4Z7OB

Integrin alphaiibbeta3 in complex with agdv peptide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
total genus 115
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4z7oB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4z7oB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4z7oB03
3IJEB 3TCXB 3HXOA 4MMXB 5E6RA 1IJBA 3EFOB 3ZE2B 4O3UB 1IJKA 1BHQ1 4C2AA 5BV8A 4XW2A 4HQKA 3NVQA 4WK2B 1Q0PA 4M76B 1T0PA 4CNBA 3QA3E 4G1MA 1RS0A 2WW8A 1L5GB 4NENA 4FWWA 2P26A 1SHTX 2ODQA 3N2NA 5KYUA 3TXAA 5KYWA 4C29A 1RTKA 4CN9A 5E6SA 3TVYA 4WJKB 1T6BY 3OL2A 2X5NA 1MQAA 1XUOA 4HQNA 2IUEA 2ODPA 1NA5A 3K6SB 4O02B 3NIDB 2VDPB 4HQFA 4Z7QB 1JEQA 1N3YA 3EGDA 4MMXA 3IJEA 3ZDXB 1SHYB 2NVOA 3IBSA 5HDBB 1M1UA 1U8CA 3F78A 4F1KA 1M1XB 3EG9A 3BQNB 2ADFA 3BQMB 3TW0A 4BJ3A 5E6SB 1ZOPA 1AUQA 2XGGA 1YVRA 4WK4B 2NUTB 1FE8A 3EH2A 3F74A 5HJ2A 3PPXA 4F1JA 4FX5A 1AOXA 5KYUB 1YVPA 4NENB 5KYXB 4O3TB 1JV2A 3EOBI 3FCSA 3ZDYB 2I6QA 1QC5A 3HXQA 3K72B 4G1EA 2ICAA 2XWBF 3VI3B 1M2VA 4K3JB 1SHUX 4A0QA 3ZE0B 2I6SA 5E6UA 5E6UB 3PPVA 1CQPA 4HQOA 4Z7OB 1M2VB 2QTVA 5E6RB 1MF7A 4HQLA 2VDLB 2VDNB 2NUPA 3FCSB 4DMUB 4WFQA 1PCXA 3AL8A 2UZYB 1PT6A 2VC2B 1MQ9A 1JLMA 1JEYA 4MMZA 1OAKA 3PPYA 1XDDA 1PD0A 3V4PB 1XDGA 3OKYB 2M32A 3V4VB 1MHPA 2B2XA 1JEYB 3EH1A 2P28A 1MQ8B 3M6FA 1DGQA 1UEXC 1SSLA 3EGXA 2O7NA 3RAGA 4C2BA 1M10A 5KYYA 3AL9A 4UM8B 1FNSA 2VDQB 3BN3A 3ZDZB 3Q3GE 2XWJI 3NIFB 4JDUA 1YUKA 1BHO1 3EOAI 1QCYA 4O02A 3K6SA 3OKWA 5KYNA 4Z7NB 3AFCA 2VDMB 3VI4B 1DZIA 3OL2B 3FCUB 1ATZA 1QC5B 1LFAA 1JV2B 1ZONA 3NIGB 3AL8B 3T3MB 2I91A 1M2OA 2WINI 5KYWB 1L5GA 3ZE1B 5LN1A 2VDOB 4G1MB 3PPWA 3EG9B 1N9ZA 2VDKB 4UM9B 1U0NA 1U0OC 3HI6A 3T3PB 3K72A 4G1EB 4GZ8A 4UM9D 3EFOA 1JEQB 3EGDB 5ES4B 1CK4A 5KYXA 1MJNA 3EGXB 1SQ0A 4PN7A 1V7PC 1IDOA 5KYYB 2NUTA 1OLZA 4IHKA 1IDN1 1TYEB 4MMYA 1RRKA 4NEHB 5HGJA 3K71A 3K71B 4MMZB 4IXDA 4MMYB 1PD1A 1M1XA 4JX0A 1AO3A 4WK0B 1RD4A 1ZOOA 4CN8A 1U8CB 2VDRB 4IGIA 3GXBA 3E2MA 3ZQKA 2NUPB
chains in the Genus database with same CATH superfamily
2XD4A 1TXGA 5JXEA 4R6WA 4HNSA 1RR6A 5DYTA 1GRCA 5AVSB 1KEZA 3IBEA 3TH2T 4ZQEA 2EO9A 3WCYA 4W82A 1CDDA 2ERXA 4ZV4A 1G6KA 1S9WA 4O2BA 3GVHA 3PFKA 5E1QA 4FR5A 3I9LA 3L8DA 4D3DA 4P2OD 5JBNA 3ZIDA 1E4XI 1P4UA 3H87A 1RLIA 1NMXA 4XB2A 2MQ3A 4EG0A 3AKZA 5D7IA 5GRZA 2HQOA 3DOCA 4NQDE 3BH8A 3JWGA 4NUGH 2H6PA 2UWEE 1GKYA 3SYRA 1QUFA 1GU7A 2QQLL 4FGSA 1QVRA 3U46B 1BVYF 3R7RA 3DM9B 4ROTA 3LQAH 3HU2A 4DLLA 5INCA 4MNQD 2IHKA 2QTGA 5HHXH 3MBED 3MRJB 2VMJA 4DZRA 1UP7A 3AETB 3OLCX 4POYA 5F3RA 3BVUA 5HKLA 5FPKA 1NDUA 4G6MH 3UFIA 4AQ7A 2J85A 2XDQA 4PM1A 4LV8B 5D7LA 2OPCA 3PHHA 4YFEA 3TBWB 4Y1FA 3PDWA 4EZJA 3SBXA 3IUEA 4PRPB 3UMVA 4ZUWB 2P4HX 3TLCA 1C5BL 3LN5B 3QUZD 4MJ6B 1ZITA 2VLRB 5I19H 4ZO8A 4QTUB 3L0DA 3ZRSA 3WADA 4B6GA 3ZLJA 1SO8A 1JRHH 3S2ZA 2ZTHA 3QH4A 1OXUA 4W5QA 3D02A 3IVKB 1CG9B 2Z31C 2AEPH 1ZLUK 1DXHA 2H59A 3GJYA 1UP6A 2ZT8A 4F4IA 3I3DA 4INJA 1RULL 4IZIA 1PJBA 4LF3A 1QPPA 2VXSL 1VYTA 4RHUA 4YDNA 4YDLB 5CP7A 1J7VR 3P26A 2IX3A 5ES3A 3BT2L 4Y5XA 1YIDA 1H2FA 4WW2C 2OESA 1KELH 1FW8A 3LRLA 5L3RA 5F7FA 4CF5A 5E5RB 4IR7A 3ALPA 3BWCA 4LDCA 4DAOA 3HMQA 5DJ2B 3HM2A 3VFVA 3ARDA 4M5YH 1OWLA 1ZJZA 4JZOA 4J4BA 1CL7I 4R7TA 4F8TA 3QW2A 1Z82A 5E94B 3VQMA 5DUPH 3EFBA 1FBIH 3KKZA 2Y2WA 5HHNA 5FM5M 4RIRB 3NVMB 1B0ZA 4JKLA 5HDBE 2VGLM 1OTYA 4XUGB 4WBSA 2IEGA 2YIMA 4KN6A 5D2NE 3WLPA 3O9WC 5KREA 3KZNA 4BFSA 1X19A 1YJBA 4LL4A 4Y2DC 4MCIA 4LSSL 1MOQA 1XZ8A 2VHTA 4FMCB 4FXPA 3Q8XB 2YMXL 4US1R 3D2UD 2OB2A 3EGWA 4GXUN 4EHFA 4MKZA 1X44A 3D6HA 1BWWA 1QTIA 5F5NA 1P7QA 4PG4A 4G1MB 1KETA 2AHRA 3D52A 3W7BA 4G7YL 4M0MA 2FWLB 4GI6A 1EDQA 4XCFL 4UHCA 1S2DA 3E6HB 4LVOC 3CHQA 1VJDA 4NO0A 2CYAA 2IYZA 3HDQA 5IGXL 1KO7A 1QFZA 1BCSB 1G20B 4YPGB 3EYUH 5TF4A 4BO1A 5J1TC 1U8LB 3LWBA 3K1JA 3OEYA 5E2TH 2DCMA 3QIBB 2PZAA 2PUFA 5JXAL 3SQDA 1NLDH 4OKVB 2XCSB 2CFTA 5DQDL 3T7RA 2Z7WA 3KQYA 1A4XA 3FU7B 3WB0A 5FA4B 4CIDA 4J6EA 4CKCB 3K09A 1HQ4A 1P61B 4WFGE 1HNZB 3O0LA 2CHEA 4HCRH 1I33A 4HDAA 3N43F 1NYTA 2ZYWX 1H3XA 1LEGB 1VCMA 2PUEA 5C0GA 3CZAA 4TTRA 4DPMA 4NFDA 4UBIA 5K9KA 1L5VA 1PZSA 2ATPB 1P4IH 5C34B 1EFXD 1ZX1A 4U1KA 1UWXK 2EIKB 3AOEA 3DHEA 2N1BA 4U6NA 1AK1A 1JFQH 2O8BB 5EHFA 4Z4CA 3TTSA 2WB7A 1K92A 1R7RA 3PR1A 3CUYA 3QEOA 2JLUA 1VRSA 5L8JB 2ZI5A 4X64B 2PA3A 5JS2A 1VKNA 3BA6A 2XVLA 1HKLH 4RH4A 5JAIA 2XCUA 4D9FA 3CVWA 2BBTA 3IP1A 5ITBH 4YXFA 4WTZA 3EG9B 3RPKA 5A2BA 3I04A 4ZQGA 3P4XA 2HP4A 1SVCP 3VPCA 2W2MA 2QYHA 3HDGA 3L3OB 3UP6A 5DHDA 4L51A 1V5WA 4RPIA 4ORGA 1KYIA 3D6UA 4L4ZA 4KK9D 3KQPA 3ERCA 2AQ1A 1XVLA 2QTHA 5A3SA 5LCVH 4WEBL 1HE5A 2ISDA 1F1BA 2WQ7A 3SJ7A 4P57B 2B78A 3JY6A 3V4VL 3EJCA 2BIFA 2ZXFA 2F00A 4P46B 1YEKL 1SHYB 2P9FA 4GEGA 2WPDA 3RAFC 4N8DA 3F78A 3GMOB 4RIIA 1RRPA 3NWOA 2I55A 5DV9A 5D1QD 3FONA 3D0VA 2ZUQB 3TPCA 5IMKA 5KS2A 3IP3A 1V8BA 3LIZA 2JCYA 4MICA 1SFRA 3P2BA 3UXFA 2R4QA 4E42B 1E1NA 1QGUA 5EZQA 4YHNA 2J57A 2FMIA 5JU6A 4G0MA 4GRMA 1ZT7B 5F6IC 1TYAE 4IWNA 1QH8B 2VDJA 2C2WA 2PNFA 5E4IA 1LWNA 4W1SA 3FU5A 4UM8B 3L8MA 2JGDB 3IE2A 1KFEB 4HK0A 1GHTA 3PEYA 1AN9A 3LK6A 3AUSA 4M6NH 1ZM4A 4N0QA 1GSIA 1B0RA 2NVBA 5AFAA 2JNWA 3BKML 3OU6A 2MU1A 1A7JA 3ZC3A 2JBHA 4BA8A 3C2AL 3S44A 3U36B 3F0TA 3OAYH 3UBGA 1WLSA 4L0DA 4PEVA 4YCSA 1TIUA 4PGBB 2DMGA 4WZ6A 1AQYA 1GQSA 2DEYX 4HXAH 1BVLB 4L4TA 3I5UA 4GY4A 1E79D 4LL9A 2ZPAA 4CG1A 3P40A 4D96A 4YI3A 2GHQA 5I9LA 1SIOA 3OTWA 1Z15A 4NQZA 4AYTA 3LSOA 1BMDA 5I1KL 2SNIE 2J2ZB 2NXEA 1SWVA 4WZAE 3QVVA 4NC2B 1I1QB 4TM7A 2G1KA 2E6UX 1GYUA 1U0QA 2WC1A 3DVQX 5DD3H 5EBLA 1BS2A 4CMHC 1OARL 1FE8A 2ZG2A 3DV6B 3H3KA 4JXJA 1LYQA 3LUKA 3QU4A 2Z8VC 5IW8A 2IPUG 3NHRA 4MJIB 1PY9A 2N7SA 1EFAA 2PKEA 3LBFA 2H0AA 3N1QC 4UIKL 3C12A 1JZGA 2M32A 4UBOA 5KSBB 5F9DC 5JYCA 3BXZA 1UJTA 1TF7A 5KQRA 1FYVA 5E8NA 1U3HD 3F5WA 2YW9A 3I8SA 1N7JA 2BEUA 4RENA 1OGTB 3PP3K 4R2GB 4D45A 3JD0A 1F90H 3H9SE 4BQNA 2I87A 2AOVA 4KO7A 1JS1X 2F5AL 2E5FA 1WL8A 3T3DA 4LPYA 4TYYA 1IJNA 2FUEA 3JQRA 3DVRX 2LTAA 4WV1B 1JE1A 5A05A 3WX0A 1G8FA 4RTSA 1QLRB 4K3VA 4O4YH 1L1FA 4KH1A 3LQYA 3F7YA 3N8IA 2F43A 1NCDL 4LZWA 1KIAA 1MJ5A 2W22A 4Q14A 4FKZA 3LUFA 1P7VA 2IEAA 5C1OA 2A74C 1EVYA 5JPDA 3COSA 4E5MA 3FBWA 4G4SO 5A62A 2LW7A 1TMQA 1WAEA 3MUNA 1OLSA 5IQMA 4YCNA 5DHFA 2EQ5A 1OVZA 1W0JA 4DW2H 4CU2A 5ITWA 5DBIA 1T5SA 3UMFA 4H7EA 4HDMA 2ZOTA 4EZMA 1OTHA 5T33L 2KQUA 1SHSA 4PLJD 3CZCA 3BRFA 5AQEA 2H1PL 1BAPA 4XNUH 3WGUA 1I7RA 2IS1A 1BE1A 2X10A 4OSUH 2IDKA 3WNZA 4X5WA 3D3EA 4W5RA 1QG4A 2BJWA 4NZFA 5ESVB 5EEGA 2UVDA 1YCHA 3T77A 4MVJI 4R1UA 1G8HA 5BO5A 4EZEA 4R9RA 2BHFA 2WWXA 4PS4L 2OORC 5IAEA 1I3NA 5DJZA 4P8RA 3HFJA 4DCTA 5FIUA 3H9QA 4E1BA 4IP0A 1S2MA 3BXXA 3QC5X 6ADHA 4TMZA 2E86A 4TNWF 1VHDA 3BGVA 4BQOA 4PV8A 4MDFA 4ID9A 4DNLA 2VUUA 4TSFD 3GGCA 4Z1MD 3M3HA 1I3GH 3VPSA 4OZHF 1PIGA 1UXWA 3DKVA 4QBIA 5JMOA 4A16A 3D43A 1R6UA 4N1HB 1CDYA 2P2LA 3TF5A 5FPIA 4YHIA 1XL1A 1AMUA 5FV7A 2I65A 3V6BR 4FIDA 2IXDA 5K01A 3INOA 1K2DA 1IARB 5I76A 2FEKA 5HBGA 4GSXA 2FPIA 4WXEA 1WHPA 4ZMLA 3UO8B 1C2YA 5I0WA 5E4EB 4X6EA 2PZEA 1MY7A 4KR9A 3NTVA 4OM0H 3ZWOA 3ASZA 4Z3IA 4ZMSA 4Q6BA 5LQUA 1SXBA 4LNUB 3Q3GB 3DBRA 2OG2A 4L1DA 1T5DX 3G5AA 4K5MA 3L7BA 3QFCA 4XWOD 4PVNA 1F2TB 4KMSA 3OTQA 3X2FA 2WO3B 3UJ9A 4OQQA 4OM8A 1GRNA 4KJPC 5CD3B 5IJ0A 3OSZA 4FWIB 1DO6A 3DURB 3M9LA 1PDKA 2CKBH 4A2HA 3V1MA 2ZXQA 5DYGA 3H2BA 2ZR9A 4RMJA 3ZE1B 4AX8A 3P0JA 7REQA 2OMVB 2CGYA 3LBAA 3G59A 4KXQA 3O4RA 5ECYA 4DPRA 5EOQH 1DJOA 1CU4L 3HC3L 5G4MA 3BYTA 2W58A 1WPRA 1HL8A 5HDQL 3UAOA 3EHEA 5CVVA 2QKIC 1J86A 3F8SA 5BOJA 4MMXB 3MRFB 2R7KA 4BNZA 4LG1A 4L3EB 1IU1A 3JRNA 2P8LA 2CFIA 3B60A 1HN1A 4PG9A 4FABH 3G0HA 5F8RC 4V2UA 4QECA 5EHQA 1VCIA 2DLCX 1N2RA 4DR5B 1OCOB 2P4AB 3Q8FA 5B8CA 1YNKH 3HP1A 1KIFA 2YARA 1MRCL 2XOKD 2JI7A 1X1AA 4FEYA 3IXTB 4TL5A 2HLAA 1T1IA 4MAZA 5DW3A 3D05A 5T3ZH 1TCRA 2AG5A 1ENOA 4QPZA 3T99A 1YVUA 3MT7A 5BRZB 3E15A 2GYVA 2OXGA 5A2FA 2K0RA 4OQTA 3COOA 3EJUA 1AO7A 3GZ4A 2R1VB 4AM0A 1S7RA 1ULSA 4AK9A 2QHRL 2JLPA 3UCQA 2XNHA 2XMBA 2I03A 3RU9A 4BLRA 3UNXA 4LSTL 1U9CA 2RK3A 2RGCA 4HWBH 2F19H 3SBQA 4QTTB 1CLVA 1W49A 5L6YH 1PMYA 3I0MA 3REOA 3ETSA 5FWXA 1MW1A 2V0AA 3IX7A 1GCIA 2Y7OA 1J99A 3LNCA 1S9DA 4G5YA 2Q21A 3ZWCA 4R7DB 2XA2A 4JS7A 3PJFA 1X5JA 3LHIA 4YE4H 3Q5OA 4EK9A 3PWTA 1ZWLA 3GFBA 3ROLB 4LJSA 1OWRM 3VYPA 6CHYA 3JXEA 1CDUA 4A9AA 3DUUB 3Q48A 4ZI7F 1VI6A 5ALSA 3UG6A 5DZAA 1IOLA 4AL8C 4N1CA 1JNJA 1YE5A 1U36A 1T2CA 5B3NA 2CK0L 4X1OA 2YMQA 4RS3A 3EMBA 3C5ZB 1DUYB 4Z77A 3M6DA 1BHSA 1WZCA 4KWCA 3C6KA 3DMHA 1AGEA 1ASOA 3ELUA 5GSVB 1BFVL 4MOWA 4RANA 1TOXA 4NDZA 4DSTA 3QI2A 3DBXA 1XKXA 1OXSC 1BEZA 2QL9A 2W8BA 1T80A 2I2AA 4ARBA 5CYFA 2BCKB 4KVFA 1EHYA 1UWYA 3GINA 1FVXA 3MLXH 4QDTA 1GGUA 2V2TA 2H7XA 1W6UA 3LZFL 1PD6A 4YH6A 4NZTL 4AYMC 1VRWA 4WKXA 1E4EA 2PX0A 1SA0A 4PPNA 4E7OA 1FNGA 3IR5A 3AB3A 2UZIR 5TX7A 2XRMA 2OZPA 4RISH 4PJDF 3SJCA 3WJJA 2JFWA 3PEVA 3KGTA 4YHPA 3SZGA 3NJHA 4LMQE 1BBDL 3RHWK 2DFNA 3WZMA 2C1OA 1MOSA 4X6YA 2YBEA 1DRVA 3F58H 4IKJA 2H1HA 2NTYC 4KFCA 1PQZB 4ZQIA 4HVLA 2ZDHA 4HETA 2Y9MB 1L5GA 3N28A 1AS3A 2CL5A 2JL1A 3WSQL 5I17A 2JA2A 5A2QA 2WWNA 3THOA 3VC3A 1EIZA 2HXYA 4JT9A 1CJYA 1EXUB 5G3YA 3ROKA 5D2LE 2CR0A 1WUYA 1FVOA 2DCUA 2QTEA 4Y4FB 4HWZB 2X0FA 3VRIA 1IUNA 2WAAA 3R44A 2PZ8A 1Z6AA 3FHQA 2CHFA 2HJFA 3UO1L 3PUUA 4BNTA 2YVQA 2NXWA 4P9HH 3N86A 2AKRA 1RP9A 3OSKA 3P9PA 5MERA 3ZI0A 1J0YA 1OD9A 2MSPA 1ZD5A 5C07E 4TL6A 3DAYA 1MCRA 1K72A 3ORYA 4OGLA 1R5VA 1J05A 4QWWD 2C1EA 4IIBA 3OT1A 1T6NA 1KY6A 1EZVX 5E6ID 4IKLA 1XVUA 5AJVB 4BUZA 1DRKA 2OXFA 4U9UA 2D4AA 5BZDA 4QLBA 5BNWA 1ESOA 1XMOB 5T3XD 4F15B 4AJWA 4E2YA 2YD1A 4Z99A 1E8YA 2VHYA 4Z7UF 3EYUL 4X7EC 4ETMA 1KCRL 3K73O 5E9WA 5HG0A 3ULVC 2X88A 2C5AA 1G59A 4LSRH 4QUJA 1NOLA 3ER9A 4Z49A 5CXUA 3QUMB 5F70A 5FK9B 3WJLA 1YBHA 1YHZA 3LH5A 4Z1PA 3UBTA 4BUQA 1HZZC 3PWVB 1H2HA 2WZPD 2FQXA 3WFHA 1RUML 1MCJA 4H26A 1QC5B 4NCDA 2P1DA 5LAPA 4NS4A 5JOPE 3NT5A 1E3MA 4JVOA 1LA2A 2HPZA 1DFBL 1BXAA 5HZHA 3N6RA 1WWAX 1H6EA 1I8AA 3D6FA 1XTQA 5E9AA 3FH5A 2NY1D 4F37F 3EGXB 5E2TL 4XHQA 3RVUC 1RMYA 5JZBA 4CDHA 2WJGA 4EATA 1C0PA 4JR0A 3FGNA 1OASA 4YC2B 2FIKB 4NQDD 2BIHA 5DK3A 3GSVA 3ICWA 4D26A 1QKZH 4PTTB 2Z9CA 4HLZG 1A2KC 1JZFA 1DLFH 3MRIB 1QUEA 1Y3FE 4TTQA 2DWDA 4EO9A 1CR9L 1UOWA 1ZRHA 2EECA 3IMRA 3C7CB 1MC5A 4C4XA 1QO3A 3EC2A 1X5ZA 1M9WA 2A35A 4DB4A 4IHJB 4FC3E 5DI3A 4GVPA 4V03A 3FMGL 4P5KB 4UQEA 2VYVA 2O48X 2YZKA 2P67A 1L0XA 5D9SA 3RNKB 1FSFA 3AVPA 2PYFB 3FUHA 1SZPA 4I4NA 4R1OA 1OSZB 3G2IA 2EEBA 3P0IA 4UULA 4H4DA 5D7JB 3IT8D 1C0LA 5LCVL 2BHTA 3B1WA 1M7UA 3HGTA 1E2KA 2VTDA 3VFWB 4FWTA 1R0WA 1I36A 2FZWA 5AB9A 4LN1A 4HN2A 1FDOA 4FFZA 5KS9F 5H16A 1U04A 3WKML 2EAUA 1QSFB 3FSGD 3RQIA 1JV5A 3NBKA 1TJIL 2I6XA 5JROA 4YUWA 2Z4QB 3ZY6A 2OY0A 2I4MA 3GDBA 2X5JO 1CD1A 3QA3A 4URXR 4U1JB 1RZVA 1T4GA 5E6IA 1Z74A 2V7UA 1MA0A 4JB8A 1E9QA 4J16A 1JZSA 3I2YX 3O31A 3G7UA 5CGYC 1FRNA 1G4UR 5FHAL 3GNTA 1H8LA 3SGKC 2O0KA 2VERN 2UUDH 4XJTA 4B2PA 3ZSTA 1ERNA 4XYGA 1SC6A 2O57A 5H3LA 5K0LA 1EGVB 4OJDH 1RQRA 5TARA 3QSKB 1WD9A 2NZ2A 5C3IA 4WI4A 1E9SA 4N2GA 4LSQL 4BAZA 1EP3B 3P9KA 4MJID 2AJZA 1P3DA 1TJIH 4BU0A 1FU7A 3MBXH 1UODA 4X8HA 1P4RA 3CR7A 5ALCH 1QORA 2VJOA 3U6RA 2V3WA 1C3EA 3U61B 1SCAA 1CB4A 2PR4L 1AGXA 2H2FA 1ND6A 3ER8A 2VDWB 1E7YA 2PTHA 1NJSA 5KMGA 3KLKA 4GVXA 3PKIA 1IM9D 2WVGA 1YS7A 4Q2ZB 4IICA 2AK4D 1VYUA 1CGVA 3L1EA 1UMKA 5CR1A 2I99A 1YEDB 1HTYA 3WK8A 4PNHA 3H1TA 3NGLA 1JXOA 2A6IB 3O91A 3HMXL 4E9LA 5I18H 1QO9A 1YIOA 3I5MA 1E9VA 4YRNA 4XO3A 5B39B 5JD4A 4LSQH 4YHHB 5FBHA 1GKEA 1WJGA 5EEHA 4XDGA 5KVGE 4G6AC 1QBGA 1EK3A 4CKBB 1JJBA 3MXOA 5C81A 4W1QA 1A0OA 5FTMA 3R5KA 3G17A 2DT8A 3G2MA 3T7TA 3KKNA 4CIAA 4DV7B 3AXLB 3BD3A 3BA1A 4PU0A 1SCUA 3BESR 4JM2B 5JISA 4U6SA 2FFHA 5KHAA 1LGYA 3DWTA 4EB3A 3QU2A 2HM7A 4PWHA 4QDXA 3TVDA 1CE1H 1EU1A 2WIBA 3HRIA 1WZ1L 1LWJA 1CUXA 4ZMXA 1DAEA 3QHFH 1A0QL 4HZUA 2CLIB 3RAJA 3BXNA 1F90L 4OFQA 3EXIA 1X14A 4YDRA 5AB0A 4GP5B 1EM6A 2VYNA 4M5SA 4K9MA 3GMPB 4DAEA 2QPAA 3KYAA 1V16B 1WB4A 4KX7A 5BYKA 4KO3S 5CFRA 2CV2A 3GRWL 4TWRA 2QR5A 1KEEB 4GM4A 3DB1A 3MWLA 4NFSA 3YASA 3VD5A 5LQAA 3GMQB 3QCVL 1TF4A 4ERNA 2J8OA 3B13B 1AS6A 1UH4A 4QRQB 2DQFB 4ND8B 4NYLB 1B6SA 3U6KA 3PL6C 3EYQC 3QUBA 1I9JH 3HAEH 2Y0BA 5G4LA 3IDMB 1XTRA 1XZHA 3NN8B 4YHLH 5JOPD 2PLTA 4ZVSA 5GS2H 3N7TA 4QWWA 3QFJA 3RG2A 5LLDA 4LGYA 1A65A 4XCYB 1PVHA 3NCJH 2I91A 4NKMA 3DP7A 4OY3A 4MJ4A 4TTAA 4DR4B 3FW1A 1U0FA 5LP6B 3AK4A 3ZLVA 3NDZE 2IT1A 2QDWA 4KP7A 3JS5A 1ZPLA 3HMWH 4LWOA 2F59A 4UNNA 3EUEA 3U0VA 1MCQA 1IJBA 4IBQA 2VYCA 2F19L 4QCIA 3F5MA 4BKRA 3PHBE 3QPCA 4FLMA 1BFUA 3VACA 3NEPX 1GR0A 5C7YA 1B2LA 4JJ8A 5AW6B 1AAJA 1L9KA 1U1EA 1KRWA 1I4TD 3GLIA 1SF3A 2C03A 2LWIA 4NP4L 1XTJA 1GSMA 1N3YA 4QT0A 4HX1A 4FX2A 2G5PA 4PYNA 1TQCC 4IK7A 4FNQA 2K3HA 1JPGA 3AKEA 3GMNA 4GVLA 4BLOA 4ZFNA 4PRIA 1ZANH 3F2IA 3FFOA 5IT0A 1IBYA 2C1PB 1FFAA 1TTAA 5IBUG 2V7BA 1AKTA 4QTZA 4BJ1A 3PWNA 3HDYA 1QS0B 1W2GA 2WIIB 5F1PA 5EKUA 3QWAA 4DQLA 3EEYA 1GVHA 3PWPE 4LOLA 3P9MA 3U7WH 2HKFL 4ZAKA 1RZIB 3II1A 4Y2DA 5DC9B 5LXGH 4I4WB 2JCBA 2R83A 2EXWD 2BWJA 4RBNA 121PA 4BE7B 4R4JA 3COWA 3ZHDA 5AKKA 2ZZMA 1KXHA 4E9TA 1ITZA 1KLFB 3G04B 1SIWA 4IBOA 3LVTA 3IUSA 2OLEA 3T5TA 3T4AC 5DYYA 2PP7A 1MCZA 3UPUA 4OZGF 1Z6TA 3CCHB 4JFEA 1Y81A 4CM5A 2IQAB 1DP4A 1FP7A 3T5BA 2CLHB 3QJRB 5BV0A 4QRTB 5FKAB 1E0SA 5IVZB 3ZW9A 4HUXB 3GT4A 3V7NA 2NVWA 2QVXX 4YX2L 3H84A 4ONHA 1QCCA 4EXPX 1TTFA 2XKNA 4CTKA 5TQ2A 4MB1A 2RH4A 1AQMA 4TWAA 3G6DH 1RM0A 3D3VE 2VTBB 1E58A 5TMBA 2RCSL 2PO7A 5JYBA 4LOVA 1E2WA 1HI6B 1ONSA 1PBYA 2BM9A 5KSAC 3KR9A 4RFVA 3WXMA 1ISJA 3NA4A 5D8JL 3HA7A 1HPLA 3W9EA 2VKQA 4WI9A 4IHJF 3QZWG 2HSZA 1YR3A 2CNBA 3PDGA 4COOA 4RKQA 3NT0A 1CUIA 3ITEA 2K2WA 3LKZA 1YHNA 4H25A 3QX7A 3QX9A 3TSCA 3DTVD 4BKTC 3ZXAC 4U3SA 2RC5A 5JMPA 1Z5VA 1ODSA 4HZLA 3PICA 5DUML 4EHAA 1H1DA 1U8HA 3U4BH 1XXFC 2AKEA 2YUTA 2D7MA 2VDML 3NUQA 1LQBC 1K6QH 4G65A 3QLTA 4S0ZA 2YPKB 4RLSA 3MVEA 4GPAA 3PHOA 4HT1H 5T6BA 4BGDA 4IUCS 4KXYA 5IXJA 2J3LA 3WJ2A 2G75B 3M3DA 2MTAA 5T3ZL 2L04A 5K3AA 2AXGA 2FW6A 3RVOA 1SIBE 2CE2X 1QVAA 3OG6B 2PQ0A 1AD0B 3EDDA 4PJAF 2DFLA 3ZWQA 2IFGA 3UG4A 1HWHB 1UBGA 1V7QA 3EA4A 3FR8A 4GM0A 5I73B 2W88A 5AOBA 4WQOA 4WDIA 2YZMA 3QYPA 5KJ7E 4CF6A 5FUCE 1I80A 3DK0A 2L0DA 4LW8A 2X2OA 2RHLA 1BTOA 2AQNA 3C3JA 1NMAL 4S2UA 2HMYB 1IKOP 2Z3VA 2IV3A 4RXTA 5E23A 3Q9QA 3QWIA 2X4TB 5FCUH 1MQAA 5LBIA 1GGHA 4L22A 2C8JA 1Z4IA 4BJ6A 2JCXA 2A6JB 4D82A 2Q2QA 1GCFA 5HGAB 3OZCA 2QUKA 3DGFC 1T4KA 3K32A 1LF0A 1P9NA 1B7GO 5IM7B 3OIGA 5T5FL 2ZG1A 3HG5A 1UBCA 3D12B 4XMPL 5F77A 4XARA 2NY0D 1Z5PA 1NURA 3LPOA 2FW0A 5C0DA 1I2BA 2G3ZA 4H1UA 4UQ3B 4ZTEA 2AJTA 2W59A 3RUHA 5LWHA 4B0MB 4ODVH 4PJ7A 4ABYA 1FA9A 4PHZA 4P4GA 5FUQA 2BL4A 4LCYA 4P81A 5JPNC 1OLXB 3WD5H 1VL0A 5AW5B 4YDSA 3WLFA 3GHYA 2ICES 5AHXA 3FJYA 4P98A 2R23B 3GQFA 3H75A 5FFNA 4NFHA 3T2QA 1XMQB 1DKMA 5CFZA 4N9WA 4JPIA 3GLKA 5GISH 3AG4B 1U1IA 4DCUA 1E92A 3TL2A 1WP4A 3UUWA 1EI9A 4MAYC 1C4XA 3CO5A 1R8XA 1KE2A 1QDLB 1CXIA 4TQAA 1NL0H 2DQ4A 1A4BA 1AH1A 5BVGA 5K8UA 2P4EA 3M1BA 1GPKA 2VUIB 1L7AA 1I32A 3PDIA 5TGTA 4PN3A 2DQTL 1D5RA 1P44A 1YNLH 2TMGA 2JLCA 1GFSA 2YPLA 3K0AA 3PJDA 4HQRA 3ES9A 1WZEA 2RAUA 2FO4A 3UKOA 2PA0A 2QL7A 1UBOS 4OH1A 1G3UA 4U6TA 3D6TB 2XUKA 2FJUB 5IHPA 5CB4B 3BGAA 3ZK7A 2WP0A 2ZUWA 3L3OC 4BRUA 5E9DD 4KOBA 1A7OH 3PDHA 1Q0YL 1EGHA 1K6MA 1SBSH 2PPDA 4NJMA 3KYDA 1L7RA 1QIKA 4D4HA 1JLMA 5AKVA 1EQUA 2YIHA 2DMKA 3V9PA 4EOGA 1QUPA 4PYHA 1NUUA 2IS2A 2H2WA 3HFRA 3V3TA 1E27B 4JVNA 4JFEE 1K4MA 2X42A 4P7BA 4QEDA 2A67A 4XM0A 1Z88A 3NCMA 3HS0C 4NJ9H 4B7LA 4CRWB 4LSDA 3KB8A 1C8PA 5AVKA 4KKBC 4JFYA 1BEXA 3BZEA 5IOKA 1BW9B 5THQA 2AG6A 1PQWA 2QADC 5K0FA 1XTUA 4HGKC 2BEKA 1FHGA 4G97A 4KQHA 4XCQA 4RDCA 2ZJSL 1O6FA 3PHQA 3AU8A 2VP4A 3C6ZA 4OSPA 1M7GA 4DQKA 1ROWA 2AQSA 1J49A 2C9QA 2ITCA 5K8LA 5C0CB 4ZTOH 5BW5A 1US8B 3OPZL 3AL2A 3QU7A 3PLYA 2FWNA 1HDXA 2H48A 5DWUH 3ZLTA 4H4NA 2V65A 2EKSB 4UNQA 4B5ZA 4RSMA 1OALA 4I0PC 3IDUA 1ILSA 2D2IA 5F76A 4MVBC 4RRPM 4CGTA 3SCZA 3PDOA 3NOXA 1XQVA 4IQ0A 4L8DB 4GRWB 4OLXH 3HB0A 3NMEA 1XAIA 4W99A 1I7TA 1JG3A 1TEXA 1BCIA 2ZIFA 2ZYRA 4MB2A 1TMYA 5GGSA 4ADGA 4KIGA 3Q5YA 4A5SA 1S7XA 2VJMA 2F1BA 1KR2A 1OT2A 4U7KA 5SWZB 3PHJA 3H8VA 5HI3C 4ODUA 1OBOA 2DPKA 1ICTA 1P18A 3AYXB 3KFXA 3INUL 4G6KL 4LYDA 4O5AA 1FAKT 1JHQA 3URMA 3QNXA 3KKQA 1W72B 2Y1XA 1RT9A 5AW4B 3HG0A 1R5NA 4UTAA 4CMIA 3LSTA 1QO7A 1TF2A 4GZ5A 1AJ7L 4M9SA 4EA6A 4WENB 5I16B 4IX9A 3SJVA 1P1RA 2BUBA 2XCIA 5AKGA 2NCMA 3Q7RA 4H1HA 2FGJA 3F3KA 4OP3A 4I2XB 3MB8A 4JLMA 1TECE 4TS3A 3PK0A 4OGAD 3WXVL 1CTMA 3PF8A 5EIFA 4IDOA 4NBUA 3MROB 4EPRA 5A40E 1QRDA 3F4LA 2HRCA 2FX8L 1TD1A 4IOJA 2OBLA 2NY4B 4DQAA 2BLNA 3EBAA 4NJEB 1GUDA 2AI2A 3L4WA 3B2QA 1U9IC 3RG8A 1XGTA 5KPDA 2X09A 1GNTA 5HKKA 3D69B 4KFTA 4CE6A 1K8ZB 4L08A 4FN0A 4XP6H 3HS0A 3HYTA 3KYCA 1FH2A 2AC2A 1OSPH 5TGBA 1XXLA 4OQNA 4CLRB 2LTQB 4U1GB 4RGOL 3KQOA 3N1PC 3DZHA 1K3UB 1YA6A 5LKNA 5JW4R 4KTEH 4BQ6A 4DCSA 2VSQA 4AGNA 2VRKA 3ZTNL 1P9LA 4MA7H 2H57A 4Q24A 4PTLA 5B4VA 3BERA 2BY0A 2NR6A 5I7AA 2FDBP 2C77A 4ZFQA 1TLFA 1IVNA 1Y8QB 3OOHA 1MENA 1Q3KA 3EWAA 4QLAA 3KLHD 1YC7A 2C83A 3D06A 3S8MA 2MOGA 3T0IA 1FNEB 3WTWA 5AW9B 3X2QB 1B15A 3L8YA 4N76A 2YR3A 1MAVA 4P4TA 2BHZA 1L4FA 4MCZA 1YGPA 3CLUC 5EZLA 4FDTA 1A8JH 2FATL 1R18A 4NZUH 3BUYA 3GCGA 3QPUA 3VGJA 5GTDA 1VYHA 2X3YA 2XA3A 5G4KB 2JW5A 2R96A 3K9CA 1SUPA 4EDWH 3HNSL 3M86A 3P27A 3U1VA 3E5RA 2J08A 5I0ZA 3ZHQA 3AG5A 3OJ2C 2JJYA 4ZTOL 4LTMA 2AG8A 5HDBF 5EU6D 4JBYA 4TUOA 3T54A 1O08A 3PBKA 1E1CA 1IIBA 4EN3D 2DUNA 2AXWA 1UBTS 4UB0H 5KWIA 2GBLC 3MJ6A 5FLEX 2XYCA 3ELAT 1T20B 4KQ6A 3G1TA 4ANXA 3PITA 3PIQA 4UTRA 1IPEA 3BJMA 2WD7A 1LDMA 4S12A 3ULUC 5E7QA 1WTLA 4U9IS 5K0JA 5TPZA 1HT0A 5ILTL 4HKXB 3LKDA 2GBAA 4TF4A 2CBTA 4FNAA 4KH0A 2JJMA 1A1SA 4JI6B 3HI1B 5E2VH 4LHWA 3GSWA 3ZVKA 2L17A 3Q2VA 1B8PA 5JBIA 4GKJB 5TPWL 5ADPL 3D50A 1S0UA 1JDJA 4FZJA 2A9CA 5I66B 2Q0QA 1EEYA 3N1GC 3VI4A 5FI0B 2Z34A 1HQRA 4N3UA 4Z9XA 1U0SY 5FYKE 4EQZA 3OR7B 3ABLB 3LZQA 1I7DA 5HCNA 2BSQA 4FXGB 4OX9B 2BNQD 1ZRMA 2B6HA 3PV6A 2A92A 4KUCD 1MQ8A 3KL5A 2HJGA 1AGDB 1VP9A 4LSSH 4HJGB 2F3RA 4XNDA 4QEKA 4X85A 1MPXA 1T8TA 4V0ME 3S27A 1CFNA 5KO2A 2CIKA 3KSZO 1J8VA 5CPFA 4TV9B 4RPJA 2VNAA 3VAAA 2O2SA 5DTFA 3T3OA 2FCRA 4ZK8A 1FEZA 1KCLA 3FTSA 3V6FA 1Z0IA 4NBXB 5WRFA 4PYGA 5IB3B 2BFPA 2GUOA 3BH9A 3MRGA 3PGCA 1B6TA 2HJVA 3WGKA 1BZ8A 1BJ1J 1JXDA 1YYLH 3DTNA 2M1ZA 3LW8A 2Y1OA 3QQDA 4JVWA 5IGXH 4MA5A 4JXXA 1E98A 1SC3A 1UK9A 2VAVA 1JBEA 2OCDA 6TAAA 4O0MA 3GVXA 1H19A 1UCFA 3KPSD 4MYDA 1YXMA 4AEHL 4KNSA 8ATCA 2VYQA 5D86A 3U6XS 4J3OD 2ET6A 2B2NA 2PZGA 2Z0BA 5DGTA 1WABA 2KPWA 3L0BA 1NUAA 3M5DA 2Z5GA 4C0QC 4UTCA 4WNJA 3DTVA 3W6ZA 1LEKA 4M43L 1GR1A 2UXTA 4Q6IC 3MJ9A 1TO4A 4PSUA 4LSPH 3CDFA 3L2OB 4GUPA 4R97C 4ZAYA 4JFPA 2W2LD 3V00A 4KI5C 1UD6A 3QFFA 4CODB 3AM3A 3WGVB 1OXBB 4E41B 4IIJB 3L3KA 3HB7A 1JPNA 1ZH8A 4DKDC 5DR5H 5L7WA 3SZOA 1SC9A 2PWPA 2P7IA 4UQPA 5L2JA 1JR6A 2EVHA 1CUZA 4F5EA 3QK0A 1WA2X 5FL7D 1H6FA 4FL4C 3B9BA 1SN0A 2CDRA 1SXQA 1ZN9A 3GMSA 1LP9B 1Q1JH 6PFKA 5C09D 4ZMBA 4A0FA 5AXDA 4QUIA 1S1MA 3MLTB 1F1DA 2YZ7A 3CBRA 5KTOA 5BXFB 1P0CA 2B2CA 5IFKA 1X80B 1SXCA 3OC8A 3FUTA 1P80A 4OQPA 1MNAA 4QM7A 1KHTA 3L02A 2NNAB 3HB3B 4XVHA 1BFOA 1DCMA 4WHMA 2AKYA 4PLKC 2C3VA 3SN6A 2YQ5A 2HX9A 1Q0RA 1G38A 1PX2A 1TUBA 4DH2A 4R4BA 3Q9PA 3GLAA 3B2MA 1XEAA 3UK2A 3UADA 5J23A 3D6JA 2Y1KA 3CFEB 5D5PA 4JX8A 5F7YC 1JLHA 1L6ZA 4TTDD 4EI6B 1N5KA 2V7TA 2VWEE 4NR0A 1FVCA 4WJG3 2WTNA 4R2MA 1U2CA 2BZGA 4LXUA 4OUKX 4X5LA 2OZVA 4MAYD 2XVYA 2HKFH 2QORA 5DMIH 3MACH 4N0RA 4I89A 5DYWA 4YMHA 5ALRA 3DXAD 2C0QA 5HM8A 3OHMB 4CEHA 2PWEA 1Y9DA 2CO2A 3T1YB 3HNOA 3Q0IA 1EGJL 1FUKA 4N4AA 2QJTA 2W6JD 1KEGL 5AAWA 4P23B 5EPUA 2YV1A 4FKKA 4GKLA 2VISA 3IJSB 3NBAA 3LQMA 5MEOA 2VDMB 4NERA 3A4TA 3DTXB 1M71A 3M5PA 1LNSA 2XB9A 1GIGH 2FQEA 1E2DA 3VGGA 2D2EA 1F7UA 4GECA 5EXPA 5DWVA 1L7IL 4TVPL 2O2EA 5J57B 3IPYA 4QRRB 3BISA 3OY2A 4JFUA 2Z8SA 2X8AA 2DUMA 1USUA 2K7ZA 4G5RA 1X1QA 3P0EA 5DI8B 3A6LA 3DMPA 3PXJA 3R06A 4M21A 1YPZF 1UFRA 1KI3A 3C6QA 5B7QA 4DREA 2QAGC 1X8XA 1OLLA 2Q5BA 4HLZH 3HBJA 1YDPA 2YMOA 4DGVH 1P0SE 2QGZA 1THAA 4MQLA 3PI6A 3FTGB 2OMYA 3S3TA 5FL7A 1NF2A 1FZJA 1L4NA 4JB9H 3N39C 1VCOA 1RZFH 4F4JA 3V6OE 4WT7A 3Q11A 4OB8A 1AGBA 4CF3A 4RVOA 1QFUH 3HBAA 4JP2A 1JYSA 2R1YB 2MJWA 1FTWA 1K68A 1I9JL 2ZXCA 4DNFA 1SHWA 1CUGA 3G9AB 2FLMA 4Y9TA 3R7SA 3M7OA 3GK3A 2CWRA 3NTCL 2NZJA 2DYRB 2QW8A 3TBSA 4UUPA 3PPYA 2ARJB 3RVXD 3ZE7A 5HYSB 4NUGL 1IPHA 3MSXA 1PS0A 1JGDA 3EFEA 1RZKC 1PZDA 1KNXA 4G9EA 3Q8MA 3RFRA 4H7JA 1KB5A 1EZUA 4L8WB 2AFRA 2PEYA 2XIJA 1LK3L 3LECA 1XR8A 2N42A 3T9WA 5JQHC 2GHIA 1BXRB 1RAFA 2QD2A 2C3OA 3S40A 3G6WA 3GXOA 3R5XA 3O3OB 5AK5A 3U16A 1RI5A 1T9KA 3KAQA 1S3KL 1E0OB 4HOXA 5D55A 2SECE 3MNWA 1NC4B 1CQJA 2J5LC 3SR0A 4N4YB 5AKHA 4D2IA 3I9FA 5BNTA 4TYUA 1F3JA 5EU7E 4E9SA 4HDRA 4NHUB 4NGHH 1NW4A 1J48A 4GUOA 3E2MA 2JFCA 1IGFH 1ZHKB 4K86A 5J56B 3C8DA 3GLRA 2V0GA 1I7NA 1IQ0A 1LQSR 3MBEB 2XVAA 2OW7A 4Q4EA 4MUEA 3KM2A 2WV7A 4MZ2A 4Q6KA 4U6YA 4NTZA 4AYFB 3NCCB 1R6TA 4YUEH 3F8WA 1BA3A 2FUG1 1IT9L 5HMMA 5JYLA 1FFDA 4HJXA 4G71B 1KXVC 1B16A 3U25A 4RZCA 3G6JB 1MLCB 2EJCA 3MZ0A 3LJ3A 4AL8L 3GARA 3SO3B 1MJGA 4BC1A 2BIPA 1YR8A 3BK1A 2H1PH 2E8ZA 1I1AD 1R6VA 2PCPB 3PYXA 4RQQA 2APFA 4OCLC 2DQTH 2W48A 3SSOA 1Z6YA 3B6SA 4JBXA 4OHKA 5HJ3B 5FXMA 4HJ0D 1PKEA 1TU2B 1L9NA 4FHCA 3EO1A 1MELA 4IRXA 4G43A 1Y6ZA 5CIQA 2R2EB 1QG0A 4RETB 5CLJA 2WHQA 3ZCXA 1A9PA 3T7EA 2Q4EA 2BWIA 1QFPA 1OY1A 2LIVA 2QQKH 1CL7H 4JAMB 1EG2A 2JKSA 4HS4A 4E3WA 3KPRE 3NCYP 3V10A 3WKNA 2FSVC 2YWHA 1Y7HA 2GJZA 3T4XA 1J8QA 1FNDA 5F3HB 3D7LA 1ZT1B 4JB0A 5EESA 1QVVA 4ZXFA 1BVHA 3F4KA 2F1RA 4I1UA 4MV9A 3MM4A 1MWAB 1X5AA 2VLJD 4FQLL 2WHPB 5L51A 2ZCJA 5FNVB 4MA1C 3MDJA 3QXDB 2PXYB 4KMMA 1NTOA 1YNKL 4RA9A 2PT9A 3IC5A 1GCUA 1L5MA 1HEJC 3R5HA 3WNOA 5AOJA 3GW8A 2CO4A 2NSYA 3WWEA 5IYZA 3S2SA 3QG7L 4P2RB 1XF4B 4MQTB 4IKNA 3KHUA 1ZAYA 1BDHA 4ABWA 4B27A 1JB1A 2MR5A 5LUBA 4JZJC 3GLZA 2VZUA 1UD5A 3GIZH 2V5TA 4AXWA 4DCOA 3UTOA 4DCCA 5TFSH 3KYBA 3HY3A 1FTSA 5EEXA 3EXHB 3X3GL 1T29A 4OFKA 2A5DA 5EFIB 4PGAA 4PJHA 4UTPA 1QJCA 1U8UA 1MKFA 4YI5A 4HUWA 1HYSD 1SQFA 2VE6B 3ETTA 2O4UX 5GM1A 4ZOLF 5J1AB 2CALA 4BLPA 3U0PB 3DOSA 3OWXA 2FAXA 1B4JL 3B1YA 2FB9A 2YK1L 3VYOA 3UT6A 1AXSA 1NJ9A 3OCUA 4JBLA 3D4YA 1I3OA 1AD9A 5J0BA 2J56A 4WW2F 1E2NA 2FRXA 4IHOA 3E3QC 2GRAA 2BEVB 3RVMA 3O47A 4R8LA 1E4XH 1RWBA 1KUMA 3V4VA 1KP9A 2GKGA 4NQEA 4W6XB 3H2QA 1DL7H 4IXDA 5ALQA 1Z66A 1LO3L 3EC1A 4PYRA 3TOXA 4O4JA 1GKKA 1KY2A 3H65A 4NNPA 5AK6A 4K2AA 1CZNA 4DY4A 4F8NA 5HKAA 4UV7H 2HVKB 5KX5A 3EVAA 1QYDA 5JOFB 2XT6A 2Z3WA 4B4WA 3DDNA 5KQMA 1EE9A 4YDQA 3PJEA 4FLHA 2ZOKA 1VBKA 2XMRA 1T0UA 4BZPA 3HC7A 3ETNA 4JRXE 5B1EA 1INQB 3VWJB 3OA2A 3WWDA 4NULA 1XCPA 1AZRA 3H2ZA 3IP6A 4G67A 3L5KA 1XEWX 1O5OA 5HHPA 3NVKI 2YEZB 2EX4A 2PTTA 3O4IA 5CO1A 5ICUA 1E6WA 4C0KA 4X63A 5DBEX 2MYUA 2J25A 4AMGA 5I75B 4WZAB 2UZYB 5IVHA 5CR9A 1JDPA 1VA4A 4P3NA 3Q2KA 4YPJA 1KTKE 3LKNB 3OHXB 5I1LA 3MQ4A 2V6BA 3SF8B 3FU8A 4A6PA 1LP9F 1X7XB 3OHXC 4HFNA 2ZM6B 3EBLA 1ACYH 4D4JA 4RZKA 1DMRA 3WGNA 4W4OA 3RJMA 5ESAB 3P3UA 2YC2C 4ENZA 3MAWA 1CEQA 4DN4L 5HVWA 1DE0A 3HDVA 1SXJD 2PBFA 3FYEB 1VPEA 1K5NA 4PWFA 3BRDA 5D7KE 3WS3A 4IJMA 4ZC8A 3ARPA 3N8HA 4KRPD 3W3AD 3VH3A 3ESOA 3K5WA 5GAJA 4RQTA 4YC2C 3SQNA 1EJ8A 2NTEA 2Q6KA 1VIAA 4XRCA 4RIHA 3D8RA 4KVNH 1A9XB 5LP1A 1BGXT 1L9PA 5ENWB 2NY6B 3IAS6 4OI7A 2J0UA 1BOGA 4EDWL 2PSDA 3BO8B 1J5PA 1R0RE 3O4JA 3TZVC 3PNVA 4RGNE 4U3CA 3QI9A 2LFEA 1NEZB 3V1LA 1U7PA 3X3FH 3PC3A 2AK2A 3QMVA 2QNRA 2VQSA 4WEMB 2QUIA 5ADHA 5B5SA 3WYNA 4B6ZA 3ZE8A 1TZOA 3KCPA 2JLVA 3CINA 5IW1A 3IAQA 4MP6A 3N8KA 1JZ4A 4D4IA 1KBQA 5HF6A 2P9GA 2Q5FA 2Y1CA 1GPH1 3I61A 5ILTH 3N2KB 1A7NL 5A1TA 4Q9IA 3WYEA 1PL0A 2NU9B 3EOBB 1AZLA 2JJUA 3E7FA 2GCNA 4QXAA 4F6RA 2YZNA 5E7BA 2J9YB 4DN6A 4MV3A 3R5FA 4NNYA 5AVRA 4DV5B 5B3JE 1EEUA 1E0KA 1GCOA 4GI8A 1A64A 4GRWF 1YZTA 4WIAA 4MINA 3QCUH 2DLEA 4YREA 3I8XA 5JTTA 1B0PA 3BHJA 1L5HA 1CS4C 3QNWA 1L0PA 1P5UB 5E5MB 4J3OG 5EP1A 1JEOA 3N8GA 4LMAA 1X5FA 4ARSA 3MX0B 4PRHA 2XZZA 1NONA 4WXYB 1SD5A 3ZV7A 1WYJA 4LLYB 4NMMA 2E7HA 4JVUA 4PWYA 4JSRA 2BM3A 2XTLA 1EB8A 1XDBA 3FB7B 4Y19E 3O2DA 2VDOH 2QTLA 3B9KA 3AVEA 1DWUA 4DM3A 3MRVA 5DCYA 4CUZA 1NR5A 2YXPX 2UY7B 2MWCA 5JC1A 1E50A 5AD0B 1EGAA 4WAUA 1F8UA 4MIEA 3GCWA 2Z5LA 3TPZA 3QPXL 3WL3A 3CE9A 1Z6GA 1SRDA 1D5ZA 3LPLA 5TPWB 1NAKH 4LGRB 5SWSE 4RGVA 4RYLA 1KPGA 4GAEA 3L4BA 4ZPXA 2H3HA 3MD0A 4MLZA 3QCUL 1R37A 4PNZA 4JO3H 2HLDA 4CSPA 1XCXA 5KVFL 1ARZA 1O9BA 1UMCA 2VHXA 3IR7A 2D7OA 4UHFA 1HHGB 2YOCA 4K26A 1JAIA 1QCDA 2PXHA 4PJEE 1W8EA 4LSRL 5CPBA 4UUJA 2CSPA 1WCWA 2PW2B 2ZR0A 3ASOB 4RVUA 4EUHA 5FHBL 1P69B 3CJQA 3JZAA 5F7DB 3WOVA 3HKFA 5DGRA 1O5IA 5CBEA 3C5WP 2H16A 4QAWA 1PZ5B 2D2XA 3R4RA 4ML3A 5EAIA 3QVMA 4D9GA 2QG4A 5AQ1A 3K5IA 4RAVB 4PX5A 4XN4A 3HU5A 2BGIA 5EUCA 5HVNA 3N5CA 3GUZA 2NZXA 4YGVA 4UIMB 3MODH 1OH5A 1XQ9A 5C08A 1LPAB 3P1VA 4Z7WF 1NLBH 2AXPA 1MCBA 4NENA 3MA7A 1JIUA 1BZ9B 4YJ2B 3IBYA 3OZ9L 1EWQA 3RU3A 2C31A 4JOCA 3L84A 1RLUA 3T8VA 3CH1B 1XUOA 2XBUA 3LLSA 4JJGA 3C08L 3WLHA 2WZBA 2XTAA 5BNIA 2Q7OE 1QLEB 4G8GE 3T95A 3L79A 4G5QA 1EO8H 5D96C 2EXWC 1OOAA 1D04A 1T0HB 1T89A 2DSTA 3SFTA 3GS0A 3CFDB 5CFQA 1Z7BA 3LNGA 3Q8AA 3N58A 5D6OA 2HRZA 5A0FA 2VR7A 5I9NA 1LLQA 4QGTA 5IBTL 5AB2A 3TT3L 4AMVA 4DQUA 4L9RA 3HN8A 5FJIA 4AP9A 3LEXB 3Q2IA 5D5QA 4BAGA 4G3YH 5AUQA 3FNEA 4K88A 2M6RA 1O6TA 4MRMA 3I6GB 4Y8DC 1A1VA 4HG2A 1HSBA 2ZOLA 3QITA 3RHZA 1FQWA 1NI4B 5AAMC 2VHZA 3BVPA 4OYRA 4BO6A 3G7NA 5DD5H 5F7JA 2FRDC 2JWHA 5EN2B 1PT7A 3C16C 4UB0L 3HA2A 3M49A 3U7HB 2IAMD 2KI6A 4QJ3B 5KG9B 4KKCC 1PJSA 3H2GA 2HFFA 1ODIA 1V7PC 1NBMA 2QUJA 4HUNB 1XWIA 4JY4B 5AW8B 4JC5A 2R56H 2RSLA 4F72A 2NY3C 2OJEA 1R3IH 1JPJA 4BXVA 3IB6A 2LU3A 1VM6A 3RQSA 1NW6A 3RYIB 3LTEA 5IBRA 2CO6A 4DP7X 5I0VA 3PT9A 3HE6C 1UZUA 5ALMA 2A1WH 1JZHA 5I9MA 3K0YA 3QPDA 4OP2A 2IPKA 3Q8CA 4BH7B 1ES0A 3K6NA 1QUNB 2EDDA 3WHXB 2DBLL 1W4LA 4JO4H 3PC2A 3MPOA 5GOTA 1HE3A 5CCGE 4UTNA 3ECVA 1U8JA 1DX6A 4CL8A 3HR4A 4PINA 2JB6A 4K9LA 4QTIL 2ATXA 3CA8A 3MRMB 2QX6A 3QG1A 4QXGH 1SYVA 3OJDB 4N0CC 4YRRA 4LCWB 5A6MA 4I18B 4YJZL 5FHBH 2BSAA 3FFCA 1U2YA 4NCXA 2W1NA 3DSNB 3I6ZA 4IDPA 1YEHL 4XWGL 5IW6A 1CY8A 3THRA 3HG1B 1CBUA 3CU5A 3VISA 1RIHL 2HWYA 4AVYA 3ARWA 2FBRA 5HP5A 4YRTA 3NNNA 3PL1A 2C7RA 5DVNA 1MCPH 1AC5A 3H16A 1RK1B 5B2ZA 2CKBB 3STTA 4AY2A 1ZHLB 2CLOB 2FBJL 3M1OA 2EICA 2GARA 2IWKA 5E03A 2VPWA 2DTMH 2JAWA 5INDA 4GR9A 1U6AL 3ZDZE 4I5GA 4X6CA 3HCRA 1VFMA 3PFIA 4NQEE 1MI5E 3LT0A 1P2BA 1IN7A 3KBEA 5HYVA 4MVXA 4GSQA 3VFTA 1NICA 3APMA 1I3UA 3ULVD 4ZVNA 1HHHB 2VKTA 2ZZKA 4Y4KD 3R09A 1E9AA 1E2MA 4JI4B 2A9RA 3QZWB 1E7UA 5SYAA 3ZYJA 1H3FA 5L3VA 3MHZA 1N5AB 3OICA 5A1JA 4QT5B 2NZIA 5AUPB 5LZ5A 4G0YA 3K9WA 3V2AR 1PLCA 4FQQA 1QM5A 3TYXA 3GL9A 1HU8A 5FFGA 4AVIA 2WFMA 2ZP8A 4CMEA 1N5YH 4HYYA 3UERA 4DGYH 2ENUA 4MQ7A 3U3ZA 1JQEA 3D7KA 3K81A 4Y7OC 1SBYA 3VYNA 2HB0A 3EDKA 4HH9A 1GZ7A 4ANFA 1PX0A 2OV8A 2G1AA 4HNQA 1A98A 2EJUA 4NCJA 3DOFA 1ZSDB 5AW0B 4AXXA 3A4DA 2H8PA 4MKTA 3UEZA 2H1SA 3K2MC 3SQRA 2XG4A 3VD0A 1XD8A 5DD6A 3RR2A 4HK4A 4JLJA 4JG0L 3MJTA 2QZ5A 2OR8A 1YAHA 5JYMA 4JPVH 3LKPA 3SE4C 1RHRA 2OJZH 3HBMA 5TVKA 2BFDB 4QELA 1L9TA 5EO0B 3CLWA 2W2NA 1FQ9C 4BFTA 3N2JA 4DCQA 4PRAB 1TM1E 5KJ1A 2H4JA 4H0IA 2E7LC 4TLAA 2ACKA 4MHSA 5I7HA 1HCYA 1JE0A 3RZCD 3V6MA 4E22A 1IATA 1R5IB 4OIBA 1TGYA 3IO3A 3SMVA 1XIWD 2AKAB 2QKSA 3MXVL 2D7TH 1H23A 3CNOA 1DVFA 2GT9A 3DETC 4NXMB 4URFA 4O0LA 3ZDWA 4CMGA 3QYCA 3LHSA 1FMCA 5C09E 1LV8A 2C3HA 4O3MA 2FHFA 1COWA 1NXXA 3ONNA 4K23H 1I01A 5CN1A 5AIBA 3OJVC 5I9SA 4E03A 5JORB 4BN4A 3MLPA 2I29A 3HI4A 4I77L 2I80A 4A7PA 3IEXA 4BLQA 3L7FB 4GMTH 4OCSL 5KVDH 1KVRA 3S8FB 2AX3A 3GFGA 5KUKA 1CY4A 2VN3A 3RTQC 5BVPH 1MDTA 3OX3A 3HO8A 5TVGA 4GKVA 4B9YA 4JLBA 2EE9A 2F53E 2ZF9A 1P74A 2CVPA 4JRFA 2K45A 2Y67A 2W0LA 1W35A 4G0ZA 5EL0A 1D1SA 1N0XL 3D4NA 3ZXSA 1U2TA 1WAAE 1AF4A 1DBAL 4H0GA 2QRJA 1U1FA 3D0LB 3UFXA 4LBAA 4KGJA 421PA 4B9KC 4MKRA 1HDOA 1KWKA 3U4IA 4AKIA 4E14A 2O8CB 1OB2A 1NVUQ 2P1ZA 4KI0A 5IBQA 4JGMA 3GF4A 2PSFA 3S3SA 5EQTA 4ZRGA 2HZHA 3OB0H 5LGJB 3RE0A 3W7AA 1G1MA 4LKCB 2NACA 4Z1MA 2RGEA 3WMQA 4OD1H 1YUMA 3O21A 2HG0A 2XNDA 2XG5A 4QOKA 4FYWA 3JV4A 3D4OA 3GN1A 3D09A 4X95A 4RAQA 4D74A 4PJ5E 4OHFA 2WT8A 4TS6A 1PR0A 2ZLBA 3DTUB 5JAMA 2XWXA 4YDZA 1FB5A 3CIQA 5SYMA 3HB5X 4BQBA 2GWRA 2NY5C 4G1CA 3L1HA 2CUTA 2QRVB 4V2BA 1WULS 4IRJB 4AW9A 1VKOA 1SNRA 1MB4A 3EQZA 2FAUA 4D97A 1OB5A 2BFEA 3MR9B 2LR4A 3O82A 4PLNC 3VMMA 3K0CA 4CLDA 2DB8A 2V4UA 1Z63A 1KE1A 1WRFA 1NP7A 2PFKA 2PAAA 1S6NA 4L48A 3VXPA 2Z3ZA 2WF8A 2RBGA 5JSHA 4PJ8B 1RZPA 4QHUA 4Z3JA 3BWSA 3OKOA 1KFCB 3U79A 2PYIA 5G4OA 5L4LA 3EA0A 4K8RH 4N5LA 1HNYA 3AQYA 4XB6B 5E8DL 3I4FA 5AG9A 4P4SA 2O5ZH 3D6GA 1Z36A 2VW7A 3EEBA 3O2QB 3VUEA 3IQZA 2VAAB 2MNWA 4XNUL 3TZCA 1ZTXH 3VWKA 4AYBA 3VDAA 2OG1A 3LZPA 4UTBL 3WD5L 3PC7A 2IXGA 2K1MA 4E41E 5T1MB 3FT4A 2NT1A 4R3WA 4BGEA 5JDCA 3H86A 3STBA 3GLFA 4LF6B 3G6JF 2F1KA 1PW7A 2DLTA 5TE7L 2EEAA 1HI9A 4LZAA 1ET5A 3EYOA 1HRDA 1OSYA 5CSBA 4OPMA 4OU3A 7MDHA 1PJ8A 1H5BB 3DVAB 1GJUA 4N1EA 3VHXB 4R81A 1NI3A 2G8NA 2OUKA 4ZOLB 1TYBE 3HZYB 1PFCA 1MGOA 4ACBA 5E6ZA 1CUHA 1T4CB 1U8PA 2HVBA 3OKEB 2HYMA 2VDPL 1NW5A 2A0KA 4CM6A 5FUZL 4P3KA 4XWOC 4YAJA 3QT2A 4LLQA 1KFJB 2X1PA 2VNJA 3GI8H 2NYVA 1WP6A 2RJMA 3IJEA 2YWBA 4JKPL 3O8XB 4YNYA 1M1XB 4DYHA 2P2YA 3D4GA 1KR5A 3UJIH 4KOEC 2W0FB 3QLUA 4A3SA 2Z2YA 3QDMA 3ICVA 2HLEB 4YAOA 2KH2B 3P9ZA 2VR1A 1M0SA 1NBME 1LS1A 1UOOA 3WICA 4OHXA 4ZNCD 3GJRA 5IASA 1KYVA 5FTNA 1WW3A 4QTHB 4EN3C 1YMMB 3N0WA 2ZGVA 4DN4H 4KGDA 4BNDB 4ZYTA 3NHZA 4BEWA 4U1HB 3QW9A 4LLMB 4F38A 5ALKA 4E15A 3QV2A 2NT0A 3IDAA 1XMXA 1RY7B 3VR6H 1Z33A 2AXHA 4YHMH 1DQMH 2OOSA 3FYSA 4LRWA 4IIYA 3DF7A 1T8WA 4KSBA 3RL1A 1E79A 4DUVA 2AJSL 4DIBA 1C9YA 2G7MC 4JRYB 3C5ZC 3EOYG 4CU8A 2IUFA 3RRNA 3WKEA 2F7RA 4YV1A 4WJ5B 4RTOA 3ZYOA 2EP8A 4EABA 4J3TA 2HJ9A 2CCWA 2PPEA 3K2UH 1UBRS 4PR3A 3OR6A 4B34A 4ENTA 3WLWD 1UBSB 1GGBL 4RY2A 4LCCA 3KPQA 3DKHA 1E69A 5KVEH 3QRWA 1PSDA 2HKHH 2YRWA 1XRSB 3R4CA 1BDMA 3EF4A 1IKNC 1WQVT 1XNHA 3I64A 3FBKA 2CBXA 3HEIB 1DCKA 1D7BA 2ODQA 4OZHB 3UMSA 1NUGA 1WBYA 3AESB 1GL6A 4X98B 4CMJA 1J87A 2FOIA 1NYRA 3EUWA 4DV1B 2IAMB 1EE1A 2BTOA 3EY9A 4S35A 3U39A 1YJCA 2R0KH 2GHZA 3KNBB 4PRYA 3GT7A 1P8AA 1N6NA 2XZAH 1B14A 1WZ1H 3RGWS 1GWNA 4HR7A 4JCWA 2RACA 4D3ZA 4ANKA 4EVNA 3K3PA 3VR6D 2LGNA 4J91A 3BGSA 5EPEA 4ZMOA 4FS0A 1MWAL 5TMPA 3LH9A 1XZKA 7ABPA 4DEVA 4GWKA 3NZHH 2EKPA 1G7PA 1WTCA 3A4EA 1Z5ZA 2ZWNA 5AKXA 1KJZA 1NAMB 4Y67A 2WT9A 3ND9A 1W75A 4UOW1 1G9NH 4HATA 5COBA 1Z5HA 1WKCA 3WYAA 2R7EB 2WBKA 1MORA 3CN7A 2JSFA 3DO7A 3BL5A 3GUUA 1FLAA 3E7XA 3VZDA 5DT9A 4WLOA 2ITFA 2FR0A 1WFIA 3BMVA 3BULA 3D2AA 2EJVA 2LVCA 4MQFB 3NEJA 4XO5A 3W34A 2R97A 3WV5A 4ZPTB 1Y18A 1F3DH 3NK3A 4V38A 2MYTA 3N06B 4ZFFB 3KM1A 2AYZA 4NBLA 5BWBA 3EOAA 3SKJL 1O94A 3CYFA 2IYWA 3S36H 1A1MA 4LNRB 4M8RA 1SUIA 3BMOB 2X0UA 5KSVB 1AHWB 1XL6A 3LPGA 1QBML 3PRJA 3TRFA 3WUWG 3KEGA 4FFWA 2FWUA 4YRBA 4KJYB 3D8UA 1EZ1A 3ROMA 4LCUB 2CXOA 3V6OC 4C88A 1NM4A 2JGEA 4E36A 5DR5L 4TVUA 2IXEA 2FGZA 3GCDA 1PJ4A 1RP1A 4HFMA 2I6GA 3NZ8A 3RX9A 3JSXA 2HU8A 4BHUI 3OCVA 1MCKA 3CX5K 2IEIA 2ZYGA 2R25B 2W0MA 3QXAA 1NT4A 2ICAA 4MMZC 5E99L 1V43A 4P0QB 2QE7D 5F8QC 4OV5B 4H0HB 5F2EA 3WO4B 3PA8A 4LC1A 4K0OA 4ODTL 1LK7A 3QJ5A 1F58H 3NAMA 2FMUA 1EQWA 2FL5B 4KXZH 2XYGA 5DULA 5JSUA 1FNMA 5T67A 4P3DA 3LLUA 1V9CA 4XQ9A 3ET9F 3O9WD 2EACA 5DJDA 4FSHA 1RIFA 1JW9B 4M6WA 4M88A 1IGTA 3ZQUA 2BFFB 1YQXA 2EQAA 2OXIA 2UY6B 3FYDA 1U2GC 5F78A 2GFIA 3ZXXA 2BC4B 2REQA 5T8KA 1G9TA 2EILB 4MPJA 1ZMOA 5HBRA 1OTXA 3TT3H 1T8PA 3V8PA 1TYEB 1G98A 1HXYA 2A77L 3MRLB 2QYTA 3I01M 1M9SA 3VJKA 3GPCA 1ZHFA 4MW7A 3IE1A 4W5NA 3W57A 3T9DA 1V05A 1IY1A 2I7VA 1URIA 3CV3A 5I9QC 3MGKA 3PWKA 2ZJFA 2YXLA 4YUVA 3CRMA 1F5SA 4FP8L 1N0LA 1OGAD 3MGBA 2HRPL 1DCEA 3ICPA 1IGML 3HVKA 2EIDA 1FPMA 2AP2A 5TF0A 3L7EA 4ZYUA 3FOLA 3GJZA 1KH1A 3HZHA 4XR8C 1YRLA 3BC1A 1KPRB 1XZIA 3OGCB 2QSCL 3RFZB 2OHVA 4XEUA 4D0BB 2WD0A 4NWTL 1X0VA 2L2QA 2C57A 4ERSH 5EYPA 1AFVL 3ZMNA 3MLSH 1MHHA 1YQVH 1XC7A 5HA5A 4R97B 3BSZL 3QR1A 4AKQA 2BNRD 1RWPA 5E95A 1IULA 5ERGB 3H4FA 4LCVA 4PJDB 2YBGA 2VN6A 4P3OA 3P9LB 2PPFA 4J1UA 4U3JA 5PNTA 3K4AA 3T2NL 4YSDA 4LPWA 4CM9A 3FT3A 2OHJA 3SS8A 4R3UC 4DRYA 3KKEA 3NRBA 5JXHA 3IQWA 1M4KA 2H85A 1IC4H 1FZOA 1T6ZA 3RZCA 2Y7NA 3EOTH 5CF3A 1G60A 1NCBL 3SSNA 3O6MH 4PP2B 4X4YB 3CDGB 5CVCA 5D84A 1YU9A 5A3RA 5K59E 2BVPB 5ECDA 5FYJE 3DD1A 3TI7A 1W96A 3GR6A 4EG5A 1I1FB 1X0XA 3WL9B 3JR3A 3RS0A 1XSOA 3BN9C 4X41A 2V59A 2FN8A 1EEZA 4KWUA 1NN0A 1EH5A 1G21B 2JIZD 2G4EA 4TM8A 5K8TA 2P26A 2C7UB 4PAZA 3OKLA 2C54A 3KEDA 2Y6VA 1WHOA 2V2XB 2QU7A 1IAOB 2YAOA 3LNTA 4XN9A 2QRHA 2XVGA 4JDVA 1HYHA 5EMLA 2G2RA 1P3JA 4LKXB 4I55A 5GGSY 3MOGA 3IMWA 3HJRA 5F5LA 5IDVA 2XWEA 4J5VA 1KZYA 4JM0A 1IV8A 2NXZB 2JAQA 4OKSA 5TQ0H 1Z7YA 3OOSA 4E13A 4IDJL 1Z22A 2NXZC 5EXXA 3KB2A 4LXYA 3L4JA 4AF8A 4BELD 3CLRD 1ZR4A 5INTA 4LHJB 1PGQA 4P4RB 1D2MA 1FG2A 1NUTA 2RGNC 1M7DA 4AJ4A 2WLLB 1MFBL 4S1VA 4X5XB 4EARA 3W9SA 2HRHA 5KTEL 1NC2A 4D7AA 4MV8A 3H1GA 2Q6TA 3HSKA 1IBCA 4N5UA 2Y7QB 3VDBA 4XMPH 4N3BA 3B1KA 4LIQL 1FBTA 4DJFC 2VMEA 1GSOA 2XNDD 1I85A 4HB3A 3ARRA 1U0OC 3UTTB 4GD3Q 4LTDA 2RAVA 3MCLL 2VB5A 1MQSA 3LB6C 1KDVA 4U0RB 4AWXA 1E3WA 3TM5A 3SGEI 3F5QA 5DX1A 4JFDA 4QULA 1TTGA 4BSWA 4IRZL 3QXWA 4MW5A 1V54B 5F1IB 1XEXB 3KD3A 2WUFA 4IKKA 1KI6A 1RZKL 5AT1A 4UFOA 2GKSA 3ZMRA 1E7RA 2XACC 4L4VE 1EFLA 3QXHA 1V8HA 3KOWA 4GUQA 1FNAA 3ZQWA 5I8ZA 4W9GC 4REQA 4NQXB 4QRFA 3OPXA 3VA6A 3H1FA 3K3QA 4M9UA 1QHSA 1GGVA 2J46A 1CWVA 1NL0L 3ZZSA 2EDHA 2ZFUA 3KXFB 2P9RA 4R3SA 4GLRH 1HJBC 2GTIA 1TUIA 2X1OA 4NLLA 5CLQA 5LKAA 1OREA 2IYSA 1FTNA 3I50L 3KPOA 3WWYA 1ZY9A 2GPTA 1DUIA 4PJXB 1MC1A 5F1KA 4H7KA 4HGRA 3KLNA 2OWDA 2JCCB 3ES6B 5GGTH 3UTQA 4NRXB 2CG9X 1WD8A 4EZKA 1QFMA 2CJWA 4LGVA 3AOEC 4XNMB 4ZJUA 2PP8A 4KDEA 4P31A 1M6VB 3OX1A 1W0WB 5EJEA 2RGBA 3LC1O 2C4XA 4AT1A 1TA4A 1T1RA 3AU9A 4AIRA 2EDNA 3JV5A 3W90A 2NNLD 1W2HA 5ALYA 5KYTA 3KOZA 1SCNE 2V7VA 4LHXA 5CA0A 3VSVA 4L8LA 4KFUA 5B36A 2VPPA 2B98A 1IGCH 4XPBH 4XYMA 2C9ZA 2KM1A 2WD9A 4OCSH 2TSAA 2ROQA 3KXDA 4GZ8A 4I1YA 4IOKA 2ABWA 2MCG1 4L50A 3RA7H 4GAAA 3VPDA 4IHKA 2BMEA 3GFFA 1M72A 1UTDA 4HWOA 4PJFE 1L8QA 2ESVA 1OYWA 4MW2A 5JMWA 1T0PA 1AQIA 1VOTA 5HEKA 3G08B 4J3BA 5CLYA 4KWTA 4YRMA 3QVUA 2P5YA 3BIOA 4ED9A 1R8YA 1VECA 3QFSA 4LVNC 2NYAA 4HIXH 5HHVL 4ZCRA 1T0MB 1ZVSA 3C74A 3NORA 5BQ5A 1S7TA 2AUNA 3NPAA 2CMKA 4GAGL 1ADGA 3RRMA 4RV4A 3MTQA 1UXHA 1P1ZB 3ARYA 1NPNA 3ASVA 4S1DD 5SX5H 3O1HB 4MWEA 3SAJA 1QZXA 2VLKA 5K45A 1QONA 2DKSA 3G82C 3GEIA 1J5IA 5GIPE 4Y1TA 3GJSA 1BMQA 2O4CA 3U9UA 3AHCA 2YA0A 4BZ1H 3NIDE 1RJZA 3I83A 2J44A 3WR5A 3V7FA 2ZTBA 3OT4A 5C8DA 2IEDA 3NYQA 3N8NA 4U00A 5EZYF 3R7BA 4E30A 3VVLA 3IAM1 5JJIA 1KJ9A 3GD7A 4LSUH 2H0RA 2OECA 1AXRA 3EQ8A 2AWNA 4IOSD 2ZCHL 1N9KA 3TYFB 2NUAA 3NPSC 2AQKA 5IT2L 3PWLB 2EEZA 3OF3A 2X0RA 3VU0A 4BYGA 3CVDA 5LN4A 4P32A 1JNHA 4L4SA 1F20A 1YMUA 2NOYA 4WL0A 2X4SA 4H8UA 1I3KA 1L7DA 5CEXB 3EH3B 5CRIA 2PWDA 2MTBA 4ZOQI 3IAHA 4ODVL 2P9CA 4F9GA 4E31A 1A8IA 1XBRA 5BRZD 1EJ6A 2VR3A 2NY4C 4X1IA 3M17A 2BSRA 3FFCD 3OHSX 1SVOA 5CWSB 1OI7A 4DUWA 1Z1WA 2B8TA 2XCLA 2JBAB 4FNLL 2OQJA 2Q8BH 4CIBA 4DA9A 5HSGA 3DE3X 4L2IA 2MSLA 5JDSB 3I6KB 2GTWB 1BVNP 1X7YA 1TVKB 1BQHA 2WQXA 1YUHA 1IGCL 2CM6A 2XQGA 4E9XA 1Z9SA 3N55A 2CN1A 3PXAA 4OG2A 2VH5H 4UPDA 4OQ1A 3VGBA 4WGVB 5L88L 2AEWA 2J1ZA 1NCHA 5AVWA 5F98A 3MLYH 5ED4A 3LS5L 3CIAA 1QHGA 4LY9A 1Z0MA 1TR7A 5C1BA 1Z4NA 5FUOL 5HSFA 3I84A 1N5JA 1SUCA 2OMBA 1WY7A 3RV4A 4UQ2A 1GZHB 4BFVA 3BAEL 1P6XA 4U7PB 3AF4A 4E5UA 4ZUVB 4G5AA 4Y2JA 3E0XA 1U0LA 3MOQA 2X1XR 2H29A 2BIIA 2FJHB 5D3MA 5A71A 2P62A 4HCJA 2H9GB 2Z31D 1ZI8A 1V5EA 3N40F 1FFXB 2XV6B 4IMKC 3F04A 5IN4A 5K6AC 1F7VA 1UFKA 1M9NA 4G5ZL 1KVSA 4M7WA 3U7RA 2BMAA 4YIQB 3D18A 3U4EA 1SC1A 2WA2A 4JKYA 1H0SA 5FLKA 4XPZA 3H7BA 4IIZA 3FT1A 3OQIB 3ZQJA 4RGMC 4D5GA 2YQ2A 4NCIA 3CJJA 2OVBA 3M33A 2X38A 3TUZC 3MYZA 4TT8A 3MJSA 2PH1A 5B55A 5CN3A 4GSRA 4PO8A 1Y98A 4U1SB 2OO7A 3MTJA 4KI7A 4BLVA 4DP2X 3LBYA 2PH7A 4NCC1 5JUWA 3KKMA 1WCIB 3ML9A 4U3HA 2ZTUA 3WIVA 3UM9A 4WLCA 2YMXH 3HE6A 4ONFL 1UKAA 3NHPA 1A7PH 3A1SA 1P84K 2GCGA 4Z76B 1RVFL 3UT0A 3MBOA 1H3GA 1XTTA 3H55A 1X7TA 5FUXA 1CTQA 3IGAB 3CHOA 3D5QA 1U5CA 3HPLB 1J56A 2P28B 1QVOA 3EJZC 1KXTB 2YPLD 4JFAA 4PCLA 3QG6B 1U3JA 1KQOA 2HJLA 4G85A 3Q5GA 3MOBH 2OA0A 4FLEA 4P5MB 2ID5A 1V1JA 1LI5A 3U3JA 3MA0A 3CY6A 1YRHA 3CE1A 1CFJA 2VOTA 2BGKA 4GKZA 3BMCA 3ZIYA 3HZOA 4PYKA 5CNKA 2VH1A 2D03H 4I1RA 4HUUB 2W0KA 4F58H 4UIKH 1CIPA 3KPLA 4Q18A 9GPBA 4Z7VA 1RJ9A 4EI5A 1P7HL 2REBA 2WIFA 3LC0A 2D5CA 1E7MA 3V48A 1J20A 3V2IA 5K2OA 4W9RA 3W11D 1NVVR 4RKRA 5C80A 2OSBA 1F8XA 3K6JA 4NPYA 3OKAA 4F3FA 2B99A 3JRWA 1D6VH 4C2TA 3PLRA 2NQCA 5HIIA 1RM4A 5E9DB 3O3NB 4S1RL 1ABEA 4PLPA 1ZD2P 4W6QA 1HIML 3EMDA 4XCVA 4FQ8A 3ETHA 3UZQA 3T4YB 3VXUE 4TQ9A 4OHYA 4KMTH 3PVZA 1U42A 1DS6A 3S36L 4DMUB 2ADJB 5EU3A 1JECA 3RPIA 5IKPA 4ZX3A 4N2AA 1OFGA 3AW9A 1QR4A 4IGAA 1OCWL 3MTRA 3K4PA 3INTA 4NX0A 4HHEA 1TPYA 5IHXA 2GEVA 1P4HA 1HYQA 4AW4A 2E4VA 4RJJA 2EWVA 4A2CA 1U33A 3MYJB 2P6NA 2PS3A 3S2YA 5JR1H 4LSWA 3BAKA 2OM5A 1R75A 2Q76B 4PJAB 3FT2A 1MCSA 1ZK3A 2G0NA 5HOEA 4DQXA 1WS7A 5AOLA 1YK0A 4PAQA 1QGYA 2P9QA 4L4UA 3FAZA 2DLFH 2OTPA 1K8YB 4IZOA 2E4TA 4BDVB 5KOHA 3JBG7 4I4IA 4JX9A 5DD0L 2IWEA 2GS9A 2IHVA 4HC1H 4NUJA 4W5HA 5DDHB 1H8ED 5IBTH 1DTUA 2ZJYA 3I5XA 1BSVA 3ADBA 1EKXA 3UYPA 2Q86A 4DMMA 1X74A 1JEQA 4QPDA 4QOFA 4FFBB 4OOFA 4WNSA 2D1FA 4Y2OB 2QJFA 5PCYA 2D7JA 3FOMA 4KR7A 2C9XA 1DHRA 2EBUA 4QPCA 4WN9B 1UEYA 3CPUA 2GILA 3EULA 3REVA 4G1EA 1IZKA 4YFDB 3PP8A 2EH7H 4N6GA 4DIOA 5KAPA 1H2AS 5AW1A 1UWEH 3WDSA 3ULUE 3KPSB 1YJDL 2VPQA 4HKZA 5KOJA 1THGA 2JXMB 5ACZA 2I2CA 3O6LH 2WANA 1KFKB 3HO6A 2Z64C 4ZAKC 4X1YB 32C2A 1QHYA 2XWSA 1UZLA 1U5BB 1Y7PA 1W8DA 1A0QH 5L0QC 1THTA 1NUFA 3UTSA 3BYZA 3ULVL 2IIBA 4UDTA 2EYSA 3WUWB 3AR4A 4PLZA 1ZM7A 2XWRA 3LZOA 1SD2A 1GZQA 5ELLA 3VV3A 1XVAA 1GRRA 1DEEB 4A55A 3GMMB 1HKLL 2ERCA 1Q9OB 2YV4A 3VFMB 2VPTA 3QFJD 4MKIA 3SY8A 4MS3A 2BLFA 5AZ2H 3HBFA 4MWBA 5K6TA 3NDIA 2ACVA 3WP0A 3GRAA 4ZTBA 2W2OA 5IAGA 2COKA 4AMUA 1Q74A 2HSIA 3V6ZB 3OKCA 4G23A 4BLUA 3H1ZA 5J2UB 3MKKA 3GG2A 5LXTB 3B2PA 4GOSA 3P97A 1YRAA 5I26A 2R0KL 5AYQA 5FYDA 5EORH 1HL3A 2BH9A 1U2DA 1JWLA 3BXFA 3AR7A 1KQNA 3T4PA 4KROB 1KLGB 4DNPA 1EAPA 2XMDA 3FO1A 3BZWA 1G9EA 1AGFA 1V4NA 4HAOA 1JF1A 4XYBA 3CFKB 3VZRA 4BK8A 3TLGB 2HBZA 3OCJA 2QAGB 3LDUA 1N2BA 4LY6A 3BAIA 4APQA 5EUQB 1EESA 5EBMB 3H7IA 3SC6A 3OVUB 4R8KA 3WISA 2N1TE 2N4IA 5FGCE 1NOFA 3HUEA 3T1OA 1JBJA 5I7UA 4FINA 1BD2B 1GNPA 3B85A 5EKDA 4KPHH 2YEQA 5IDYA 2PRSA 2ZJ0A 3R1GH 1WXXA 1C3JA 3OQNA 1EUZA 1SY6L 1MG5A 3CDZB 1E5QA 1XR3A 4RTKA 1JJ7A 3CC5A 3NJ8A 2OX5B 4AULA 1OPGL 1F3RB 1DJGA 4UDNA 2QGNA 4FFRA 4ZPVA 4PG7A 2HMID 5FLXA 4Y30A 4XCNA 2JJ2A 3BUDA 4S04A 5EIAA 4JKMA 5F96H 4HOWA 4V24A 4YWJA 2KE5A 4P2OB 4JPSA 4K9NA 3KR3L 4CU7A 4Y8AA 3VYVA 1G66A 3SPVA 2HIMA 4A73A 3QV1A 3DMYA 1GITA 4UUOA 1JKJB 3A6CH 1BX1A 3DDCA 1S78D 4Z2YA 1UXIA 4NHCH 1NOIA 4UEKA 1ND0B 2CBMA 5FW6A 3LY7A 3SIRA 3F2VA 2ZAHA 2CB9A 3A9WA 2L7EA 4XM1A 1RNLA 5H7XA 2B0SL 3GEGA 4NCAA 4HCFA 4PJ8D 3HC2A 2Z9DA 3TRJA 5FYLD 1VZIA 4PD4J 3OC5A 1YR6A 4F0JA 1Q44A 1DINA 4QRPD 1R4MB 4TTSA 1P5FA 4JYPA 4Q3OA 4JNXA 4CDRA 4D9RD 3VFSB 4KR3A 2JA1A 4JXZA 3MRTA 5IT2H 4K3EL 1UXJA 4N9GB 1TQWA 3IOMA 2CB0A 3TIXB 3ED5A 3GRUA 2VDLB 5HGBB 1KT2B 4P2QB 2JLRA 3JYLA 2AHOA 2YXFA 3NETA 3RJQB 1XLWA 1MCHA 3ESAA 1EFKA 4FCTA 2JFXA 1KULA 4WHTB 2IWFA 4XE5B 4TUKH 1TM4E 1QFWL 2OMUA 3ZUCA 4ZMWA 2WI8A 4HTAA 3FPLA 3CZFB 3ZJAA 4Z78B 5A7EA 3MIZA 2HG5A 4Z7VF 4NO2B 3CUPB 1JWSB 4NQDB 1A4KA 4X84A 4B6QA 1VL6A 1OXMA 3B3AA 2GNOA 5B3SB 5MHTA 2PCFA 1BNCA 2V5VA 5CITA 2AYXA 4G6JH 1RERA 2XVXA 1T21A 3ILSA 5J12C 1T7ZA 5IXSA 1JR3E 3MLXL 3TBVA 3I2CH 2ALAA 4D02A 2ZUYA 2A1UA 3VHRA 2OFOA 3FUUA 2VIRA 1XAHA 4KREA 2WJVA 3GLHA 2EW2A 4JBGA 3KJ6L 1N2HA 5TF1L 4UTOA 3LN4A 3CX5J 15C8L 4XZ3A 4F27A 4RSHA 1QQBA 3CVJA 2FEPA 2H8GA 1UKQA 1A7QH 2Y1DA 1MXDA 1ONPA 2ZI7A 5BVPL 2OMXB 5KPJA 3RFUA 4EJ1C 4X4XA 3IHWA 3OJWA 3PFFA 3ZDRA 2VQ1B 3LS5H 4H5SB 3FFDA 4XMKL 3O3DA 2J7PA 3DP9A 3ZSSA 4J0QA 2VL7A 1DQDL 2Z2IA 1X7ZA 4HLJA 4OMCA 3EDRA 3HG1E 1TI7A 5E1OA 4D56A 2GF2A 4PPTA 1NXOA 1J8SA 5DEFB 4QDJA 4FKMA 1CF1A 5D6CA 3VMFA 5DHVH 4DLZA 4I3RH 5TT0A 4P99A 3CF6R 3GP3A 3FF1A 3MNZA 5ILQA 1G7QA 3W5UA 5K3FB 5BZWB 1E1RD 4FTVA 5EV7A 3T7AA 3BUBA 1LDGA 4PJFB 3Q2LA 4IU3A 1I4FA 1CVRA 4EF4A 3CXDH 4PJIA 5F3BB 1ZLVK 2XICA 4IVRA 4BQSA 3N74A 3HB3C 1C80A 3ZZUA 4EQ3A 4Y1EA 3KQWA 4MVJD 5BUGA 1YOBA 3GSRB 1M2EA 1ZGLA 2AV7B 1VKHA 5ISZB 3VQ1C 1JT2A <