4Z7OB

Integrin alphaiibbeta3 in complex with agdv peptide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
total genus 115
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4z7oB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4z7oB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4z7oB03
1QCYA 1IDOA 4HQKA 4G1MB 3V4PB 3ZQKA 3ZDZB 4O02A 5KYUB 4MMXA 3PPVA 1SHTX 1ATZA 1M2OA 2IUEA 1QC5A 1AOXA 1MF7A 4HQFA 3IJEA 4PN7A 5KYXB 4O3UB 1QC5B 3BQMB 4MMZB 4UM9D 3AFCA 1N3YA 2B2XA 2XWJI 5KYXA 1U0OC 3EH1A 3TCXB 5HDBB 4WFQA 5E6RA 5ES4B 1JEQB 3VI4B 1Q0PA 4IHKA 2NUPB 3EOAI 3EGXB 2I91A 1FNSA 1JV2B 1U8CB 1BHQ1 1ZONA 5E6UB 2ODPA 5E6UA 4O02B 5KYNA 4UM8B 4WK2B 1MQ9A 3BN3A 1XDGA 3NIFB 1LFAA 3EFOA 4F1JA 4HQNA 3EGDB 3AL9A 3EGDA 1L5GB 4DMUB 2VC2B 3K72B 3NVQA 1M2VB 1AUQA 3V4VB 5KYYB 3E2MA 4O3TB 4MMYA 4HQOA 3ZE2B 1OAKA 2QTVA 2VDMB 1TYEB 3OKYB 1IDN1 1RRKA 3EGXA 1IJKA 3M6FA 4FWWA 3AL8B 3PPXA 1U8CA 1DZIA 2VDOB 4Z7OB 5E6SA 4G1MA 4FX5A 3OL2A 1V7PC 2X5NA 3ZE0B 3VI3B 3K71A 3OL2B 1IJBA 3T3PB 2P26A 3TVYA 2VDKB 1BHO1 1YUKA 1PD0A 3EG9A 1SQ0A 3FCSA 4Z7QB 3IJEB 1YVPA 3HXOA 1M1XA 3FCSB 3ZDYB 2NUTB 1M1XB 5KYUA 3TW0A 1MJNA 1SHYB 3EH2A 1FE8A 1XDDA 2NVOA 2I6SA 3GXBA 4C2BA 1PD1A 3EOBI 3F74A 2VDNB 3Q3GE 1AO3A 4C29A 4IGIA 4JDUA 3FCUB 1PCXA 4CNBA 4WK0B 4F1KA 3HXQA 1U0NA 1N9ZA 5KYWA 5LN1A 2P28A 1NA5A 5BV8A 3EG9B 4C2AA 4IXDA 2VDPB 4NENB 4WK4B 3ZE1B 1T0PA 4MMZA 3T3MB 4NENA 4WJKB 1SSLA 1RTKA 1SHUX 3HI6A 2O7NA 1M10A 3BQNB 4CN8A 4Z7NB 4XW2A 2ICAA 5HJ2A 3ZDXB 2NUPA 3K72A 4K3JB 1M2VA 2WW8A 5KYYA 3OKWA 5E6SB 5E6RB 1MQ8B 1YVRA 5KYWB 1CK4A 1JEQA 1T6BY 2XWBF 4M76B 1RD4A 1UEXC 4BJ3A 3EFOB 1JV2A 4G1EB 3K6SB 1ZOOA 3QA3E 4G1EA 3K6SA 4JX0A 1OLZA 1PT6A 2NUTA 1MHPA 3K71B 3PPYA 5HGJA 1DGQA 4A0QA 3IBSA 4CN9A 3NIDB 2UZYB 1CQPA 2ODQA 4MMXB 4HQLA 4NEHB 1MQAA 3RAGA 2VDQB 2I6QA 2WINI 1L5GA 1M1UA 1RS0A 3AL8A 2ADFA 3N2NA 2VDRB 2XGGA 1XUOA 3F78A 3PPWA 1JEYB 3TXAA 2VDLB 4MMYB 1JEYA 4UM9B 3NIGB 1ZOPA 1JLMA 2M32A 4GZ8A
chains in the Genus database with same CATH superfamily
4G9GA 4UJ3A 4AJ4A 4INZA 4FA7B 3K8KA 3B6JA 3ULVL 2GZAA 5T4HA 4JSYA 5LVAA 1A4RA 4HWEL 2ESVA 1L9OA 1ZGJA 3MOBL 3BE1L 3R7WB 2WLHA 3U3ZA 4CADB 2RB4A 3RSZA 3IS3A 4LQCA 4X1KA 1P6AB 4Z95H 5DEJA 4K8RL 1MELA 4O3TB 1FDLL 2F7IA 4DWWA 3ABIA 3LH2H 5GY7A 5JYMA 3DNMA 4PYRA 3FCSA 1WUZA 2B4QA 3ZTJG 3I2CL 3J7HA 2JIPA 1Y1SA 3T6XA 1CUIA 1MWAB 3KLBA 3OZVA 1WBDA 1QHQA 2VDNB 4MKHA 1V54B 3PKZA 4H4CA 2ZDQA 3K0CC 1T0OA 3O4OB 3QKSB 4RHXA 1DLHA 2YYYA 1XH3B 3VNSA 2GHWB 1IGIL 2D62A 2RH4A 2ZB7A 1NFIB 4PYGA 1XSIA 3GAMA 1JGUL 1RQLA 1QRND 1S7RB 1JIIA 3O6KL 4UHKA 2JGDB 3T41A 4P5EA 1U8XX 1HCVA 1KARA 1AZTA 4PJ5A 1RZ7H 4URYR 5HVWA 4MS1A 3UW1A 1ID8A 2IXBA 2XR1A 1I7LA 5IMBA 1K5PA 3GSUB 2C2BA 5K3FA 3GMOB 4Y4KA 3UAOA 4NJOA 2QTCA 3SF0A 3HKEA 5JMPA 3OTOB 4XFDA 2GA8A 1FNSA 1C0LA 1SXGA 2QTZA 1U8HB 4MDJA 4AEIH 1T8WA 4ZV4A 2O2XA 2DQJH 3BSHA 4DAGL 2I6FA 1PGJA 4WOJA 1QVWA 4F7CB 5T1MB 4RD6A 1CDIA 4JHWL 5LR6A 1YA6A 1S9KC 2FVXA 4MKTA 1Q7CA 2D6FA 1DBML 5LGJA 4JDZB 4DN3H 4WV3A 3LFTA 3BPCA 1LDGA 1K27A 4MB6A 3O4OC 4HXBH 5FV1L 1I5OA 1R9MA 4IZOA 2HB6A 3R0QA 3CFKA 1KPGA 4P9HH 4MKMA 4B60A 3HPRA 2Y6VA 3DE5X 1VI5A 5BV2P 3KX2A 3P19A 1H8LA 2MRYA 2H00A 1AANA 4P33A 5A0FA 2X4LA 1PSKH 1N6QH 1GXSA 4PZEA 4YRSA 3N8KA 3DGCR 2QT6A 3AF1A 2Q2VA 1KEMH 2EARA 5K8CA 3ZH2A 1FVOA 3TXAA 2QR0A 4CM7A 5EJ2A 3TW8B 2IKQA 1FW8A 4QXUL 3PGA1 4LI0A 3FYUB 3QTLA 4H4DA 1QYIA 2CE7A 2GS9A 4LWQA 2PRYA 1PLLA 4ZYUA 2H1RA 4QNRA 2BS8A 2PSHA 3OQ6A 4Z4FA 2CHUA 4NCNA 2DI7A 4FYHA 4BGDA 1QUFA 4UEOA 2PGDA 3A4IA 2FRDC 3IO3A 5EEWA 2XG4A 4IBLT 4WVLA 4NQED 4LFHD 3RKDD 2BP3A 2YD8A 1FDOA 3LK6A 2YVQA 4PS0A 3SS7X 4IRJC 4NNYA 3SEPA 3WEXA 3JYCA 3RSGA 3GPEA 3EXFB 1AF7A 3MYRA 3VG0H 1C1XA 1ZITA 1YEHH 1RYNA 5IB3B 3CV5A 1J8HE 1UFQA 3PP4H 4OMFG 1YEWA 5KYWA 1E6JL 3D8BA 3IODA 1NUSA 1X5ZA 4XC3L 2Q29A 4BO8A 1YECH 3TRJA 1WIUA 4IDPA 3HGMA 3M6UA 3HE7A 2WZBA 1I3GH 3FBTA 3V8RA 1EO8H 5DK2A 1PK9A 3GK8H 4EHAA 2FSHA 3O9VA 4MROA 4AM0Q 3TOSA 1DUYB 1UD8A 1TJIL 4KI1A 3RFRA 3FFCE 2ZIFA 1KCUL 2MFNA 4NOLA 5EUBA 1SUHA 3SJVB 2KL6A 1H2AS 3BFXA 5IJ0B 1GRRA 3VXTA 1OTXA 4FXKB 4P2GA 2BOCB 3QLVA 3MLTB 2NZXA 3KW8A 4QF1B 3H97A 2FDXA 4I99A 1P53A 3BEVB 2L04A 3L04A 2EFCB 3ESRA 4JRXE 2XBTA 4CG2A 3VG0L 2EE3A 4U7PB 2UVEA 1Z4JA 1EGAA 2NY3B 3KT0A 4MA5A 2Z31D 3DKRA 4G9DA 1ZG3A 3FTGB 1A5ZA 2FEPA 2AW3A 2O2CA 4XPHL 2RMKA 1R75A 3MRMB 3MQFA 4WNIA 4OGYH 1UM6L 2J0EA 1Z2CA 4NN6C 3LP8A 5AB9A 4NM8L 1E3MA 2OP1A 3I0ZA 2X4SA 1T9GS 4HJRA 5FYJL 4IYRA 4CF7A 2GK0A 5ABAA 4OHYA 4RV5A 4LWPA 1KTDB 4J0FA 3I75A 3FO0L 1S9WA 3W8EA 4TX1A 1Z62A 1ESZA 2WO2B 2D31B 3RKDC 5AW7A 5H83A 3ZYJA 5FT9A 5DVOA 1A4XA 1JH9A 1PF3A 3GR6A 2CJWB 3HS3A 3SEFA 2FZLA 2HQOA 5KSBE 3O21A 1U8KA 3WO4C 1Z13A 5F9OL 4XODA 4KQ3L 3VFPB 1GKOA 2C61A 3M1BB 1XD1A 2VYNA 3L01A 4HWRA 2JWHA 5IKCB 4TKMA 1WGVA 2VSMB 1UT8A 3GI9H 3WB9A 4M9SA 1UINA 2UUDH 2FZ5A 4YCBA 4IQ0A 4MYCA 1IBCA 2ZP1A 2DJ5A 1I75A 1SIBE 1E9BA 4NCKA 5HY9A 1GDHA 2A74A 2XG5A 5GZNA 2G06A 4PSAA 1JB9A 4ZKDA 4FI7A 1K8YB 2V1UA 2XV2A 1NIEA 4PJ5B 3T6ZA 4BASA 2E7ZA 1UFGA 1UKTA 1G9SA 1YK1A 1ZCFA 3U2SA 3L0ZA 5AB0A 2ZRIA 4P4KB 4YDVA 4E22A 5BUCA 2H3HA 2HSEA 3EGDB 4IMKC 3Q2OA 4DBZA 1CJKC 2ORVA 4ND7A 3UCEA 3FTSA 4BSWB 3BP5B 1F2VA 3H9HB 4R5XA 1WTCA 1REQB 4PBSA 3E7XA 1TNNA 2RGDA 1WD9A 3E2IA 2WYHA 2PJDA 3V97A 1Y1RA 1VFMA 2JFGA 5KW9L 4FQIL 3ROGA 5CZVL 3DBLB 4BQCA 3TNDA 2IH1B 2X4TB 4WTZG 1TECE 4BP1A 4P36A 1RVFL 2DPGA 4OCYH 2H26B 5G4MA 2UXVA 3KPOA 3DXAE 5AVUA 1M5RA 2VITA 2BMAA 1MRFL 3RHTA 4N7RA 4PAMA 1UXKA 4G8GA 1UFRA 4IIJB 4KQ6A 4FRWA 2OLJA 3DIFA 5BUZA 4LPYA 1CI3M 3UM9A 3QENA 4BHUA 2BNQB 3FB5B 4KREA 3V5DA 2EAEA 4IKKA 3BZFB 1AXEA 2F58L 3W0LB 4BYMA 1WBZA 3S40A 3HXMA 3E6HB 1AX9A 3S2AA 2DERA 5DBOA 2WP0A 4M62H 2GT9B 3NHBA 2CXGA 1AZLA 1L3IA 1W6RA 3FYUA 1E5BA 2VXUH 4P32A 4X0KB 1E9FA 2XMZA 1Z8FA 3SHVA 4JP5A 1KFCB 3WHIA 3SDCC 4F7DA 4KRLB 4JL1A 2VZ1A 4O2LA 3EYFB 1JGVH 1KYOJ 1CF1A 4WN9B 3ULKA 5KYTA 5CB4F 1SEPA 1RHUA 4N2IA 2J2ZA 3W6UA 1U1IA 4DH2A 1JHQA 3HCFA 4RXUA 5FGSA 2VR9A 3HBZA 4QYMA 4LGYA 5AHWA 5AI4A 3LBIA 3NMEA 1MUJA 4IIZA 1V96A 4V03A 1Q17A 1T21A 3DR5A 2C9PA 1UXHA 2HXYA 4KPHH 4CL0A 1W1UA 3G7TA 4Z0TA 3UERA 4ZXPA 3P30H 3QJVB 1NVUQ 1E94E 1UF9A 2GYVA 2Y36L 4Y5VC 1XAIA 2CUNA 1K6IA 5DLDA 3HCVA 2W48A 4B75A 2CHFA 1F0YA 5BXYA 3AYXB 2ROXA 2ZXUA 3IKVA 5KYWB 1FCGA 1F11B 5D5MF 5AYUH 2ZAGA 2JTYA 4JP1A 1RZFL 1E65A 1XNHA 2EBWA 4BIMA 5ESQB 1N3IA 3KB6A 4DP9X 4HAIA 4M21A 3LIIA 1V5WA 1S2GA 2D2XA 4ALIA 2G88A 2IAMA 1A3RH 2UUOA 3IJSA 2Q20A 1CFMA 3K0WA 3PGDB 2BK8A 5NLLA 4U33A 3MUUA 4QJ5B 2BD0A 1PJ8A 1CD1B 3W1VA 1Y42X 4G5AA 2BM9A 5A4JA 1DUYA 1U5BA 4QJ4A 1JN6B 3NSJA 3ZE6A 1N5YL 3CF6R 5JPNC 4D99A 4M1TA 4QBGB 4YT4A 1Z5HA 5LFAA 1BG9A 1PIWA 4HHWA 1NE7A 2XTSA 4R7GA 1WIOA 1LDMA 3T7RA 1HBJA 3UMFA 1QSFD 4RORA 2RJ3A 4KKAD 1BJKA 4EHBA 3BXGA 3FTEA 3CFJA 1T6WA 3LDBB 4HT1H 4CJ1A 5I0DA 1GL7A 2EXWD 1RI4A 4YACA 3EHBC 3CN4A 5D7IB 1IB6A 4XDZA 4EKDA 3ZKQD 2BY3A 1RI2A 4TVKA 2PKQO 3JQBC 2HYIC 5LP6F 1N2CB 4DV5B 4PAOA 5CAYB 1PQ4A 1LXMA 1NFDB 4Y6QA 1RK1A 2J71A 1NUFA 5L7WA 5GGYA 4P2BA 4ND2A 1E2ZA 2F5BL 3CNKA 2ORWA 3NYIA 4A91A 3K0EA 4NE9A 3DEHA 4HYYA 1OUMA 2PPEA 4KDEA 2NOYA 1XSOA 5LB2A 3UFXA 2N1BA 5E6RB 1E1LA 1TNMA 1TM7E 3TJEH 5AVTA 3KJ4C 5JOQA 4TS4A 5GGVY 2M8XA 5C0AD 4ZZ3A 3MV9D 3A3NA 2FF5A 4QODA 4UHEA 3KOWA 1PZGA 3IGAB 3KXFB 4MJIE 3NIGF 1B6TA 4Y18A 1FVXA 2HA4A 1YEKL 4FI3F 4KSYA 1JKJA 2FKNA 2WQXA 4M43H 2AJ8A 1P5VB 2ODBA 3SPVA 3E9RA 1KUMA 1HL8A 5A7FA 4YBHA 3ECVA 5HI5C 2Y92A 3FWPA 1REIA 1NIFA 4L15A 1A97A 3Q9UA 1NGWB 2VL5B 5DMIL 4NBXB 3SFZA 4CRWB 2Z92A 4Q18A 2ENSA 3S7GA 5LXGH 3ZTYA 3BEWB 1FWXA 4CKCB 2PPLA 3IDXH 3T1FB 1ECGA 2CALA 4QY8B 3VXRB 2LV4A 4OCRL 3KT3A 1G4UR 2DJ4A 1USZA 5IHBA 1UZ8B 3JVDA 2F3PA 1IGCH 1QATA 3P4NB 2BPBA 5EEZA 4JZJB 4WGWB 2DU8A 4GRLA 1N5AB 4LLMB 3MIZA 2ST1A 1T9DA 2VLRE 1U8UA 5U4XA 4KFZC 3PJSA 3QZPA 3C2QA 4D8UA 2R7NA 1CHNA 1YEIH 3F3YA 2LCIA 4ZFNA 3N9IA 5LNK6 4FP8H 2NTYC 5HDRA 2JD2A 4G36A 1RHRA 3MHPA 1KJYA 3U5ZB 1HT3A 2DQGH 2QUJA 3KR0A 4Y6RA 3ICVA 1CUFA 5EL0A 4JG1H 1JN0A 5AVRA 4DGWC 2MKLC 3VPGA 2ZT7A 3STLB 1D7CA 4OVUA 2NT3A 1YJ8A 4L23A 4K94H 3FPSA 4XVTL 3AT9A 2I9TB 1Y1TA 2H1LM 2JI1A 2OBFA 2AHOA 2G3ZA 1XEUA 4FILA 4ZT7A 5FM8A 4Q89A 3HG4A 4WY8A 2LABA 3GQFA 4XGZB 3TBTA 3E05A 1ZJ6A 2HSIA 3E1SA 2HJKB 4DS3A 1FSGA 3H1GA 5DMGD 3VBEA 4QRSB 2BFDA 4MVJD 4QFBA 4X80H 1ZP6A 2QSTA 3QISA 1UBHS 2VLKB 2ZB2A 2GR9A 1PF7E 3IGLA 1E0KA 4P80A 2ZUQB 5EJ9A 1XTMA 1JV2B 1OPOA 1HETA 1NDUA 1OQXA 1CLYH 5C18A 2GAZB 1BZOA 1MOEA 4ATNA 2Q6WA 4CPDA 2IG2H 3LRHA 5D1QE 1UK7A 4WI4A 5L9DH 3K1JA 1F1DA 1YSCA 1NGQH 4HIXL 1CWVA 2FSEA 4C59B 1JERA 4B9KC 2AUNA 4K9QA 1GGFA 4M1CC 4A8PA 3DVQX 4RTPA 4BQ9A 1XHEA 1FDVA 3RWJA 4UAOC 3JWEA 2ZYUX 3X1BA 3QVWA 2RHGB 4DQOH 2GHTA 3UG5A 3TW0A 3DOUA 4PQEA 3S35L 2X2IA 3BQUC 2YKLL 3HS9A 3HTXA 3EEQA 1P7KA 1DZ0A 4Z7UF 2SBTA 1ZA6B 1SBNE 3PLAE 3FNFA 4GR9A 4RVFA 2I85A 1PR9A 5AVZA 5HR5A 4FS0A 5F89B 2VNHA 5BVJA 1EE9A 1T21B 1CP2A 4M7KH 1N5RA 4WK6A 3KR2A 3WICA 3K1KC 1LB1B 2CNWA 2AQPA 1QGYA 3MWDA 2UY6B 2FG5A 2D9CA 1QR1A 3NJGA 1JWAB 3HCAA 3P45A 5LMCA 1YACA 4UINL 3B56A 5A7BA 3GBPA 2B4YA 4JEMA 2PYZA 4G4GA 4MS4B 1SBSH 5AW8A 1GH7A 3HRZB 5DHRA 4E1VA 3U0WH 1M0WA 2BR5A 2QE7A 3WLPA 5KVDL 1S89A 4Y6PA 3HVUA 3A47A 1UA6H 2O5ZH 2ZUQC 1A1MB 2R27A 1AGBA 4Y9BA 5J06A 1IAOB 5EU6D 4L4SA 2O20A 1CRLA 5TGZA 4ZEVA 4ZNCD 1A69A 5CA1F 5GS2D 4F5DA 2DTML 1QSFE 2JAUA 5ABDE 1IBRA 1GHFH 1P5RA 2D5IA 4FKMA 1G7QB 5LBUA 3HE6B 3REVB 1SXJD 3UFIA 3VGBA 1ZOIA 3SE7A 5BUSA 3O8QB 2FWBA 1U8TA 3L0DA 1XF4A 1PZNA 3Q9SA 4KJYA 3HA0A 2QT9A 3TEFA 3EH2A 3C16C 3OR7B 2A1UA 4M7OA 3WL8A 1G5HA 4EZIA 1TDJA 1KS2A 3RNLA 4PF1A 4HLUA 4MW7A 1P4IL 2RFXB 4DRXA 3Q3CA 2CXHA 1DE4A 3PU7A 3GA0A 3WDKA 4BKOA 1QIEA 4M0PA 5T6MA 4BFVA 3IVGA 4J03A 3WWZA 1D6NA 1KY6A 3N41B 1TYAE 2Q4OA 3BVPA 2CBPA 4LRUA 1JSLA 3NSFA 5FF9A 3QPWA 2O7QA 5F1OB 3DSNB 4OIIL 4IH1A 5ER9A 3VA2C 1ZOOA 5I5JA 2YZ7A 4EVNA 1AGCA 4JMLA 3WSTA 4HZIA 1LXCA 5I8ZA 4BDVB 3CSPA 4YEDA 3HE3A 4FHCA 1PBTA 3NAMA 4I3RH 3M1IA 1WW3A 4PVNA 2QLLA 3I9FA 2OJEB 5KYGA 4LXGA 3ZRFC 3VGJA 4M88A 1F2TA 1G9XA 2YBRB 5DPMA 1I9JL 5EC2A 4BMNA 3F84A 3K8ZA 3ABQB 1XJ5A 5JFGA 5CLFA 2DPMA 2PLNA 2Y5EA 4B9PA 2H65A 3SDXE 1JNNL 1ANKA 1JHUA 1CDEA 2XTNA 3QJQB 2L2QA 3CZJA 4R1QA 4V1DD 1E2GA 1JZ6A 3ESAA 1F56A 1AKEA 5DD6B 2Z2KA 5A2GA 4YMGA 5K7SA 2Y24A 1FLNA 4K6KA 4NO3B 3MA0A 1QG6A 2X12A 4GKSA 1EGHA 4AJ2A 1CZOA 3ROTA 4MWGA 3OL2A 2C3PA 2FMTA 3AHJA 3QEQA 4FI6A 1F38A 3D4BA 1X86B 1DKUA 1YCFA 2PMZA 1GR0A 4NZRL 3WS6A 2RBLA 3LPCA 4OK3A 3WK8A 3PHHA 4MD4B 4A2LA 4C2BA 2OLEA 3VVLA 3H87A 1QGUB 3CINA 1HC7A 3RL2A 4KN5A 1KWKA 1YKGA 4XN5A 1ZLUK 2A9JA 4MGYR 4FZEL 3M1OA 4E15A 5FM5M 4CV0A 3LT2A 3PFBA 3W8DA 1XH1A 3K8QA 3KYIB 3LB6C 3QE9Y 1I6MA 5IVIA 4BLSA 1IBGL 2YY7A 1YJBA 4NAMA 4LOAA 3BISA 1QYRA 4BN0A 3IDAA 2FO4B 2D7NA 3RFUA 4N5UA 3VSVA 1CUYA 1UB5B 4QRRB 5JNTA 5C1BA 4UBMA 3E5MA 3SGJA 1FDWA 1BJMA 2P9CA 1IQ0A 3BUPA 4RA9A 4PGDB 3S5LA 1L3BA 2W07A 3TJEL 4N2MA 5F1NA 4F5ZA 4JQXC 2V8LA 3LOPA 1B6SA 1Z07A 2O0JA 3BQUD 1V16B 4YHKH 2ZRDA 5I71B 3VM7A 4GBMA 3FTZA 1U1CA 2JDIA 4AUMA 4KFUA 2G8LA 4P99A 3BD4A 4L1LA 3I3BA 2IP2A 1VHQA 5DQ9B 4MHTA 2BEVA 1INDL 4OXRA 3T4AC 3BEDA 4DDTA 1FW6A 3VACA 3AF3A 1F5WA 3IULA 5DJ0A 4WT7A 3C2AL 5F3RA 3ZGXA 9ABPA 1NW4A 3VRJA 1NPUA 4DCNA 2X09A 3RPBA 1RZKL 3O9MA 3LQ4A 1LA2A 3PTZA 2PKQP 4XZUB 3CQFA 5DFAA 1W72H 2I6TA 3M4XA 1MX5A 2QX7A 5MEND 1KEEB 1BQ5A 4GQZA 3PJFA 3QLUC 5DMGC 4JI3B 4AY5A 3PV7A 4XCNA 3GP3A 1UMKA 5IK3A 3G5MA 1TETH 1SLVA 1HTBA 2BY4A 3CKYA 1EINA 3EG9B 1G6RL 2BHLA 3BSSA 2VUOA 4JB2A 4E36A 2GVZC 3JWDH 4OQDA 3JALA 3S8GB 2KC0A 1U3NA 4KRXA 1ZJBA 4V0KA 2QADD 5CA0A 4L4VE 1ZA6A 2B36A 4F2FA 2SHKA 2FHFA 2D1QA 3L1HA 2BM0A 3K6NA 3PIQA 1IK4A 1IJFA 3HN8A 3BVNA 4AZ8A 3S34L 1UIMA 1JDBB 4ENSA 3QDMA 2KDYA 1Y1PA 3QXXA 1R19A 5FI5A 3N06B 3BT7A 2QHLA 1RZGB 6PAZA 1PLCA 4PGJA 2Q8QA 1NFDE 5U9CA 1G9NL 3ETCA 3RYMA 4MZDA 3HFGA 4QHNA 3D6TB 3N1QC 1EZLA 2JB9A 3QAZC 1W85A 4U7JA 2BVTA 1CFZA 2IE8A 1BXKA 1N2BA 2XB4A 1UMCB 1YAHA 1U1GA 2AJSH 5TPWH 1YNTB 1EK1A 4RIRB 4JM2F 4XHJD 1WW2A 4E1BA 4OMCA 2QUZA 3E35A 3VFVA 3EB9A 4NHOA 4GC5A 2I03A 3AMLA 2PLFA 4I14A 3A22A 2HT1A 4XVUC 1GL3A 4XO5A 3CHPA 5L4MA 3IU3B 2GBGA 5IB2A 2XE4A 4OBBA 3BRFA 3FPFA 3WLKX 4HETA 4JVMA 3EBPA 4AQYB 2WAYA 3HAEB 1J56A 3AF6A 3L9XA 2ACKA 1KCSH 4A27A 2PU5A 3JTSB 1S5IL 3GH3A 1SURA 3F5WA 2WCGA 3KPPA 3LQZB 5BOSB 3SEZA 2MTPA 1GW6A 4NCC2 1E5TA 1SBYA 3EXHC 3WJAA 3D06A 2EJBA 5EE9A 3LVEA 5BYBA 3CHSA 3A04A 1MN4A 3F65A 4J2XA 3EC2A 2O1AA 4MV1A 5T5NG 2XVKA 4FBMA 3MTIA 1WZEA 2IZ7A 2QZPA 1EO7A 1YR6A 1Y4ZA 4IKIA 3MJ7B 1IDOA 1D1SA 4X7CC 4JBXA 1UGNA 1S2DA 2BHFA 3IMEA 5FPIA 1XYGA 3IOYA 1F3JB 4FJ1A 4D3CH 4XWYA 3LZOA 3U62A 2XIJA 1KE2A 4ES6A 4LQLA 2IYUA 4DW2H 3V33A 5ESAA 3PNWA 1K9TA 1YZTA 1EXUA 3OTTA 3T6QC 1YMMA 4AYSA 3C85A 4MYHA 4EG8A 1AKPA 4X5QA 4RLSA 4CN6A 3S5LG 1S8DA 2SKCA 3NA9H 2DBQA 5D51S 1WHSB 3L6RA 2FT7A 1JRHL 4Z76A 2E55A 3DG9A 2DR2A 2AI0L 1QRNB 1D8AA 2YD7A 4W9ZA 4J75A 1J7VR 1RI1A 4KDTC 4W9NC 2C4XA 4EEZA 4LARL 3KPYA 5IXJA 4J76A 3F6EX 4TV9B 5KINB 1MX1A 2E7LC 3I8SA 4JSTA 1S96A 4FDLA 3CUSA 4UQBA 4KNVA 3PD0A 3KLLA 1SB9A 3GLHA 3H9SB 1FVEA 3ROOB 1LPNA 1T0PA 3HUTA 2O54A 1SCBA 3CEAA 3LLMA 2QQLH 2GAAA 4OREX 3NOIA 4XNBA 4BFIA 3NJRA 2OJ1A 3VU2A 2K4WA 1SC6A 2R97A 1LK7A 5EZSA 2J7PA 2G80A 5C0BB 5IM5A 1T24A 6GPBA 4FYPA 3SD7A 2B15A 5K09A 1SFRA 4MDYA 1I5RA 3VOTA 2ZVQX 4TKWA 2P11A 3W4IA 2NZUG 4KMTL 4ZMNA 1J5XA 2J67A 5LQSA 4H4NA 4YJHB 1KG0A 4H5SA 4RQTA 4FC3E 2WGNB 1KI3A 5LWQA 3VDXA 1A2OA 4BKSC 1WNTA 4K94C 5A6LA 5IAEA 3DVGB 4JZYA 3PE3A 1GPNA 4M8NE 3OU6A 1Q22A 2BSTB 5JIPA 3S27A 1A8UA 3RC1A 3GHEL 3P9LA 3A4LA 1OTHA 4YAEA 2O19A 3W0WA 1EGQA 2A6KB 2BNRE 1YA8A 4AYFA 3DBOB 4QHLA 2F54B 1KR5A 2NY7L 1AQJA 1RIUL 3FU7B 3QWAA 1IFXA 5IBTH 3Q1KA 3F6JA 1CG9A 1SUBA 1HDOA 3EY9A 1RM5A 1IULA 1KPHA 3HJTA 3ZKWA 2PMFA 2EX1A 2JAWA 3MJCA 1G2QA 3FMFA 4PGAA 5JWRA 4HHEA 2F1HA 4ZP1A 4MVJM 2EZTA 3NHZA 5C09D 1UKZA 2GJAA 3VUEA 1SC4A 3LVQE 4ISVA 3UAYA 1QR2A 1WWAX 1FQOA 3WK6A 3CFNA 2VOEA 4LVOA 4NJEA 3ZI4A 1GCIA 5ILQA 2AP2A 3MCKA 2H5JA 2GABA 1VGQA 1MRFH 3F1LA 3M8OH 1HILB 4FNPA 4BNGA 4MS8C 3RIGA 1GTSA 3O2JA 1QG0A 2P48B 4TSCL 1JZ7A 5E56A 4R0LA 1PT7A 2ZSIA 4JAMB 4X8JB 2X0JA 4L1HA 3E6FA 1XD0A 3MERA 1W6LA 3TO4A 4WLFA 4EQ3A 4ARSA 1T1RA 1GTG1 4NQDB 4YAQB 3Q0TA 2IDKA 1KIQB 5DRTA 4MVJF 1A2YA 4BPBA 3I9OA 2OXEA 2N1TE 3LOUA 5IG7A 1E9DA 1OYOA 3L8YA 5JSZB 2V0CA 2QTNA 4OCMC 4P23B 5EOQL 2IW3A 3GCGA 4ZZIA 1W9HA 4BNKA 4ZOLA 1JNHB 1B4JL 4B2IA 4EN3D 4BTEA 1CXEA 3DO7A 3HGTA 4HW6A 3EOYG 5BRNA 4HG4K 3TE6A 5BRZB 4QEKA 4BKLA 2ZXQA 3RC3A 4L73A 3IKKA 4AJHA 2YD2A 1XCTA 3ZXSA 4EG4A 1VJRA 3O3NB 1VZIA 4ESKA 1OHHA 1QORA 2WJJA 1Z39A 2J5KA 1MQKH 3ZQJA 2O8DA 5DHMC 2EP6A 1RU9H 3THYB 3NABL 4X00A 3JYHA 4PRBB 1G8JA 1MZPA 3CSGA 2R47A 3BP7B 1QKZL 1VPEA 1GJIA 1XZAA 5ALIA 2DYSB 4MVJP 5L88L 3WJMB 3W05A 3ZE1B 5M7EA 4HR7A 3AVUA 4QGGA 2NXCA 1HKHA 3F3SA 4EYOA 1NAKL 4JCWA 1IO4C 3NB0A 2CKNA 1Q91A 1J0YA 3OPYA 4MAZA 2RJNA 1UUSA 4MQLA 2DCUA 2W2NA 3FKUS 4TLSA 3SDDD 2YAMA 3DV2A 4OLYH 4OJQA 4D9KA 3DBXA 5C8XA 2AUMA 4ZD3L 4DIEA 4LW8A 5BSGA 4H35A 2N9UA 3QITA 1SOKA 1QOZA 5ALXA 1HEUA 1IJEA 2HRRA 2RBGA 4EG1A 8AT1A 4GP9A 5JPMC 4CWAA 3LPOA 4DB2A 4N2AA 4PJEF 1LO4L 3QP3A 5DYOB 4E70A 4CTJA 3QO0A 4LYYA 1N0IA 3BS4A 2OGSA 3FPJA 5F3BA 5DXAA 1LRKA 3OIVA 1K3UB 1Y3FE 3NPAA 4PRAB 3OOEA 5A5DA 4AN1A 1OXTA 3NHWA 4N9GA 2OECA 3QVKA 2GSGA 2OL3B 2FATH 4I55F 5B55A 2VO1A 2NSDA 2ICWI 2YKKA 3L3JA 5B3JC 1GPLA 4GMDA 4AV0A 4YNBA 4B3FX 3GMNB 2Y2UA 4JLMA 3RFFA 1R10A 3VWJD 2QL9A 1DAKA 4NCAA 2J5QA 3TW6A 3LB6D 2YVUA 3G49A 1P7PA 1BOYA 2NYKA 3DONA 3SYPA 1CZ8H 2HBYA 2XNHA 5B7FA 4UM8A 4LBYA 5JAMA 4KO5A 1EDBA 3II1A 1TTPB 1WFJA 3D7PA 1KC3A 1TB4A 5C8YF 1T0MA 3RRXA 1VKJA 4TYMA 3F71A 5JXWA 5IMLB 4XN7A 5E24E 2GRJA 3PGLA 4JYBA 1FDLH 4WI0A 4U1SA 3CNHA 2JIXA 1E8WA 3E18A 3FHAA 2ED9A 1X5HA 1A7PL 1IEBB 5TIIA 5DD0H 2W80C 2CCVA 4WNQA 1VFOA 5B3JE 1WS6A 3VYTB 5F8QC 4WZ9A 2DQSA 2HJLB 4WO0A 4OAOA 2BW5A 4G8AC 2BKEA 4U7WA 1MW2A 1T7VA 2R86A 1G2IA 2C04A 3GUHA 1SH7A 1ICTA 3H5AA 1OW0C 421PA 4G9FD 1Y6GA 1U02A 2C9RA 1DQQB 2ZBDA 2FWOA 3LSOB 4O02B 2BGRA 1C7QA 4Z18A 4A7QA 1DLFH 3RU3A 2OK0L 5E95B 3RTQA 4TTAA 1ZX1A 3BAIA 3T3EA 4LJSA 1MI5A 4JGGA 5B4VA 1Q94A 4OF3A 1DVTA 1RJYB 2X44D 1EUDB 3MQIA 3Q0EA 1JYSA 2AYXA 3A8TA 3T3DA 1BKDR 4DV7B 1WUTA 3L4SO 3ICQB 5JTTA 3AB0C 4B97A 5HDQL 2J8UF 1OP5K 1T3TA 1ROWA 1S78D 3MJSA 3T2LA 3NEAA 3JVIA 4QSHA 4OLWL 5D3KA 1I7RB 4WCDA 2R7LA 3TL2A 4EPWA 3ZCSA 2RCYA 3QDJE 4GSXA 4YDQA 1ETJA 1UH2A 1EGMB 1GQ2A 5JHHB 3NAZA 2OGZA 4URXR 4M8SA 1Q9OA 3QVGB 5T3ZE 1W5FA 2OMZB 1A5BB 2ZOKA 2O1SA 3UMSA 2BAGA 1TYZA 4HS8L 4XAQA 4NBNA 3DT9A 3GIDA 1PWXA 1W0WA 1NP7A 1E9RA 1P9MA 5A6SB 4G71B 4CLRA 4MVXA 3TNJA 1JHMA 2XQFA 1ZLSH 2PX3A 4ZI3A 1K08A 4XVSH 2D7QA 5FUCE 2WAQA 4ZVQA 1ZSHA 2GI0A 1P4UA 3U6RB 1EFPA 2ID9A 5FWXB 2A1TS 4LXIA 4XX1A 1UK8A 1R16A 4EEEA 3UH0A 4PCUA 1TVCA 4ZEMA 1I9CA 1P4SA 4O1IA 1AC0A 3ULUE 3HKZA 4L0MA 1U0GA 4G01B 4JO1L 1GTJ1 2YZ8A 3QW9A 2QS9A 3HVKA 4YFEA 3ETBJ 4JQZA 4D46A 1N77A 4I66A 4QDXA 5KAPA 3RLSA 3QX7A 5KSAC 4JFSA 1Y1LA 4BYHA 1RAHA 3C7CB 5DVNA 3ZDXF 3CN9A 2EKDA 4OT1H 2EVFA 3PFFA 2PXAA 4GOKA 4LSUH 4ZCMA 2F2HA 4BBAA 2CUAA 5HVGB 2R0LL 1YN7B 4IIQC 2C97A 2OMEA 1Q38A 3BHBB 4QRSA 1NATA 1U6AH 2N7BA 2VWHA 4RIEA 3GJ8A 4MB5A 5C37A 1E9OB 3IQEA 2Q2OA 3VXRD 2ILTA 1EQUA 3NCXA 2MDTA 1CY4A 2DYPB 1SBQA 4KKRA 2BFPA 3CX7A 4KXAA 1MA3A 1O08A 4RQBA 4CM8B 5JAHA 1NCUA 4NUJA 4JY5H 1XMPA 1II8A 2VQ1A 4GG6F 1I53A 3B5GA 3ESMA 3L7DA 3UC0L 1YRQA 4MSWA 2VN6A 1RMYA 4OHPA 3PWZA 4FOLA 1ZM3A 4X91A 4IDAA 2HK9A 5TDPA 5IEKA 1Q7TA 4JR9L 3H2YA 4O2CA 1NMSA 3U7HB 3RH0A 4XNAA 1R5WA 5I66B 4GXVL 3NV7A 1NW5A 3QHFH 5E94A 3UBGA 5FTMA 4A73A 3K91A 1T36B 2FSVC 5LU9A 5ILTL 2QOEA 1IOLA 1IU1A 3TCXB 3GRYA 1WP9A 3RVWD 3KR9A 3L4JA 1M7IB 5IBCA 2HI0A 1X13A 4MP6A 3FO2A 2VNKA 2HVKB 4DQLA 3LZRA 4WZ6A 1LQTA 3RAPR 1U8JA 5IV2B 3B9KA 1BHJA 1N10A 5FAXA 3EOAB 3WIOA 1BQLL 2DMCA 3UMNA 3AT8A 3MFFA 2Y1KA 4DVBB 4NS0A 3OPMA 3ZIUA 3MTEA 4AM8A 1TTGA 5DASA 4F4FA 2ZCKH 1XCLA 4ZJ9A 2HFGH 5BSEA 4FMPA 4JFYA 4HC4A 1G9NH 3G2JA 4IIJF 4EG5A 5D7HA 1FF9A 3R3UA 2C5DC 4PWKA 1J22A 3K9GA 3GPDG 4X7TA 1UOVA 3LDHA 1JA1A 3M82A 3C4QA 1ZYUA 1SHUX 2CHEA 2A5UA 2MOQA 4LS3A 4OBEA 3T5CA 4UM7A 1HWGB 3V8NA 1ZLSL 1QSEE 1YZYA 3I2CH 4O58L 1NVEA 3ZHNA 1GCOA 1L7DA 2YFOA 4D3DA 5LCVA 4Y2DB 4LU5H 1JXFA 1TDQA 4HS3A 1CUCA 3SO3C 3VD7A 3RYHB 1UWCA 3R0MA 4LQ1A 1NAMA 2P8JA 4U4AA 1XVAA 4MKFA 3CO5A 4FWBA 2IMNA 1U65A 1KYVA 1X1DA 2H0FA 2P7TA 1SXSA 1IGJB 3C3WA 2UZ3A 4NQCB 1XPUA 3SE6A 3CT4A 3RUFA 1W87A 2FBJL 1J0AA 5JCOC 3DETD 4GIOA 2BP8A 5HF6A 3G08A 3EDFA 1RIHL 2PE5A 3DUSB 2C9AA 3MCYA 2B7DT 2EG5A 4Q97A 4EYSA 4XPAL 2J3DA 5FEBA 3C5HA 4U8HA 1IGFL 2NZIA 4UQ9A 4WI3A 2P41A 5C9KA 4D3ZA 1NL0H 3CAFA 5JUEH 2BVOA 3C5XA 4POZD 4W5WA 3MRPA 3FOLB 3N1MC 1DTEA 3TT1L 1ZGGA 2VPZA 1A9SA 2E4UA 3PGKA 4PINA 4GUPB 3H42B 3D2UA 4GMTH 5AQEA 1VCAA 5L4FA 5IFJA 1RZVA 2C94A 2TRSB 1I7SB 2GO7A 3GZNB 3F62A 3U0VA 1MRNA 2Z1DA 4KWIA 3MXTA 2OSLB 1K6EA 3MVEA 3GNMH 3V4VA 1KSRA 2X5JO 1CFJA 2RBKA 4DG9A 2A2ZA 4JLDA 1BWMA 5F1IB 4O4IA 1BCRB 3IBSA 1PV2A 2AYZA 1NV8A 4JL2A 3PY9A 5CT5A 1W44A 4QHTA 3KJNA 5KDOA 3STBA 3ATDA 3ZU5A 4EG7A 5AHOA 3L8DA 1LK5A 1RH8A 1HNNA 2WCPA 2X4NB 3P9IA 1SQ6A 3QNYA 1MH9A 3F5QA 1W0WB 4BNTA 2ZKXA 1QGUA 4PJIB 3O81A 3VFMB 3NFPA 4LNRB 1HV8A 2WWIA 3ZL4H 5DD1H 4LUCA 4ZV7A 2YXVA 4G8GD 1XKLA 2CNNA 1KI4A 1FMFA 3TZVB 3GMMA 4Q1FA 4LOLA 1BE8A 3MJ4A 4IRJA 4MA3B 2JIXD 2XDAA 1N4DA 3SE4C 4Y1GA 1PYDA 3L1EA 2Z30A 1I3GL 4AJNA 3ZE9A 2R00A 4E94A 4AVKA 1DEEA 5JNLA 1ZMOA 4JJFA 4RISH 2OTCA 4H8PA 2J9ZB 4QPEA 4W1TA 3AEUB 4TXLA 1GCGA 4RA6A 2XUGA 3PXUA 3N42F 4CMKA 3RYIB 1P6QA 4RIFA 4PM1A 2C2OA 2Q5CA 2JCBA 3HOGA 5J0BA 2KB0A 4ERXA 1MZYA 1CNFA 2R0ZH 4YV2A 4EPSA 2YQ2A 2WB2A 4WKZA 2PO7A 2XB2A 2IHTA 3UK2A 4U1MA 3RAJL 1TX4B 1KDIA 1XCQA 2HB0A 5LCVH 3FFCB 3IEIA 1A21A 3UHAA 4FWTA 2OQRA 4DJMA 1JXDA 3PT5A 5E2TL 3GLVA 2JJ2D 4JFOB 2J0UB 2AMGA 2RB8A 3UIYA 1PDOA 1PI3A 2AEFA 2IUEA 2YGPA 2ZP0T 2JBAA 4BNUA 3S3TA 5I73B 4IQGA 3BPCB 2A6JB 1THMA 5BO1H 4XN9A 2I69A 1UWXK 3NOVA 1MX3A 4NCJA 5I9IA 5J4HA 1OA0A 1H19A 4LRIC 3CFKB 4X8CA 4RMUA 4X7EC 5HVHB 4PJ6A 4LCUB 3RB7A 3ZT6A 4GAGH 3BWZA 5MEOA 1EEZB 5ALRA 2ZXAA 1QRSA 4JO2L 3FHEA 2GCEA 1SRQA 3MNVB 3HG1E 3KNBA 4OV6F 4DO4A 4W6YB 4A6EA 4F9EA 2ZWKA 3SBPA 3QFRA 1DN2A 3X1FA 2G28A 1XA0A 4UUPA 2BEWA 2IOOA 3ARGD 3IA2A 3ZJVA 5E9NA 2W2VA 4MQEA 4ZOBA 3CRQA 4UILL 1XROA 3BD7A 5D7LA 1DJMA 3KVPA 4NWIA 1DEKA 1J90A 2R7MA 3LYAA 4NUPA 2GMWA 4BTLA 3OZXA 3TSCA 1HX0A 1XX6A 3S44A 5AYQA 1FORL 4M7KL 5LOVF 5MENB 1JDTA 3FCCA 4QA9A 4UPEA 3ZJTA 3UAFA 2XYVA 1KDJA 4Q05A 4CF3A 3MLUL 2BHYA 3D48R 1VBFA 3IQXA 3H4TA 2YFYA 4GRMA 1KCBA 4X6DB 5AM3A 3RR2A 4MRMB 1XVTA 2H8PB 4HPYH 2JE8A 3BRDA 3NM4A 3FULA 2NXYB 4LF9B 1DQSA 3DBRA 5GGXA 2DH2A 2DLTA 3DHVA 1MAML 4N6QA 2ZKYA 3VO2A 2WSSA 1KFJB 2XY4A 3FGOA 4P4KA 4XP4H 1G8GA 3OKPA 3TYFB 4TNFA 5HGDB 4PRPA 4XEUA 2VE6A 5AW5A 2REQA 3DTDA 1SYVA 2NQ8A 1TUEA 3KVOA 3TSAA 3F7MA 4LHEA 4M61A 2FEEI 3KQYA 4QHMB 2CL6X 5DLLA 5JD5A 3R6DA 4UT6L 1W15A 2I6UA 1PG5A 4OX9B 1KBWA 3KHUA 2YD4A 1BGXL 4QRRD 3VGDA 1GG9A 1V7ZA 1J70A 2DE0X 3E81A 5I1EH 3A6BL 2YKGA 1XWIA 4IZIA 3RIEA 3V1MA 3AM8A 4CIAA 4P86A 3SKNB 1VMDA 4AN0A 2WIGA 3ACDA 4HC1L 2EKLA 1Z6GA 2X8WA 3NZHL 1XG5A 4OQTA 1E2MA 4L3CB 5KCZA 3K35A 1NKRA 3KYMA 1OX4B 4CMHB 3Q7QA 1UBTS 3H54A 2I3GA 2YHIB 3DV6A 4KPGA 4W5HA 3V4OA 2J9FA 1CUWA 1M0EA 4Z78B 1KO4A 4M49A 4MQ7B 4P04A 1E4XL 3JWDL 3RY5A 4QSMA 1EXVA 4JGUA 1YDGA 3E22B 3K0FB 3II2A 4K1LA 3V9FA 2PX2A 4Z1MD 5C2UB 3A6KA 3O0RH 1ZJJA 4B6FA 4EDWL 4L5CA 3HB1A 3BUBA 1OT2A 3GBDA 5I9NA 3P9CA 4C7MA 2WVUA 2OULB 3QYAA 3AJRA 4Z0BH 1BVLA 3G1TA 2IWRA 4NRZA 2VTBA 3HB3C 5ARCA 1XPOA 3CE1A 4TUYF 3JU3A 5DP2A 1L0YA 3EYUH 5AUNB 2Q6VA 1KR2A 4MR8B 1T6BX 2FPOA 3T7KA 1QRRA 4YBQD 1DKPA 2PLTA 2CXOA 1MFAL 1NLDL 2GFQA 4PLCA 1RYYA 4HS6B 1P4LA 3VFDA 3FHJA 5BQ3A 4MHSA 1WXWA 2PKXA 2QVBA 2PYIA 3K6KA 2HFFA 3BMWA 3ARYA 4HYEA 5F33A 1TZIB 3ZLUA 1XT6A 1V6AA 1HOCB 3P2EA 2NV0A 1YEKH 3ET9F 4UZGA 5KWJA 4PN3A 3MBEA 1TEGA 2YEZB 1C2YA 2G9ZA 1PEYA 1SHSA 4ON9A 4GZMA 4S1VA 3P3UA 1NZJA 5AHXA 1SJ9A 5GV8A 3SPJA 3AEUA 4BU0A 2OMWA 5DI3A 4AK2A 3OJXA 1U2SA 4K6GA 2PVPA 2X3AA 4KAAA 3HA2A 5DHPA 5DMKB 2PRIA 4HH0A 2J55A 1K97A 4H7KA 4P2QE 1C3LA 2Z58A 4OF7A 3RZWA 4PG2C 4TVPH 4DTGH 2GBAA 3TLGA 5JPNA 1VADB 3X13A 1I3MA 3PWSA 4QJ5A 2XT9A 1DAFA 4V0RA 1SBHA 2UWEE 3QEUA 1PAMA 4KMQA 4N48A 1V3KA 4FFWA 4NZRH 2FIKB 1QPKA 2WGXA 3OUTA 4K3EH 4A7TA 3OQ1A 3OSVA 1JRLA 4AJLA 1F90L 2OHJA 1L6RA 4LRNH 2I91A 4EA9A 3FQRA 3FDIA 2XSKA 1W91A 2XF2A 4YGVA 3HMKA 5KHLB 5K20A 3AFLA 2AJLI 2MCFA 1QSEB 2E3VA 2R23A 1PT5A 4Z4IA 1EQ2A 4J6RL 4KJZA 1ONOA 5C1DA 1ZVSB 3LZLA 3QI9B 4ZMLA 1SLUA 1VESA 2R5NA 4HS9A 3HI5L 4AMUA 4DOHE 3CLSD 4EMSA 4X6BB 5HRAA 2OXGA 3MRNB 2LIVA 3N2KA 5F2NA 1GIGL 1CQYA 3D05A 1AFVH 1U8OB 2B1JA 3K09A 2WTOA 2X1PA 5JS2A 5LLSA 3VFUB 3G3EA 3P0VL 3O45B 4MV0A 4EGCB 3CFYA 1GXEA 3DRTA 5JRDS 3KNZA 1DVYA 1R8XA 4L27A 3E0XA 4ZOLB 3F58H 4N2EA 4CIDA 1IZ0A 3OZIA 1S7SA 3TZCA 1GLNA 1IGTB 5JDJA 2GEJA 3H53A 5HYIA 3NDJA 1OTUD 2E27L 3AEYA 3OWXA 3WHPA 2JLPA 1Z5WA 3OMIB 2BGKA 3WCYA 3VH3A 3F6LA 3OJDA 5JW3H 5DMIH 1JHVA 1L9NA 2EO7A 1QZZA 5B37A 3IJYB 5I6LA 1TW2A 1LJMA 3MT7A 3F5SA 3DD1A 4O59O 4HD9A 2C2GA 3NXSA 2AHRA 2CZQA 1QOPB 2CLLB 3D6UA 2V3CC 4PWEA 2WUCH 5IGXH 4PW9A 3ZV5A 3WKMH 3IN2A 1LPSA 2WK2A 1E7UA 3PT9A 2O6HA 3NT5A 4DT1B 1CWUA 4Q1AA 2X2HA 4UOQA 1Z8DA 1POXA 2WE7A 3PYCA 1UUFA 2H26A 1T2JA 3S99A 1FFNA 1DVQA 4FE7A 2VJ8A 4CCWA 4OVKA 4G5XA 4FHBD 3B5HA 3OJFA 3VA6A 2ONYA 2AKEA 1J48A 5FGRA 3BAWA 4GRLB 3C1TA 3DC7A 1E4KA 5AW1B 4BJ1A 3THML 5KN5A 5LA6A 2NQ2C 3MLSH 4HB0A 1YJXA 5BN5B 5K4GA 3LQMA 4EUFA 5E03A 4ZBJA 2NU8A 1Y6MR 3AINA 2ATAA 2LLLA 4G7SB 1NX9A 3EASA 1WSBA 2DQIH 2FEDC 3FH0A 5B4TA 3UT5B 1DG3A 4MXVF 2C2XA 1OASA 3AKDA 2HUHA 3AUYA 2Z1KA 2BNQD 1A8JH 4U9HS 4QR7A 3L3JB 3JAMA 3GDCA 4P2OD 4Q2ZA 3CCCA 2ARKA 3ZWOA 4RS4A 1PZ3A 3MV7D 4H0CA 2XICA 1JJUA 1CY7A 2Y7SA 2BDNH 3OWEA 2WHPA 1NTDA 1VL2A 1CDBA 3M9WA 4Q00A 1PFVA 1BPLB 2O8NA 4HJGB 3CPLB 1I3VA 3B2DC 1UIRA 4RIGA 3I76A 1CVRA 1OB2A 1JDDA 2GEEA 4L8BB 1MIEH 1JG2A 5DGQA 1MO2A 3UB3A 4FDAA 4UZSA 3N2JA 5C5CA 1RPKA 2FZWA 4H26B 4OJFH 5DGXA 4QG7A 4LRTB 2WFLA 4RZXA 4PYKA 3S1AA 4C47A 4OSEA 3PXBA 3EVCA 3AEQB 2H2FA 2PDAA 3NYQA 4LVCA 2G0KA 4OAWB 3HFSA 3OJCA 2NU7B 1GZVA 4XWGA 1G6VK 4Q4AB 1VCBC 4B9FA 3T1HB 5AW9B 3DHJA 3MZ0A 5BR8B 3FNKA 3BQUA 2ANBA 3MLYH 1IEBA 4TTIA 2QUAA 2DI8A 4LP5A 1VXOA 2H1IA 1Q3TA 3GV0A 3MMZA 3F2IA 3LN5B 5AB2A 1USWA 2EQ5A 2P8MA 2QNBA 3K0AA 4TMWA 2FZEA 3OCJA 3RGVA 4FEGA 1A7RL 3QTBA 5B39A 3IMGA 2PR9A 1OH6A 2DDQH 3PE9A 3ZH9B 4F46A 4Z0NA 2PRKA 3P69A 2V5AA 2EDBA 2EAUA 3WK5A 5CYGA 2B98A 2WC1A 1JE0A 3JQ7A 2QX6A 3VWKD 4ZOCA 2Z92B 2YZGA 5JZVA 1NI4A 2DUJA 3HJRA 3RRBA 1ZCRA 1ZUD1 1ZJ5A 3SYMA 4XXDA 3BGVA 3ZD7A 3HFMH 3NZHH 5HD8D 1I0LA 3KYCA 4EIWA 5GVRA 4LOJA 2AG6A 5EPMB 1KI6B 2BFCB 5C1PA 2E56A 4HK0B 2ZUEA 2CIIB 5IOPA 1I0ZA 4XCQA 4YRMA 3MLVH 2C92A 4DPAX 3GLSA 1OXUA 1XGKA 4B27A 1X7GA 4F9PC 2V5TA 2HA6A 4PSKA 2ISQA 3QKIA 4YC2B 3S48A 1PJ9A 4QTHA 4AIEA 4HVAA 4GX1A 4YJFA 2A9CA 1X7WB 5LWYH 4B3RB 1E27B 3G5YA 2JLSA 4NS1A 3H7IA 3ANTA 3NZSA 2GILA 3DBIA 2C7FA 2PRJA 4B3MB 2O50A 1KGXA 5D7NA 4BFBD 5C9ZA 5DOVA 1AHMA 1GILA 2DWOA 4OBXA 1JYFA 2OMYA 3I2YX 4QBIA 3A3YB 2H2AA 4NONA 2W5PA 1LLFA 3FQRB 3C60A 2NO1A 4GI3A 1L8XA 2NSMA 1NQVA 1R9FA 3HA3A 3GB9A 1VF5C 3MM4A 3EPJA 1DO2A 2HLNA 2XGJA 3ABMB 1CQJB 3Q8BA 2YV5A 2JRLA 4PRNB 3CYFA 2FWSA 4OY3A 1BBDH 3BGIA 1AZCA 5HGGS 1MFCH 1E6LA 3ARBA 5HYSG 2UZXA 4WW2A 2XV6B 3QO1B 3GFRA 4AOFA 5L0QC 4MX7B 2FPPA 4Q02A 5J9FA 2IGFH 1M7HA 1IVYA 3AWGA 4WX2B 1V71A 4WTWA 3BEWA 1DGQA 5MFZA 1Q4NX 3NG1A 3Q8FA 2G5CA 4F3CA 3PUVA 3GRZA 2YYSA 2F5BH 1D5RA 2HT4D 1Y6NR 2A9FA 4JZNB 3GRKA 1Z3GH 2AB0A 4FB4A 1VYVA 2V3WA 3G59A 3SPCA 2WWWA 3IS1X 1BQRA 1NGYB 3NTCL 2EL9A 5EXEA 3I6LD 4U0RB 1VG0B 3O4LE 1E2JA 5LN4A 2UWEF 1OK8A 2WO4A 2Z6UA 2DAVA 3V0IA 1P9NA 3H1BA 3IERA 3O3UN 5FOJA 5HYQA 4NRYA 2DIEA 3RVLA 4X71A 4O5OA 5EHQA 3EDYA 4ZD3H 2BDUA 1YQVH 3HN7A 4NYJR 1HAWA 5GSVB 3N2GA 2R6HA 3WNNA 5L9DL 1CXKA 3QNMA 3QIBB 5HBBA 2Q4RA 4OTZA 5E4YA 4QF1A 2JARA 1X7XA 2ID4A 1UOPA 3OC5A 1R8JA 5E8JA 1OPRA 2CU9A 3R9WA 3QCVL 3S3JA 3HZRA 4KR6A 5KWSA 2MWMA 5TGBB 4WO4A 4MARA 3NH7L 4QPZA 1NAIA 3NW9A 2I60H 2OBLA 2QIPA 3HWSA 2PSSA 5I8OL 3OC8A 4Q3LA 2UVDA 4OZ4A 1O0SA 4US1R 4B5ZA 1CUJA 1FZMA 3H2SA 4Y4FD 3ZZTA 1W29A 2NPIA 1HNGA 1XCWA 4APQD 3UGQA 3KAAA 5CZXD 2ODWA 2AAAA 5DS8B 3KBOA 2ZR9A 3D85B 4LSRH 3EZGA 4BQQA 2XYPA 1J1PL 4KPYA 2WY2D 4OUUB 5C35A 1OXYA 1VRWA 2FX8L 2HT2C 1T5BA 3MNMA 3SE3C 4L37A 1CRPA 4U6QA 4Q03A 2Z5GA 5DKFA 5B30A 5F7DA 2EDWA 3IU4L 4M9CA 5K03A 5FQNA 1U8KB 1N1EA 2FEOA 2A0FA 4L3VA 3T0IA 4XCXA 4OFYA 3HU5A 4FFZL 5AUOB 1D2GA 3S3DB 4KNTA 2C95A 5E6UA 4RULA 3EJTA 2WKWA 3M5WA 3M17B 2QSJA 3BBLA 1JFFA 4QFCA 3R76A 3WKYA 2QV0A 5HX7A 2ZICA 3IH5A 1EJ6A 1CDGA 1QFXA 3IEPA 5T1MA 5AXAA 4HNTA 5C0GA 2FRXA 3SS8A 4NX0A 3OMWA 4YE0A 2B7BA 3WLFA 2N0KA 1XB2A 4DQKA 1J9CT 3R3ZA 4B2YA 4JG9A 4B6ZA 4JFRA 3ESXA 4RFEB 2NY0C 1Q1EA 2GFBA 1E60A 1MCSA 4BVAA 2TYSB 2QZ9A 3KDMA 4R4BB 1SXCA 2B30A 2F1KA 5KUTA 4G6FD 3THSA 1CT9A 1K75A 1Z9MA 2RHTA 3TIVA 2V2XB 4C54A 3U7WH 1ESCA 3OB0H 4IUCS 4YIQA 5KWVA 5DVMA 3MBXL 4MMXB 3B2MA 1OGYA 4DC0A 1O7JA 2R48A 2B8TA 3UHFA 5IJ9B 2GB2A 3VU3A 2QR0B 4EHDA 1PJWA 3E3AA 1G59A 3A6JA 3EN0A 4YJ2A 3HB9A 3GLHE 3WG9A 2D03L 4XARA 4YVFA 3QZOA 3K0SA 3IRZA 2TAAA 1OHQA 3TLCA 3CFIC 3RL1B 3BMVA 3FL7A 4KOEC 2HF2A 3WV4A 1N6HA 1I30A 2PW1B 3SSOA 2GN8A 1NVDA 4HGZA 4PJDE 4GP4B 4GL2A 3MRBB 1BWRA 3QWQB 4E46A 3KZOA 2AZMA 4ZJZA 2VDMB 1MAHA 4K5LA 1MU0A 4QHUB 4E31A 4ALKA 1XZEA 4GNRA 1SU7A 5FOWA 4N0PA 1WISA 1U0SY 2B69A 3NFYA 4XMVA 1MCFA 3P9PA 4XI5C 1B88A 4CDHA 2YXLA 1KVSA 2IUFA 3HI4A 2FFJA 5BOZG 3E27A 2QRKA 5PCYA 1BZYA 3SJAA 2BL4A 3G0HA 1VJDA 5AZEH 1AHWB 3AY4A 4JYAB 3T0EA 2KLTA 3QBDA 1KJ3L 4IFIA 1QAMA 1P69B 4GZLA 3FONA 5KBPA 3IDYC 4BPRA 2HPZA 4QRTA 4N0CD 2ONJA 1CFQA 5FTWA 4D4KA 3IUPA 5C9JA 3A70A 1US8B 2ZIDA 5IOKA 1U11A 4WEOA 2IG2L 1Q92A 3CIAA 4I3SL 2YJ3A 1T5DX 1Z5UA 1J8DA 2F3SA 3R9KA 3H0TB 4TL5A 4LHUG 4Z9XA 2K9FB 1E6MA 3O4GA 2OXIA 1T1XB 1J2RA 1VG8A 1TA9A 1PSZA 3SR0A 4P3KA 2GSDA 3GLGB 4WTQA 4KR3A 2VHXA 4RJJA 3MTDA 2XN0A 5MEQA 1V4NA 1YOVB 3T0EC 1C14A 4L3OA 5K9QI 3OQPA 2IDMA 4IWYA 2LRHA 3ZIAD 2D0HA 3TBBA 4E2WA 4MNQE 1BFVH 2J9YB 1QI3A 3DM5A 2WLZA 4UHDA 5HWSA 2MHAB 43CAB 4KQ0A 4TLAA 5EC8A 1KJMA 2XSZA 4HWOA 4JJHA 4TNGA 1U3FA 1GA6A 4X6LA 4F37K 2EDKA 1F8FA 1TIPA 1D9KA 5DMYA 4ZAWA 3PQEA 4XBEL 3IQHX 1E4JA 2IAAC 1CRZA 3EE6A 3FU3A 3IJEB 3PC7A 4WKGA 3I58A 4CG3A 3BC1A 3V8CA 4QLWA 4AO6A 4RBPH 5DYIA 3AQXA 3DV4A 4G3XA 4KFSA 3IPCA 2IZ5A 3U3DA 3GLHB 1JG7A 3TZVD 3LRMA 2JHPA 3L7KA 3L41A 3O9WA 2ZI7A 1DEDA 5FORA 3SPIA 1BOGB 2ZUUA 4DP6X 1JJFA 3PX2A 4BFIB 1QPBA 4MQMA 4LVHB 4CM4A 4JMNA 5GIRA 1VYUA 4TVOA 2YYAA 2VAJA 3DX7A 3WWOA 1YHYA 1AG0A 1OZTG 3MRCA 1EP3B 4Z7QE 1E3QA 1ZH6A 1FVCB 4G6FB 2R0WL 2VDQB 2A4EA 5L2JB 2H29A 1BDJA 3MOBH 3BAKA 5LLTA 1E7YA 1ZIPA 2EUZA 3RGWS 2UZIH 3TU6A 4JI0B 3UXHA 1JL8A 3IDSA 1MVFA 5EESA 1HINH 2V6IA 1YEGL 1OLUA 4KC0A 1LILA 1TZJA 2PN1A 3L81A 4II3A 1EUZA 2V7PA 2O8VA 4RCZA 2CBXA 4HBGA 1BAPA 5IFKA 2VA9A 1YTLA 2DKUA 1QFZA 5G3YA 2H2PC 2OMNA 3FT2A 5EIIA 5DZOA 1M8FA 2ASEA 4XB6B 2WUGA 2Z91A 4FQQB 2LFEA 1SKMA 5CN3A 2VB5A 1PZ2A 4D81A 5E4AA 1LPMA 1D7AA 5F76A 4KXVA 1QBLL 4X6CF 2LE0A 3PCRB 4BVHA 1BHO1 1A4UA 1Z0FA 3LCJA 1QMUA 2PQ0A 3QXTA 1WZ1L 4GSYA 4PLKD 2B8WA 4RGYA 3AFMA 4Q24A 4EJ1C 5FA5A 1JLRA 1WM1A 3AHEA 3RFVA 1IILE 2DL2A 1MCEA 2ALAA 1YEJH 1XD9A 1TJXA 1A6VL 4FL4B 2ZUDA 1NF8A 2V9PA 5K69A 3QUQA 3OOSA 2J4DA 4OGXL 4AITA 2CO7A 1BP3B 2I4MA 2Z09A 4FYRA 2DUUA 2EGGA 2HKAA 1KNQA 3KL0A 3ASVA 1M9NA 4G1CA 3OO0A 4YT5A 1VIWA 3CU7A 4FZ5A 2VKWA 4ZMWA 2LVCA 1TQHA 3NGBB 5CINL 2X0EA 4Y2OA 1RUQH 2H32A 3K8LA 4UVIA 2AV1B 1BQ3A 3CK0H 5I4IA 1VL0A 1U81A 1FFOA 5FYKH 2F1BA 3FMOB 4JPIB 3MACH 3WNOA 4LHXA 4FYKA 4NYLA 5DN9A 1WBZB 2DTXA 4EN2A 2OWDA 4Y9SA 5HQ3B 1XXHB 2G1UA 1I7TA 5K8UA 1I9GA 1EX6A 1SXNA 5CP3A 3UCFA 5GGRY 5CDGA 2XLBA 4FLQA 3KB2A 3ER8A 3WLAA 3PE4A 2G3YA 2QIOA 1VENA 4LEOB 2QJWA 3GCWA 1SKBA 4I9GA 5IMKA 3U4QA 1A8HA 1BXUA 3ZK9A 4DNPA 5AK0A 3BZDA 1LDYA 1JU4A 3RBZA 3QKRB 2A92A 3D4LA 3C09B 2ZIGA 3Q11A 4DC1A 2NNWB 3EFFB 5B3JA 3A4EA 1DBAL 2FL5A 4KIWA 2VUKA 2J2ZB 2QZQA 4HDAA 5EC1B 3QPXL 3I6ZA 1KENH 1RFDL 1ZK4A 1H6EA 5BWBA 4EI5D 1JTOA 4G8EB 5CEZE 1PJ2A 4F8JA 3MREB 5FX3A 3VH8B 4FA6A 1WXDA 4GDMA 4QHUA 3W11D 5IC5A 3WO3B 3CURA 3PWUB 3TQIA 1Q9WA 1QV7A 4FMVA 5G2NA 4LSMA 3X1KA 1KHHA 2Z65C 3GFBA 4EGJA 5ARBA 2C1PA 5TQ2H 4C0SA 2A9PA 3OVMA 3JV5A 1VDZA 1Z1WA 4WWKB 3BKJL 1BJ1H 5GGTA 4AZUA 4DP1X 5GQSA 4H3SA 3PL6D 1RSYA 4MRSA 4P3NA 2FN3A 1JEQA 4XYGA 4TTGA 1NBWB 3KETA 3QUKB 2XHNA 3IDYB 4YHBA 3CX8A 5IUJC 1BFTA 3QEGH 4XMPL 1B8NA 1KAQA 1QRDA 1ULZA 4KQGA 3GIWA 1LX7A 1TU4A 2XA1A 2OQVA 3TN0B 5GONA 3OESA 5JS1A 1MMFB 1CD1A 3EULA 3GT4A 4EKYA 1YEEL 1FSZA 3BXPA 4UCQA 3KPVA 4ZMPA 4OHUA 4NPCA 2P6MA 3NGMA 2NUPB 5IJAA 1F45A 3IIEA 3GWGA 1JZ4A 3H2GA 1PNOA 3MGTA 2FZGA 4HALA 3KDPA 3ZBTA 1JDJA 3LDGA 2VA8A 4JLOA 2P40A 5T6BA 1JXMA 3JQ6A 1SXPA 3WXVH 4HSGA 2BELA 1HH9A 4MSUA 3DBSA 1KIPA 4L9AA 1FY2A 3W5BA 2WUBH 3U13A 3WO0A 3SSAA 4BAGA 4JFDA 1FXWA 4TQEL 3ZKAA 4RELA 1YYLL 3ZWKA 1AH2A 2MEJB 4PCVA 4XVJH 4K3GA 4L22A 3UEZA 2HQ1A 3OPQA 3QEUB 3RHZA 4K3JL 3KLMX 5AM5A 1UH3A 3DM9B 1FC2D 1FUUA 2DT5A 3P0FA 2C9VA 3K1AB 3TDNA 1KEVA 2ATPA 1SCKA 1X92A 1FV1B 5EIOA 4WDQA 1QX4A 4L4TD 4FNLL 4ZAXA 1PWZA 4H6XA 4YMUA 4D41A 2ZSAA 4PZUA 3EW3B 2X4QB 2OMUB 3AWEA 5J6GA 3I64A 5L7XH 1BOFA 3TTWA 2J1LA 1XZMA 4LF6B 3LHAA 4TYPA 4MVBD 3KJHA 3OX2A 2Q49A 2J9GA 3ZV7A 4PJEE 3V4PB 4BE4A 3OT1B 3IR7A 1IONA 4JZKA 4OIMA 2YPLA 2B5WA 2X4GA 3NTRA 1A96A 4XB2A 1QIDA 1G0NA 4HIEA 4EVRA 3AEZA 3I01A 1J6UA 4PTZA 1TQ6A 3E3QE 3I9JA 4IUBS 4N2OA 1WZ2A 5E9JA 2Y7QA 4PJXA 2N42A 2VLIA 1QBML 2JKNA 2NOAA 3VD3A 1QLWA 4HKZB 2ZWYA 2Q5OA 1JRHH 5CGYC 1WZKA 3RW9A 3B3FA 4H1VA 4XOUA 3BE8A 2CRZA 5BO0D 1PBYA 4GW5A 4I0PB 4JI2B 5DIZA 1U31A 3D34A 2GM3A 4PB9L 5F9OH 1CVSC 1PQUA 3VHQA 2MQCA 1JAHA 3ZR6A 3QIAA 5J1AA 1J8MF 4FOSA 2IPLA 4LKCB 2WABA 2M6KA 2IBMA 3ATFA 3WMGA 4M4SA 2BWIA 4AGOA 2VZ9A 1R46A 1W4BA 2B8NA 4Q4DA 4X9BA 1CU4H 1AHWC 3GM0A 2Z9DA 1ZCZA 3FLBA 4KDFA 5AUPB 3JTMA 4FYIA 3S0PA 1SUSA 4YAKA 1SCIA 1NLFA 1T1WA 4GF5A 1C9DB 3C8DA 1N1MA 3UYPA 4CGTA 2OR9L 1DG9A 2C8LA 4CCYB 4L4VA 2ZSKA 5DD0L 3LK7A 3H3PH 2ZUCA 5T3XL 1ZESA 4DMGA 2HCRA 3ZHQA 4BKLB 1NMZA 4D98A 3GMNA 1R3IH 4GEIA 3ZDZE 2HT3C 5ITBL 3S3CB 1ACMA 3DWEX 1N6IA 4LL4A 5KVEL 4ZEOA 1W52X 5HGHA 5ACMA 3V7YA 3WLSA 2QAGB 3P27A 1QLEH 2EDQA 5HDBB 5K9ZA 3QHFL 2A9OA 4PJAB 5D7JD 5ETUA 4KV5F 4ZAKC 2X3BA 5EZQA 2EFGA 5I7FA 3VMNA 3QIWA 4RVHA 2ZJAA 4Y9EA 3K6IA 2HSGA 3TX4A 2C20A 2IV9A 1PR6A 1U0TA 2DUWA 4DHEA 4V0ME 2O8EA 1Q20A 4X7MA 1XMSA 3U7WL 3QNXB 3PCTA 4OFXA 2HU8A 3COWA 1XVUA 2OSWA 2WXQA 1UBCA 4QU5A 3SZOA 5JXEA 4V2UA 4W9HC 1C9NA 1ZWIB 2PKDA 1Z2NX 2XKAA 1JHLL 1U2YA 1KTVA 5E0QA 2P90A 1CGWA 2YVAA 4JHUA 4D0DB 2H2SC 2IADA 4LPCA 3LYLA 2ERYA 2WZQA 3U0PB 4ICIA 4HWEH 2Z2ZA 2JGFA 3S81A 4U3XA 3ZXIA 2E75C 3W5SA 3FU9A 1MLCB 3HPLB 5AVZB 4DLWA 4LAQH 1WO8A 1M10A 2XV3A 4KDWA 1RLOA 1R9JA 2AJ3B 2B59B 5JDSA 2WYIA 2FZ4A 5FPQA 4G4IA 3SSMA 2JJVA 4E5XG 4CSZA 1TF4A 1IIRA 5GXBB 3FOMA 3HR5B 4JO4L 4GPTA 1Z9NA 4LCIH 3SS9X 5FCUL 1A4CA 1DE0A 3L4YA 2E46A 5T7BA 1WOMA 2YFQA 1FYTE 1DVFC 5LMUB 1VGRA 1JI3A 4NHEA 1YRYE 2FQFA 2WVVB 4OLBA 4A6YL 3PWTA 4UAJA 1DUVG 5J57B 2W8ZA 4JX8A 2YVLA 5DWUH 4ZI7B 1OB1B 5IW6B 3LQFA 2GNAA 1OR8A 4RVOA 1F2QA 3QHZH 2DQMA 4WZBA 1ZHNA 2FGWH 4TV8F 4HAKA 5CEXA 3V4LA 4HT3B 4KY2A 4LBVA 1KVRA 3DMYA 1RVV1 3MT9A 1A5FL 3DZDA 5FXCH 5DTJA 4LCWE 3BZEA 4RD0A 1R3HA 3RYCB 1DDOA 4FOMA 4BK5C 1HTTA 1GKIA 3LUJA 2A5DA 4AULA 3U2JA 1VQ1A 4E33A 1WZCA 2X58A 5BZXA 3ALXA 2V55B 1E1KA 3GSOB 4RYLA 4AI6A 1RKQA 3UAVA 1Q84A 4F9LC 3DEAA 4ERNA 3VYOA 4XVRA 4DMMA 5DFTA 1UMBA 1ESDA 5IVHA 5IHWA 4HRXA 3ACBA 3UT6A 4P93A 4IIQB 1SMKA 4MULA 4GBXA 5A43C 1OPGL 2DIBA 4GG6E 1AGYA 5FEUA 1U98A 4DARA 5F7XA 4MJ3A 2WU1A 5I5EA 1QMGA 4ZV9A 3LS5L 2AI1A 3QLTA 2VT6A 2PRZA 1ZVVA 2AZ4A 1WMEA 3ENVA 2PZAA 1WULS 1RI8A 3NEXA 3PXDA 2DWEB 1JXQA 2XBMA 2G5PA 2KS6A 3AU9A 5CXXA 2P3YA 1J8KA 1H6AA 2HUNA 4XB7A 3TGPA 1JPUA 1E43A 4MEBA 3FZQA 3I9KA 2FY8A 2JZOA 4NQVA 2YBRA 3NZ8B 3OQVA 5IXYA 2BFWA 1KNOA 5EWLA 4G72B 3R7QA 1M7GA 3OPXA 1Y0BA 2ZYTX 4EFKA 1C4XA 1T2XA 4MMZC 2BBWA 3ZW7A 4H8VA 1ZKMA 3K5SA 5DC9B 4POZC 4GVPA 2BP8B 3O2SB 1SVBA 3RWHB 8GPBA 4RWYH 1WCWA 3QO1A 5GHWH 2B3RA 5JS8A 3VTKA 1H65A 2EZ9A 3CDGA 3QK0A 4A7UA 3K4PA 4KLNA 4W1SA 4LZKA 5F7EL 1XA4A 1CJMA 1ISIA 3IT1A 5E7QA 3DR3A 2PTUA 2YWZA 1HYHA 4WI9A 2QSYA 2Q3AA 5KSBB 1ZK5A 5I66A 2YFNA 2EXTA 2H16A 4ZVKA 4R1OA 2WFZA 1A6AB 4K3DL 2YTZA 2PGLA 5J2TF 4CN8A 4B9IA 1JWUB 3KFXA 3QEHB 1BQSA 2V5MA 2JGRA 1BOOA 3DVAB 4N3AA 3ZZQA 1AXIB 1PY0A 25C8L 5EU3A 1WUHS 4KVFA 4QRPE 3FKJA 2O6EA 3LHPL 4P59H 2FMFA 1DKMA 1T4BA 1EQAA 3PL5A 2QA5A 3SBRA 3K1TA 1WBYB 1YZQA 2RKBA 4P3DB 2BW0A 4JI4B 5M94B 1SZCA 1NRXA 5LD2C 1OSPL 3RUGE 1NXOA 1H15A 3WL3A 2NTJA 3ARTA 3O4LB 4JFYB 2C82A 3CVIL 5T1LD 3VFPA 3UJ8A 1TMGE 5H70A 4FCAA 6PFKA 2WMNB 2P8LB 2AC0A 3ZE7A 2P5WE 5JCPA 3BN3A 1QDUA 1BX0A 3OWOA 3HB7A 1UUNA 3ZYIA 2FO8A 5DMXA 1RRPA 3MV9E 5BUAA 4P46D 1MCQA 2QMYA 5TR9A 4V39A 5F21B 1G5AA 5IDQA 5HY9B 1H85A 1NM5A 4BN4A 1U1FA 1U8EA 3OX4A 3KL3A 4URTB 1EBAA 1JYNA 3SE8H 2XX0A 2ORBL 5J3HD 4IEFB 3AS0A 4KKCC 1QVOA 1AR2A 3OZLA 1C1DA 4WCYL 4RSGA 4H08A 1MY5A 2I66A 1MR3F 3ADDA 3EVZA 2QUKA 2IOHA 2JKWA 1XK7A 3QX3A 1H2RS 1W5AA 3RVJA 5ER6A 5CDTA 5DYTA 2LW3A 5D1ZC 2CVHA 3P97A 5FOUA 4WJKB 3BKCH 4CC4C 4WY2A 3PGJA 3CVHL 4RMRA 4X9XA 5EUKB 4PYNA 3HKFA 3AOEA 1VA5A 2VLJE 2NUTA 3PG2A 4MYRA 4JFWA 1JQBA 2RHDA 3KW7A 3MUFA 4M9ZA 4X7FC 4JQIH 1ZJ4A 5BPHA 2ITDB 4P4GA 2VUHB 1KIMA 1KB9J 4OJTA 4UTOA 5JXAL 1OYYA 3LXXA 4BJ6A 1UYWH 2J0UA 4YGAB 2VF7A 1NG1A 6AT1A 1UZNA 1SA0A 1P17A 3RS5A 4LKXA 3FOBA 3FUEA 3SC4A 1HDGO 2PUGA 5IFJB 2BWDA 4IIUA 3HEIB 4FW8A 1IYZA 2FX5A 2M1ZA 5BZWA 3KR1A 5GISH 1Z4NA 1UPFA 5JCXA 4GE0A 2XQJA 2HPHA 1NCNA 3HUJE 1D1PA 3V5DB 3WWDA 1N8ZA 5AIBA 3H9QA 3QJOA 4DUYB 1KFBB 2CDNA 5LYJA 1DXOA 3PV6A 3ROZA 4D92A 4XO8A 3AUSA 1GSOA 5I30L 4AB1A 3E6HA 3GPLA 2CFOA 3ZDYB 3JRNA 3WY4A 1W5TA 4F97A 3IDMA 1MJNA 3BYYA 4NV0A 4OQEA 4BB6A 1FNLA 4I5BB 2ZG3A 1CMOA 3QSGA 2WQAA 5F6HJ 3GQBB 3L3HB 4EQ2A 1R4AA 3UGKA 1JNJA 5F2OA 2YHBA 3PNLA 1OREA 5KC8A 2MCG1 4E9WA 4IOKA 2WYWA 1MW8X 2ZWMA 3NDIA 4OZIE 2BVPB 1T7WA 3E5NA 5FUYA 4FDVA 3UQYS 1F0KA 2XPCA 5K3DA 4DDVA 3OKLA 3RRJA 4OFPA 1T2CA 5COBA 3OZ9L 1MDBA 3T7SA 3K6SA 2CB9A 4UEJA 3N75A 4D9FA 1OBCA 3WGNA 1IK6A 1V8HA 3IP9A 1L5GA 2HIGA 1Y7PA 3RTAA 4ZW3A 4NJAL 5CHNB 3UJHA 3WDIA 4IGBB 3G8BA 2B1HL 4R8WL 4JKPH 2PGJA 3HSKA 3P2TA 2YN2A 1MFPA 4KROB 1VFNA 1W581 4MOWA 1MO4A 1QYDA 4RZCA 2LWIA 3EJCA 1EMTH 2R44A 4IKLA 5TQ0H 1BIIA 3Q5GA 4V0LA 3W5VA 3MV9B 4WU5A 3ZMNA 4PJDB 3Q2NA 4DG5A 4B5KA 4U1LA 3EDMA 1EXUB 5SZIA 1FZTA 4I18A 2I8CA 3PB3A 5D7IF 1B1AA 2Q5EA 1IRAY 1Q0RA 2A0YA 1ONQB 1P19A 1MPXA 4RWHA 3QDGD 3R24A 4UVHA 3IIMA 4N8VA 3NCMA 4PR0A 1QRNA 3ZHXA 4EUSA 3LKBA 2PUTA 3EZXA 1M8PA 4UARA 1E6JH 5IQ9B 1KTDA 4BFJA 2QSCH 3STZA 4PIMA 1FO0B 5E1GA 5EBGA 3DKKA 1UZAA 5BOJA 2YD0A 3ROOA 1FVEB 1T0PB 4GM0A 4CIVA 3SF8A 2GD6A 5HE9A 8FABB 2CY0A 2ZCJA 2J6EL 1Y34E 5CEJA 1TQBB 4LY0A 2BDNL 2ICEA 3MLBA 4FC6A 4U0JA 4O2EB 4L7QA 3M4NA 3TCLA 3CLTC 2O3UA 3BCDA 4AQ8A 3VMFA 5DHDA 2VR4A 4K7FB 2IFFL 1KZQA 2CDCA 3QFJB 1SOAA 2FLKA 3AX6A 2GBCA 3IUSA 4PP1C 3I2GA 2PA0A 1IFRA 1O6CA 4OB6A 4UNVA 2BKXA 5ETJA 1OM3H 4ZZKA 5G1OA 3KXLA 4MMYB 1JEYA 3RWBA 1XEFA 2BS9A 2GJ8A 3R0XA 3DCJA 3ESPA 1NP3A 4TYWA 1GPAA 3QJHA 3PRZA 2XIBA 3WFEH 4KOBA 3V9CA 2ZWNA 3SGJC 1EB8A 4J94A 2X4UB 3VKVA 3D1MC 1AR1C 2QAJA 3G6AA 3IVKB 2W93A 2XCSB 5CNJA 5CCEA 3HE7D 5DJAB 4RADA 3GHPA 4P3DA 3MJ9H 4YVNA 4Q7LA 2JIXB 1CJVC 3MX0A 3VFNB 2ADOA 4MQEB 2FUNB 1ZQ9A 4XX1E 3L8HA 2FK7A 5LBSH 3B2NA 4NO2B 3AUXA 3LUDA 4O0LA 1QZXA 2K9UA 4TT3A 3VPBA 4ZOAA 1CUAA 5C07D 4DGYL 1OU4A 1ZIYA 3C5VA 1U8CA 2P5WD 3O3MB 3BMQA 3TLEA 1X39A 4K81B 4U1HB 1QQ5A 1PVVA 2QDXA 7FABL 1APBA 1KFGA 1IZYA 1K7EB 2DR3A 1A6VH 1ABEA 3A1SA 4W9EC 1W1IA 4QG3A 2CG9X 4M7PA 5AKRA 2WR8A 1DQQA 1IM9B 3HHSA 1BW9B 1HNZB 5IROA 3LV3A 4F6LA 2ZCUA 2EX4A 2W2QA 1F06A 3LXRA 1NIDA 3HMXL 3BZ4B 5L2KA 4CU5A 2X53A 1RPJA 4LVOB 1DQVA 5YASA 4N3TA 3A3KA 1CUDA 4AO8A 5FUWA 2VF2A 1P62B 25C8H 1HILA 1YIDA 3OAAD 2JJ1D 4I4IA 2VDKH 4KIJA 1N67A 1GQFA 4F38A 3WNPA 1JBJA 1J5EB 5JPNB 3BX7C 1S6YA 5KX5A 3RPKA 2KQMA 3B5IA 4X5OA 1NQOA 2PM8A 4IRZA 5TGTA 3MNWB 1YEGH 4EI0A 4X20A 1VKXB 3VX4A 3VGGA 3MJ6A 1J5IA 4IYKA 4TSAL 1TKRA 5JHDB 4KQXA 3LUAA 3PLYA 4BN5A 2F53B 1KGWA 3AXTA 2C4FU 4KXWA 3K70D 2Z2XA 3X3HA 1AIZA 1HYRC 1TYDE 1HYSD 4UNTA 1QABA 4OQTH 5ALZA 4Y16C 1UKQA 2I9LA 2QDKA 2YRZA 4CQMB 1F13A 4X83A 1FIGH 3REWA 3FVRA 2N59A 4LPTA 1YFZA 1TL7C 2B3TA 2R1YA 1OAOA 3KV3O 4HSQA 1T4CA 4NK5A 3DC2A 1FQ9C 1XGQB 5HYSB 1TO2E 1EEYB 3KJ6L 3F5MA 3CQ9A 2Q76A 3O8XD 2F9LA 4IHAA 5LG1A 3IA7A 1YL7A 1JVKA 2H2WA 3ZKMC 3HLAB 4ODBD 4NRZB 3G79A 3EWAA 2DLGA 1QQDB 1TTBA 1Y8QA 3F12A 4OCSH 4JJKA 3EQZA 4BMXA 1OBOA 1DVFD 1EE2A 3BIJA 5HGJA 1CBVH 3QKTA 5HYJE 4MJIA 4Z7NF 2IEBA 3FZYA 3IMUA 3B6EA 4LLMA 1K85A 4U6VH 4AEFA 4TMFA 5TMPA 3ZVLA 2IDTA 1RD6A 4JLRB 5KBNC 5JA8B 1E9AA 5G0WA 1GU1A 1XEXA 3QF4B 2MMXA 4H7HA 4PV7A 1ISPA 2E6KA 2IXEA 2IF2A 5CP8A 1AU9A 3O6LH 4RVCA 2EYRA 4NYIQ 4RGBA 4HJUA 4W9RA 4F86A 3IEKA 2IOQA 4P3OA 3FCGA 1D6VH 1KCWA 4AUUA 4ZANA 2WWVD 1MC5A 2XTAA 3GSNH 4J1TA 1MP0A 2NTVA 2JTDA 5IB1A 3CFJB 4ENRA 1J0HA 3C6SA 3JZMA 2VHYA 3ILPA 1QHFA 5EE1A 2UXDB 1T26A 1U6JA 3LKPB 3TBTB 5DSCB 1DJPA 5LO7A 3ENQA 1OTSD 4OLZH 1PV1A 4KTEL 5AG9A 2W4IA 5C07B 3WZMA 4MXQC 1DLHB 4BNXA 4XPBH 3VRLE 2K7ZA 3BIOA 1G5PA 4AZSA 3KPQA 3QLUA 4RGVA 4QLAA 3S4YA 2NYRA 4ZCQA 4C4PA 2YJGA 5FPTA 1YAZA 3DF9A 4BDSA 3KSAC 4MHHG 4YRTA 5B22A 5JQGA 1LO0H 3LPWA 3R7AA 4NZ8A 2XYHA 1HZHH 4HBQA 4IK7A 3STZB 2FN8A 1EHCA 1HT6A 1PGPA 3JTTA 3B36A 1U91B 5C0IA 3QEBZ 3M3DA 3WQBA 4C20A 5BVJB 3G2QA 1EVIA 2OMKA 1FMJA 5BR1A 1P2CB 1IC1A 1SD1A 3CVUA 2VDLB 2F8MA 3IP5A 1S3IA 3QUGA 3ZCPA 3DK2A 4ABQA 4QKTA 2O2IA 4M8QB 4HFWA 1IHYA 3AFNA 3K8OE 4WWKD 2WPNA 2H1SA 3AYZB 3MW8A 4CM9A 5E23A 3KLOA 4PTUB 4FFNA 3FNEA 1ORQB 2XE7A 2VCOA 1RFLA 3EXIA 3FQWA 4EI8A 4EUNA 5C0FB 3ICOA 2BMKB 1OKKD 4B0MM 1UJCA 3MS4A 1DO8A 5ICMA 2QNIA 3TWYA 4HAOA 4MA7H 2EYQA 1F48A 4O4HB 2VZUA 4NQTA 5EJ5A 4BQNA 5L3RA 2EYTB 4EG0A 2GEQA 1JA9A 2JLLA 4X6CB 2ZZNA 4U9UA 2OZPA 3BQUB 2HRGA 3D3NA 1D2EA 2QVIA 4PEEA 2Q8AL 1BFUA 3LW8A 4GYJA 2FXVA 4X65B 2II6A 4PGZA 1YQXA 3ZU8A 2C8JA 3FYSA 1M1ZA 3LQAC 4CMBA 4ZK2A 5DHYA 4ZUUB 4F1KA 4MYUA 4FK8A 1AGBB 3V0HA 4U4IA 1BXGB 3C8UA 3GMQB 3WNZA 1D2CA 4GPBA 5CJJA 3PC4A 2WBXA 5JQHC 2I4NA 2FPUA 3AXSA 4FE4A 4RGMB <