4Z7OB

Integrin alphaiibbeta3 in complex with agdv peptide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
total genus 115
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4z7oB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4z7oB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4z7oB03
4CNBA 3BQNB 1ATZA 1Q0PA 2VC2B 2VDPB 4JX0A 4G1EB 2NUTB 2QTVA 1JEYA 5E6UA 1M2VB 1RTKA 3ZQKA 1CK4A 4WJKB 1JEQA 4NENA 1XDGA 3M6FA 2XWBF 2VDMB 3K71A 1SQ0A 4FX5A 1M1XB 2WW8A 3HI6A 4IHKA 1LFAA 1RRKA 2NVOA 2XWJI 4O02B 4O3UB 3NVQA 3NIDB 3TVYA 3N2NA 2P28A 3FCSA 4WK4B 3AL8A 1MJNA 1PT6A 1ZONA 2NUPB 1U8CB 1OAKA 3EOAI 4IGIA 1FNSA 3VI4B 5KYYA 1L5GB 2NUTA 4F1KA 2ODPA 3K72B 5E6SA 1XUOA 4C2AA 3EGXB 3V4VB 1JV2A 4NEHB 1JEQB 1MHPA 3BQMB 3EGDB 2VDRB 5KYNA 4JDUA 1QCYA 1PCXA 1QC5B 1DGQA 4CN8A 3AFCA 4GZ8A 1NA5A 1YVRA 3PPYA 3IJEA 1M1UA 2XGGA 4WFQA 1U0NA 3ZDYB 2B2XA 5KYWA 4O3TB 2NUPA 4Z7OB 1U8CA 1AUQA 1XDDA 4C2BA 4UM9B 3HXQA 3NIFB 3NIGB 2M32A 3TW0A 4Z7QB 5HGJA 1JLMA 2WINI 3RAGA 4G1MA 3K72A 5HJ2A 5KYXB 4K3JB 1MQ8B 3ZDZB 5HDBB 4MMZB 2VDNB 2VDQB 1IDOA 1N9ZA 1U0OC 2ODQA 2X5NA 4PN7A 2P26A 1T6BY 4A0QA 4MMYB 1DZIA 5LN1A 1JEYB 5E6RB 1M10A 1N3YA 3IJEB 3ZE0B 4F1JA 3EG9B 3K71B 1M2OA 3PPWA 4DMUB 1UEXC 5KYWB 5KYUA 2ICAA 1YUKA 4XW2A 3EOBI 1AO3A 2I91A 3PPXA 4G1MB 1MQ9A 1OLZA 4G1EA 1SHYB 1SSLA 3AL8B 2ADFA 1M2VA 5KYXA 1PD0A 1RD4A 4NENB 3V4PB 1L5GA 3EH2A 3TXAA 5E6SB 4HQKA 3OL2A 3EGXA 2VDKB 4MMYA 3OKYB 1MQAA 3IBSA 4O02A 3K6SA 1RS0A 3BN3A 4WK0B 3E2MA 3EGDA 3EH1A 3ZE2B 1IJBA 3F74A 1IDN1 3T3MB 4UM8B 1FE8A 3EFOA 1TYEB 2I6QA 1QC5A 4M76B 1PD1A 5KYYB 4HQFA 1SHUX 3Q3GE 1ZOPA 4MMXA 3AL9A 3OKWA 1BHO1 1JV2B 3F78A 3ZE1B 1T0PA 4IXDA 2UZYB 3TCXB 5ES4B 1CQPA 4HQOA 3OL2B 5BV8A 5E6UB 3ZDXB 4Z7NB 4WK2B 1AOXA 2IUEA 1MF7A 3HXOA 4HQNA 3T3PB 3K6SB 3GXBA 2VDLB 4MMZA 3PPVA 4UM9D 3FCUB 3QA3E 3EFOB 4BJ3A 4FWWA 2O7NA 1M1XA 3VI3B 5E6RA 4CN9A 1ZOOA 3EG9A 1YVPA 3FCSB 1SHTX 1IJKA 4MMXB 1V7PC 5KYUB 1BHQ1 2VDOB 2I6SA 4C29A 4HQLA
chains in the Genus database with same CATH superfamily
2AGVA 3HNSH 4AXWA 1XXDC 1DQQA 3TF7C 5I1EH 1A47A 3NPZB 2O8CA 1C5BH 2VM3A 2I67A 1SN7A 2YVAA 1ZWLA 2YO3A 2BGKA 25C8H 4PRBA 3H5IA 5E9WA 5EYPA 4OZFG 2YKGA 3AEQB 4EGCB 2C58A 1K7SN 4CW7A 5FQOA 3DOEA 4PYRA 3V0VA 3ZE2F 3LLUA 1WBYB 4I55F 1C9NA 4QFCA 1UURA 3GB7B 3AVOA 4QGAA 4K7PL 5K9ZA 2EECA 3QG1A 4QRRA 3BVPA 3JARB 2GNOA 5D5MA 1NCCL 1MJ5A 1U31A 3LQAL 3UUEA 4JUTA 4QRQA 4X20A 3TPZA 1NW7A 1THAA 2N3ZA 3CLEL 4BNTA 2XKKA 3AU1A 3CEHA 3F96A 1GPH1 3RHWF 2DB3A 1CNFA 3IP7A 2HM7A 4ZAYA 12E8H 1VDGA 3HLAA 4CR6A 2BDNH 3M8OH 4FABL 4L5YA 3HHSA 1G0DA 4GW4A 1W72A 4E5SA 3FLAA 3QCTL 4OKDA 4DTIA 1FX0A 2NY2D 3CZEA 5GJBA 2FVXA 1NJ5A 1E3DA 3CX7A 2FYYB 1ZD2P 2DECA 2DYKA 2RGWA 5C2UB 2DG2A 1IZJA 1OZAA 4Z76B 4HEPA 4PAOA 4EHFA 2CHFA 1TZ8A 5GGQH 5FGCB 1ZIXA 5FNVB 3W1WA 3PQYD 5AI6A 1ZA3A 4PWKA 1PUIA 2HMSA 3GDOA 3TLJA 3LRHA 5GADl 1BG9A 1T66D 5KS9E 4WLUA 1P69B 3UXEA 4AQ1C 5IARA 4ZVSA 2LIPA 1WH0A 4RD1A 3CXHK 3EIHA 1SKBA 1EZSA 2HFEA 5B3JE 4U1SA 1JIKA 2HY7A 2WQUA 3D87B 2ZTHA 1NWOA 4Z8FH 3V5DB 4Z0BL 2UXGA 2X8WA 5TQ0B 2ZUXA 4MRSA 3BQMB 3EXHA 4NZRH 2XJLA 4U6XA 2QSUA 1Z4LA 1QYRA 1HCYA 1ZGBA 5ALXA 4J3SA 2WXIA 4HUKB 4WW2A 1HFKA 4M29A 1JAIA 5B30A 1TTUA 2XECA 3QUZD 2NLOA 1FYHB 3UV7A 1KB5B 4P2RA 5DHTA 3NIDF 2JH8A 3H5VA 1SRDA 2ANCA 2YDYA 4DVJA 5BZWA 1SHYB 3P54A 5H37H 2DJIA 5CP3A 3LMJL 2AHOA 1WCBA 3KDMA 2XG4B 1DYZA 4HCFA 4HEQA 1E89A 3F6EX 1CYGA 1GG2A 1U2GA 2CJPA 4HJ0D 3BQUA 5EFIA 4E33A 2WKRA 4BQ6A 4LYYA 3VDQA 3D3QA 3MQIA 4U63A 3ZZNA 4C7VA 3MBWA 3AETB 1MF7A 3QWQB 1FJHA 3MNWB 4JFEB 2X4RB 3BBLA 4XNYL 1MENA 1K4DA 2BHLA 1P74A 3VD5A 2GEBA 1BXGA 2O8BB 1QLHA 2OCLA 4CM1A 1E65A 5E5LA 3DZHA 3O6KH 4GLRH 1YQXA 2QIOA 1KZ1A 1NXPA 1YLBB 5L53A 2OCPA 5FPIA 3GLEA 2NU9A 2JIDA 1K7XB 4G65A 2NO4A 5E2VH 4RVNA 2Z8RA 3HC2A 3MGAA 4JJKA 4V38A 4XJSA 5AVZB 1J0CA 2YUVA 3ZZTA 2H08A 4PW4A 3TBHA 3E3NA 3OLCX 4DDTA 3UKDA 4DKEL 2FWLB 4NCDA 1Q7BA 4GG6E 4UINH 2HEIA 4N01A 5TNXA 1MRZA 5D6CA 4NZMA 1HXMB 4ZW3A 1KENL 3WYGA 1YTLA 1TU3A 5EUOF 1AO0A 5FL3A 4M55A 4FDTA 4H60A 3STZB 4TLMB 4QI3A 1K8XB 3JQAD 2R47A 5JR1H 5H37A 5FO7A 1F4VA 5I66B 2FG7C 4MQ4A 4P2RD 2MJLA 3BZEB 3I8OA 2XZOA 1KYOJ 5EE9A 1M7UA 2X4GA 3DNMA 1PZSA 5DM70 1IQDB 1F8TH 1B88A 3NX4A 2VDPL 2W9EH 1RULH 1IEQA 5C7LO 4Z4EA 1JV2B 4UCFA 5J12C 2IX3A 1Y3HA 2G5PA 2WIJA 3H5AA 1RERA 3ARGB 4JKLA 1EEXB 1KENH 3EZ6A 1YYMH 3T2OA 1R9MA 2W0LA 2BSCA 1XMQB 1SHWA 1B93A 1I6KA 1CIUA 2GCOB 4PPNA 4G7VL 1RZKH 4DR2B 3SYCA 2VLJA 2C7PA 5HOQA 3L7AA 3ICWA 4NDNE 4ZCTA 4ZTPH 3B3FA 1KVSA 2XCRB 2FO4A 3R6GA 3T7SA 5T64A 4M6ML 1HDIA 3ST7A 3TRDA 3O3EA 4ZUSB 1RPNA 4LJ5A 3AG3B 1V9CA 4K23H 4ESHA 5FHQA 1WTGT 4UT9L 3SBWA 1O8BA 4WNYA 3SC4A 4JKIA 4YC7A 2VWPA 2ONZA 2WXOA 1NBIA 4HDIB 2WIAA 5FFGA 3B8YA 1OFVA 2XWPA 2FJHA 3HJFA 1XFAA 3E1GA 4HDSA 1JDPA 5BSUA 3G2KA 1OH8A 3P2DA 3HZVA 1SR8A 1A4KB 4R5TA 3A70A 4BDVA 3BZWA 1BYPA 1D8TA 4PGDB 4BA8A 3M4XA 4C56E 1WQVT 3IU4H 4J16C 4S1QH 1SMKA 3BIAX 3JWNC 2PFKA 2EVJA 5DD0H 4Q9IA 5MFZA 2R2HA 1NQUA 1Z6XA 4DZ8A 2G9KA 4KDFA 4M98A 4L4VE 5DX1A 5IAJA 3GNLA 3ROMA 2PMEA 2F54D 4Z9KB 3DUHA 1BJ1H 5HBBA 1VECA 1F6FB 2BSED 3AFOA 1DP4A 1YR1A 1M05B 1JWBB 1XJ0A 4L0YA 3ECBB 3LN4B 4ZMQA 3OJWA 5BRJA 3CVXA 2D3JA 1ZUNB 5EF1A 4QT5A 1YRAA 1YL5A 3VFSA 2PA3A 1DJQA 3D39D 1IILE 3QAQA 3RK0A 1OF2B 1SIBE 4J3JA 3ROLB 3HNVH 3O3NB 1ETZB 1GCGA 2ZXEB 2GK7A 2O7QA 5BN4A 4OVUA 4L37B 4E41A 5LGJA 2X6CA 4ZQKA 3O6MH 1NOLA 1QBLH 3D85D 4LSVH 3HYNA 4LJ4A 2PW1A 2D54A 4G5QA 4Y4KC 2F64A 2AAAA 3IK2A 3D43A 3P2IA 2NY0C 3Q2VA 2DBVO 2XRFA 2EEAA 2WLMA 3GEFA 3GMDA 2JE8A 1F7VA 1VE7A 1WZ2A 2HO4A 1KJ3H 4EQ6B 1HKLH 1MW1A 2DHCA 5JEEA 4AVKA 3QOWA 5JDIC 5TGBA 5D7SL 2OQJB 3QRGL 5JPDA 3B9PA 1CZKA 2AV7A 1J0IA 4GKSB 1EJBA 5DKFA 3WEBA 2F54B 3K91A 5AB0A 1HYHA 3M8OL 4FABH 4OSPA 1N8NA 4P2AA 1DJWA 4IKJA 4R81A 1E0AA 3IGFA 5CJXC 4AGNA 3BVNA 4HGMA 4JA0A 1OBVA 1YSCA 5AW1A 1E2LA 4ZV9A 1JSYA 3NSYA 3DAOA 3MOQA 2FWOA 1Y4UA 2OMKA 1X6LA 1GGIL 2HHCA 3H9GA 4K9JA 3KXIA 3VMFA 5JH7F 3I1IA 4CMIB 5DLMH 3U26A 2EIEA 3AXTA 2VITA 3AWFA 3D7PA 4D9KA 1Q12A 4K9DA 4DB4A 3FTQA 1BX0A 2O2SA 5E56A 4D9CA 5GJSL 3RYHA 3SDYL 1G1YA 4UE3S 3EEYA 4NIYE 3ERCA 1XA0A 1PDKA 4NZNA 3WKBA 1CUSA 1OAKH 4PJ8D 1WPCA 5JAHA 2JGDA 1EJ2A 4F92B 4AD8A 4QFBA 2Y36H 3NTOA 3QV2A 1JECA 4BLQA 4N3NA 1G66A 4DCSA 2KBGA 4NJOA 3JWDC 1WTCA 1O6FA 5GRJL 4YHNA 2MWCA 1DVXA 2RQEA 2OZEA 3LZ6A 4BX0A 3PFQA 1CTQA 1H4VB 3DQPA 1LBSA 1DJHA 4AV5A 4RH3A 2WE8A 3H1TA 1WAMA 4MPDA 3P9XA 1L5HB 1L7TL 3LPAA 2A77H 2Q2EB 2VISA 1ZCBA 4EUFA 1G21B 3RIXA 1GKKA 3P73B 3FCXA 5LQMA 3KDPA 1IJBA 1XX6A 4OBEA 5CIWA 2IPUG 2WIMA 4P3CH 4GMKA 1ZOIA 5JNUA 1WDMA 1AZVA 3FCBA 4AY4A 5JNYB 5ISMA 3MELA 3V1KA 2Y36L 1J00A 3FKQA 2C4VA 2JFZA 2H0EA 3BXZA 4IZIA 3EYSH 1KFJB 3MV9D 4XR8C 3WB0A 4G97A 4I50A 5DS2A 3ZHUA 2JV6A 1H4QA 1TTCA 4YX2L 8GPBA 2IY8A 3WFCL 4Q4DA 4NR0A 2ODNA 3OLWA 3ZOAA 3T0EB 1NU8A 2GB4A 3LNCA 3H2ZA 5CW1A 3REWB 3S35X 3LBIA 5TQ0H 3NW9A 4GGOA 2Z31C 3WWPA 4QDUA 4HGYA 4QU5A 4GP5B 3A4IA 4Q52A 3KPQA 3A9TA 3REQB 1X44A 5ALHA 3EDYA 3FONA 4UNIA 3FGOA 3HC4L 5ID1A 1E8NA 1DC8A 1GAQA 3VR6H 2BDTA 4KZKA 2R23A 3IXAB 5EZJA 3U0WH 4XYMA 3TIVA 2G0AA 4E5XG 1JR6A 3HCNA 2X3UA 4IRSC 5DHVA 4DF3A 1FNEB 3OKOB 3RM3A 1HH6A 4HWSA 3M7FB 3CRQA 4FKMA 1XR9A 1FRGL 4CLXA 1UPXA 3M7IA 2OX5B 2RC5A 4BK8A 5F7ZA 1VXRA 2YAEA 1Q7RA 4MS6A 3LRLA 2E27H 3QO1A 4ODBD 5GRWA 1FRVA 1XMJA 2V7BA 2O2YA 4ZKDA 1MEOA 4GEGA 3KQPA 4M56A 4UINL 4S0HA 1AKYA 1TYAE 4LCEA 3CK0L 4JBIA 1E5UI 1CDEA 1M73E 4CMAA 3OV6A 4A6YB 3IOMA 4OKNA 5SV3A 2R2AA 2DR3A 1ZINA 1EEQA 1NKGA 2WSYB 3AEZA 1KIUA 2W6MA 4YCDA 1C12A 4YXHH 4NYIQ 4PR5A 2PUGA 2ZXGA 1MJFA 3OI7A 2BH0A 2ZXQA 3AUWB 1SUPA 3FO1A 2VDNH 3DETD 4AMGA 2RHGB 2FYVA 5D1XD 2GVZC 4N6QA 3U81A 5LQNA 2XWJI 4OJEH 5C0FB 5FUWA 4OHXA 1RJZA 2AG6A 1PR1A 1MNUL 4A63A 2M6KA 4PANA 2Q3BA 3DIFA 4K9EC 3ZU2A 3AEKB 3MJVA 2ANBA 4U1IA 5LZ4A 5IB5A 1BCSB 3FZGA 4AMZA 3ZHBA 2OBXA 1HOCB 4JHLA 1WNTA 3MPUA 3RC3A 1YPZE 1Q7GA 1XCPA 4K9NA 1BF5A 3I34X 1AQMA 2A6KB 2GPJA 2DPKA 2XWCA 3I01M 4BHUA 1QOPB 3WIFB 3QDMD 1JAHA 3IKCA 1FCCA 2QKIC 4PIVA 4HHEA 4YHIA 3WXMA 3E3QC 1U28A 4AYFA 4XDZA 2WWKT 3HVKA 3OKLA 3OT5A 3IJ9A 1GMEA 4G9DA 4LVEA 3FSVA 3T6ZA 4DUVA 2X9XA 2EADA 2PZFA 1B3BA 2E5LB 5D84A 4JPWH 4OZGB 4JS7A 3RI5K 2X4PB 1O6GA 4EENA 1IEHA 4X6FB 1ANUA 1GXEA 3AIOA 2APVA 4I4LA 5EORH 3VOBA 1WO2A 4NONA 3OJXA 4L8DA 3N28A 3EA4A 1XFPA 1G63A 4X4MA 1JGUH 2CDFA 3MDJA 3M6DA 4B3GA 1U8TA 1YI8A 3D7KA 3KFLA 5C9ZA 1PX0A 4LK3A 3L4ZA 4O63O 5B5SA 1ZVYA 1TU2A 1OI4A 3CSSA 5JRDS 2HT6A 1CEXA 2XAAA 2V7QD 2QZZA 4YAKA 2A9NH 4IIUA 4Y6PA 2BHTA 3ATAA 1N8TA 3V00A 4V2UA 3IIEA 4JQSA 4OFXA 3MGOB 5AW5A 4YSOA 3KVYA 5ESQB 3IHLA 1J8HA 5DU7A 2Y2VA 1E1RD 4XGQA 2NXJA 3IU3B 2D9QB 4TYMA 1NU6A 3SBWC 5KANG 1WDAA 2XXAB 3DJTA 4EJ2A 2IS6A 3OOJA 3DE2X 3ZLTA 1YZQA 4NUPA 2FWPA 4X92A 1X7QB 1XZFA 4P4NA 3AL0C 1YDFA 2PCYA 2V3DA 3OJEA 3TM5A 1PD6A 2VDML 3RTBA 3OESA 1G9XA 1LI7A 1A50B 2HB6A 3NJVA 1TDQA 3D8MA 2ZZUT 4BQCA 4I48A 4KKLC 4ZW8A 3DTXB 1AXEA 4J3VA 4G1MB 4LZKA 2IALA 3LH2H 1F86A 2MR6A 4LOIA 4ZDHA 1N26A 3IDOA 2WVVA 3GRFA 4U2KA 5BUZA 4Y9CA 2ZXBA 3K8MA 2O0KA 4UMFA 1G7MB 2A73B 4DQLA 4YT8A 3OSVA 3IULA 4AJHA 4CBZA 2Z91B 4GP6A 3N9GL 1XQWA 3TURA 5DN6D 5GGVL 4IVQA 4KI1A 2Z4SA 2QTCA 3G0OA 2V0GA 1ZANH 1XI2A 2IANB 2J7PD 1M6VA 1OFHA 3ZLVA 4JGNA 4O1IA 4X6LA 1OEZW 1KS2A 1YQ9A 3F7RA 2FOIA 5J6GA 3A4VA 2H65A 3DROB 4MD4B 3BZUA 2I9TB 2C0CA 4OX9B 5DEOA 2O61B 3GLHE 5I7WA 1J8HD 2G63A 4YUZA 1W5TA 4JM2F 1MP0A 3CMOH 5HS6A 4KZDL 2Y27A 3TPUA 1SCUA 4ZW5A 4IJMA 1OHZA 1HLGA 2DUJA 3L7YA 1X15A 4K71C 1GCIA 3IUPA 4EYSA 2WZ6A 1WD7A 3IHTA 1UAAA 3M6VA 1NVGA 5BPFA 4WN9A 5U9CA 3N2KB 2WLHA 3RNKB 2IYPA 2ZVDA 5IJ9A 4DJJA 4JG0L 5CD5D 1U36A 4KXNA 1XCBA 1NBYA 4YRJA 3IGLA 5HYJD 2GK0B 3FOEC 2PBLA 1R6VA 2R48A 4AI7A 5KVGL 3DAHA 4JM4L 4O08A 1XCWA 5JSZB 2VTBB 5DYWA 1EHXA 1OAUL 2P1ZA 1XTPA 1NLDL 4TOIA 1SU4A 4BZ1H 3H8NA 3L3HA 3O8OB 2HGZA 5ED4A 3G6JA 4KH9A 4HFMA 5D7SH 2OXFA 1PSWA 5JPNB 2AVNA 4BQEA 2WAMA 5DDIP 5DK2A 3U31A 1QFJA 3WTUA 2LOEA 1O2DA 3QNUA 4L3WA 3MTAA 3PE6A 3HR4A 1KKMA 2K4WA 5EZLB 4DUXA 1Q9KB 1D0VA 4OAWB 3ROOB 4KN6A 4C20A 3RHFA 1NVUQ 1VGKB 3IAFA 4IL5A 2BRRH 1EU1A 3GXOA 4CKYA 3PWJB 4J3TA 3MGCA 5JASA 1V3LA 4PJ8C 3SO3B 1Z2DA 4IJ3B 1BJMA 1CXEA 1VFPA 1NDGA 5K9JH 4GYBA 1BQLH 3UG3A 3IVRA 4UAGA 1R24B 4L08A 2A9MH 4QRUB 2FEDD 4PS4H 1GPMA 1TVCA 4R4ND 5TQ0L 3K2UL 7REQA 1T20B 1R0XA 3ES9A 3QG7L 4PP2A 1JZTA 3NJRA 2BGRA 5CX4A 5DS8B 4FI3F 4ORGA 1NC2D 4WHYH 2QRVB 3UG4A 2QRHA 5CGZA 1KP9A 2J3DA 3GD5A 4JJGA 1P0CA 3PFUA 5LYJA 3RTDA 5AYQA 3U3JA 2FO8A 5CTAA 4EARA 3T38A 1G5FA 4QD2E 2DS4A 4JUBA 3FO0H 5D1ZI 1SKYE 2YLHA 1YC8A 1N5LA 2P5WA 5EBLA 1T1WA 5HIIA 3NAAL 3CRVA 2QYOA 2UZYB 2ATXA 1ZRUA 3MUY1 3SPVA 4RV5A 3QOYA 2ZBUA 3KEFA 4ZYKA 3S2EA 4FXKB 1F48A 5K9KA 4AU1A 1WG8A 1KJMB 4HTFB 4KO5A 4OHYA 3ETJA 1YC2A 4V0KA 4HDMA 1PEDA 3O6VA 4G0VA 3HB4X 3KYOA 1U8ZA 3CKMA 5IVIA 2RGSA 1E9PB 1EFDN 2BR5A 4JIMA 3QORA 3CWZA 2G36A 1RKQA 3THWA 4TUKH 1UJ2A 4H6VA 1YZTA 3NAAH 3TX2A 3EJQA 1AR1B 3ELAT 3KCPA 4IRJD 3L6CA 1PZFA 4Y2DA 5KVEL 3TG8A 4MGZR 1U1IA 4LJ7A 3PDDA 5JHLA 4CQLB 4H88H 2J0QA 1B8NA 3QF4A 2FR0A 3UMRA 2R8YA 1O9HA 1H2AS 4KQMA 5HR5A 3L8CA 4AQAB 2EDFA 2QTRA 5AVRA 4KUZL 4A8PA 3KIPA 1FZKA 5JD5A 4K71B 4F8OA 3UL4A 3LPCA 4H8WH 2DM2A 3B9VA 4DPMA 3CFBA 3KK0A 3LUCA 4LP5A 3PG5A 4REMA 3EAQA 1T5XB 4WJ5B 4WHTA 2DGDA 4RA6B 1RUPL 3Q0TA 1SG0A 1ORTA 3OG6B 3DH0A 4QPCA 5B3NA 5DJ0B 3DW3X 2VRWA 1HUQA 4OHWA 2Y7MA 2G5UA 4BXVA 3NC4A 1NKRA 4XPGL 1QF7A 3T1HB 3OPMA 1ZYUA 4G6KH 4JB8A 2HLFC 2PN1A 1UCBH 2ALJA 3C0KA 1FS5A 4ZX5A 1S8DA 1UJMA 4Z54A 1L3WA 4N8DA 3RCBA 3CHRA 9CGTA 3C5CA 3EVAA 3RSQA 3SO3C 2NY6D 2WP0A 3WMGA 3FUWA 4ZFOB 4DMKA 1FJGB 2VXBA 2GHWB 5C97A 3N0PB 4W5TA 2B2XH 4D0BA 1RAMA 4DTGH 1KYOK 4I1OA 3QIWD 4V0SA 3BUQA 4FMBB 5KWVA 3KJHA 1A7JA 3Q3GA 2J09A 2R1WA 2Y25A 4QU8A 4LBYA 3NIFB 4YXKL 3IEMA 2HSEA 2M83A 2R0KL 4Q74A 1I4FB 1CY4A 3FSRA 1TD9A 2A7BA 5INCA 3E9NA 3OOHA 4UTAL 2EDWA 1LO3H 2OULB 5ETUB 1DAOA 3FWZA 4ZMSA 4C0BA 4HKZB 2EJUA 3QHQA 1ZDSA 1W4ZA 1Y7LA 3ILQD 4NUMA 5HDBE 2ZI4A 2O59A 3L4BA 5E4OA 5L3SB 1ZIAA 3B1JA 2YGNA 3VU9B 3P9IA 4UQPA 3ARQA 1CS0B 2GJZA 2GI0A 3OXSB 4WZ6A 2APTA 3PHQB 1U58B 4OI8A 5IW6B 4I99A 1WDKA 2I9KA 3F5WB 2UXVA 1BOGA 3RRYA 3WKAA 4JL6A 1BQHB 4AOFA 2W93A 4XX1G 3ABKB 3L8YA 3UM9A 2ICWA 4NLHA 3SZMA 2RH8A 3U4BL 1XD2A 2VK1A 3VFVA 4IVNA 5EIBD 1ECGA 3QHTC 3HS0A 2OGTA 3P9QA 4OL9A 4G6AD 2ZE0A 3EA5A 4NZZA 1G7PA 1OAQH 4L4TE 4PEEA 4BFEA 1E2QA 3PJGA 2NXZC 5H1YA 1Y18B 2DR0A 5F6HJ 1Z2OX 4GPAA 4JEHA 3RR2A 4MV0A 4IIGA 2IBMA 3T8XB 1U8IB 3QXCA 4I9WE 4XB8A 2OSXA 5E95B 4M6MH 4YHPB 1IB5A 1P0IA 2ONYA 4BVBA 2W2TA 4HC4A 5EUQB 1E4JA 1IM3A 3M83A 4E9YA 1KYQA 3VNAA 3TEZA 1O6TA 4A7PA 5SYAA 2JGAA 4HNHA 3PYXA 5CGQB 4MROA 2EDMA 1SVNA 4IZOA 3JQFA 4DF9A 3IQDB 5JIPA 2NVUA 2XRAH 1KYXA 1XQ4A 3O3DB 1JTTA 4TVUA 4P4GA 4EIGB 2J3IA 3AJ8A 5AICA 2VYCA 1W59A 2JVUA 3JQ7B 1MB9A 3PHBE 1EZ4A 4UQAA 1A66A 5LXGH 1YR3A 1V3KA 1HZHL 3HVNA 1D6NA 1HDGO 3VHXA 3FMGH 2FAUA 3SSAA 4CMEA 1GYPA 1PV1A 4GU5A 4KNVA 4OGYH 1I8AA 1J39A 2ZYWX 4OM1H 1LH0A 1EB9A 3QUKA 2Q4BA 3ZZUA 4ZJZA 5EWMB 4DQOL 3FU7A 1UPFA 2AQNA 2FLWA 4S0SD 2NW3B 4KDVA 3ZDXE 2XB9A 1SHJA 4PYNA 1Q0YH 5FYDA 3AV0B 5C0ND 5L8KB 1EHYA 2X8AA 3VAEA 3WTYA 3WV5A 4ZYZA 5DNWA 2I3BA 4C8XA 3BJEA 3CBJB 1NONA 1ZD1A 5DZSA 4PR5B 1XMPA 5J6HB 2QMQA 1WXDA 3EOAI 3Q5DA 3QNZA 3F4BA 3T6XA 3E4CA 4TULL 3V4VB 5KUKA 1RAFA 2I03A 1WCYA 5I51A 1CC3A 3CLRD 4YP1A 5KSWB 1CWUA 1U8OB 4BKMA 5ALCL 2QMJA 3MMEA 3I2YX 1NASA 4P3XA 1RWQA 1KERA 4PLFA 2XCUA 1E4XH 1II8A 3JSXA 1F1DA 4KIJA 2GN8A 5GZ6A 1KY4A 2JIBA 3HU3A 1U0SY 4NN7C 2NVWA 4NG4A 3IRPX 1CJKC 5I76B 5ESAB 4Y9RA 2QVLA 1EG7A 3LDGA 5T3XE 2L7EA 1CQZA 3Q48A 4L8SA 3PPXA 2H7XA 4ZSOE 3AMKA 1AD9B 3L9EA 5CN1A 1DEXA 3C8KA 1J21A 4MDHA 2MR5A 2BM0A 2CE2X 721PA 3WGNA 4TL6A 2FSVC 2H16A 2I66A 2X2HA 3B2QA 4QHUA 4XOAA 4FNTA 2DYPA 1N6HA 2QBYA 1H0DB 1G59A 4OLVL 5AVUB 3TWCL 2YPLA 1MXHA 4HQOA 4RFSA 1KNOB 3IXTB 3Q7QA 4NY1A 2CT8A 3RZWA 2NY4B 2KPOA 4IIHA 1ZSHA 3GAAA 2I6SA 1VADB 3FTNA 5AVQB 2VLRE 1TQ2A 1KBVA 3I5YA 2D3WA 1H0HA 3VWJA 1FC1A 1BM3H 4X6YA 1QHFA 2G3XA 4MD0B 5IVOA 1N1MA 5JSHA 3V4LA 4R83A 5EWLA 5B37A 5EZ6B 1RK0B 3DTUB 2RMKA 1DSSG 2VJBA 1V3QE 5JC1A 1HKFA 3K72B 1M7IB 1ZQ1A 2VO1A 2AEFA 2Y05A 2AYYA 2WOYA 1K9TA 4I8DA 2VZ1A 3BXXA 1EEUA 1EVIA 2X4IA 5IKCA 2ZJ3A 3HVUA 1G7IB 3ALPA 3TOZA 4PRHD 2V5UA 1TXKA 4PYIA 1F2UB 2AMUA 4BGVA 5AL8A 4AG4H 4HNSA 3TJPA 1X8LA 3DE6X 5DA4A 5CD5C 1UFVA 4N2BA 3U44B 1YE5A 1QAWA 3E22B 3R1GH 2NYKA 3L8MA 5JSYA 3M1CA 3FFDA 4BPRA 4PAGA 4Z9XA 4N7BA 3E23A 1BGXL 3US1A 4Y2DC 1YE8A 3HMQA 5EU6D 3JX9A 4K3JH 2YAQA 1M7HA 4LWQA 4L05A 1RPTA 3DE4X 5IHUH 3BAEH 3V34A 4ZMXA 4M61B 3MFFA 2B1AL 1R3KB 1S4IA 1CN4A 2IHYA 1RZJL 1YVEI 1VESA 1P2SA 3O9WD 1SVOA 1S3KL 4YEDA 4AWBA 1Q1EA 1RUMH 1ACLA 1DJLA 5D9SA 4N12A 1O9WA 4ZZFA 2PM8A 1X7XB 4OGAC 5LDSA 5EZOL 1PJAA 1DR9A 3NPAA 3ABGA 4IAOA 2BLNA 4XOUA 2OSVA 3V3TA 4KXBA 2XWBF 1JGDA 4U2YA 2UYOA 1TSHA 4LSPL 3KYNA 5BW5A 1VRWA 1RZGB 3TNNB 2GZSA 1GTNA 1VJRA 1NDMB 3FCSA 3KPRD 1RYBA 5KYYA 3OZTA 2BVPB 3SZLA 3VPXA 2QTVB 5LOVF 1ZSVA 2CV0A 2ARJB 2D74A 1U2HA 3HZ3A 1ISSA 3NCJL 4GW1B 1ZVQA 4LKCA 1NN0A 2ZXCA 5JHLL 2FNWA 2YC1A 1QGOA 2ZZNA 3Q3EA 3NCCB 3QFJE 2I1LA 5IC6A 2FR4B 4PN7A 5I6NA 1G3IA 2ZCJA 4MYPA 4OXQA 2WXPA 1A7OL 3NZ8A 5KYWB 3DLPX 1S3FA 3EEIA 5D2NC 2QLJA 1U1FA 2EH7H 3KBHE 4WW1A 3SY6A 5IHHA 3OA2A 3MBEB 5IT2L 3OF6D 3RY6C 1ACZA 4PQGA 1DLFH 4FJ1A 3RF7A 4HWUA 2KW5A 2R2EA 3QR2A 1I51A 3MO1B 4TMYA 3WK5A 1V26A 2W8BB 3GMIA 3WBDA 1NF9A 4UPDA 1BQRA 3OF2A 4LLDA 1W25A 5EMHA 2EX4A 3ZGHA 1F3LA 4J0GA 3SHOA 1BXXA 2JKYA 4G8CA 2A6IB 1HSBA 3GSOA 1DXHA 3HCEA 3L45A 4M36A 3WHKA 1JGTA 1GG9A 2BJWA 5H59A 1AHMA 1Z17A 1JNHA 4M48L 5DYFA 1C30B 1QI5A 4K9EL 3HYLA 2L7JA 5LLTA 2R8XA 3DYPA 1ASOA 1QIGA 4KK6D 3WIOA 5J5EA 3ND7A 2B7CA 1XNRB 1KG0A 1NJ9A 4XRCA 3UZEA 2VR8A 2GCYA 3UBFA 4OYYA 5FGBC 4XMVA 4P84A 2VHTA 1RZ3A 2A9KA 4JZKA 4NKOB 4KOAA 1CJVC 4YX9A 1DRUA 1KAQA 2QW1A 4DV4B 4YHYC 3FT4A 5EF0A 4JCCA 1R66A 1AO7B 3FWYA 3O8XC 4JX8A 1J25A 1NLFA 5BRZA 3I0ZA 2WD9A 2GY5A 5BOPA 2JGMA 4F80A 3A4NA 3C41J 1T2AA 3OM0A 4WZAB 3A28A 1UZNA 3U1QA 2BY1A 3OQ1A 1RHHB 5SWZD 5IK3A 4K9EH 1I1CA 3ECSA 3I02A 3SVTA 4P5MA 1P4BL 3TWOA 2FZWA 3RGWS 5D6NA 1EFPB 1MH5A 5KEZA 5C86A 3EWIA 4QOKB 2VSMB 1I3OA 1KK2A 1UMDB 3O2DL 1Q0RA 1Y18A 1WQ3A 5IT2H 4ELDA 1PQ4A 5DJDA 1ACYH 3PD0A 3THOA 1IIBA 2GTZA 1J56A 1RPQA 2GXQA 4GOLD 2ADFL 1T7XA 1KVTA 2ZB8A 5I7FA 2CMHA 3OC5A 2FA9A 4BQNA 2ZJSL 5GGSA 5BUPA 3DEZA 1MCFA 2C8NA 3IFLL 4L5BA 4H0FA 4EB3A 3M6FA 3GG2A 4M7JL 1GD1O 5EIFA 3IJRA 2I80A 5TFSL 5BJTB 2EXSA 5FUYA 2F7QA 5JVDA 3DURA 1L9KA 1X7ZB 1TB4A 4PGDA 3PLNA 2NDGA 4CIXA 1Z4JA 1LV7A 1IVTA 3C4QA 4LF9B 2VL5B 2XMBA 2D4FA 5CH8A 1TAUA 3GXNA 3ZW9A 1EDOA 1T9CA 3D0KA 3AX6A 1HMPA 3BGAA 43C9A 2O5XL 3RX5A 2ZXUA 1VIVA 4DZ8B 4JEGB 4L3OA 2AJDA 4WE3A 4ESOA 1PK8A 4IDLA 3VQ2C 5LBIA 5EMLA 3SYMA 3DXAE 3JQFC 3ND9A 8AT1A 3QDAA 4FYJA 2DQJL 3DFZA 4U7MA 3FZEA 4LASH 2A6JA 1X8JA 1DSFH 5BW4A 1D6SA 4P05A 1ISIA 4NCC1 2PKYX 2E87A 4MIKA 4GOSA 1YPZB 5IEBA 3MFYA 3VKVA 4UQCA 3CZAA 1QC5A 4CDNA 5JHGB 4JFAA 1T2EA 2GTWA 3DLIA 4PJCB 3GZQA 1WU8A 3IXAA 1M5UA 4AGMA 4LX0A 2HA1A 2OG1A 4HHAA 1RCYA 3JZFA 4P2QA 1H4TA 3L9RB 3M6AA 1ZK5A 1S6NA 5DHVB 3M1AA 4IOFD 1M7XA 1GSIA 3CQPA 3OKOA 3VXRB 2W71A 3F7PC 5F96L 4AZUA 2BNQD 3R19A 2JJ1A 4CCSA 2XN9B 3P5SA 4XN9A 3SYAA 3INOA 2A57A 4WJKB 1UIRA 4FMCB 1AKJD 5EQDA 2C83A 3JTMA 4DADA 4N2EA 1C1YA 1JJBA 4P38A 3ULUD 3FN3A 4UQBA 1QIMA 1NBOA 2CGEA 4PJEF 3UPUA 1A3CA 3UTZA 4L16A 4YDVA 3DDUA 2E7ZA 1IGTB 5D2CA 2X0JA 1RYNA 3RTLA 5D3ZA 5IT9A 1TM1E 3V8PA 4CF7A 4M5YL 1X5IA 1DHTA 2XVMA 1FP4B 2J48A 2X19A 5DH9A 3VH3A 4TS3A 2G5BB 3MACL 1LDGA 3EDQA 4MINA 1DAMA 2XOKA 4R7DB 4BA0A 2SEBA 4NKIH 4FFBB 1TGYA 3QEQB 2P0AA 1AA9A 4B3FX 1NF3A 3GVIA 1Q7CA 4OP1A 1UFUA 2ZJ4A 2G8LA 1VFBA 4JGMA 5EWIL 1T0UA 2E86A 2QN3A 4ND8B 4FTVB 2JB5L 4O4LF 4U2DA 1ET8A 3TFOA 4C7OA 4AY0A 4OHOA 5NLLA 3UQZA 2PTTA 3AR9A 4N9WA 1UOVA 5DF0A 4U4IA 2PL5A 5KHLB 2ESVB 5G4LA 2EEDA 1FX1A 2Y7LA 3L4YA 5JMPA 3BTVA 3B53X 2AC4A 2OCIA 1FTSA 3PKZA 3BH6A 3QI2A 3QK7A 1UH2A 1U58A 3I6KA 3DHNA 2G0LA 3BP6B 1LPPA 3L84A 1TJPB 4P2OD 2HA3A 1NGSA 5K3DA 2PVPA 2I71A 2WZ0A 2NUTB 4FKZA 4WUTA 5DUJA 4EKEA 1BVZA 5I9QC 3EFEA 1J9CT 1M6EX 5L9AA 3EWAA 4RZKA 5KJFA 3B2PA 1M3SA 5C1MB 1N3BA 2NU6B 4X8JA 3HDTA 3L0PA 1USZA 1YQGA 2GLTA 4NCNA 1AUPA 4QFDA 3FFDB 2EH8H 4WDIA 2K9FB 2P2YA 4TS4A 3G2HA 4NLAA 1UA3A 2NY1B 2AITA 2GM4A 4TVKA 2PRSA 3MYJA 4FD3A 1OK8A 3MK31 1QK5A 4LY6A 1QUNA 2C5BA 3KKOA 5F3BB 2Q1YA 5DR5H 1ED3A 2DQGL 3FXAA 4FB5A 3APMA 4MJ2A 1V8PA 1IMJA 2CCLA 2CUHA 1USUA 4Z78A 5HMMA 2HVBA 2R1TB 3BN3A 1E3LA 1GLGA 2X9WA 4BUGA 4DN3L 1ZK3A 3QDJE 4G36A 1XPRA 2IXQB 4RPJA 5B38B 3VA2C 3ISWA 4TTGA 3C3XA 1AQ8A 2VQ3A 1VZHA 4QRPE 5JISA 2OHJA 3D69A 2MRYA 4FC3E 5I15H 5HYVA 4ESKA 3RIFF 1EGJH 4OCMC 5GXBB 2EEXA 4P7GA 2HLEB 1M2KA 2OHXA 4WUKL 1Z6AA 1MAVA 1E7YA 2BSTA 4D3SA 4EY6A 3R3JA 1AKVA 2F9BT 2HTKC 4OZHE 2FQFA 4I9FA 2Q0HA 2YW9A 5JQWA 3SBRA 2YOGA 1G6RB 3BUTA 3QEJA 5FCUL 1EMDA 4PJFA 3SFVA 2AANA 3N2IA 3TW6A 5IROC 1GZ4A 1ZA6B 3G82C 3KB1A 3KGTA 3MGKA 4FMFA 3P3RA 2XQGA 3T3OA 2VMFA 5CAEA 1YJDC 3EIXA 5A71A 1Y42X 5T1MA 2I5PO 4RJIA 4J0KA 2YWGA 1NJ1A 2PQ2A 3WO4B 4MZXA 3P9ZA 3KTFA 4JFUA 4QREA 5HFJA 2YCLA 2TRHA 2PX5A 3ZPDA 3O8DA 2YGPA 3U1VA 2GEKA 4EP1A 5AP9A 3V2HA 4H35A 3QJRB 2VTVA 3L9YA 4MWFB 2X0IA 1PG7X 3KQTA 4PMEA 4AC2A 2RHWA 2BLFA 1RV6X 2F8OA 2I9LB 4PRDB 2EDJA 3A4AA 3C5JB 2CR3A 5BR4A 2R2CA 2HGSA 2HAZA 3BZ4A 4FFWD 1O6VA 3DMTA 4LXIA 1I53A 1MFBL 1GVHA 3LDBC 2XZAL 2C9UA 4TUOA 1VE1A 4P5EA 3KL5A 3MTQA 3NHWA 4WXEA 1FYVA 4E51A 4LG1A 2YHUA 1YONA 4KXMA 4M8IA 2PRIA 1TK9A 1BU5A 3GLFE 4RCVA 4DV2B 4IS2A 4Q3OA 2C5FA 2DQ4A 2D7NA 4K5MA 1LBHA 3L1KA 5CZXD 2A3RA 1YT5A 2TMKA 3R2JA 4DDVA 2Y0SA 3RVVC 5L3VA 4Q24A 2LKDA 3TEFA 3TQOA 1G5IA 1GW6A 2EHDA 1JR2A 2JJSC 5HPOA 2R25B 1QHOA 5EIQA 2ZJ5A 1TTRA 2VABB 2IQAA 1IPHA 3KUUA 4RZ2A 4ZANA 2CKBA 3W34A 2G0TA 3NA4A 1MLBB 1LHZA 1RL1A 1FO0H 5IVXB 1PF3A 4XPHL 2ETWA 3GHHA 2HSZA 5EE5B 4TRPL 2ATAA 4D8OA 5I3CA 4EF4A 2LBPA 1FLTX 2X4OA 5TH2B 3ULUL 2H0QA 2GYVA 4JFED 4RFLA 3I6MA 1NA8A 4LAQH 1USQA 4XAWL 1WZEA 5JXAH 2BP7A 1NGPH 2BCKB 3SPGA 4PG7A 4AGOA 1EHLL 3KLHC 3MRCA 2HBQA 2ZSWB 3SYNA 5IB4A 5KZCD 3BH0A 2E9SA 1P7QA 3MRIB 5A16B 5H9WA 5SY6A 5ENZA 3JD2A 2W94A 3UTCA 1AG0A 1MCSA 4MV4A 3V4VL 4MUGA 3T3MB 4PFEA 5E8JA 2P11A 1G7HB 2B20A 4KI5F 1Z5WA 5F2KA 2WIFA 4X66B 2W6QA 3INYA 3KZVA 4XOCA 2WU0A 3TMYA 5HHTA 4LZJA 4YLEA 2HTLD 4JKMA 4R7NB 4ZJ9A 2C34A 1VSVA 2ZBRA 4I9WD 3NONA 5K4HA 4Y1AE 3EMKA 3UB4A 4N6NA 3IU3A 3TD2A 1W49A 3QS2A 3ILPA 2BEJA 2YYYA 2A1TS 3OLVA 4TL9A 2AMFA 1F4WH 1OBHA 1V25A 5F0JB 3ZHLA 2B9BA 1ZVVA 4XMKH 1CE1L 2HRPL 4PYJA 3S4SB 2V03A 4KG7A 3UF0A 1UYWL 3LWNA 2JQMA 4K94C 3QPVA 4TQUS 1SXZA 4HAZA 4WFQA 3TN0D 2QKIA 3FUCA 2HJGA 4NS0A 1X7WB 2WYIA 3O45B 3O8XB 4ARCA 3JZYA 1OAJA 3TQFA 2P6RA 3UYRH 4TOYL 3DYIA 3LWDA 2VDQB 2YFNA 3VBEA 4K1XA 2KLTA 2VXQL 4FXGA 2CXXA 2Q29A 4L85A 2QENA 2PO6A 3JASB 1KY7A 1BFTA 4PGMA 4ZXPA 4XVOA 5B1CA 2YWYA 4BAGA 2WWYA 4UTOA 4WNQA 2A5DA 1EVJA 3OEWA 2FZ3A 3JQRA 4ODVH 4PSAA 5DWQA 4LMBA 3IFNH 3QORB 1KCSL 3PQCA 5ESVA 2LE0A 4C07A 4EN3A 4PRYA 4L9SA 3OJVC 1MJJB 3RYFA 5D86A 4EA8A 1ZBQA 4OQQA 5CU5A 1PS8A 4TUYF 2BOCB 1H3FA 1T9GS 1GKOA 4ZV4A 1H93A 4OMFG 2GARA 2RKOA 1PBYA 3Q43A 1OGAE 6PAZA 3FF7A 1W4CA 3T5CA 3OWXA 3M4YA 2YPVL 5G2NA 1KI3A 1E20A 4ILEA 3TO2A 2C4HA 2HFGL 5BY2A 1T04B 2A9AA 3FT3B 3HZHA 5LBSL 2EO1A 1CR2A 1W8OA 4OU3A 4DLWA 3L5WA 4IMKA 1DC7A 1ZD3A 3GK3A 4NKDA 3QLUA 2X9NA 5ENWA 5J4VA 2HB0A 1TAGA 4NHCH 1XF4B 3KR3L 2Y1FA 5DI3B 3MHTA 4XGKA 2QRPA 1ZLWK 3BILA 3HK2A 4YRRA 4MDFA 4PPGA 3LKSB 5KOVC 2QTBA 4C08A 5T3XH 1BLIA 3VXME 1I9RH 3RS9A 4F38A 1E3MA 1ZK1A 2F15A 5JNRA 5ERWA 2XNKA 3FTGA 4GKJB 2O6HA 2NX5A 1QGED 2C3HA 2R29H 5FA5A 2OHHA 1BAPA 4BQSA 4QUOA 2FPPA 4H8UA 3LQ2A 4ZK6A 1YUKA 2VZEA 1LGVA 2NV2B 1DO0A 3VYUB 4UARA 1DBJL 4IFIA 3IJPA 3LNTA 5EQTA 3KYDA 3B2XA 1D2HA 2W07A 1C3XA 3X1BA 5I6LA 4CF6A 1JXKA 3ND6A 1P4IH 4QC2A 3HE6B 4BOYA 1BBDL 4BTLA 4AY6A 2ATPB 1RSZA 4HZ1A 1NCDH 3BWDD 3DL4A 1FF9A 3EXHB 5B53A 3R75A 3WSVA 1T2FA 1VA5A 1RZRA 3CR3C 1N57A 1ZKMA 2D0OB 5B3JA 1ZLEA 4K5LA 3U30B 1NLDH 3ZKXB 1CGUA 5F6HI 2GIMA 4N5ED 3ULUC 1Y5NA 5KSBA 4KZDH 2EZ4A 1HXYB 3N3BC 2J5WA 3KKZA 4OUOA 2YV5A 2CRZA 2YXNA 3D9AH 4WHDA 1W72B 1N7ML 4E0RA 1NY6A 5AKVA 3V7NA 3SX4A 5K8UA 3V2UA 5I18L 3FH5A 2C07A 5HDQH 4IXNA 3QCUL 1L4LA 1NFFA 1PLLA 1K8IB 4IGFA 4XTCS 4OCZA 4JM2B 3VXNA 1LK5A 5LLSA 5GGYA 3UK2A 1YEKL 1DVTA 1K8DB 2H85A 5D5ME 1ST3A 4LVCA 2FLMA 4LSSL 3I64A 5IMMB 2BJHA 4E5NA 5AB2A 1FQOA 2XZTA 3DX6B 4DZBA 4YHLH 3FPFA 3KDAA 1NUPA 3HS0B 1MHHA 2V3WA 2I4LA 3MBWB 4AFNA 3M8KA 4RA3A 1HWYA 5IDWA 1YRBA 1P4UA 1B9ZA 1OV6A 1WICA 4XNYH 1C1XA 4XEUA 2V6HA 1UJ3B 4Y4HC 4ZXBC 3NR2A 3OPVA 4JANB 1F1JA 1PF7E 4XP9L 1XA3A 2P8LA 1XZGA 3WIUA 2WUGA 2DQUL 3V79C 3EF0A 3U7FB 5L2JA 4W4TA 2AK4E 4XWWA 4MI1A 5BNZA 1E8WA 2R4QA 3AHGA 3E5HA 2I8CA 2WAAA 1HZLA 4AZ3B 5AH0A 1WCXA 3GMLA 3SGEI 2FWMX 5MEQA 3GDCA 3D6VA 2GJ6D 5KS9A 2COEA 1QH1B 3C8HA 3F78A 4HTFA 4JCOA 4ATNA 3KPYA 1FE8L 2EJBA 3P02A 1GTFA 5TF0A 5IAOA 3AVUA 4NC2B 1MX5A 1OLLA 4E9WA 3K32A 4MV3A 2QGNA 1V1RA 2JSFA 2DBRA 2PIAA 5KWSA 2R0LH 5DC0A 2VJ8A 3CTMA 2VSQA 4DKDC 1NZJA 3EYUH 3QWOB 3L5HA 5A3RA 2X4DA 5I3ZA 4TMZA 3QXHA 5KQLA 4FMKA 5CBEB 5A9SA 4AO6A 1TZHB 1RRGA 3T1QA 2QVGA 4FSDA 3PC3A 1K4CB 2LT9A 3P0RA 1DQZA 1DPGA 3NP9A 2OQIA 4IGBA 2DEXX 2PYFB 4QRAA 3VNQA 2EKLA 5DEIA 5DMXA 3HUJF 5TGTA 1IGTA 1TQUA 5DU2A 5IRCD 2CWWA 4OHBA 4WNJA 3ZJ5A 2C4TA 4FNQA 2HMVA 3KZXA 2ZCZA 3RWIA 1KRHA 6REQA 2J4WL 1XKLA 2ZSDA 3B8SA 3K9LA 2DY2A 4Y5XB 3RUGE 1G38A 5AVZA 3G5VB 4UQ3A 5DVLA 1Y07A 4YSUA 3VHQA 1NUSA 3MBXL 1BVRA 5E2UL 3K16A 3CURA 3TFKC 3TO4A 3PWVB 2X3BA 1VL8A 5CT5A 4H44C 2ED8A 1GUZA 1E2DA 1GAJA 1E2EA 1XF3B 1ZN2A 3PEYA 3RVSA 4RA9A 3DJ9A 5T3ZL 2KPNA 2HCJB 2XZQL 4OCRH 3ZE8A 3KAAA 3RVUD 3C6QA 2H9AA 3NTUA 3F4KA 1BD2D 1J7JA 1EK1A 2ZRPA 2HBZA 4M89A 3DMMC 1XTIA 4PHGA 5CJXA 4UPVA 5K59F 1A98A 2Y22A 5HYSA 5IKEA 1IFXA 5CLIA 4HPJB 5AOIA 4FLEA 1GS7A 4C56D 4DPAX 3C3KA 2J9FA 4FYHA 4QOKD 5DMIL 1GTJ1 1T66C 4CQNA 1NL0H 1JGUL 3LKNB 3EIQA 1Q20A 2I54A 5T3UA 2E9WA 1T8YA 2NUTA 3PBKA 5F4ZA 1JV2A 3LYUA 5HI3D 4POZD 3Q6GL 5DGIA 4Q4IA 5TXGA 1CG9A 3RHZA 3OCWA 3CRRA 2A30A 2HX8A 3WMXA 2IQ9H 1RIUL 3FFWA 5IKOA 3LK7A 3MJGX 2IBTA 5JW4M 3GC3A 1G9TA 1VMDA 5EO9B 3V6FA 3PNWB 3ZO0A 5JUWA 3TEMA 3IHKA 1D2CA 3U79A 3EFBA 1QV7A 4KQWA 5I5EA 2ZSVB 4CODB 4GICA 3B5GA 3LQRA 3FLBA 4DMFA 1UEXC 1OXVA 3MOBH 2SCUB 3VFSB 2ZDGA 2UY6A 4AAYA 4XNQA 4Y2SA 2JFHA 3ZBQA 1U4EA 3FU3A 2PBZA 5C6PB 5PGMA 2YDXA 2IDMA 4M7RA 3M6WA 1QI4A 4ODUB 3B82A 3T15A 1N0LB 4RTQA 4HQFA 3P0VL 2PANA 3QUYC 1OE3A 4OZIE 1WFOA 4EABA 5HHXL 5ISZA 1X5AA 2AC7A 4KE9A 5HYQA 2VXQA 3ZVVA 4LHXA 3SD7A 1GPKA 4R0LB 2VKTA 5HFNA 1Y8AA 4PJHE 4NKMA 1W34A 3I84A 1QA9B 4I9UA 1JRLA 3GPEA 2L82A 4O29A 3Q8AA 4Q9KA 4U6XB 3NETA 4JSRA 4JAVC 3B2NA 2CCKA 4RYDA 2JCCB 2IC2A 1KC1A 3MFFB 3IPRA 1ZHNA 2NT0A 3X2EA 2X2IA 2VT7A 2RB5A 4LXQA 4C2AA 2REQB 2LTQC 1Q9LA 2FHCA 1J8VA 3GD7A 1E9EA 3BPLC 4LPVA 1DIAA 1W85B 2WD8A 1H8HA 1CG6A 3PXJA 4I9XA 1Z6GA 4DWHA 2ZI3A 5AK0A 5T1MB 4L4TA 1G1MA 4HS8H 3ZKWA 1CJYA 1VGEL 3GSRA 3BQUB 1NHWA 2IBZX 3WXVH 2RI1A 3FSAA 3UK0A 3KHUA 5FO0A 4X41A 2X1MA 2DJ5A 1MI5E 5LGJB 5K69A 4MMYA 1GGTA 5HW0A 3OIGA 2XIDA 4RESB 1P0MA 3QKUA 5C1OA 5CTJA 4BZZA 3EEBA 2J5BA 1QYGL 4P98A 4POUB 3MV7D 1AE6L 2FW8A 4LKCB 2P8MA 4MMXA 5AHKA 3QVWA 3BP5B 2AGJH 1NVMB 1GKIA 2Q3XA 2YWBA 1J88A 4UV4L 4FWWA 4N49A 3MRNB 3FYCA 4HYEA 3V4PL 1FUEA 4QM6A 3EYFA 4LLUB 1DKRA 3EVGA 4HLNA 1E5BA 2Q6WA 1WZ1H 3NBYC 2PKWA 3MXWL 5FBLB 4JC4A 4A26A 1ZT1A 3VXQB 1KXQE 1PS3A 2QRGA 2V6MA 1AUOA 2XVGA 3F12A 2GTQA 1LLQA 2PBRA 2A4ZA 1W0JD 5KYKA 5DQ9B 1LJLA 3DHWC 2JWGA 1FI8C 4UTRA 3OQOA 4L8VA 2C3XA 2OUKA 1A7RL 5A9RA 2VDVE 3IDXH 1QHGA 2OP4L 4G83A 3ARBB 5ANRB 4ALIA 3P0FA 1ET7A 4JDVA 4EI5A 2Z65C 3HBQA 3PC7A 2QPDB 2ZKHH 3DQZA 1DANU 1WCWA 3E0XA 4Q9QH 2HRLA 3NRCA 5ULLA 1YR9A 5JVDF 4F97A 5C0GB 3F7NA 4GSUA 4K6OA 4BSWA 3QQ9C 1EAMA 4JDZA 3WHXB 2VPXA 3TWYA 2WLIA 4WO4B 3HG3A 5J2TA 3F9IA 1CXHA 2IDFA 2BEWA 5DBHX 2WN2A 1RZVA 2IIPA 1MVFA 2AEMA 2HA4A 2J8ZA 2AN4A 4FLRA 1AQHA 3B9DA 4S0TD 4A3SA 5EGNA 3MLEA 4OQPA 4Z18A 3RI5F 1OLOA 1HBJA 3JQ8B 4DVBB 4YAEA 5EOTA 5EMMA 4J12A 4D94A 1F2VA 1NW3A 1FZJA 4YPOA 2AQ3A 4AENA 4XSGA 2Z08A 3O94A 3AR4A 8LDHA 1XHFA 5LB4A 4QO1A 4A36A 2OP4H 1D2EA 3CUKA 3OFKA 1O9GA 2BEUA 1A4CA 2XDYA 4OJTA 3MX0A 4D6XA 2VF7A 1IM2A 3MJ6A 1CY0A 1P2CA 2ISCA 4I55A 2R27A 2DXIA 1SY6H 5CR1A 4MMZC 3N58A 3K2QA 2Z0UA 1Z5NA 3FBKA 3S3PA 5BRZB 5B6PA 4DG5A 2K6WA 1L5HA 4N7MA 5D5MF 5AW7A 4IWYA 4M9ZA 1CD9B 1JP7A 4TV9A 3C09B 2WZPD 2PUFA 1GSKA 4Y19A 3P4OB 2QADC 4X62B 1MCOL 3HC7A 2CB9A 4MZ3A 4FSHA 4QXAA 2P6MA 4Q4EA 3UJJH 2KS6A 5B7FA 1NKOA 1JLRA 1IT9L 1F02I 1FTNA 3ABMB 5D7LE 4AQYB 5E70A 2HR1A 4QGGA 2IVFA 3QE4A 4QT0A 1XQVA 4LI0A 4H1TA 4G84A 2X1WL 4EA7A 3GGOA 5FOXA 1CPUA 4C4SA 3FIJA 3VWKD 3K30A 5FUVA 4EI6A 1FVDB 2P8JA 3O6FC 4BEJA 3SQOH 1TU0A 4HCJA 3OMAB 3B85A 2PWBA 5A6LA 1ID5I 3KOYA 5BV1A 1N2RA 2C3WA 3HSSA 4A37A 4L27A 4ZUUA 4Y2OA 4L8YA 5CB8A 4KDWA 3VJ6B 4DIFA 1NMEA 2ZUTA 4A15A 4Z23A 1YA6A 2A38A 1NM4A 3N44F 1GTVA 3MOAL 1TF2A 3RE0A 3G9VA 2TMDA 2AEWA 2RB4A 4M93C 3IWUA 3NIFE 5FUMA 1Z4QA 1RFGE 4IQ0A 1BM3L 4WNQB 2DQKA 3BQUC 1GNTA 4I2XB 1XJ5A 2IMNA 3C15C 4JJ7A 1KDPA 2QQEA 5BOSA 4BS9A 5JPMB 3FUEA 4N0YL 1DBWA 4A39A 3AUKA 5HDLA 1UWEL 3PQFA 4IBUA 4PJ5B 2BGWA 2Y66A 5BVGB 4X4KA 4ZNEE 3RUGF 2H2FA 3KZ1E 2B4CL 1WF3A 2IOMA 4W9RA 4R1SA 3BVWA 2F48A 1QU3A 2DMBA 2I2BA 3WGGA 1JMXA 4WNSA 1O96B 1E3IA 1DZBA 5HHMD 4YN3A 3UW1A 4B75A 1Q1QA 3M5PA 3RRMA 4ZFZA 3PPYA 1Q0QA 2IYRA 3UTPE 3BMQA 1YZNA 2XEDA 2Q7YA 5ENWB 4I2VA 1QTIA 2ZF8A 4OHCA 1V95A 1YKSA 4RCZA 4X61A 4BKOA 4PLJC 4Z2AA 2BS9A 3IQXA 4O00A 4JYZA 2V9RA 4PN6A 4L5FE 2XNJA 2QG4A 3BH8A 4MS3B 3OZEA 4NZPA 3MJ4A 5DQJB 5JDCA 2IH4A 3EXG2 5BT9A 4JUDX 2QGDA 4JZNB 3R3SA 1Q21A 3OFND 1D5MB 3DD5A 3T7JA 2IQ9L 1KHHA 2OE2A 3V0HA 3NCEB 2FZCA 3W79A 4KGDA 4XCXA 2CL0X 2PYDA 4RADA 1Z0KA 4M37A 5AOKA 3GLUA 2VQSA 1CR6A 1XJCA 4OAQA 3PWNA 1Q0SA 4DC1A 2W59A 1LU9A 2GAOA 4NAQA 1OTXA 5BYBA 4L2YA 2NLJA 1H3VA 3KB2A 2J0UB 4KQEA 4YVFA 4CM4A 4AMWA 3A5VA 5C09D 2OM2A 2Z1PA 4F3FA 5AM2A 3SYLA 2GX6A 2P5TB 4NENA 1N3NA 5E8PA 3IURA 2WN3A 1M1YA 4UFPA 5EHFA 4FX5A 5BRZE 1JL3A 3KD4A 4PWYA 1YDPB 4YY3B 1IM9A 1Z5LA 1GSHA 1JZ5A 5ECDA 2A5GA 4ZDHB 3RRJA 2VQUA 1DBML 3OZ7A 4L8DB 4FKBA 5EXXA 4Y4FD 3VKUA 1Z8NA 1K66A 1ZZGA 3EZYA 4HH1A 3HUDA 1NFDA 4E9VA 5ICXB 3HN7A 2WO4A 3UIEA 1J8RA 5JOEA 1ICEA 1QHSA 2FMIA 4OF0A 2WINI 3EUUA 4BMNA 1G7JB 1IX2A 1XZLA 4POZC 3VSCA 3BIBX 1VG0B 3MV7B 4ONFH 3EW7A 3M89A 4WZBA 1QM5A 1T3TA 1T1GA 1HL8A 4ABQA 1P1HA 1WPQA 3RY5A 4CCYB 2Q7OE 2HFGH 2ZR9A 3GA0A 3G9UA 1T3FA 1U3HB 4BQQA 2PYEE 3C6XA 1ADQH 2ORWA 2VCYA 1I7UB 3I75B 3JYQA 3FOMA 1OF0A 4N82A 3H1BA 4ROSA 1W36C 3PQEA 1QO7A 2NNAA 3UERA 2G17A 1WAEA 4KE7A 2NUAA 4U6QA 1Z9OA 3NYWA 4GQ9L 4MKHA 1JVOA 2J8UE 1TJGL 2VDKL 5F2EA 3SDXE 4WV1A 4H7KA 4C83B 3BWAA 2DPLA 5ALGA 3MRVA 4R6XA 3X1FA 3TT1L 4Z3OA 3BQNB 3DOSB 5AKSA 4BFGA 1F3DH 5BWNA 6ABPA 5GGVH 2YRBA 3OLEA 2BNQB 3TYFB 3UYKA 1B0RA 3CWQA 3BD9A 3ZMRA 2O2IA 4KVNL 2QLFA 4YJGB 2EOAA 2C7UB 3RSFA 4WY8A 3H9HA 3LTNC 2PABA 2B92A 5J5CA 1XU9A 1UXLA 3CN3A 4Q7LA 4P2QE 1KI7A 4LHJB 3RVWC 3BE5A 5DT1H 4U9UA 5BO1L 1QLRA 1ZG3A 1NMAL 2DB8A 3FYHA 3O4LB 3CVYA 4HFUH 1V5IA 3RBSA 4K7FB 5CBEA 4DW2L 1P4LB 4MVBC 4UT9H 2VDMH 2Q3DA 1RYMA 3E0GA 2Y6SC 2M1KA 5FO2A 3RC2A 4OI0A 2Q4EA 4CU5A 1L1QA 5LMCA 4AJJA 4ZZKA 4EVIA 3VXMB 4UMGA 4CZ2A 1V4VA 1LPSA 5BRAA 4DKTA 2Y1OA 4G9FB 3LH2L 2PW2A 3SJVA 3E48A 2M1ZA 1M6NA 1QQTA 2N1MA 2EKSA 3RRQA 1PGPA 4Z1MA 1X9QA 4A6YA 5FLVA 5AZ2H 5EU6A 4KE6A 3EBIA 1YY8A 3AYXB 4KOEC 4ZVMA 2X0UA 4ZJPA 1D1SA 5CVCA 1OR8A 2X7LA 2OHIA 2QFPA 2Q8BL 3A6CH 4M0DA 1L4IA 3RL2B 3G49A 2YGVA 4PJ7B 2YD7A 2XN2A 5EO1B 4LECA 2CPUA 3C75A 4NDMA 1VMEA 4AJLA 1UXWB 3PWJA 5FK9A 8PAZA 4HJJL 1CFNA 1IXRC 2BOBB 1BREA 1RLOA 4LW8A 5E7MA 3OX8A 2XOTA 3GMQA 2B5VA 3L46A 2QQNL 1E4WH 3GLZA 3NOQA 2VP0A 1L0PA 1MJ8L 4QRUA 1PEWA 2BFFB 1CT8B 2YMQA 3TW8A 1HTWA 2EQBA 4RVGA 4BVJA 4X3CA 1KYFA 1GGCH 4DR1B 1Z5PA 3D1JA 3DX9A 4N1AA 4BE9A 5YASA 2A0FA 3PVZA 4G7YL 1VLHA 1JU4A 4PINA 1K3IA 2G5BA 1NLMA 3KR3H 4XQ0A 3G1UA 5TVKA 3V8VA 4EXKA 2VJNA 2JI3A 4Q19A 4IDGA 3BTOA 7PAZA 3FTSA 1GYRA 4X5PA 4Y2GA 3IGAB 3GNSA 4Z7QB 4P5KB 1UAGA 4XGZB 4ND8A 4FTVA 2O1WA 1JQBA 3OZ9H 2X5NA 4OCWH 3D6AA 4MA1B 1GGYA 3ACDA 4A7VA 3IJSB 1NLZA 3GO4A 4HJGA 1QS0A 3VFOA 2DP4E 3EXLA 1KJMA 3GOQA 1NMBH 3T61A 2R1ZA 5E9DE 5IFKA 1U2SA 2ECPA 4KWIA 3NJNA 3AB3A 4NJEB 4MW9A 4HQKA 3TA3D 4N7RA 3JD1A 1BYOA 3ZE2B 1C5CL 5ENDA 4LFHD 1VPLA 1ZK0A 4IR7A 3CONA 3D3VD 2C8VA 1ZMTA 3R0IA 3VX3A 2BSQA 4C4YA 3T0FA 5JSUA 1T8PA 1B4JL 4XPBL 2ENSA 4BKTC 2JZNA 1X5KA 3PRYA 1G0XA 2DFLA 1FG2B 2F53A 7REQB 2YIMA 2OI9C 2EWWA 3UA3A 3KWVA 3Q5TA 2D0IA 1NN5A 5B58C 1TO2E 4ESEA 4FFWA 2ZYSA 5IUSA 3QZOA 4PJEB 1TMCB 2IWKA 2J3HA 5GP1A 1UD2A 2GC4C 4W6WB 1OWNA 2ZB3A 4CM6A 3CX3A 4JKNA 2GI4A 5CFNA 1IKOP 3PDHA 1ZA3B 4BMVA 4YMUA 4O9HH 4ETQA 2PNJA 4KNSA 2HT3C 3NBKA 1WW3A 2BJVA 2ZRKA 3CLUC 4HETA 1MO5A 3H9ZA 3L8GA 2HIHA 2IYWA 1LC0A 4RF5A 2MQCA 1AGCA 1I4LD 4M5SA 3SGEH 1H22A 2X4RA 3BSZH 4ACAA 4V1DA 4MNQE 1ZJ4A 4R9UC 2UKDA 3N2JA 3QFJB 1DQQB 3UNXA 2BP5M 3UPDA 4DGWC 1WIWA 4M8QB 1BXAA 4GF5A 2CRYA 1MR3F 1BF2A 2V59A 2D8AA 1B6SA 5DZPA 2AG0A 3ZHFA 2B1AH 4F3TA 3G8CA 4N8UA 1PSZA 3AEQA 2C7QA 1HDYA 2BGIA 4KH2A 2BY2A 1IK6A 3I74A 4X0NA 1FUIA 1SM4A 3ADPA 2ZWMA 2PGAA 1G7QA 4J2XA 4GWKA 4CN6A 2XZDA 1YHNA 1Z75A 1SHTX 4B9CA 1M0WA 4PX2A 4QHTA 4NZJA 4HYYA 2V1XA 1O96A 1HT2E 1WBZA 5I66A 3A47A 4XP4H 1N59A 5LMUB 1QHQA 3EW9A 4LRXA 3KYKH 1NGQH 2IF0A 1HEYA 2Q3LA 1MNQA 2AI2A 4MCJA 4MB5A 2IELA 2ERJC 3BGWA 4PBXA 1UKZA 1NLYA 2J88L 3M82A 2WOBA 4J4HA 3MAAC 2GJKA 4G37A 1QTSA 4LLYA 2QRZA 4CG1A 3DQQA 3IX7A 3FHOA 4KAJA 2XWJB 1T6YA 3JVGC 1K4KA 2PZKA 1GRVA 4MS3A 2CUNA 2FSFA 2ORBL 3WN5C 1Q50A 3LRKA 3EPKA 4RTMA 5LM3A 3A1VA 1XD2B 1Z32X 1E9RA 2HX7A 4HQ0A 2VQFB 5KVFE 1NQVA 3AU8A 3H97A 2NXNA 4L4ZA 1GR1A 1WC7B 4IJWA 4EPSA 3ZSSA 4F85A 3FF8A 4P2RE 4R31A 4AC4A 4RJTA 3L2LA 1J90A 1JDSA 3N2GB 1X8XA 2XB4A 4BO1A 1L0XA 4QOIA 5AW9B 5B64A 3O3EB 1Q2UA 1U2TA 1IBKB 4BZXA 1UKEA 3PPEA 3L3JB 5E4IA 1E28A 1DQTA 1OYYA 5EZIH 3S7ZA 2X4UA 2OBMA 1QB7A 4RAVA 3CM0A 4UVEA 2R66A 1GQFA 4RSHA 4FILA 4XRGA 3ADCA 2EXXA 4P9HL 4F8JA 2Q8PA 3TBTA 4NBZB 3TZ6A 1MRDH 3KQHA 3QZNA 3R6DA 3NNSA 3K1AA 3NEPX 3T12A 3H9QA 4A6DA 3D0AA 2FGJA 1IZKA 1T03H 3WJMB 1ZM7A 3W4JA 1IQDA 1CDHA 3UAJA 4FZ8L 1YEHH 3KVNA 4G43A 1KMQA 3KJEA 4N6OA 4KPFC 3GWZA 1PFWA 4BSJA 4LCWE 4CQMD 2JLAA 1HI6B 4N85A 4CQMB 2HBYA 4Y9DA 1TMQA 4DCMA 4DMRA 3G04B 2J8UF 5B21A 1GR7A 2JLCA 3AAZA 3PNKA 3H42H 4CF4A 3N70A 3GUZA 3MV9A 2FXIA 3QDMA 3ZVRA 1UM8A 4QUKA 1VB9A 1IQPA 4M9UA 1FP6A 5JIBA 4YAWA 1R4NA 2NZVG 5HVFB 2J71A 4OBXA 1VRCA 5EXEA 3THML 2XA9A 1N2SA 3FHCB 4NO0A 3LOUA 4RULA 4WK6A 5L40A 3IP3A 1K6JA 4JITA 5DD1H 4B97A 1KGSA 3BRSA 3WKNA 2JHCA 3GMTA 5IMMA 3DVIA 1G5PA 1QRAA 4ZTEA 5CP3H 2IHTA 3A4MA 3L04A 2FSPA 3TLRA 3O2JA 3ZE1B 1TZ2A 1I3RA 3HUTA 1RIVL 4IUBS 3X44A 1IUPA 1KOAA 1B4LA 1UC5B 5KMGB 3D3WB 4DLNA 3RG1C 1J9GA 4QWMA 3U3OA 2YBRB 4PGJA 4RFNC 4YRSA 2EKPA 3LW7A 3U2QA 3WN5A 4FI6A 3DE3X 1BE6A 1DJMA 1PT5A 5BO1H 1YRLA 5DYNA 1NJ6A 1TW2A 3JQEA 3H4IA 1P1RA 3RG8A 3MRGA 3PNQA 5I19L 4IQ8A 3HKZA 1H15A 4OGLA 5JANA 5E1OA 1TLMA 2JK5A 8FABB 4KUEA 2CKBH 1UQRA 5FR2A 3N07A 2YPVH 2F59A 4UUQA 1THTA 3FA2A 1EJFA 2R5FA 2VOTA 2QRMA 2XQYA 3N53A 1IE5A 4PB0L 1MB2A 4BNZA 3OHMB 4KZPA 4GI8A 4WSGA 1KMCA 3HI6H 1W1WA 3RBGA 2WWKO 3S2FA 4C14A 1Z5GA 1AMOA 3LT5A 3CBKB 3WAGA 4L0MA 2H41A 1JA1A 4M7KL 2B16A 4MVBD 1F17A 4LRSB 1CFSB 1U6IA 5LD2B 2VXSL 4H0CA 1KOFA 2YL2A 4DQXA 3CSPA 3GC6A 1LJUA 1Y4AE 4B9GA 3U6BA 1HMYA 1U5BA 3SF8B 3ESOA 5DN6A 4RTOA 4JO1H 1RT9A 1Q16A 3L1VA 1T0PA 3GRWH 1XOIA 5EA0H 1E92A 2AHIA 3IKTA 2YR3A 1IJNA 2JCYA 3QPDA 5JZMA 1G7TA 4YRCA 4Q4HB 2MQ3A 5KG9A 1F7UA 3CUEF 4D8XA 1F2UA 4ODWA 1YEDA 1D1PA 4QTIL 4LU5L 1TF7A 1MFUA 3HJCA 4ZZIA 1U3DA 2E7MA 1YGYA 4IOKA 3QJFB 3LKRA 1JWUB 3FH7A 2IUUA 3ZGNA 4YDLB 3ZXYA 2GJ6A 3QE5A 2OV4A 1M67A 4IGIA 2QLYA 4HCGA 1RJ9A 2VISB 1DPFA 3N04A 2X2FA 5JAUA 5LWQA 2PMFA 1X74A 1FXWF 4F3FB 2X05A 3RWGB 3EBHA 5AVUA 5F9JB 4AVYA 5KNDD 2CVPA 4WNIA 1T5SA 3UMSA 2OYSA 1PG7W 4CVXA 1A5BB 2VF5X 3WLEA 1RYDA 3RVTD 1WVIA 3RC9A 1JR3A 4BO2A 2Q6VA 1LS6A 5B36A 1M7DB 4BO9A 3B43A 1I9CA 3RT9A 1MJ7H 2F18A 1FQWA 4NNXB 2DWQA 2NQ8A 1L9QA 1P1IA 3VPAA 1WB4A 1BNCA 2EP8A 1SEBA 1YNTF 3SKJL 1TR7A 3IKVA 3KOXA 3QWFA 2PWPA 5GHWH 5KWEA 2ATEA 1Y6NR 3ZTEA 3H8VA 1UF9A 5HQ3A 3KJZA 1ORWA 4HXEB 2FWNA 5FYQA 3IXQA 1BP3B 3FN0H 3VTFA 3L4TA 3BDIA 3DEYX 4V1DE 1H1DA 2D1QA 1P18A 3F85A 3MNZB 2PGNA 5DRTA 1P4RA 4E68A 1C16B 1PGOA 5F5LA 3LGXA 1HXYA 3WTSA 4AH2B 1IOVA 4OFDA 4XNAA 1N6LA 3FWPA 4ALAC 2RH5A 5JFOA 2IW3A 5GRYA 4FJZA 3KBPA 3L7FB 2I25N 2OMXB 1XTKA 2UY6B 1BZ8A 3ICVA 4PJ9D 1A1MA 1GQ2A 3AREB 2PL1A 3RDTA 4Z9BA 3R06A 4AGQA 4DO4A 4A73A 2B4KA 2RAFA 3JSAA 2WD7B 1HYGA 1CEQA 32C2A 4ETQB 1XDSA 2CBQA 2JZOA 2BBWA 1OIOA 1M76A 3KEDA 3ZGOA 4BVLA 4E6PA 4ZAVA 1FFNB 1P84K 1PG0A 2R2EB 1CS6A 3HPLA 1J07A 1ILWA 3CPHA 5I1KL 5KSYA 2C7UA 4S1RL 2QR5A 1C14A 1EPFA 1G5TA 2PPCA 3EOBA 3LMKA 1Z3GL 1PBTA 2Z4QA 2K2QB 1V16A 1YB4A 3U9UA 3R0XA 3X3GH 5LCVL 4V0QA 2NSYA 4C76A 4PLKD 1CB0A 2CDGB 5C8YB 1PL6A 3WB1A 2AOTB 2JAHA 3ZI7A 4XNZC 5IDVA 4PM4A 2ADGA 1LQSR 2V7TA 4TNGA 4QAMB 5BV0A 5ALYA 2HPAA 5MEPB 4OLFA 2OMYA 4HY3A 2B9EA 4NBXB 2R29A 1PWHA 4PWFA 2MSCB 4JFTA 4B7UA 3CUPB 3AUAA 2F5AH 1USGA 2RR3A 1V35A 3E6AA 1BZ7A 8ABPA 1MA0A 1Z88A 2LPMA 4TTDD 1SUIA 4UM9D 4N5IX 2VN3A 3OAZH 4WW2C 4TTAA 4QDTA 3GSNB 1RWOA 3W3AH 1XR9B 2CGZA 5DFTA 2N9UA 4G70B 3T6QC 2APSA 2LAGB 3WMSA 5HA5A 2NY5L 2H2PC 3QYPA 1XZWA 3UJ8A 4XCYA 3RWEA 4MSUA 4JR1A 3DMYA 4C57C 4QUIA 3VKFA 3BGFC 4E36A 1JEJA 2XSZD 4X5XA 4UVGA 4XI9A 4MYHA 1JFFB 1D9ZA 2W6CX 4B5ZA 2RA1A 2G1PA 4MHHI 1B9KA 1OMOA 2EW8A 3F2VA 1XR8A 3EYVA 4EY7A 4MYWB 3JQGB 5GGQL 2X6VA 4MTMA 5IASA 2F62A 4DR7B 2CHVA 3HCAA 5BOJA 5ECJE 1T5KA 1H6CA 1G5QA 3SGJC 1ORSB 4OF6A 3ZDAA 5T6MA 3QQPA 1I9GA 4F72A 4ZJUA 4KGLA 3AR6A 3I4CA 1Q0TA 4FAAB 3TIDA 4KJPD 4P3DA 2HTFA 2ZCKH 1VE5A 2NM0A 1DCMA 2CLRB 2FIKB 1D5WA 5D7LB 4J23A 1CIJA 2GVDC 1XEUA 3BIKB 3JUYA 3B9QA 1L5GA 1FUKA 3T1NA 1JKJB 4AQDA 4ND3A 2L42A 3HKEB 4RHXA 3O8QB 1THMA 3JQQA 5F7YC 5ECYA 3S36H 1P4HA 3VFDA 2H48A 4MVJI 5DF1A 4KCGA 1KIAA 4KK5C 4L8CA 5F89A 4YAGA 1UEIA 2DULA 2BZCA 4N0MA 1JV5B 3D2AA 3NHRA 4ZZ3A 2NOAA 4B7LA 5EEGA 4MO9A 2TRYA 3CUUA 4JRXE 2G4EA 3AFGA 1OQAA 1G7LB 1LF0A 4Z51A 3N39C 4FGKA 4KXZI 5J59A 3TOXA 1C1EH 4B0MM 1KAGA 1KJ2A 4H8QA 4JVPA 4LJSA 5L88H 3NCJH 2P4EA 4YJFB 3U44A 5EIVA 4GW5B 1FO0L 2J3SA 2G60H 3WU1A 2A73A 5EJGA 3E8UL 1KDZA 3WYCA 2EZ9A 5K8LA 3ZIAA 1KBQA 1GJUA 4QEDA 5BW8A 3CLWA 3HUJB 2PUDA 5HHOA 4CJ0A 1SZPA 3CLUD 3CQ9A 3FAZA 2PSFA 3D09A 4PTUA 2XUIA 1YQVL 2YZ8A 2DHEA 4GO1A 2ZPUA 4OL0A 4D79A 2ENQA 3QDGE 4DMLA 3GK8H 4FFOA 2GGSA 3CZ9A 4K88A 2OMNA 3QKTA 4FCTA 2R0KH 4KHZA 1XEAA 5L9DL 2RK4A 3HUFA 2YBDA 2OMZB 1NKSA 2ZT5A 2RCSH 5IQLA 2OAGA 4TOYH 5DFVC 3U9LA 4FC7A 1RZUA 2R1YB 3FTPA 1CUOA 1NE2A 1GGCL 4PBVC 2XWTA 3MSCA 1ZMOA 1VGEH 1VB3A 1XGUB 4IDJL 3A2KA 1PZ5B 3VXSD 5I8OH 4LVUA 4CKBA 2F8LA 2BNRE 4KXVA 2G5GX 4CNBA 2WLKA 1V5WA 2X14A 2R7MA 1UKYA 1FNSH 1R3HB 1AQDA 3FU6A 3MYRA 2A6JB 5I74B 3LQFA 1JN6A 3WWDA 2C0PA 4G11A 4QLWA 1DJOA 2P5UA 2VQEB 3G5LA 2BD0A 1F0LA 4OZIA 2C04A 3WGUA 4RD2A 3O2DA 5L2KA 1XV8A 4F9LC 2V2TB 2F58H 2Z09A 2G28A 3AS0A 4ZMLA 1Q83A 4GKZB 4L5JA 3G2IA 1M3JA 3O8OA 2DTSA 2FT7A 1T26A 3CH1A 3WENA 1VSUA 2DHRA 1FJ2A 3WG9A 1VE3A 1W4AA 3P9KA 1H4SA 3FD8A 3KYCA 1K3TA 1Y5RA 4I36A 3WLPA 3BL8A 4DA4A 5D6OA 5IABA 4GEIA 1P17A 3RPIB 2PLNA 5M04A 1E5YA 1I8IA 1KCLA 1O7JA 5DD6B 1S7RA 2EACA 2I2DA 3ER8A 4OGFA 1TZMA 1NDGB 2FBOJ 3WTWA 2Y1LA 3GT3A 3L3GB 1GGHA 4FOSA 4NU5A 1D3AA 4KTDH 5AD0A 2VDRL 1VL0A 4OCSH 1MG2C 4OUDA 2YFHA 5KU1A 2QTFA 3RS0A 4F9FA 1GZPA 1GT6A 1GA6A 3IMCA 4N28A 4X6CA 2XBZA 1JXAA 4JO1L 3QEGL 3LOPA 2VJYA 1R3DA 2FPXA 1H3GA 3PAZA 4QICA 5GM2A 5L2KD 1V11A 1FN4A 5BS0B 5JHDD 2O8FB 3L7NA 1PJBA 1KCRL 4WAUA 3EDFA 3ZLBA 4JHWH 2QM3A 2VDUE 4RE5A 1ILEA 4TMPA 4IJTA 1DTEA 2CKDA 1A6TB 2QUZA 1I82A 2Y1EA 3BFKA 1DVFC 3MPCA 1WSAA 4PZDA 1WTLA 5J4HA 4CMGA 4ER7A 3AXIA 3QPXL 2JLPA 3IE2A 3WLLA 4MPRA 1XD9A 2GEQA 3BMVA 4J4PA 4IH1A 2ITDA 2DFVA 3RS8A 3W11C 2OMVB 1BGXH 4IIDA 2WWMC 1K63A 2ZNXA 1HJCA 3UFIA 3CR7A 4Y2TA 4QRRE 3KHTA 3BZFB 2XMPA 1XL6A 3I2IA 4GYJA 5IFAH 1AJ7H 1SM3L 1PR5A 4Q7DA 3WHIA 4JC5A 1HTTA 4XUGB 1WMDA 3W5HA 3AT0A 4PZPA 1K8RA 1KPVB 4RQQA 1AGRA 2VAAA 3GRUA 3E8VA 4JQIH 4W9MC 1VP9A 4IHQA 1OTUC 1Z16A 3H5OA 3VJKA 2AQRA 1E1CB 3K3PA 3CKLA 4ZAWA 4ZCMA 1CU4H 4BP1A 3MS4A 3B6ZA 5EIHA 3CFJB 2CR6A 5K6AC 1M75A 1SDDB 3KCNA 4KK6C 2BM3A 2VDLH 4RCAA 5GOTA 4AVHA 2VPTA 3SCZA 3PQ2A 1IT9H 3UXMA 5GGUB 1QIDA 2VMDA 2ICES 2JHAA 1ENZA 5JHHB 1UXIA 4N8VA 1FW6A 2WHYA 4E4TA 3CFNA 3W3BA 2DOKA 4O4IB 2ZIXB 3BHMA 3DHPA 3HGMA 3J2PA 4M4RA 1ZH4A 4W6ZA 2X6MA 3HMWL 4BQBA 3IDQA 3GJ5A 4B2PA 3L8EA 2PF6A 4TPRH 1AXGA 4P46A 4UUJA 5LBUA 1QLJA 1PNTA 1E5AA 3VD2A 2JFNA 2AG8A 3X12B 4HNAB 4I4NA 2OD7A 3QI9A 4RETA 1EDDA 1QFUH 3V97A 1W72H 1GSAA 1K3ZA 5F35A 3B8EA 3GSNA 4JLSA 1XB3A 1KSHA 4BMZA 4DT2A 1U8AA 4EJFA 4IGBD 5T5FA 1C7EA 1KC5H 1P4LA 2F8VA 4KROB 4PJIE 1FCJA 3RUFA 1UEMA 1A6ZA 2B1OA 1FQJA 1A8QA 3RYIA 5EUOE 4YT5A 3TONA 1LX6A 3BC1A 5K3AA 1KPRB 4DLRA 4EAQA 2B2XL 1H8OA 1QW9A 4WWKD 4Z3EA 1P2FA 3HU1A 4NNPH 1YJXA 4YL4A 2I9LA 3H3FA 3CJJA 2BFDA 5AVXB 1UH4A 4P2OC 4UCXA 3RGBA 1MFNA 1RSFA 4NQVB 1GL7A 1S1CA 3MRIA 5KQPA 6NULA 3U3MA 5IHLB 5AW4B 4JJIA 2QL9A 5CPFA 5CA1F 5JROA 4G5FA 4O3TB 2I1WA 1W9MA 1Z0FA 5I8CA 4GKLA 4YUEL 2VH1A 4NO2B 4OB8A 3T0DA 1NRWA 1U2CA 4MMZB 1MFCL 1Q9OA 2OENG 3O2VL 1AS2A 3UQYS 1AIPA 5D3KA 7FABH 2RJMA 2XRZA 1ZD6A 3B3GA 2AS5M 1OIVA 1M0EA 4WO0A 4XBGA 1GN9A 3DX9B 5A43C 2C5DC 4UKDA 3K0EA 3WFBH 3Q98A 1VZ2A 4HAWA 4YFLI 1WXEA 5JXWA 4H4CA 4YFVA 4D8PA 4M1YA 3BPOC 1PW3A 5GGTH 4CA4A 3VMMA 3MHPA 2ZWSA 3K7UA 2BDUA 3U2SA 3HC4H 4DA0A 2H06A 3F98A 4LVNC 1WLHA 1B6RA 3KL2A 3W6PA 4BNGA 5IJZA 2JHPA 2GEFA 1GNPA 1OLUA 4OZHF 3HB9A 4AJ9A 4XAKE 5F7MC 4RD6A 4FOPA 5DM4A 2GYWA 4HLDA 5H37G 2QU8A 4M0CA 2ZWIA 3D81A 1LDBA 3FOFC 3W11D 4XX1A 3N59A 1HIMH 3UV6A 5DVPA 2BP7B 3JRXA 4NWUH 4QTHB 4IDJH 3QRBA 3QX3A 3EXJA 3Q10A 3C1OA 4GXUM 3GZ4A 3PA6A 3ZV5A 1JNLL 2ORIA 2BGGA 1NR7A 1SVLA 3A22A 4Y9BA 1TMGE 4Z4QA 4J43A 1I10A 1W0WB 1SXJE 3SGDH 1ZHKB 2FPMA 2XLCA 3A4LA 1BQKA 2EFHB 3O7MA 4M1DL 2R7NA 4XX0A 3A21A 3D51A 4BGLA 2N47A 3FOCA 4V0NA 3NXSA 4XPHH 2CO7B 3B83A 3HDGA 1UOQA 1USVA 3LPPA 2WZQA 4MWEA 4ZYLA 2WB1A 5HHQA 3O6FD 1A7BA 4N1EA 3H6HA 3OSZA 2JGLA 3O6FB 4PGHA 2G5CA 1QSVA 3AC0A 1SN0A 1O95A 1ZE3H 1DSFL 3BN3B 4U6TA 4MW2A 2GBVA 4HOMA 2XMSA 2Q7AA 1FAIH 1EFCA 5HDOA 4IJVA 3Q2IA 4KLAA <