKXA 3T7CA 1OK0A 5SWZA 5JZ7C 4K1XA 2DQDH 3P32A 1Y6GA 4CI9A 3VO8A 1L4GA 2G04A 1T9GR 2QRNA 2J0VA 2QW0X 1BMFD 5ETUA 1A1NB 5LP6A 1LWHA 3DOJA 5ITSA 1V96A 1RHFA 2NN3C 4YX2H 1HOCA 2PT5A 2A4ZA 2XF8A 2I6QA 3I73A 1XL0A 6LDHA 3VM6A 4BMNA 4EPWA 4RESB 4QG3A 2Z4QB 3D6HA 3FQNB 4AMYA 3MACH 1JEJA 2SBTA 4DANA 1J1OH 2CKDA 2W60B 4Y8VA 4Y7DA 2G17A 2I4IA 3MLTA 1OWPA 2WBJC 4OV6B 3RVDA 4B3CA 5F2FA 2XEDA 5ALNA 3T34A 4ZW7A 4A1OA 5C3UA 1IUZA 4JFXA 3AUUA 5K4AA 3I2JA 4KTDL 2R2HA 3ZHCA 4LPCA 2VN7A 1QUFA 2ZNWA 3CUTA 1RWBA 1FFPB 2QGNA 3VU2A 1UIMA 3SDSA 4JBWA 3NCMA 2QT0A 3VACA 1Z15A 5F7OA 2BELA 2FFJA 2NT4A 5DD5H 1R9GA 5IVDA 1X3DA 3T41A 4BNIA 3PX2A 2ZCKL 5J40A 3AIOA 3QQPA 5EP4A 4F1SA 2AI0L 1N0UA 1USWA 2XZDA 1KPUA 1HOEA 2P47B 3JV7A 2FECI 1HH6B 2CM5A 3VD3A 3NDIA 4D6PA 5DJ6B 1S7RB 2ZD0A 1JALA 4P7BA 3UQYS 3FFCE 3LS4L 1H8NA 3NXKA 4ODUB 2FF5A 4PLFA 5AJZA 4UAOC 3H6KA 2C1ZA 4JY6B 1QLEL 1HG0A 4PJ5E 1FSKC 4PP1C 1GGBH 3Q15C 3UMJA 5HG0A 5A9RA 3LQFA 4MQFA 4M22A 3DVSX 4LHUD 3KBBA 2H85A 3BRGC 1DYZA 2XCIA 2PNDA 1J5XA 1NGQH 3GGSA 4KO8A 3IUSA 2ZCHL 3OOHA 3T2QA 5CT5A 1B15A 5TFSL 4AGQA 1LLAA 4ADGA 2O23A 1O9ZA 2NCMA 3PYLA 3LH2L 1UD6A 5JD3A 1TL7C 3RBAA 1QLRB 1URPA 3K5IA 3TRKA 3JD3A 3EKCA 2XVAA 3FH7A 3QEHB 3A1VA 3WCYA 3HFSA 1E3TA 3AR2A 2C3VA 2RTTA 5CFAA 4HMCA 2HPHA 1SKYE 4K9EH 4PJHE 1K5DA 1E66A 3V4LA 2JJSC 4XVTH 5CLYA 1F5SA 1GQYA 4D4HA 2ALWA 3BLBA 2CKBB 3HPQA 4PZUA 4X54A 1OP5K 3LLMA 4U2CA 4HBCH 4XE0A 4C5AA 3QR2A 4P5TC 5BW7C 1NMEA 4A0HA 1C4KA 5WRFA 3PDOB 1LXMA 1ZJ6A 4I6GA 5CVUA 2PNFA 2X0DA 3BGDA 5FAKA 4JLDA 3CZCA 3WLBA 5I2IB 4FM9A 3U48A 2IELA 5ALEA 4EATA 4LB8A 4B6PA 4LSDA 5I9BA 3O95A 4QKXB 5E4EB 1S8FA 1X6NA 4V2UA 2LV4A 2Z08A 2R8SL 2GI4A 2BGKA 2VSCA 2WKQA 1FYEA 1DRKA 5JPMB 3TB6A 3B7WA 1DXQA 2BCKB 3N40P 1JMZA 3DZIA 4PS0A 1AH1A 2EKDA 4U9HS 4HUXA 3ULVL 4NR0A 1PAMA 5IFKA 4DVRH 3T0EA 3C3BA 4MV4A 3D1MC 1CXIA 1SF5A 2YHIB 2WIFA 3QHZH 1FC2D 3RWJB 1YN7A 1BCIA 4I5DA 1MOPA 4XCXA 4FQJH 5D1HA 4NK4A 4BX2A 3IJHA 3IQXA 5GZOA 1BYUA 5IMMA 2AOXA 1JWMB 5DEFA 3REOA 1M3SA 3F6BX 2J8OA 2FEOA 2A5LA 3FTCA 4RPKA 4UT7H 5KVGL 3HBAA 5EF3A 4P4KD 4YRQA 4F5YA 1EFHA 1XF2B 5JYBA 3UAOA 3G88A 2J4WH 4A8JC 3G9ZA 2JJUA 1MEEA 2FQYA 4K1LA 3H8VA 1GGTA 2MH4A 3TIGA 1SLXA 1RYZA 2V0AA 1CFSA 1AXSB 2IKSA 1UQUA 4ELME 3ODGA 2HMTA 3SE0A 3PNQA 3K7UA 2PFSA 4F6RB 5AW1A 2B92A 2E9BA 5HHXL 1B3RA 3BIFA 1RQPA 3JVEA 1ACCA 3K8MA 1T25A 4M3HA 1D4OA 1WETA 2IRWA 4LBEA 4BL5A 2D31B 1E8MA 3HVJA 5D2NE 4RDHA 4JRYD 1FV1B 4G11A 3R8QA 2AR9A 2VPWA 1GFZA 2X12A 4LPSA 2Q46A 4S0SD 2PYDA 3UK0A 3KLAB 3EGDA 721PA 4XX5A 3RL1A 3RQIA 4PJBA 4NIYE 5MFZA 3CSBA 2HRCA 3AWDA 3VSCA 1PKQE 2AA3A 4MS8C 2R47A 3TLJA 2GZMA 4L27A 4XW2A 1EBFA 2WG0A 2XNSA 3RTAA 3EVTA 1P7YA 1EO7A 3LEXB 3A9WA 3GLHA 1B3JA 2HUPA 4WEUD 2VJKA 4RZXA 3K72B 3IK2A 4EELA 5MEND 1E4YA 3HBPA 2WIGA 3VMOA 1NGSA 4PRLA 1JXJA 4HH8A 1AGRA 3VG0H 3M45A 3C8KB 3PUWA 4DTIA 1CB0A 3RY5A 1GGUA 3B1FA 3V0WH 4WFGD 3EVGA 1V25A 5HE9A 2XUKA 4BMDA 3BCDA 3SKMA 4YL9A 3EUFA 4PR3A 3SSMA 1OYWA 2DQGL 3IPAA 4FQ2L 2WD8A 2PAFA 1M2WA 2DPMA 5CT4A 1U92A 4YXLL 2Z31C 1U9KA 4DLUA 4PBRA 2VP4A 4L0ZA 1IDOA 1MIEL 1NSNL 3FHEA 4N24A 5DD3H 4H1VA 4L9LC 1KY7A 4N6QA 5E00B 1JW9B 1NP3A 3MMEA 1DQMH 4BWGA 3O4HA 3RHTA 2BMDA 1KACB 3HZMB 2EO9A 2YMTA 2WTNA 2EDDA 1TCMA 1WWWX 5FAXA 2Z9DA 1IN6A 4YV7A 2GVNA 3MCVA 1UHVA 1DG9A 2DBRA 2OKGA 3KJ4C 1AE1A 1J2TA 1VEPA 3CMOL 3LE8A 3IDUA 4GIOA 3PUUA 3D69A 1ADGA 1JILA 2EWVA 4Y88A 2FZ3B 1NDMA 1TVMA 4KXXA 3A3NA 3B43A 2G1AA 3F5MA 5FCUL 3GEBA 3OJEA 2X8JB 2VR3A 1NFDA 1E50A 3EFDL 2ORIA 2AC0A 4OIFA 4ZFFB 1RWWA 4NT6B 3WN5C 4D7BA 4BE7B 1OZTG 3MRMB 4HK0B 4D3DA 4U7TB 4QG7A 1ISMA 1GGNA 4M54A 2VTFA 3RVBA 5T1LA 2C5LA 4ELKA 4CIXA 3HSYA 2W81C 2VSOA 1FFTB 1NCOA 5CFOA 2VDMB 2APXA 1WPQA 4LYJA 3MUY1 2P4AB 1SNRA 2VQUA 4K55A 2K45A 1Z5PA 4RD4A 2QW1A 4U6VH 4OFYD 3SEQA 1XSOA 4JUAA 5EC2B 4RA9A 2BBSA 1KP2A 1PZ2A 3RG2A 3OXSB 4F46A 5L6YH 1C8BA 4RV4A 3S4SA 5IYZA 3LXUX 2EO1A 4A37A 5DQJB 4I19A 4PZLA 3K9GA 3V5DA 3BD6A 5ICZB 4YQYA 3GBNH 2K78A 1KJ3H 3E2IA 3CH4B 3G08A 1U3NA 1J2UA 4WLOA 3QORA 1KJVB 5CD3B 3QRGL 1HXYA 2J12B 2JLQA 4JL8A 5AK6A 2ZBQA 2Q8QA 3EXEB 2GA8A 4TLDA 3DRQB 3N40F 2I26N 4NQVA 4IIDA 4TNVK 1LP9F 3V8NA 2P5EA 5F72S 3PFBA 3ZSTA 4KTEH 3NJ4A 2HMSA 3IT2A 4TV8A 3G5VA 3H9BA 2LPMA 1LPSA 3F9RA 5EIHA 5I6XB 1PLJA 1ZH0A 2ADGA 5C0AD 1FNGB 2AEQL 1G6Q1 1T2AA 4WECA 1J70A 4LSPH 5E6UA 3ZN2A 2ODPA 4NZUH 2A92A 1HTWA 1EVTC 2EXTA 1CY4A 5AG9A 3H65A 1CDHA 4H0NA 3UT0A 5IKXA 3OIFA 4M6OL 2B8OT 2C4KA 4NEQA 4IV0A 3TQSA 3A6CL 1EZ4A 2A0LC 4G8EA 2PT6A 1M1YE 3G7TA 1BPLB 4EDHA 5DRWA 1IQ0A 3KM2A 2BUAA 2AF3C 4KHXH 5HHOA 1V7MH 4Y1AB 4N8EA 4MNTA 2D1SA 1H22A 1DJOA 3C5ZB 1P9RA 5EWIH 1I7ZA 1KIUB 1YJ8A 2ZU0C 5ISZB 5B64A 4IDLA 2F3QA 2C2HA 5CP7B 2DLFH 2AV1B 2Z4QA 4HS3A 5JTWA 4NCBA 5CIPB 1N1MA 3PRKE 3JYCA 1TLLA 1QK4A 3HMXL 2RGCA 5KCZA 2DPLA 2GPJA 1Q94B 4DCGA 1KBWA 3GFFA 2CA3A 2WY2D 4ICXA 3IFOA 4UUBA 3TLMA 2GN0A 3OPYI 1KH2A 3T2LA 2PKDA 2GDZA 3R77A 5L6LB 1DBJH 1K2VN 2OMEA 3T1VA 1G0XA 2Q3AA 1RAMA 1KMMA 3AZPA 1MPAH 3QWRD 3AEKA 1U8PA 4ZPJA 3LY8A 4NZJA 2FHCA 3GI8L 1SK9A 221PA 1NZFA 3LN5B 3N1PC 1CG6A 2PPVA 2CFOA 4IF4A 4XMTA 1E2EA 4RMWA 5DJAB 3JWNC 2CK0H 1S9DA 3QX9A 4GOND 4E4TA 4CTJA 3CFKB 3PQYA 2CGEA 1Y8RB 1W72L 2C82A 3NA9L 1L9QA 4LOKA 4EQ6B 3PWZA 3GNTA 1E8YA 2G70A 4RX1A 3D0VB 1JF8A 4DC9A 4PNHA 3TONA 3E1GA 2C92A 4RLDA 3CONA 3IAXA 1LW6E 4F6CA 2LUOA 3G49A 5E4EC 4YJGA 4HNAB 5KW9H 2X5NA 4DUVA 5JPMC 1PV4A 4KITB 1I30A 4ZCMA 5JHBA 1JSRA 4DFDA 5B38A 3AINA 3PR1A 2FB4L 1TTPB 4NNYA 1MAWA 2AXFA 3R41A 5ALBL 3NMEA 1KB5L 1IEQA 5C7ZA 2UX6A 4TVOA 4PREA 1E89A 4ZMZA 1JG2A 3ALPA 2PPAA 5DCWA 3MFFB 4EH1A 2GTHA 3BCRA 4EYQA 3LMJL 3UZEA 1BX3A 1SG6A 2NR6D 2HWXA 1I4LD 4HEJA 1PF3A 1AU9A 2JQAA 3E0GA 5TJ9A 2O5XH 3HNRA 2DCUA 2P3SA 3FB7B 3HUJA 4PGDB 2WAYA 1CDDA 4W5OA 1MB3A 3BT2H 5FWQA 5JXEA 1H2FA 1QLRA 1Z9BA 5CLWA 2ZP9A 4PW4A 3IRUA 4RNRB 4UU9B 1TITA 3BQNB 2UAGA 3ZCRA 3RC2A 2BHZA 3DVAB 2EH7L 2E4UA 3S2IA 3HCWA 4NO3A 5FGSA 4XLTA 2VR4A 4X6EA 2GYYA 4ZUUA 4OLZH 1KS2A 4P23A 1NLUA 3WLOA 4WBNA 2ZYRA 1ZGHA 3MRGB 3AHGA 3GT4A 4K3EL 4QLRA 3LHIA 4M8KA 2JAUA 2CWRA 1MCKA 5FS5A 4YY3B 2VSKB 3Q7JA 3JYOA 3RI3A 1B7GO 4YP0A 1P44A 3AM4A 3TL5A 4FMCF 5BWNA 3RY6C 3NJRA 1MXGA 2NTJA 4W63A 1A9EA 3SHQA 3RNOA 2FYVA 3ECVA 3KTAB 3UABA 1XB8A 3R0JA 1MLCB 3FN0H 1LXCA 4H7EA 1PZXA 3KJZA 2X44D 3NVAA 4WJG3 3EZXA 5AI9A 5FBWB 1CUHA 1IAKB 1PZFA 1PDKA 3LHPL 4NJEB 1OLUB 1ECCA 3H2KA 4CW1A 1HKUA 1GKYA 4LHQB 4Q9RH 1XGZA 2EW8A 3DZDA 3FRPG 3NSXA 4FBMA 5J1AA 1V7NH 4HC1H 3RV4A 1UWYA 3HB0A 1NY6A 1H5BB 2V5YA 3FDIA 4A6DA 3B36A 3R7SA 3IDFA 4H0FA 3MXWL 2C77A 1SMOA 3MBXL 3WEOA 1J00A 4OZGB 4N2CA 2NUTA 3EC7A 4LRTB 1F4LA 4E5DA 3TJEL 3IEVA 1KZ1A 3D12B 3QE0A 4GGPA 4R2XA 4HGKC 3VR4D 2HFEA 1T43A 2MHCA 5I7EA 3K9HA 4P5EA 3AXLA 3BWYA 4MUEA 5I0DA 3PDHA 4RNCA 4XX0A 1DELA 3U31A 1QSEA 3FWKA 1NGPH 4NZDA 3VH1A 3QUMB 5E1MA 4R81A 4WHTA 1TVEA 5E5RB 4FW9A 1KXHA 3RY6A 5K39B 5TPWA 1U3WA 3GHEL 1MJJB 4BZ2A 3TOVA 4J0GA 3KYKH 4EO5A 1CS0A 1P0MA 1EVUA 3L9RA 2AXGA 4OQTH 3KPSE 1N2OA 2ADIB 2AAVA 4TTQA 3BX1A 3TX2A 5TV2A 1JR3E 5GHWL 5H37H 3EXIB 3C8KA 4WXMA 3T04D 3UJJL 1F4XL 1C7TA 1BD2D 4B74A 2WWOA 5FUWA 4LW8A 3VZBA 1C3LA 4BYMA 2F7IA 3Q6MA 4YRFA 4AZVA 3VFMB 2J30A 3C8HA 2IYWA 2ED8A 4KI1A 1K6QL 1E7MA 3O3UN 3GBPA 4N86A 3K16A 3MILA 1PG5A 5KBKA 3VYWA 1RJZA 4PO8A 3KHUA 4LARH 1OBVA 4C89A 4J39A 3E6AA 3ERXA 1EVQA 1UP7A 1GZVA 1ZICA 2EW1A 5JW4R 2OHVA 4CODB 5KNBH 4GG8B 4HEME 5D85A 3L3DB 1L3NA 4K0RA 3I85A 4NJ9H 2XTZA 3TEYA 3UTZA 5CEYA 4X4ME 4YONB 4PSPA 4BUHA 3QWBA 3VA2C 1MLBA 4K07A 4XB3A 4Q9IA 1P7QA 1AVTA 4JT8A 5IARA 4W4OC 4M37A 1CFTA 1ZD9A 3I04A 4EUEA 1PU2A 2W8ZA 2IK8A 3Q1SL 2J3HA 4HKJB 3TASA 4W9GC 4MIYA 3QNMA 3SYAA 1OVMA 1SM4A 2OYCA 1E3ZA 1QJCA 2WKWA 1XCQA 2Q8PA 2WLIA 4GW5B 3RU8L 3R6GA 3ZHVA 1YZUA 5IMKB 3OICA 2OCIA 1FTSA 2PR9A 2WHQA 3FFDB 1Z34A 4KFMA 1YUNA 5I6XC 4EHAA 4L1SA 2EYUA 4LY6A 4J3NA 3QJTB 3D7LA 3LY9A 2QA5A 4JG9A 4AQ7A 5TS2A 4JR9H 4GO8A 5CG2A 4N0DA 5G0VA 2ILTA 4KJYA 3TBTA 3QU7A 1U7OA 4WO4B 3KM1A 1GZPB 4XWGH 2WG2A 3SZOA 1KB9K 2EKZA 3U1PA 5IESH 2GUYA 2BMKA 1T8YA 2R1WB 1W8DA 4BB6A 4CPDA 3RUGE 1R3UA 3ZN6A 1OZ0A 3BJLA 4XQ0A 3B8YA 5A3IC 3C5ZC 1XQXA 3LTEA 4ZTPL 4Q1FA 1DO2A 3A2MA 2XWXA 3WIAA 1TUBB 5A6VA 3OXSA 4KGJA 1O7JA 4GIBA 4JFDB 1W8IA 2QE6A 4EF6A 4BQCA 1ETZB 4WI0B 1GTJ1 4MUGA 3GTTA 1OWLA 3O2DH 2GO1A 3GDWA 4NF2A 3DO8A 5K0FA 4DKDC 3GPEA 1FFNA 2H31A 2HPTA 1MV8A 3CJJA 2ZX7A 2NY1D 2C54A 4QOKA 1EJ2A 1XEWY 2PAAA 5AW4A 2P62A 3DRQA 4GLFA 2PH3A 4AWAA 1SVSA 2X9NA 1L9XA 4FLHA 4D9QE 4C2UA 4UTAH 3HU1A 2FYYA 1YE3A 2VDOB 1XQ4A 3EWSA 5DNVA 3RRXA 5I5RA 1P4RA 1QP1A 5H37G 1OAUL 1J0CA 2ZZMA 1DUZA 5C7XH 4R3WA 2C9BA 4JM2F 3TT3H 3W2FA 3BVTA 1ZCJA 2ZXDA 3TFQA 3WYGA 2CYAA 5EFOA 3B5HA 1GC1H 4UQOA 5DS8B 3QOFA 2EDYA 4YWGH 3SEAA 1IMOA 1FNFA 3L6EA 1RWXA 3OCWA 4LYAA 2B25A 5CRIA 2W6JD 1RPNA 2IOQA 2DH6A 1EQWA 2OXHB 4P2QE 4ZFGL 2Z58A 4D9NA 4OGZA 3H7IA 3L5OA 1UOKA 2IAMA 1CUIA 5MENE 2GITA 1X94A 4ZXBB 4ZI8A 1BXKA 4X80H 3SXUB 1XWWA 4RGND 1PWHA 5EN2B 1XB2A 4G80B 1R5OA 5CFRA 1HVXA 1WRFA 5I9NA 4JC5A 2AJLI 1R37A 2W90A 3HN2A 2JFVA 1A14H 1U63A 2I66A 4Y16B 3O2WH 1HN1A 5HJGA 4YJFA 2YHSA 5I4BA 2C95A 1IZ9A 2JGRA 1U8QB 5K1ZA 2G8NA 1I2ZA 4G0OA 2WQ7A 2V7QA 4OBSA 3ZWQA 3RK4A 2QSZA 1VL1A 1Y98A 4NS1A 1CFVH 4BNGA 4J6RL 2B4QA 2J73A 1VRSA 3KS0H 5DEJA 1A9VA 5DK0B 2YOFA 4ZHSA 8PAZA 2G28A 4BMSA 3H18A 1D07A 4XP5L 1HT2E 5DC2A 3ZKND 2R0WH 5K9KB 3OJWA 4LWPA 4BO9A 3LDFA 3WK5A 4C7BA 1JIIA 1N8KA 3R4DA 2R4SL 2WJAA 4BEVA 2IPTH 2VDKH 2XWBB 2YJZA 4JPSA 1QGYA 3RK0A 3AR4A 2BKLA 3CFKA 2H06A 5G1OA 3VB9A 3EXFA 3DSNA 1I0LA 1HFUA 5CEJA 1TIPA 4EQ6A 4BEWA 1IM9B 4N0QA 2X0VA 3PXJA 1W1WA 4EAEA 1KPVB 3N85L 3LPLA 4N2HA 4WBXC 4QTIH 4ZPTA 4MA8L 1CMOA 3DZCA 3C2AL 2A74A 2QG9A 1N2XA 4OLBA 4XCEA 1M05A 3E70C 4D43A 3O8CA 2VXQL 5DI8B 1RURH 2Y6SD 2HPVA 4AK2A 2R69L 3T0GA 4L29A 2FW8A 1NCHA 4K9KA 1BZ8A 3VXPB 3RWCB 3CXFA 4IDJH 4LKXB 1VSBA 4KIWA 1UBFA 3MFFA 3IHLA 4TKWA 5GJTL 3AROA 5FA4A 4PGEB 5IC6A 3TRHA 2OJ1A 1SGKA 3U4HA 3RTCA 1PZNA 2K7FA 3U7RA 5HQ3A 5CF3A 3QKSB 1EGAA 4Z9KB 1A7KA 2X4SB 3MBIA 2BIHA 3N2JA 2QB5A 1BCSB 1IJBA 3VFGH 3H05A 3QMPA 4FJ2A 5AEAA 5AZUA 1KBQA 1L5WA 3FWPA 1H5BC 5E95A 3OLWA 5BSGA 2FEDC 4AIOA 5JJIA 4HPYL 4FWWA 4K03A 2MYPA 2PX0A 1PFVA 4P99A 3WNQA 1TIKA 1BYIA 4H1LB 2H0EA 3BMOA 4PGFA 3L9XA 4E3ZA 3R5FA 4AZ0A 4BH7B 2FKNA 3DBHB 1QMGA 3L18A 2E8YA 2YQBA 3QJYA 5FV2A 1KVQA 1UM9B 3C3DA 4WFJA 3PS6A 3ELBA 5SWSB 1Z2NX 2PZFA 5LZ8A 3RU9A 1J9CT 4MR8B 1LO5A 4XBEL 1MCDA 3MRJA 1XVTA 2W93A 3CUEF 4UU7A 1IHYA 3UUWA 1GKIA 5FFFA 1PFGA 4URUR 5D7NA 2ZVQX 3HKCB 4ZT6A 3E7XA 2R2BA 3KTAA 4PCTA 2MCPL 2X3CA 5G0WA 3WQSB 2X13A 4JMNA 2BDUA 5BW5A 1OUMA 2VNCA 4P06A 3NKFA 1G7MA 1GYVA 2PA3A 3HE6B 1J8YF 1CGSL 4DCJA 3TTWA 1S4IA 1KAOA 1EP2B 1NCWH 5C0EB 2REQB 1QF6A 2ZWSA 1KFAL 4LAQL 1A96A 3IFNL 3GW8A 1NM5C 3KL5A 4MB0A 2ZICA 3BOVA 2C5EA 3HA3A 4Z7QF 3IR7A 4V3BA 4A73A 1ARZA 3NH6A 3WOVA 3AXTA 3AF3A 5B39G 1ZWLA 2XFXA 2DN7A 4L4VB 4J1TA 4OGYL 5EJ4A 2P42B 5DTFB 2HJHA 2AGJL 1U8MB 5DS1A 4UIKH 1GMEA 2ONKA 1ORSA 1FDRA 1WF5A 2JNWA 5IB5B 1N0LB 3PPVA 3VR5H 4TQEL 4ZUSA 4Z3JA 1RC1A 1JS1X 1F4PA 4K8RB 1LEGB 3U3JA 1GCUA 1ECYA 1O6BA 4E42B 5I6LA 3DEJA 1B9ZA 1KK3A 2NIPA 4CM1A 2KLSA 5K39A 3QXCA 5JMTA 4AVIA 2FJ0A 2ZYHA 2MNWA 3ZD7A 4X6BB 2BVUA 4JEMA 1TUIA 2GT9A 1YJQA 3MWEA 3PFCA 3X3FH 2KBFA 2XSZD 3ZHDA 4EABA 3PQCA 3UAJC 2QMZA 2QM7A 1WXDA 2ZJ3A 4JP1A 3ZW8A 3GZOA 2AEMA 5JC8A 3B5TA 4PWFA 5AALA 2JLRA 2Y7LA 2N75A 2NTEA 1TMGE 3ZE2B 4N6OA 2WP3O 4WO4C 1D6VL 4KMTH 4PR5B 5IVXF 4XDZA 4QBTA 4H60A 3KPYA 5BURA 1UKAA 2C4FU 1PNOA 4L3OA 4F57H 1A8PA 1NFAA 3PWPD 4XJXA 2NZ8A 4RDCA 4K0KB 2GJ6E 1N2HA 2HG0A 1YZVA 1AD9B 3RVJA 2DSNA 1KDTA 4RSHA 2PRYA 1WP6A 2VYND 1CUYA 2QV7A 4O02B 1FNEA 2A35A 2YL2A 2NW6A 2Y2VA 3V46A 3WNNA 1MTOA 4FQIH 1PGPA 5GZ3A 5KVQA 1BZDA 5JSHA 3BB3A 2OCPA 3MRBB 3MRVA 1H9CA 1UJ4A 3GKWH 2CO6B 4UHDA 4AYFA 5JD4A 3I6GA 4JLAA 2O8NA 4F06A 3CISA 1MCLA 1RXYA 1KVUA 3F5WB 421PA 4NXKA 3JQFC 3WMSA 1ORDA 1MF2L 2OYSA 4N1EA 2RFXA 1BJ1H 4HSCX 4CN6A 5F1PA 1DSSG 3ND7A 4Z1MD 5EMNA 1ODAA 3UJDA 3GQVA 4EI6B 4UNTA 5CB4F 4E41B 3NACH 2RHWA 1GTFA 2I69A 4C56B 4ZVQA 4PIMA 3LTVA 3FFDA 2E4VA 4KH1A 2X14A 3ARBA 5I76A 1R5JA 5ARCA 5T8IA 1I8LC 3UP6A 1M73E 4TV9F 3T08A 1SHMA 3JYHA 2DWEB 2WKOA 2OHGA 3GMQA 5SZIA 1GAWA 2DLHA 5CLTA 5CA0B 4MAYD 3TLCA 3GUVA 4FGMA 1RHJA 5E2UL 4B9ZA 1RZFH 4CLOB 2R1WA 5B57C 4RLFA 1UVQA 4ZXBC 1E1MA 3K9NA 2PQ2A 4HJRA 2Z5GA 1LSOA 1G2QA 5EIFA 1BHQ1 4O1IA 4MRVA 4PP2B 5DC0A 3PP3K 3SBRA 4QSHA 5DA4A 2H32H 4O2RA 2GCOA 4HJEA 3GFGA 4X5XA 1ZHLB 4NLHA 1IAIL 4NI5A 4Y16C 5I1AA 5K09A 2G71A 3T61A 3FS9A 4JHZA 1CTQA 4HAOA 4QFCA 4KDEA 3TZCA 4IH4A 1B9KA 2XWDA 3P2IA 4EKNB 5DD0L 5CCKL 3GHPA 2B4YA 1FXWF 3IP3A 3HO1A 4G2AA 1T04A 2GJAA 3FCBA 3D2UA 3PWKA 1SVCP 1DC8A 5KINB 2JELL 4GR9A 4M5ZH 2EIZB 3O3BA 4MNQE 3T77B 4B3GA 3ARXA 3ROLA 4F3FA 4X94A 3PL6D 4Y1EA 4GSKA 1MG5A 4DETA 1PK7A 3K8QA 3BQ9A 4JZYA 4YCSA 4BFRA 2YC4C 5KYGA 4JROA 3DMFA 1A2BA 1D7FA 3WL9A 1EUDA 4J1SA 3CZFA 1JK8B 3N75A 3ZY4A 3DJZA 4FYMA 1GAFH 5MEQA 5A5VA 4IJ5A 2Y9PB 2R6ZA 4F8YA 5CM8B 4KHTL 5AJTA 2ISCA 4Z0XB 1Z12A 5D7JD 5HI5C 2RGSA 1RZ8B 3RS0A 1N5RA 5AL0A 3AU1B 5KN5B 4KFCA 5ADOL 3V9FA 1KH1A 1VIVA 5TX7A 2JSFA 4GYYA 3OGOE 2Q3BA 4PRDB 1WG3A 1YYMH 4FD2A 1I2BA 1YU9A 3S36L 1QE3A 2FI1A 1QBLH 4DOHE 4OGWA 3QRLA 4Z7VE 3M83A 2ZCUA 4XT1C 1WQ3A 1A27A 5JJCA 1BD2E 5FOBA 3L43A 4OCNC 4ZT3A 1WB5A 4F38A 2WNGA 1IM2A 1S7QB 1KARA 1RKQA 2OMVB 3DOHA 5DHDA 1EP3B 4B82A 3KLSA 4NI3A 1Q9OB 3E1SA 4XAKD 4KXMA 3SR4A 4RAVB 5DW0A 1XV8A 5HI4D 1YNKH 5DK0A 2EKPA 2NSHA 4RACA 5C2JB 3TCLA 1R5VA 1V9LA 3U9PH 1E64A 3B8HA 4KQ3H 4I8DA 1J1XL 2A1TR 4RIFA 3UAXA 4BE6A 3PLRA 1P6XA 4Q3KA 1X5YA 3RRJA 2ZIXB 1XRSB 3S0PA 3QNZB 4Q48A 5J8OA 3SC2A 3EUDA 4WQMA 2HX8A 4E03A 5CN3A 1IM9A 3L06A 5FBQB 1YVLA 4MCZA 1HORA 1J06A 3VVMA 4H7VA 5HYQB 4JUBA 2NRDA 3GFPA 4J2OA 1RZKH 2FOIA 3J07A 1LP9E 2HDWA 3GL9A 4N0PA 2C3HA 3GJRA 4EFNA 5IJZA 2YXLA 4UE2A 2OM5A 5ADWA 3U5ZB 3AG4B 4NCC1 3TECE 5K8CA 4JELA 4PBTA 2HN9A 3Q2KA 2EXWD 1BQ4A 2QQKL 2ZAHA 3SKVA 1E6LA 1DB3A 4B3RB 1HNFA 1CFJA 4DQXA 2IYQA 1OL0A 2AVGA 3NLLA 1N2RA 2C9CA 2D2FA 5I0YA 3CIFA 3RWCA 4FZ5A 3TLAA 5C0DB 3GAZA 3PD0A 2OBNA 2BDNH 2B37A 4AOFA 3NFPA 3RZCB 1TYCA 1U11A 1XTVA 2A88A 4PRBA 3NDPA 4D0RA 1SCUB 1PUXA 4N22A 5IQ9A 3OQJA 3H0EA 2B36A 3C5JB 4RM2A 1GS8A 3EXHB 3HE6C 2E9GA 3J7AC 1UYWL 4QHMB 4MS3B 4G89A 2JI8A 2UVQA 3P9MB 3O41B 4OI2A 4PLZA 1SN7A 1MVFA 1SHZA 1V5GA 4G8GA 2CBOA 1SAYA 3L4BC 3ZL4H 3U37A 5LYJA 3MGOA 3IVCA 3RW9A 1I9CA 4H8PA 3UT5B 3ZWOA 3GSQB 4WXEA 4R90H 2RIPA 4EMSA 2CCGA 4C1NA 3ETJA 5LWYL 4RFSB 1GEGA 1M0SA 1UEJA 2C3PA 4G67A 1M67A 1Z9SB 2VZLA 1DFIA 1QIEA 2UZ3A 5TGTA 4KMQA 5CMLA 1B4JH 5I1DA 1U91B 4GH7B 4FDUA 5DQDL 4HGZA 1S01A 5I7OA 3FTSA 3WELA 5DCUA 3SDCD 3SBQA 5C07E 3WFCH 3K8ZA 7REQB 2GBLC 2C1EA 1YDEA 1U8JA 4X8JB 2DTDA 1X92A 4X7DC 4ZCTA 5I1HH 1RLIA 2MMXA 2NU7B 2YQZA 2JAQA 2IGFH 5I4IA 3O9WD 2HCRA 1L1QA 3BH8B 5AVXA 4A4DA 3EG9A 2EL7A 3RVVC 3WLEA 2IX9A 2XYCA 4K8RC 6CGTA 2KI5A 4KPEC 2GD2A 4C4OA 5KTNA 2B35A 4DGYL 3CIAA 5E4AA 1M1UA 4MR8A 1C2YA 5JW3L 2XRYA 3P27A 3II1A 4MQSB 1J0BA 3K4DA 2RI0A 3HI5L 1UACL 5D5MB 1OLXA 4FB5A 2NUAA 2XUOA 2P80A 3P4MA 2K2QB 4I9WE 2OLEA 4KPHL 4Q14A 4Q0XL 4I1NB 3WEBA 1KI4A 4DCUA 4CG1A 2C34A 2DIAA 3KQLA 3ZEIA 2NZWA 4A38A 1U0FA 5EEYA 2EVWX 4KX9A 3BRCA 2IEGA 3S5LG 1NOLA 3EXJA 4CKCB 4REOA 2PETA 1YMMD 5T41A 5IDYA 2IMNA 1GOFA 4MQTB 1VMIA 3DC0A 2GCEA 1K9VF 4TVBA 1YK0A 1W47A 3UOWA 3NJGA 1MRCH 1QQDB 2QAJA 1WSWA 2F1HA 1OI4A 5G4KA 1Q0XL 2EE2A 4CC4C 1TPYA 3AKCA 5FEUA 4I6JA 4HF5L 3W6OA 1TYZA 1CERA 1JGEA 3O31A 3MRHB 1G9TA 4YCJA 3TVMB 4X5WB 1JDAA 3FCAA 3FR7A 1IN1A 3QR0A 2A4MA 3Q87B 4PRYA 5J4KA 1QHNA 1K6IA 1JAHA 5AHWA 5IB5A 2CN1A 1CR0A 3T1OA 4HRVA 5THXA 1DJXA 1I10A 2Q8BH 2VH2A 1JZ6A 1WIOA 1DIGA 4UV4L 1PE0A 3K4QA 4F2PA 4EBQH 1WMSA 2BP7A 2O5NA 2VYFA 3MRQB 3NOVA 4P35A 1JHRA 4EXKA 4LRSB 1GMIA 2DQJH 3CBKB 4HVBA 5H80A 4K6GA 1EK3A 1Y3HA 1BWSA 2I9KA 3BTOA 3OGCB 2YK1L 4RY8A 1W5TA 2R2GA 3QZUA 2A2ZA 4YSTA 4HWBH 3ENKA 2RCYA 1W96A 2X9WA 2NP7A 5FORA 1HO3A 1PLBA 2FSEB 4PR5A 2IEZA 1Z4QA 3RGGA 3P9LB 3E80A 1UFVA 1I2MA 2JJMA 3HG1B 5ALLA 1FAIL 5JU6A 3JWDH 3UC0L 1FFGA 2PYZA 1ZAKA 1Z68A 3QYPA 3WNCA 1IFHL 5JXWA 2G88A 3R0VA 2VWEC 2VDQL 2HJKB 3NP7A 4JGBA 1E27A 1YSOA 5DHVB 4N65A 2OVBA 2VA9A 3AETB 1JPSH 4NONA 2XVMA 3MNZA 4X1YA 4L2LA 2RB4A 3CR7A 4DEWA 1QUPA 4ITUA 1PEKE 1HZKA 4ZD3L 3HE7A 1PQPA 2Q28A 3RT9A 2CO6A 1RTKA 1ZCRA 3MCKB 3D2CA 4F2GA 2X0NA 4NLAA 3WKAA 4Z5XA 4Q9KA 1G3QA 2G3MA 4FFWA 2QVKA 2OV2A 4PINA 2O5ZL 5K0JA 1USZA 1NU8A 3Q01A 1KDOA 1HAWA 2NYYC 2VLLB 4TLMB 2VP3A 4P5MB 1RQRA 2VM4A 4UEKA 3JVGC 1SDDB 1Y4DE 4XNDA 4UE3S 5JHDE 4NM8H 1ZSVA 2B3RA 4PLVA 2H16A 1RJLA 4KY2A 5F96L 2E7LA 3RI5F 5DGIA 5JNSA 4JX9A 1Z35A 1EHIA 3ZTYA 2YMLA 4H7HA 3TS8A 4LRQA 2QZ9A 1V3KA 3QVWA 4FVTA 1RXWA 4KR7A 3QO1A 2CH8A 1UOWA 3L6UA 3UBXI 3HRKA 4LEXL 2QRUA 4W7SA 3VDCA 2PRZA 1NIAA 2R1YA 1QNZH 2WJVA 2FPSA 2OSVA 2J0EA 5B3JA 3PWVA 1Z9LA 3HCBA 1ZIPA 5JSZB 3PUYA 1JZQA 1HCZA 5E9DE 3O8QB 4NBUA 1DRWA 3RIXA 3FIJA 1J87A 3V7UA 1RWPA 3GOQA 4JKLA 2DKNA 2PY6A 4J7XA 1EVKA 4PN3A 1PD1A 4NKQB 4M88A 4Y6PA 2Q9AA 4KI5C 2VXTH 5I7HA 1TOXA 5JR1H 1EEZA 5HHMB 4LP4A 3G2JA 4KRNA 2FLKA 1IAMA 1PL0A 4CG2A 4F93B 5SWZB 2C5BA 3OQHA 2QJRA 4OT1H 4TVPL 4F8LA 1SC3A 3O0RL 3JWGA 4XIFA 5FUXA 3WHKA 1YC8A 3A25A 3WYAA 5ETUB 1KENH 2F3SA 4OLFA 5LP6B 4OIMA 3OE7D 3UAWA 4PCVA 1HOCB 4ZQIA 5SZKB 4BLTA 1AG0A 3FPYA 1DV1A 1T6ZA 1MWAH 5I82A 2MYNA 2I29A 4GX2A 3U4BL 4OLHA 2J9FA 5GJCA 3CV5A 4M1MA 3TA3A 1GYRA 3OB0K 5IPFA 5MP6L 3GA7A 4ANUA 5CN1A 3MJCA 4DDWA 1TVKA 4EHJA 3T95A 4L4SA 2VXSH 1JQDA 2XMRA 3WV4A 3MLTB 5JJLA 3COYA 4MUBA 3TTUA 4FTDA 3B37A 4ONOA 2P9QA 5GIOE 1IWBB 2CFCA 2Y0DA 2F00A 2HHHB 3M07A 4H3SA 1FYFA 2NO0A 2JGMA 2RIRA 3EGCA 3E8SA 3WJJC 3K6IA 4D9RE 4G0YA 4L4XA 2A1UA 1ZVQA 1RPTA 3PT5A 2WQUA 5AAWC 4GPBA 1E5TA 3U7QA 4C14A 3SSOA 4CWAA 2KLTA 3T1WA 3WLSA 2YD0A 4Q34A 2W65A 1T24A 4TTVA 3G5LA 5TE7L 2O3SA 1R0BA 2B0CA 4N28A 4RFEA 2XLCA 4XNYH 1LQTA 1ZJAA 3ZUNC 3GD5A 1DO0A 3IAM1 4F7WA 1W4ZA 4LTMA 5JDIA 1KPUB 3WLKX 3IGKA 3CLUD 4JY4A 4FLSA 3RZCC 4RQAA 3WO0A 4P33A 4XWOA 5D7BA 1PT5A 4MVJE 1WB6A 2ZXEA 1NZJA 2IXTA 3EXHC 1EA9C 5IHWA 4KY1L 5E1BA 3FFXA 4EEKA 1QVWA 3TNNA 2J67A 2IPUG 5MN4A 1H2XA 1Z2OX 4MQFB 5DH9A 5CVJA 4GXNA 4XRRA 1GY8A 1UP6A 3QVAA 4G8DA 4NU0A 3O2VL 4DG5A 3REFA 3C70A 4UQEA 3L5KA 3IXTB 3N8NA 1SHKA 1I7RA 4QD3A 2O8BA 3RO7A 3M7OA 4D6YA 2GHQA 2OCFD 1XB6A 1AK2A 2I25N 5ICUA 4EN2A 1YUBA 4KFTA 5TDHA 4NDZA 4JPVH 7TAAA 5A1JA 3TBWA 2P2ZA 1TU0A 2IXDA 1BS1A 2X2FA 3IAS1 4JJ4A 1JSZA 2G7ZA 2RACA 1KZGB 4RMNA 1JI0A 2OZVA 5DV9A 3PJGA 1OAKH 4A0GA 1G2OA 3CINA 1AR1D 2DLEA 4KQMA 1PAZA 5C5CA 4TUOA 3GEDA 4LNVA 3FW6A 3CMGA 1WQVT 4QXAA 4JLOA 1I32A 2D0GA 2I27N 5JS8A 2BGWA 3VX3A 2B0JA 2FPGA 4XI5C 1IOVA 3K9QO 5HIAA 5D1ZI 1NNSA 2MT9A 1N68A 3SDYH 3C5JA 4YPFA 2OQIA 3WIIL 1Q0YH 2HJWA 1OSEA 4L8SA 2H5UA 3KPRE 3MV9E 3UBXG 4MS3A 4LSUL 1IKFL 2G9KA 4IF6A 3SDAD 4N0CD 1FNSL 4AP5A 3C6LA 1CD9B 3LBIA 2XB4A 3DRTA 4HUXB 1T21A 2OO5A 4C0XA 3T0EB 3HBQA 1BE0A 4LCVA 4MKRA 2J33A 4QWWC 3S37L 5DU7A 2IT1A 4EA8A 4JL2A 4PU0A 2DR2A 1AFVH 4CE6A 4UUJA 1XGQA 1Z9SA 1PEDA 4Y18A 4MAUH 2GHZA 1V4VA 4PW9A 2Q2VA 3DE0X 3IJHB 1A4UA 2FEKA 3TVMC 5IMMB 5DEFB 2IVZA 2WHRA 3RTQA 2OZLA 4BVKA 1QTIA 1JG6A 2C4HA 5IP5A 3V0VB 3CDFA 2WZPD 3ZIDA 2OPCA 4BGLA 2ZITA 2BS9A 1GRNA 1B2WH 1QNIA 3EAQA 3F96A 2DUNA 3VXUA 1UPCA 3UEQA 3F6PA 3NAAL 3N43F 1R15A 1DPGA 4BU0A 5TE6L 4KXYA 2C4WA 2PX5A 3DWEX 1E0DA 3U46A 1CFSB 5HXMA 1IT9H 1EK5A 1T9CA 4P4LA 2OUKA 1D6JA 1G66A 4GKAA 1G8AA 5AW1B 4NRYB 3QVXA 2NSXA 4F92B 2V7WA 1S7UA 3GM0A 4LBEB 4V0SA 4RY2A 5DWDA 4M3KB 2W5UA 3LW7A 4URFA 4RHFA 1DKQA 4JI6B 3EGDB 1QI3A 3VGDA 3RL1B 1BAFH 1Y8QA 5DO2D 1X1EA 3IMCA 3UFIA 2XZCL 1X6VA 3OUTA 1APBA 1V54B 1YDPA 4CKCA 2ENQA 2ED9A 3TC9A 5DTJA 4ZAXA 1EIBA 3PV6B 3DB2A 5LN4A 2WFLA 4XR9A 3LJ3A 5CZVL 2Y5TA 3VD5A 5BRZE 4JJFA 2O4UX 3OFKA 2VDVE 4FI7A 3BFWA 2AYYA 3FJYA 1RCYA 4QWWA 4XAKE 3DF9A 4ITVA 5COBA 3OLZA 3M9WA 3OKOA 3O8XA 1O7DE 3LX8A 2GPAA 3FLAA 2ENPA 4I5FA 2BONA 4NQSA 2IFTA 4Q0MA 4MXQD 2NY5H 1W44A 1QE0A 1VHDA 3UTSD 4MCIA 4HX1A 1E98A 3DUFA 1GLGA 3DBIA 4Z9YA 1NCUA 3MJVA 2HK6A 5ALRA 1N7IA 1QGAA 3MWFA 3URMA 2PX3A 1U92B 1E2IA 2CCLA 5LCXA 5FUCE 5EEVA 2Z8WC 1T15A 5B4VA 4U39A 2VF7A 3THML 4MKHA 3LKVA 2B3IA 1E9FA 4DIFA 3VO0A 1HQDA 3NABL 4NFDA 1KN2H 4FSXA 1JH9A 1IHUA 4QHNB 1RYMA 1UBJS 3AX6A 2EFDB 2F8VA 1A98A 1U2PA 3PWTA 3MMEB 1UH5A 1P5ZB 1GW0A 4CSZA 4GICA 4I50F 4LYHA 5CEZL 1YDWA 3BYZA 4LCWA 4IIYA 1P1BA 4OXNA 3WL4A 3LKRA 1QWNA 4ERNA 3AFLA 2Z8RA 4W9HC 2W58A 3GO1L 2X77A 1NVGA 2VMCA 2AE2A 3D69B 2GY7B 1KFBB 1IC4L 3VXMA 2FWNA 4QUBA 2YY6A 2WJJA 3BMWA 2W2OA 3G1UA 1NDMB 2Q8AL 3PHBE 3Q2LA 5ANME 2QS9A 4FGWA 4LRIC 3EMKA 1L9MA 1KY3A 3ZDFA 1IRAY 1NFDB 1WIUA 3BDYH 3LC0A 4WN3A 4ZRDA 1DBBL 1Q7EA 3WVNA 3MLXL 1YNTA 1YCSA 2C3UA 2BMVA 5T1LB 4ELKB 1TVHA 1V10A 1G3MA 3H3JA 4ERXA 4L74A 3KYCA 4LL4A 5LP6C 3MELA 4JIGA 2GN1A 5ERXA 4ZPVA 5AM3A 1HESA 1I4DD 5DM1A 3TSAA 2W1NA 4BBWA 5CINH 4PAWA 1FX0A 3L1FA 5I1EL 2AQSA 3Q85A 4OUDA 4TQ9A 3L1OH 2I7DA 2XKJE 1U94A 5F5LA 5H1YA 1M74A 1M8FA 1E8NA 3S4SB 5JYEA 5IYZB 1RSYA 4P5MA 3CFNA 3V5DB 5BR8B 4ALLA 1JXKA 3CKKA 2YFYA 2GD1O 3STXA 4YR9A 2YEZA 3QORB 2ON6A 1HXYB 1UT8A 1F60A 4UQ3A 4ETQA 1TC1A 1IBKB 5G0TA 1AS3A 2QTGA 4NQVB 5K4GA 3D5TA 3RUCA 3W9BA 2WF6A 3VFDA 2G08A 2P48B 3HBFA 2P5EB 4FWIB 3QCUH 2PTVA 3NCYS 3WHXA 3A3YA 4TV8B 2QYSA 3G5VB 3O8QA 2P79A 1RXCA 5CU9A 3EC2A 1U8FO 1EFXD 3GEPA 2ADGB 1OGAA 4LMBA 4GFXA 3QXVA 2BZGA 3ZKAA 1K06A 5E6UB 2RHGB 2QVCA 2QVIA 4NQCE 4AD8A 3UGXA 3DMGA 4YCMA 2ZSUA 2H1FA 3TLRA 2NVBA 3PWUA 3ULUL 1XVSA 2DTXA 4XQ9A 3ZE1B 2MEJB 5BRNA 2IV8A 1Z0MA 3VV3A 1D5IH 2J6IA 3VTKA 5KAQG 2YARA 4F91B 1W7AA 3N0PB 4G8EB 5DRWB 4G9BA 5IVXE 3MQIA 5CCJA 4NV0A 5HHOB 1DCFA 9GPBA 2CHUA 3OJCA 2A14A 3MYJA 4N5UA 3WR5A 1GUFA 3HAEG 4JUTA 1I7ZB 2E37A 4W70A 3MJ8A 3LQZA 3BPLB 4B41A 1RK0A 4FTVD 4ZAYA 3ND9A 5JAUA 1SVLA 1JKJA 5KWYC 4C6HA 2BWQA 4K8OA 4E36A 4LK3A 5BRQA 4HS3B 3QW2A 4JKOA 4WKPA 4YO7A 1JGLL 5HVHB 3RADC 5AOZA 1SB8A 1XMIA 4PFKA 1AN9A 5CCGE 3VKVA 3ZK0A 3IFOB 3E6HA 4BP3A 1QG2A 3HDQA 2NZXA 2IH4A 3W57A 3QULA 4EN3B 4J0DA 2ICAA 1Y7TA 2JCYA 2V9TA 4G5AA 1JXMA 5DTIA 3AEKB 4X00A 3DOSA 3I6BA 1LDMA 1RZRA 1DE0A 2HLFC 4J94A 1U8PB 2UUOA 1VL0A 3DX1A 2GJKA 3QX3A 4J0QA 1N5KA 4FJZA 4F9PA 4K9NA 2H1PH 2YWRA 3V7MA 1ILUA 3LY5A 2GZSA 5DT2A 2G9ZA 2WXIA 2HGZA 5K01A 4R2WA 4IYRA 1Y9ZA 3M1AA 4EW6A 1U98A 1SFDA 3HIZA 4D02A 2NOYA 3IDJA 3PV7A 5I8OL 3PQYB 4MQMA 4ODVH 1T8UA 4AJ2A 4DV5B 1IQRA 3OAYH 5EOCH 5AUPB 3P1JA 4TT3A 4LZZA 2K9FB 4OMDA 2XCOA 4N3GA 2OTPA 4GEJA 2NADA 2KZWA 1TM2A 5H35A 4AM0Q 1KLGA 4K7FA 2YS4A 5A9TA 3KOMA 4JT4A 4YPVA 3IDAA 4YS6A 4JS7A 3LLCA 4H8WH 1VE5A 3N1GC 5E1OA 4LSQL 2UZ1A 2ZBGA 2WW8A 3FPJA 4YJGB 5AKHA 2WIDA 2AJVL 1M72A 3GA0A 1XL1A 1UZGA 2QR5A 2VN4A 4M6MH 3I2CL 2I80A 5B38B 3LHKA 2JI9A 4NNYB 2AXFB 1Q95A 4RH4A 2JXMB 2VAMA 4KDCA 3T9DA 2R15A 3GLFA 1YZLA 4PN7A 3P9NA 4N0RA 2OCYC 4PREB 3T0EC 3H1TA 1A1VA 4BUCA 1LK3L 2BIOA 3IP9A 5HIMA 3IXTA 2VDRB 1UCTA 5KPDA 4GG1A 2IF0A 1FBTA 5KZCD 1FLVA 4XXDB 1GG2A 1N2GA 3PNYA 2C1PA 3HUJB 2BMEA 2C0PA 1WQ4A 5GZOC 2EXYD 3LRMA 5BZDA 2OOKA 1GTMA 2WYZA 2JNZA 1H85A 1NQAO 3DHPA 4ZDJA 3PC8A 4ER5A 4B9IA 2CW5A 2WQXA 3DYVA 3UMGA 3ABOB 1RXVA 3FTDA 3PQ3A 5L3RA 2VDLB 1HM5A 3L0BA 2F74B 4XPTH 1B74A 4ZZ1A 3D4YA 1RACA 4NO3B 4XN9A 4MJ4A 2D74A 3ZY3A 1BFKA 5DHPA 2N0KA 1P4BH 4X6EB 4OV5A 4ZUUB 1E4WH 4OIIH 4P23B 4P9HL 1A3ZA 4QPCA 2P8MA 3OFND 4WBNB 1O1YA 4QBIA 3BGFB 3Q8XB 4IEIA 3ZTTA 1YPZF 4LN1A 4HTAA 2J48A 3PB3A 2O6DA 1ONQB 1AF7A 3HS9A 4NMWA 3ENWA 3K1TA 5AXDA 3CX2A 3I53A 5K5YA 2J3QA 4LKOA 3L1HA 5EXTA 3SD5A 4PWGA 1OV6A 4LA4A 1BVKA 4Y7MA 1UQTA 4Q1EA 3AHFA 2C5DC 3PNPA 5EHFA 1A9EB 3FMGL 1HYHA 3A5VA 3QVGA 5CM2Z 1ONPA 4EI9A 3BXFA 4HBQA 1SHTX 4G0NA 4TYQA 4BFIA 4BNDA 4LRYA 4OQFA 4Q56A 5DFTA 1PDKB 2YFKA 4OGLA 5JQGA 1NH6A 4JQIH 2L42A 2VRQA 4UOJA 4CW1B 2GJJA 2AVFA 2ZPAA 3U1TA 3DB1A 3U62A 3C5HA 4A23A 1TEFA 3V0VA 2G0NA 2JQZA 3RA7H 3QUZA 3C7TA 5D84A 5T67A 2B20A 3VPBA 5J1AB 4G7SB 1YEKL 3DAOA 4E70A 4QUHA 2NY6B 1A2YA 4PYOA 5B6PA 1SC6A 1EMTH 4MZ2A 4JHAH 4FEYA 1X8KA 4YRCA 1EZ1A 2V7XA 3HSKA 4ABYA 4BFZA 3EGEA 3K94A 2NUTB 3IP6A 1AOZA 1GNTA 1H65A 5G02A 4HRYA 3BWZA 1SU4A 5GRWA 2D0DA 2WPDA 4KUEA 2VAJA 4NRYA 1PGNA 2I24N 3ATAA