4Z7OB

Integrin alphaiibbeta3 in complex with agdv peptide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4z7oB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4z7oB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4z7oB03
1SHUX 5BV8A 3EGXB 4PN7A 3NIFB 2ODPA 3AL8A 4MMZB 4NENB 1XUOA 3OKYB 1MF7A 4MMYA 4Z7QB 1M2VB 5KYYA 1JEQA 3IJEA 2ADFA 4G1EB 4FX5A 3BN3A 4O3UB 1MJNA 5E6UB 3VI3B 3EFOB 3K6SA 5KYXB 1JEYA 1YVRA 5ES4B 1BHQ1 4MMXB 5KYWB 2NVOA 1U8CA 4G1MB 1M1XA 2P28A 3FCSB 1UEXC 1XDDA 2VDPB 1AOXA 1N9ZA 2XWBF 3K72A 1AO3A 1IDOA 1JLMA 1BHO1 2ICAA 1U0OC 3HI6A 5KYUA 2VDOB 3VI4B 1IJBA 3RAGA 3OL2A 3NIDB 4CNBA 3EGDB 4WFQA 3TCXB 4BJ3A 1OAKA 3E2MA 3AL9A 4F1JA 3V4VB 1SHYB 1QC5A 3ZE0B 3AFCA 1JV2A 3FCUB 3K71B 1ATZA 1PT6A 3EOAI 4JX0A 2QTVA 2UZYB 2XWJI 4WK2B 4XW2A 2NUPA 1T0PA 1CK4A 1JEQB 5KYYB 3IJEB 2VDMB 4HQNA 3EG9B 3ZDYB 2M32A 5E6SB 3EGXA 4NEHB 2VDRB 4NENA 1YUKA 3Q3GE 2I91A 5HGJA 2P26A 4CN9A 1AUQA 1RS0A 4HQFA 5E6RB 1MQ8B 3K72B 3T3PB 4IHKA 4WK4B 3ZDXB 5E6UA 5KYNA 4O02A 3IBSA 3OL2B 2I6SA 3EFOA 5KYXA 1V7PC 4O3TB 3F74A 4Z7NB 3EH1A 3TVYA 4HQLA 1PD1A 4G1MA 3FCSA 1L5GA 3AL8B 2WINI 2ODQA 2I6QA 3F78A 1M2OA 1QC5B 2VDLB 2VDQB 1MQ9A 3EOBI 3NIGB 1JV2B 1ZOOA 4MMYB 3PPYA 4IXDA 5HJ2A 1DGQA 1SSLA 1XDGA 1IDN1 1RD4A 1SHTX 2NUTA 3TW0A 4Z7OB 4HQOA 3QA3E 4IGIA 4UM9D 1RRKA 3GXBA 3K6SB 1PD0A 3OKWA 1JEYB 4MMZA 1T6BY 1IJKA 1U8CB 3K71A 1M2VA 2XGGA 1M1XB 3M6FA 3ZE1B 1YVPA 4UM9B 3ZE2B 1Q0PA 1U0NA 1OLZA 2X5NA 4G1EA 1FNSA 2WW8A 4C29A 3PPXA 3HXQA 5LN1A 4F1KA 3V4PB 3T3MB 1NA5A 5KYUB 3BQNB 2O7NA 1MQAA 3PPVA 4JDUA 3EG9A 2VDKB 1SQ0A 4MMXA 1CQPA 5KYWA 4A0QA 1PCXA 4O02B 1FE8A 1RTKA 5E6SA 3ZQKA 3HXOA 1ZOPA 2VC2B 3EH2A 1DZIA 4WK0B 3ZDZB 2VDNB 3NVQA 1TYEB 4CN8A 2B2XA 1L5GB 4FWWA 1M1UA 1ZONA 4HQKA 1LFAA 3N2NA 3TXAA 4DMUB 5E6RA 2IUEA 3EGDA 4C2BA 1N3YA 4UM8B 3PPWA 4C2AA 4WJKB 5HDBB 2NUPB 4GZ8A 3BQMB 1M10A 4M76B 2NUTB 1QCYA 1MHPA 4K3JB
chains in the Genus database with same CATH superfamily
3AHDA 4S0ZA 5EO9B 1XJQA 1NMBH 3R4DA 5BJTA 2BMJA 5L88H 4ZZKA 2CIIB 4QRPE 3A05A 1PRYA 4PYQA 4UOW0 4B3RB 3VGJA 3V6BR 3PABB 1XXHE 5TPWB 1YCSA 3OT4A 1PL0A 2QRUA 2YJ5A 3TBKA 1XD1A 3OR7A 1FTNA 4HSEA 2Y6SC 3I05A 2DQHL 4ODVH 5ELMA 1B8NA 2CXHA 1B26A 4X6EA 3CZCA 3DG9A 4WWKA 5BUGA 3KGUA 3VVVA 1E1RA 4XMKL 3EOAA 2QD5A 1HDCA 5IJ9A 2EDBA 3SYCA 5L4JA 2ZETA 3WDJA 5FRDA 3ZCRA 4ZVOA 5C9ZA 4FSDA 3LK7A 4OKVA 5AVUB 1Z9PA 1QH0A 1UPTA 4GC9A 3WN5A 2IK8A 4JJIA 1COBA 1F97A 3ZSTA 1KI8A 2D2XA 4PQFA 4DEYA 3KK0A 4XOAA 4B34A 1BN7A 4KN6A 2O3SA 3AS3A 4F9PC 2FUQA 1VXOA 3I75B 5EN3A 3KKQA 1Q9OA 3URMA 3DE0X 5DNCA 5CP8A 3LUJA 4UM9B 2XA1A 2QORA 4BZ1L 1ET8A 4AEHH 5ID0A 4BFFA 3DS8A 2AW3A 5KVDL 4P82A 1A2QA 3ZE2E 1A6ZB 5DWVA 2UUBB 1KCLA 5D6CB 1XMPA 3P5BA 1AVAA 1TMQA 4IMPA 1RWPA 4P2RE 3D3VA 4DKFL 3ISYA 2R83A 4AE0A 2F8MA 1ZCFA 3UBFA 2FH6A 2FUCA 2YV4A 5HE8A 2BFMA 2GBTA 3B2PA 2V2TB 3MLTA 4F56A 2XBLA 3EAGA 1UFVA 3LQRA 3Q8CA 1HYHA 4QLRA 2C9ZA 2IITA 4GO8A 4IHJA 3C3AA 2YRLA 3IEXA 4NZRL 4PB0H 3CINA 2OB2A 4KLCA 4CG2A 2HPOA 4HT1H 3SKOB 1DVTA 5E2VL 5J3JA 4X9FA 4CUCA 4EGCB 3MBEB 3SGLA 4YK7A 5JHDE 3GRRA 3L5OA 4WW2F 1B0WA 2BMKB 1IAKA 4Z3GA 2WFZA 5HXAA 3MV7E 4PPNA 5E6RB 3GEEA 5AB9A 3AETB 2H1LA 1HYGA 2W07B 4DMHA 2W2NA 1QPGA 2BOBB 3NJGA 3CTTA 4KQKA 1R6VA 4MGYR 4NOJA 1BFVL 3A4YA 4YXKH 5C7ZA 1XTKA 2JLBA 3SY8A 2XT0A 4N48A 4U00A 1KGCD 2O7NA 1IKOP 3KPSB 1RXEA 2L2QA 1QBKC 3MFFA 5C09D 3WGIA 1JZ6A 5IC5A 1L7IL 5KVGL 1DOZA 3WBFA 4EARA 4FBMA 2HYDA 1CBJA 2Y1AA 4GMTH 4KDWA 1B0UA 4D99A 4FVTA 1NCHA 3UTSA 1YN6A 2WWXA 4ATNA 4NQED 2QNIA 1IGJB 5D55A 5H3HA 4ZXBD 2IDUA 5BNZA 5JO5B 3U4BL 2IEDA 5K6AA 1HHKB 2YBDA 1MNUL 1NFDA 3ARDD 1WOMA 4E9TA 4UQ3A 3P0FA 4MUGA 2P30A 5TMEA 4MW0A 4RTNA 4B7ZA 5BW6B 5IX8A 4GMGA 1R3JB 4QECA 3LT1A 3FTWA 2P3SA 5BZDA 4ENVA 3HI5L 3ILXA 2XN9D 2BC4A 1XFDA 5HPYB 1NBZA 4XNQB 5CHNB 1NMEA 2HVBA 1RJEA 1F2TB 5DUBA 3ZIYA 4CJ0A 3HBPA 1J8FA 2AKAB 3LTEA 3A3YA 2UVFA 2EKSB 1H8HD 4E4YA 3G6KA 1BZ8A 1M1SA 2RQ8A 2QQKH 2AFVA 3OGCB 4GLRI 3FTPA 3LZOA 1K7CA 1DN2A 3Q6GH 3O8QB 4HFMA 2RGXA 3L08A 4BFNA 3OKDA 2JLPA 1F1JA 3F5MA 1TIBA 3B7GA 3QEUA 3V4PB 1EZVX 3HVDA 1MIEL 2QQLH 1RC0A 3K4PA 4KPFC 2X6BA 2G28A 2B35A 1GZPA 2R1VA 2ESVD 3UK7A 2BIFA 1BQHG 5IYZA 1KDOA 3W5BA 5AOBA 2XMBA 3J2PA 1TEFA 3UTTB 1RXLA 3CZ9A 4ZZ0A 4DQVA 2NZWA 3GDCA 1BAGA 2B82A 3RJQB 4HH3C 3K8OE 1ZTMA 1MEOA 2G8LA 3ZHYA 1QSED 5F93C 3BXZA 1FZJA 3G2LA 2F7RA 5LJLA 2WCPA 1IGCL 3C5ZB 3AF4A 4JB8A 3COSA 2GBLC 1FSKB 4D8PA 1SXGA 3P97A 2W0SA 4ABUA 2Y0CA 4HYQA 4JFEE 4MA3A 2JWHA 3C7CB 1MRFH 2CZCA 2K5UA 1Z16A 4O3MA 4K1LA 5I1HH 2KSQA 2PKCA 3LHIA 2ZWKA 1R16A 4B4VA 3FRPA 1G17A 2K0RA 2X6QA 3BVUA 1XNRB 2XUFA 1COWD 5D1XA 7PCYA 1Q92A 3PP3K 3NC0C 1O97D 4B43A 2WXGA 5GS1C 5GRVK 3DQPA 4FB4A 3GZTB 4ZDKA 2OC4A 2ZKHH 2MWCA 2UZ4A 3OJ2C 1YPZB 4R16A 4R8SA 3HG5A 2BK8A 2W65A 3LUGA 4MPTA 4PJ9C 4PGJA 1AB6A 3RU3A 2FI1A 3OZDA 4WZ6A 3ESOA 3C14C 1XB2A 4GLOA 1AUOA 3QHAA 4FQLH 2CBOA 1SU4A 3I76A 2QV7A 3HZVA 1RZ7H 2UYLB 1JAXA 1SVLA 2H6PB 5BW8A 5TPZA 1T0MB 3O8NA 4GX2A 1MJ7H 2MSPA 1CY0A 2VT6A 1IBLB 9MHTA 2C5LA 4TTRA 2WSKA 1M1UA 1JGEA 4PJAE 3CFBB 1B8PA 1RWBA 4ALNA 1WZLA 5JDJA 1DFXA 1T7WA 5IM4F 5IT2H 3RWGB 1XSOA 1LRJA 4G0UA 2GM3A 1RKBA 4R4FL 3OLVA 1AZZC 2QN9A 4JY4A 4UREA 1L9SA 2VPZA 5HMLA 5TQ2A 3O6KL 4OBSA 4RRPG 4Z3FA 1CUVA 1ZGJA 2O6CA 1WSAA 1ZKDA 4JG9A 4IW4C 5K05A 3MZ0A 3HS0C 3LPNA 4HWBA 5ITBL 3FOWA 4YNBA 3ROFA 3HI6A 1T15A 4WSKA 3OJXA 3F98A 5MENB 1F7VA 5C81A 3SFZA 3EIWA 2CXXA 4GT0A 4X7BA 3W0WE 1Y1PA 2X5JO 4LNUA 5FO7B 1EFRA 2LAGB 4A15A 3LLSA 3P9NA 4JHXA 2I9LB 2UWEA 4LOVA 3D64A 1CE1H 3QUMB 5DHFA 2O3JA 3SO5A 1YAHA 3OF3A 4XOUA 3ETNA 3WHKA 3P4OB 3EVZA 4AMKH 1G7RA 5SWZD 2WTPA 5AJVB 3FUCA 4Y2NA 4IRZA 4YXWA 3JWOC 2Z98A 5ENVA 4Q3DA 5DO2D 1NDGA 4O4LA 4OH2A 2I2FA 2Y9MB 3ECWA 2PRYA 5E1AB 4ZYKA 3MTXA 3TOCA 1IL1B 1AXSB 2OKGA 2G6TA 3UJAA 1ZA2A 3KPRA 1QW9A 5C5EA 3V7AE 2PS3A 2F1HA 2Q9UA 1TTTA 4KJWD 4D97A 4XAWL 4G0WA 3QUXA 1ET7A 4K71B 3UBTA 2QT1A 1SJMA 1T3GA 2R0KH 1TOXA 2FX5A 3EEQA 1PVVA 2V8MA 1IQWL 4J7AA 3W5CA 3PPWA 5HTOA 3B9RA 4CKZA 1YR1A 2YPLE 3AWGA 2BRRH 3MRMA 5LAXA 3WWYA 1E2IA 2FEWB 2ZK7A 1JQEA 3GEHA 1BIFA 1RWKA 2FV8A 4XNMA 4GR4A 2QHXA 3BPCA 3MXOA 2QL5A 1GWNA 4WLVA 3UJ8A 2O2XA 2IAMC 3SJAA 3GIZL 3WS6C 4OI1A 2HQOA 3SYPA 3VXUB 3GLIB 3CH1B 3N6YA 3Q9SA 4ZOLB 3ETGA 5I6DA 5JZ7D 4URXR 5ESVB 3CU1A 4HLZG 3RKRA 3WJ7A 1RRGA 1IC4L 1DO6A 3JV0A 5J58A 3DVIA 2C5FA 5MI0B 1OE1A 4WQOA 4J1UA 1KFAH 4W9JC 3DXXA 4RMTA 4ZVNA 1MA0A 3ZGYA 1UAYA 1UT8A 4QNNA 1J49A 1ICEA 2BNRD 3ZHRA 1E9CA 4YK4B 1D2GA 4ZN6A 1VHPA 4O9HH 4RGVA 4EB3A 2REQA 2Q27A 3LG2A 4AY6A 3GSNL 5EZSA 2VJMA 1SU6A 4RXMA 5GIRA 4LCIL 3EK2A 4FQHB 2AQIA 3HXQA 1JHLH 3TNNB 2XKUA 4FHCA 1WHTB 4F38A 4ZT2A 3LEYL 1D5IL 1N2CA 2YD6A 3LUBA 1I3UA 4V2BA 4B8WA 3IIMA 1WS6A 4R9VA 3KDPB 1KOLA 4OF0A 2OP4L 3DGCR 1POWA 4X99A 2YIDA 3AVPA 1G9HA 1KPUA 3WIHA 4EVNB 3ZY4A 4RTOA 4RGNB 2GJ6D 1F45A 3IBOA 2NX5B 1HEZB 2BHYA 3F5WB 5GGVH 1XH2A 4R69A 1LNSA 2VT2A 4CUZA 1X7YA 5JZVA 3ARGA 3UZEA 4AU1A 3RWJB 2PH7A 4AUJA 2P2ZA 4J91A 1TTCA 3RGGA 5EBWB 5BQ5A 4QUAA 43C9A 2XRMA 2PFKA 3UJ9A 2R8XA 3WTWA 3SDCC 2Z34A 4UIMA 4L8SA 1JECA 1FJ2A 1HNGA 3O3DA 3C5JB 4XNDA 3L0IB 2QQGA 1KQGA 3CLTD 1AZUA 2YMQA 1K63A 3FCXA 4MAUH 3OHPA 5AYTA 4U3SA 1A8ZA 5GGRA 1BF5A 5AP9A 2O5NA 1JZ5A 2HA3A 4MEAA 1QRTA 1WETA 4O4YH 2GBVA 3FYCA 3C98A 2FW8A 3B8HA 3SBOA 4GUPA 4N40A 2IODA 4P4KD 4GKZB 1JKMA 1WC7B 2A30A 5H5JA 3G85A 7REQA 4K55A 2NCMA 5DJ0B 3O03A 2NSLA 2PXYB 3I0ZA 2NY4B 4KK6D 3DLPX 3OR6B 5D72L 3JAWB 4Z53A 1TZKA 4A0RA 4Y4KA 3ER8A 5T1DL 3WEAA 2V7WA 2J6EH 4PAGA 2E8ZA 1VIDA 2LW7A 3N74A 1SJHB 4B9GA 1R4ZA 3TN0D 4D9RE 2A9KA 4PRHE 3V7AG 3GNSA 2B0JA 1G7QA 4G1VA 5HVNA 3FNGA 4XI5D 1WCYA 4BQCA 2ZX9A 3S1LA 1WV7T 1SIBE 3D18A 1LEHA 3MRIB 2FSGA 4DR4B 4ZJZA 4ZI7A 4OQQA 4DXHA 3ANTA 4K8RL 1DU4A 5AOJA 4TMTA 3CLFH 1S8FA 3DUHA 2VA8A 5LJIA 3AL0C 2I3GA 2HIGA 1VSBA 4N0YH 4P3DB 3VXTA 3GJZA 4QRBA 5KTOA 3FUKA 1B3JA 3SP1A 4JM4L 1C30B 5I19L 4WJ5B 3WIIL 2Q10A 1GM5A 2X4PB 1NGWA 3JS5A 4P4RB 3VD5A 3KUDA 1HY3A 4PBRA 3MLEA 3Q5TA 1MDAA 1NFIA 3ZDXF 2NQ8A 2ZYTX 4JJKA 1W72A 4Q6YA 4ADJA 2OSYA 1D7OA 3RHFA 1AQNA 3AR6A 1FVFA 4O2FB 1FUUA 1SIWA 2W6CX 4JFWA 2EDMA 1QYCA 3SDDA 4NAVA 4RSRA 5TSDA 2B9VA 3JXEA 4A0QA 5FI5A 4ONFL 3ZWWA 2C3WA 1NFAA 2VDQL 3CDZB 2W48A 1G7IB 5AWNH 1VIAA 5GSRA 1EBFA 3BZUA 2VJBA 2ZRPA 2C7PA 4W7HA 2EQAA 3JZAA 4XH2B 2D7TL 2C99A 3Q8BA 1C5DA 3WLLA 1B2LA 4TLLB 2XPGB 4JCWA 2ZBRA 1JWSB 2XVBA 5E56A 5IEJA 4K07A 2A9NL 2VQ4A 5H02A 3FGOA 3NHZA 4UBNA 2BGUA 1BHO1 3MRDA 5AW6B 4H6VA 3QE5A 4EPYA 4JFDD 3JTMA 3QDGB 1OI4A 4DCMA 1GYCA 1J4AA 2AJUH 1W6WA 2BEVB 4QT4A 2WYIA 4AZTA 4QRTA 4JV5B 8ADHA 2J6IA 1O87A 1WZCA 2AFIE 4ZPXA 1FDLH 3EDFA 4H20H 2PLRA 1TW3A 3SBWC 3OQVA 3TQSA 8GPBA 4RETB 4ZYVA 1D7FA 2QF7A 5A4MS 3PJFA 1FL5B 3FN4A 3U9SA 5PNTA 1O75A 3RA7H 5AWFC 2HMVA 5C8JA 3BMVA 2HLHA 2G5BA 3QNXA 5DTEA 1V5IA 3ISVA 5EOVA 1IEHA 1FNSL 1S7VA 3QXJA 4OF5A 4IOJA 1M2JA 2NXNA 3MTGA 3I0NA 5K3EA 3LX5A 1Q38A 3QTTA 3NOVA 1ND0A 5FWQA 3I2GA 5JXHA 2AXFA 4YCCA 4PW9A 4ZPVB 4WI3A 5C0IA 3HY3A 1Y6FA 3BXEA 4MUEA 2YZ1A 4QODA 2QLVB 1QMPA 3ULUC 4W70A 3WD5L 1E6EA 1XMVA 1OLLA 5EJGA 2F54D 2FLRT 1G7LB 1R3HB 4OCWL 3EYVB 1QP0A 3UC0L 3IDIA 3T52A 2Q21A 4IM8A 3VPAA 4QZVA 4FFNA 2OV6A 4IVPA 2HSGA 3U4HA 1SUIA 1MPAL 2DCUA 4FFRA 1HZLA 2ODPA 4EKGA 2WNKA 3TZVC 2VISB 2Y22A 4G1EB 2BSED 3AMKA 2KM1A 4UCWA 3F84A 5J11B 1XTPA 3DW1X 3SE9H 1TZMA 2P28A 3PPSA 1NGXB 5JWRA 4HIXH 3KD4A 1I9CA 4BJ3A 2B16A 1JWAB 2V37A 4YXHH 2RCYA 4RGBA 1TZAA 4K0OA 2PH3A 3IOBA 1WCV1 3DEHA 2R5NA 3NK3A 4RJTA 1M34E 4QVGA 4PJHA 3ZDQA 3P8ZA 4UTPA 3SCMA 3WO4C 1NEUA 3EJZD 4N3GA 1XQXA 3EB9A 4N03A 3MBOA 5BQOA 2FJGB 1DZ0A 4DANA 5ENWA 2VXVL 2L4OA 1GY8A 1DJPA 5C0CB 3PWZA 4FKBA 3CJRA 1YQGA 4Q6IA 3AVTA 4XAQA 4GKSA 1L7PA 2WQ8A 3HMXL 3UCXA 1B73A 2AJZB 3OD5A 4BYGA 1OC4A 4CGUB 2OYRA 3LDBC 1SH7A 4FZ8H 3MUZ1 2WPDD 2VZ8A 3VQLA 4R8LA 3UBHA 2PL9A 4IINA 3VXOB 1YEFH 1PS3A 3ND7A 5AALA 1KS2A 3WK6A 3EXLA 1R6UA 5B37A 1XHEA 1TKBA 4BGLA 5LKNA 3E23A 3ETEA 4OFZA 4EUFA 2ZAMA 4HUJA 3TFQA 3WKDA 3PQ4A 2JBAA 4KI0A 2EZ0D 3DNMA 2OGWA 1V37A 3GJFA 1UWGL 4BCXA 3T9CA 1VB5A 1SIUA 5D2LA 1BJRE 4QFDA 3APFA 5C09E 1U80A 3ASOB 3QEQA 4XVTL 3FOLA 5I1KH 2YD5A 4GM1A 4X20B 5G40A 2XUGA 5JW3L 2FJSA 3VXSB 1S7XB 3IOCA 2ZTVA 4NQEE 3OMXA 2WWWA 1DARA 3HB3D 5IF0B 4ARSA 1QRUA 3WFCL 1NOIA 2LXNA 2Y69B 4KE6A 4CMGA 3RIHA 4PRAA 3HE6A 4P92A 2HIMA 2I67A 4L48A 3ZO9A 4W9DC 1OP3K 5LQCA 3ONDA 2PETA 5LBSH 4WFJA 3WCYA 2DHEA 5I7SA 5E2UL 4G5RA 2FECI 4BB9A 5EMNA 4FXGC 4CLDA 1VL5A 1USUA 4NQVA 3QR0A 2DQIL 4TL6A 5DF1A 4XPZA 4CUKA 1L9OA 1AGEA 1QYVA 1ADYA 1R00A 4BVFA 2B4TO 4M8SA 1AIFB 3ESUF 4KGXA 1PLGH 4JM2A 4N18A 4OAWB 5EU7C 3VU1A 3KVNA 5ILGA 1K68A 2V7TA 5SY6A 4KMMA 2WILA 4HEHA 3S48A 3ATEA 4AJIA 1NV9A 2HJWA 4J3OC 3CR8A 4BWYA 1HHIB 3LDGA 2J56A 1K2VN 4IIXA 2J0UB 4NLAA 3HEAA 4M7LL 1Q0XL 5FB3A 1BS2A 4V0RA 1KULA 4AEIH 5IOPA 2D62A 2Z4QB 3BUSA 3R1GL 2HK7A 3VZBA 2ESVE 2PU5A 4YIQB 3KAJA 4LVNB 5HZHA 2W7TA 5TF4A 3QI9A 4BYHA 5FPYA 3ITNA 1T2DA 4M6NL 2PW1A 1SMOA 2Z8ZA 5DUJA 3MLYL 3IQHX 1N26A 5K8VA 3ZWQA 1QSEE 3AV3A 1GOFA 3SBEA 1MCWM 2WQXA 1NMXA 2QZQA 2J4FA 5EG5A 3KIPA 3KPJA 3CRMA 1H2BA 2E6JA 1UBRS 2GBPA 3EMVA 4GLFA 1UBGA 4JFXA 1Z4JA 3EFHA 1NM5C 4A6PA 4CM9D 4RDHA 3BTSA 3CNBA 5BSEA 3IDQA 4IBYA 3VCLA 1HT3A 4NZ9A 1BLNA 1CQKA 1HEIA 2EVHA 2QYHA 1JQLB 3O8XA 5EZPA 5CA0F 1XBDA 5H0IA 2VLJA 1X77A 2BKLA 3UHOA 1KI4A 2BFEA 1RTTA 1EUYA 4RY8A 4UD6A 4GR5A 2O2DA 3TX4A 2ZW9A 4BV8A 5K39A 3IIKA 3AQIA 2FW7A 3Q8KA 1BSIA 3G79A 5BUSA 1FMLA 2BP7A 3DEYX 1CLUA 4JASB 1EUTA 4BLUA 3C39A 3ACBA 3TE6A 1GPMA 1O1YA 4ZD6A 4UTAL 1QVRA 1Q7RA 1S7GA 2W43A 2FJHB 4LCUB 5CP7B 1H2FA 5AVTA 3K5IA 4F7TB 1RDFA 1GVHA 3QDMD 5MFPA 2BY4A 4NBKA 4NEGA 3R4CA 4ZNEE 1UBEA 3T9FA 1XTJA 4CN1A 1NI4A 3DJSA 1PJSA 3GZPA 3GUZA 4GKNA 7FABH 1JHMA 1R0KA 4YLEA 3D8HA 5EE3A 5I8OH 2DMGA 1GYPA 1NSTA 4GRIA 3TF5A 5I1CH 3ST7A 3P3YA 4HXEB 3S7TA 4XUDA 2G72A 3GUCA 5EKSA 2BCJQ 2OL3L 3CDYA 3DDFA 4PRNA 3F65A 4JREB 4ER0A 3K8QA 3UAWA 1MD9A 2DV6A 5BUQA 1J0IA 2KWIA 4LQFL 4QDTA 3D4PA 2YV3A 1T8PA 1CUUA 3A1TA 1EGVB 4KI7A 1YLBB 4X7CC 4E2ZA 5E2TH 5TEWA 2XDAA 1Q0TA 2OZ4H 3PWSA 3GSOB 1U3VA 1DLJA 4UUAA 2HTLD 3QMVA 4CYMA 4IBVA 4F2MA 4AD8A 2KS0A 3E8SA 4HXYA 1U6AL 3RC7A 1RC1A 1J2YA 2EF1A 3C3JA 4PLPA 3OC0A 1N64L 2JJTA 4YMLA 5SWZE 4R0LB 1F8YA 1PUXA 1W52X 4Z7OF 3D8MA 4DKEL 3QXAA 4U1IA 3RT1A 1A7PL 4LNHA 2DFLA 1L0BA 1QR2A 4DT1B 4IDJH 5KS9A 3D6FA 3UGXA 5CDTA 2OXHA 1MJ8H 4JFZL 3P9YA 4LESA 5IFHH 4FE3A 4OZFB 4DXDA 2PUEA 4ZCTA 3A67H 2IZ0A 1RP1A 3DO6A 3ORJA 3TVMD 2RH4A 4XWYA 3BUQA 3KP1A 3I6QA 3BMCA 1OCRB 3I42A 3RVXD 1E7VA 4DCPA 3NBXX 1QPPA 3EDMA 4Q9JA 3J81A 4PJCF 4CBPA 3NBYC 4TKLA 3DV0A 3JCZA 2BVQA 4C56D 2HRGA 5C0AD 3TA3A 3NQ41 4B7CA 1SA0B 9ATCA 1ZY2A 5LA6F 3QELA 4UHEA 5CITA 1K5WA 4HC1L 3OJVC 2IFTA 1JNNH 2V9PA 3CZGA 1NN0A 1VSCA 2FL5B 3H4VA 3JWOL 1PO7A 2WU0A 4DWVA 2E76C 1D9XA 3C09C 1FL6A 1SCUB 1BD3A 3GSRB 5CCKH 1Z15A 1ADQA 1JPTH 5K0NA 2RH0A 3FUDA 5EZ6B 1JN6B 5LMUB 1QBBA 2VJAA 1KL7A 1NBIA 2CXRA 2FWIA 3KX2A 1TZHA 5M7QA 1N25A 4CM1A 4LEXH 1KMQA 2HSZA 1K4DB 3QDHA 4RAHA 5KZCB 1VZHA 4LLDA 5D96C 3UTQA 3DJFA 4NNYB 4KPUA 2HBRA 3EXFB 4U1KA 5LOVB 2Q1EA 4Z7VE 2JKLA 1ZW6A 1THAA 1TNMA 3D02A 4HZUA 1XZ8A 2Q86B 5EKUA 3Q3IA 1SQ5A 2BNRE 1N2RB 2HG5B 4GBED 2YKLL 4KNQA 2J8UE 3W7BA 3PC4A 2DWQA 4GNKB 4L50A 2ERJB 2FXIA 3R6WA 4FYJA 1RKXA 5SZKB 1MHCB 4Y5VC 2Z35A 2X38A 2NW3A 4C4UA 3LTNC 1Y6JA 4BMYA 2JIBA 3V2IA 3E22A 3AUSA 1BX2A 4V3CA 4OGFA 2F7OA 5DIFA 4LYFA 1V4VA 3QE4A 4C20A 3OSVA 5A0TA 3SDXF 5D5MB 3F62A 2FW0A 1MVUB 3VWJC 3GBML 3RWDA 2CRYA 4W6ZA 1WFOA 5J06A 3EZ8A 1CK0H 5KSPA 3L3HA 1D5XA 4KOAA 5HWSA 1UMDB 1A4JB 3VD2A 1KO1A 5KVSA 3S88H 1U8JA 3MWJA 1U8QB 5AKGA 4L9LB 2ZD0A 3UGJA 1ZH8A 2QLBA 1BE0A 4MVJH 3IPLA 4L16A 2CD9A 3EULA 3T2OA 4K05A 4KV5F 1MT3A 4DSAA 4R2JA 4XM2A 4N3UA 3DI3B 1P29A 1R8XA 4ZARA 5H8WA 3PX3A 2ZJ1A 3HUUA 4AG6A 4MJ5A 1KLFA 5AUMB 1I1AB 3D39B 4DKDC 1XGUB 4QGHA 1QHIA 2RHRA 1EQWA 3QYMA 1AO0A 4PPGA 3DE6X 2K9FB 2HT3C 4PLJC 5BQXA 4JUIA 2X8LA 4YZFE 4E0BA 1E6KA 5JW4Q 2I6XA 5C7IO 4NR0A 4PNHA 2CBGA 5BY2A 1XH1A 1VE9A 5IY5B 3F1KA 4FL4B 1K2DA 3C60A 4NZMA 4EJ1C 1J05A 1SBQA 3FHTA 2QQNL 4WWKD 1EFVA 1E1RD 1Z62A 2J8OA 1NCWH 3W5HA 3AJ9A 2OCIA 1K5DA 4B3BA 2A4EA 1A6UH 1T0HB 1EUQA 4HGMA 4QLBA 1AH2A 1C1DA 2JELH 2FK9A 4WW2A 5LQBL 2Q1TA 4V1CB 5LCVH 4LWZA 4CJ1A 1NRIA 3DOJA 3VPSA 4P05A 2EJCA 1N5YL 4FC3E 1MCJA 2VPQA 1JKJB 2A0XA 4KIWA 2R0LH 3K1AA 3GAZA 4JQIA 1WMAA 5TDNB 1GHTA 3STXA 2X3YA 4EVIA 4CN6A 4U7FA 1RPNA 2B4AA 3WRYA 1TJMA 4XO8A 1U81A 5D71L 3MRSA 4QDKA 3R0MA 2OA9A 1EM8A 2OMWB 3O4JA 3RT9A 3TDKA 3H9ZA 3UJ3X 3EYSL 2NNXA 3WIAA 3QU9A 4CTJA 1PSKL 3BH7A 4TUYF 2VUKA 2QVCA 5LZ2A 4DNFA 1O0CA 3D3VD 1UKQA 3K16A 4POYA 2FNAA 1Z6AA 3IAGC 5FYQA 4RKYA 1I0LA 4G8EA 3E05A 2X5XA 4GFDA 5GQBA 2I6QA 1MNNA 5DZAA 4R90L 4CVXA 4RJLA 1CFSA 2H4YA 2P7HA 1CXFA 4FJZA 3QG6B 3S1AB 1ROWA 2PKDA 2VFAA 1RUPL 3OKWA 2ZM6B 1UURA 4LOUD 3SPGA 4JP5A 4HBQA 2IP2A 2WIBA 2GD0A 4FTDA 4YB8A 3V8CA 2AJTA 4F21A 3T0XA 1ORTA 4JI1B 3GVCA 1K6QH 3T0BA 2VSNA 4UXJA 1N59B 3RYTC 1V95A 5G0VA 2XYVA 3GBLA 4ZODA 5BW4A 1XGTB 2PO6B 2Z4RA 3RVTC 3AKEA 3ZGIA 4AG4L 5G3YA 1RZKC 1RFDL 3MWGA 3ZHUA 4HB2A 4QOGA 4OCNC 3D50A 4LSRH 1CE6A 2YN3A 2HVKB 2ZSWA 1CG6A 1TMCB 1PQPA 1UWVA 1U4FA 3ZXAC 4GWLA 1AGDB 3U0PB 3OHMB 4H4DA 1X14A 1RVDA 2NAPA 1CB4A 2EU8A 3EXHB 3MLWH 5ICCA 1QOKA 5FPPA 2O5CA 1BWPA 2A2ZA 1UXIA 5ITVA 3QJTB 2HJLA 3THRA 3H7BB 4Z4QA 3HVJA 1JI0A 3PHQA 3NMEA 1BFUA 3T15A 2HWKA 2BR5A 1SLWA 3DEIA 4NESA 1VHDA 3OWHA 2IT1A 4OI0A 4JFDE 3UJTL 5JQ6L 1MLBB 5KBLA 4YMPA 4B81A 3PQDA 3UTSD 1ZSYA 3GEPA 3B2UD 4RISH 1ZOSA 4H1TA 5AVOA 3PZBA 2HJKB 3RUPA 3SE4A 3FETA 3BFPA 5I9QC 1D6SA 4PZ0A 4X7RA 2HT2C 1CDUA 4PV9B 4Q3OA 3FJOA 4RDQG 3LHPH 3T1WA 4QHTA 2SCUB 4Y5XB 2MSLA 4H2AA 3I50L 3TAUA 4XHJC 4HZ1A 4FULA 3MRJA 4IOFC 4PRDA 5LWYL 4PBDA 2G0KA 5E2AA 4UBOA 3TZEA 8ATCA 3EDJA 2JEZA 4D9KA 3E3LA 1XMEB 4A9AA 4CEIA 2PEZA 3ERCA 4NAJA 4CSTA 2F54E 1IPEA 4UEQA 2Y66A 3GJ6A 4NHEA 3UIYA 2XWRA 2C4KA 1JIJA 2BT4A 4U02A 5DGDA 4GGMX 3PWUA 1MR3F 2GX6A 2WJ7A 2QRZA 3R7WB 4TT3A 3QX3A 1NWCA 4DIKA 3B9EA 3WB2A 4FQ1H 4Z3KA 4Z6KA 1RRCA 2H32A 4EKYA 2DHQA 2ATIA 4EN3A 2YJ4A 1T5WB 4F58H 3V0VB 4WZ9A 1V7ZA 4OSUL 3TKYA 1QBGA 1IQUA 3A6LA 1GZUA 1UVQA 3SQOH 1KBVA 3RPEA 1OH5A 3CHRA 3QVMA 3T06B 3GEMA 1ODAA 4A67A 3U4DA 5BCAA 3PJGA 2O5ZL 3KM1A 4Y2YA 3WFDH 5IM4A 5D8JH 5CS7A 2OSVA 4MMZC 1GNLA 2B8WA 3NGLA 4ORGA 3CVCA 5DVZA 1Z4NA 2ID4A 5AW8A 5B7EA 1U9KA 3R75A 4GX5A 3NT0A 3LL4A 1XCMA 5IKOA 2LCIA 4N5NA 4R5TA 4XPBL 3LY6A 5GJBA 5IIEA 3G8CA 3ZOZA 1DELA 4JFYA 2IEZA 4JJFA 4YY3B 2WB2A 1ECGA 2HPVA 2K6GA 4HDAA 5SYNA 3TEFA 4LARH 1JFTA 1KHTA 1BD4A 4KMTL 3K9GA 1FC2D 1WXQA 2I7XA 4QHLA 1CUCA 1LLUA 1RXVA 4UDOA 4RSVA 3UW1A 4W9NC 4JRYA 5D1XD 3IJ5A 5J9PA 2DG2A 4HV8A 4HKTA 1DJZA 4JO1H 1D3AA 5G4NA 2VH5R 4B95C 2P3LA 4X24A 1YFLA 4NMWA 4FG6D 4P5MB 2WVVB 4RZCB 5KYXB 3GVIA 5I1GH 2ITCB 2K2QB 2R47A 4MINA 3EZFA 5DZPA 4QTXA 4X6BB 1RK0A 3X2EA 4AL8H 2A73B 1H2EA 2X6RA 3AVXA 3P9WB 5FX3A 1T2JA 1EZSA 1WIPA 4CLRB 2J5KA 1OLSA 1YFKA 4KUZH 5TPZD 4HJRA 2E0PA 5E5UB 2JCCF 3EISA 1QEWA 4HJXA 4ZVSA 4IRSB 4N2GA 5I0ZA 2RGAA 4AT1A 5B1CA 3HPJA 1J33A 1M6VA 1GGTA 2XLCA 4B7XA 1AX9A 4TZ6A 4ZS6C 4L4ZA 2QVKA 3D8TA 3L7KA 4Z7WF 4G97A 2A59A 3ZW3A 3H18A 2IPOA 1QUNA 3JVEA 1TLTA 4Z3DA 5CSBA 4LI3X 2OG1A 3RYIA 1AKUA 1ONBA 3WS3A 3UWDA 3CFQA 1CR6A 1ZVMA 2DRIA 4O51B 2YW9A 1INEH 2WXKA 1LMKA 3EO1A 4BMDA 4W5TA 5CP3A 2QWXA 1BQKA 1M0WA 2A99A 3TB4A 2DW5A 1EFRD 3KNBB 5H8DA 1UKSA 4GP6A 4RTKA 4NG5A 4HW6A 2ZIUB 3R7NA 1E9PB 3GZ4A 4NKDA 2ESRA 4XQ9A 2Y0BA 4KJXA 3EJSA 3T8YA 5EINA 4L18A 1U0FA 4YAJA 2AG6A 4RQQA 5FO8A 4BDVA 1DAMA 4YXWD 2QKIB 4G0VA 5C7XL 1L7RA 4PSAA 4JG0L 1TCAA 1O7VA 3VRJA 4OA5A 4ZAWA 4F4IA 2OCJA 1NUPA 5ER6A 2QX9A 5FWNA 2FEEL 5AYUH 1UCFA 8LDHA 3QG7H 2Z4TA 1ZA6B 3CC5A 1XZDA 4MW4A 2DYSB 3NUGA 3FCGA 3PNWB 2QT0A 1AZWA 3QUXD 4B3EA 1AGBB 2OBNA 2ZJZA 2QADC 3TD6A 2ACKA 5F0MB 4FYXA 3MCUA 4RXTA 2YD0A 2YC1A 1UM5L 2C2YA 4NQCA 2OPBA 3L0PA 3ZC3A 4XVQA 1DZ3A 3AB8A 1CR9L 4FYRA 1SJEB 1XRJA 1LZLA 2COVD 1G5HA 4OU4A 3CDCA 3QAZB 3HE3A 5I1EH 1ZT4B 4YHKL 2BHLA 3LKOB 5FQOA 1M71B 2NQ3A 2YQ3A 4P7FA 4GQPH 2IC2A 3I12A 3CRQA 1WMEA 4OATA 1LS1A 4UHCA 2ODWA 5LGHL 3GMPA 4F15C 3EEIA 5A5DA 2O9JA 1PHPA 1KEPA 3R9KA 3PRZA 1OK8A 3NIGE 5FYJD 3MV9B 1ZK1A 2DPLA 4R1SA 4YEDA 4MNQB 1TVBB 4OZHF 3L6OO 3FMGH 5I3CA 2A6JB 5HYVA 5FM5M 1A6TA 1AVTA 5CGBA 5ILTH 5AVQA 2RAFA 2BH0A 3D8SA 4DDKA 3ZK0A 5JPCA 4NYJQ 1BXRA 3N58A 3LD9A 2WKQA 2DQJL 2P6RA 4OD1H 1PL8A 4EUPH 3D6JA 3OXRB 3CC8A 3KLBA 4C59B 3FCOA 4LY9A 1I1HA 4NC1E 2HY7A 4PFQA 4AMWA 2Y7SA 1G6RH 4PF1A 2Q0QA 3ZU2A 1J9RA 1XUOA 1RW4A 2OYMA 1TLMA 5I8KL 3EBHA 2P4AB 4MQTB 2X4NA 1ODLA 8FABA 2XFXA 2O8BA 3L5WB 2DWUA 1JZ8A 2VQEB 3JBG7 1IGML 4XCVA 3GP3A 1M05A 1QNLA 1UWEH 4M62H 3QDME 3ZZNA 3ENWA 1UFGA 1W36C 2C26A 2X4RB 5TQ0L 3VFOB 3RKDD 3P9SA 4FWBA 4Y5YC 2HVJA 4PWEA 4BEIA 1RHUA 3S2AA 4X80L 2BJMH 3RIFF 4NWUL 4HH0A 4JT9A 3O9WA 4EOWL 1JK9B 3FMIA 5AUQA 3VNYA 2HRBA 4CKQA 9LDTA 4N8VB 3K2UL 1HZJA 1HK6A 2AQHA 2RHWA 4KAQL 1OFGA 2UXBB 3UG3A 3HSSA 3W8NA 3AREA 3ZHKA 3L5HA 1CE8B 3NWPA 1KO5A 1H2AS 1LWHA 1IK4A 5BWCA 1G1YA 2AQKA 2WG1A 3BWSA 2BJWA 1IHOA 2ENPA 5CVUA 5JCJA 2B6NA 3CFJB 2I9TA 2FR4A 4ZJPA 4HWRA 3RANA 4ND7A 3OY7A 3QFFA 3M6VA 1PDVA 4BU0A 4I1SA 4II7A 1KZQA 1F1GA 1JJ7A 1Q7TA 1XEFA 1GCGA 3FJ1A 3R3YA 2Q2QA 2VMJA 3HABA 3GC6A 4LXFA 5IXSA 1SXJA 4QRPB 3PIQB 1XX6A 1YNSA 3P9LB 2EGHA 4BNFA 1W34A 4XCYA 3B89A 3ARBB 1GMIA 2CVZA 3AKDA 4P98A 4JZJC 1XXHB 1L4IA 1ZT1B 2NSHA 4OZFG 3RC8A 1UJ5A 3BE1H 3A6FA 2POQX 4CI0B 3T1FB 3O3EA 4H8PA 2VERN 1LF0A 3OL2A 3GM8A 1P45A 2R2HA 1I7UA 3REWB 1RYYA 2B5IB 3QBVA 1DR9A 2G8NA 1TPZA 4MJIA 4C56E 5T5QA 5C0AE 4WO0A 2GYWA 4EJSA 2NY6D 4IK7A 1F6DA 2WB7A 1T0JB 4RMHA 4DLZA 4Y4KD 1X8KA 4MAMA 1GGVA 1PG7L 4LHXA 3RREA 2X2IA 4UTZA 4GG8A 3ICOA 1UDBA 4NATA 4Z76B 2QAJA 3I6YA 5GS2D 1FGNH 3RB5A 4YJGB 1RV6X 4R7DB 1AMOA 1GZVA 3C9NA 4D8OA 3SKMA 3RYCB 5JUEL 1KOGA 5ANRB 3BUDA 4ZX5A 1A6PA 5HVHC 2B2XH 1F2VA 3ZE2B 4R6WA 4UUOA 1N9GA 1I3KA 3QKSB 2AABH 3IEIA 3VXPA 4TNVK 1O5TA 2NUBA 4KRNA 3NTOA 4U8HA 1RYDA 4P2RB 4P0DA 4Q02A 1HSAB 4Q9LA 3WE1A 4KK9C 4PJGF 1A1MA 1GAEO 5GM2A 1UZ8A 1QE5A 5ABPA 5A7HA 3HEBA 4L0ZA 3D25B 4YHMH 1SJ9A 3PQ3A 4ZXFA 1EH5A 4HLNA 4RD4A 3EGSB 4QBTA 1ILEA 3RNKB 5FOSA 3FH0A 1YDEA 3UY4A 1SPXA 5AW9A 4UWQB 4MDFA 1KBOA 5L2KA 2VJPA 4UM7A 5IH7A 3A6GA 3O6VA 2VOJA 3FSAA 3P1VA 3PUVA 3LMJL 3OPZL 5DMJB 3T38A 3F3MA 2AR9A 4NJ9H 1XRMA 5JHDB 2IDMA 3AFHA 1YA5A 5DO9A 3H9GA 3QO1A 2YFQA 2D0GA 3MV7B 2J43A 5T3ZH 5HGDA 3WQQA 3HN6A 4LBYA 1OWRM 1QASA 1NQXA 2WQUA 4HMOA 4NENA 2UZ1A 2ALJA 4W7IA 1Y8QA 1RRFA 2FPSA 4WKGA 4L6IA 3H5IA 2A7XA 2VRAA 5CJOL 3BK2A 3UH8A 4LOEA 3COOA 2IXBA 1O58A 2BSTB 3FHQA 2OZVA 1B2WH 5JW4N 3D6GA 1GCFA 1XTIA 4YDVA 4OHKA 4MV1A 3NSFA 2XA8H 5PAZA 2GC7C 1XZCA 3IDGA 2EP5A 5TTRA 2IGFL 4K3HA 4G6JH 1HKLH 1O94C 2MH4A 2J5QA 5G1OA 2QENA 2ENUA 5DJ5A 2P5SA 4KDTC 3LY9A 3SDYH 4AQEA 1EFHA 3GH3A 3ROPA 4ON9A 1XPJA 1JK8A 1B6DA 3STLB 3ABRB 4FRWA 3BPOC 2QTAA 2W00A 3MQFA 1YSCA 3RB8A 3U1TA 2BSQA 5EF2A 1Z12A 3BGFC 5ALSA 5E95B 3UTPD 1NBOA 5J56B 5JCOC 2DFNA 3ZHNA 3I30X 1M2WA 3BQUA 4NYLA 3F9CA 4P9NA 3RS3A 3TO2A 1FFNA 2Y5TB 1LPAB 5FLXA 4XC3H 3UAXA 2Q2OA 5E8NA 2F1AA 1MHEB 3IBTA 1EFKA 2LDXA 2CBQA 3DWTA 3EAFA 5C1PA 1XRRA 1TJNA 5IVPA 3PHIA 2HPTA 2WDZA 2P45B 1E1DA 3VR5A 4EHJA 2Y7QA 2DH3A 1H6BA 3A4EA 2ZP9A 1RQPA 2XGJA 4NBNA 1NYRA 4RV4A 2PYFA 1KNOA 1FH5L 3D3VE 2WJ4A 4N7JA 5C9JA 2XICA 2HHJA 1WLSA 1WU7A 4X9GA 1DYZA 1H3TA 1IZYA 1GPKA 5FFMA 1MHPH 2OSXA 3T9WA 1E4HA 2YWRA 3SCMD 4R4ND 1Q77A 1WW2A 1YUBA 4KQ3H 2BY3A 1V27A 1VFAB 1CLZH 1IBRA 3CVDA 1U2GA 1M53A 4W5JA 4GIOA 4JDEB 5DLLA 5LBGA 3OTIA 1WTCA 4REOA 5C0DA 4B4DA 2A3RA 4WMLA 4GAEA 5E1IA 4QOFA 3L3BA 3MRKB 2X4SB 4C7BA 4NONA 2ZIDA 3TXXA 5DQDL 1JFQL 1F51E 2X1MA 4JFEB 2OWEA 1EFTA 4N3NA 4FXKA 1NUQA 2H57A 2VK1A 1ZA1A 4K6KA 4ZA2A 2VJQA 3I9FA 2VP6A 3WLAA 2M6RA 3IKCA 4DWWA 2NO7A 1OSZA 5COQA 4R9UC 2QTZA 1PJ3A 5DHVA 1TPYA 4X5WB 3PV6B 1QO3B 5D9SB 4L8FA 3PG2A 4WV1C 1E2JA 4YFLI 4MAYD 2F58H 4F72A 3JSXA 2EYSA 3WXVH 4DJEC 1MAHA 5F7ZA 1BG6A 4OCXH 4HRAA 4MB6A 1F41A 1GSKA 1X1DA 1Y1QA 3Q0TA 4CJXA 1SUCA 2P9QA 1PYWB 2I8CA 1BTOA 4BP1A 5T5FA 4EY7A 2H7XA 1YNTF 1U42A 1XDSA 1RZKL 2DUWA 1VTKA 4MS4A 4AXWA 1HURA 2R4RL 3EIOA 4JYAB 4BEJA 2IBMA 5I5EA 4IIEA 3PD0A 1N0HA 3RAJL 4PJAB 3ZXSA 3L3OB 1SC6A 3DGGB 1XL4A 3E9NA 4LJ9A 3AL2A 4AITA 1CYGA 3HE6D 4P99A 5IK3A 1U2CA 4ZQHA 2B8TA 5ADPL 2ZWMA 3BBLA 4KQIA 4YHNB 1WP6A 4HALA 3PNVA 2VNSA 1NGPL 5T67A 2JJWA 3A4VA 5F9AC 1E69A 2AOXA 1VDGA 35C8L 3ROEA 1AT1A 3LHKA 1S9YA 1QNZH 4KYIB 3Q7EA 4EUKA 1N32B 1SO8A 1OBOA 3ZHBA 3UWMA 4OXXA 3X1BA 5CGTA 3F3KA 2H1OA 4Z9FA 1YEDB 2CLVA 3W0WB 1KBGH 3S3DB 2VN3A 4JM2D 1MRNA 3L93A 3PYMA 5LLIC 3H13A 1Q19A 1NA8A 4K8RC 3FYIB 1U8EA 2OTWA 2X28A 1Z83A 4BZXA 2FGKA 2GSDA 1FUYB 4OVUA 2NU8A 3CMMA 3BSZA 2W2PA 4URFA 4K7JA 4JP3A 3T3NA 5HF8A 2WVAA 1OTTC 2JV6A 2KL6A 1L5RA 2IZ6A 5LMZA 3FB6A 4C30A 3V6LA 3AX6A 1G4RA 3GSXA 3JATA 3TJHD 2H2SD 2VDWA 2ZZKA 3BGDA 3FRUA 4EEEA 2RIPA 3IT1A 1ZMTA 1TQCB 3QI9D 2D8AA 2VN8A 3FNRA 3V6OA 2XNDA 2GPBA 1J2JA 2SKDA 5ILQA 5EORL 4EB0A 5DOZA 4F7DA 2YXMA 2JLCA 3C8DA 2O8FB 1MQAA 4JBWA 3A25A 1YO4A 1QCDA 6ADHA 4QYMA 3AY4C 4X1YA 3S96B 4H8WL 5B4MD 3BMQB 2YPLB 1H2HA 2OV1A 4U2EA 3GQBA 4IL5A 1K86A 4L5YA 4OLUH 3AIMA 5DJXA 4FI3C 4XBGA 4AQZA 2PUBA 3WTXA 4Y6PA 2BIQA 3QA3A 1RRVA 3H86A 2E46A 3MGAA 4KWCA 2WRZA 2MPAL 3SYTA 2FHBA 4AUUA 2DGDA 2OBYA 3FWNA 1IEVA 5D1XE 4O02H 3MV8E 2LUOA 5DULA 5KSUB 3L0YA 3H9SD 1V2HE 3UDWC 3QOFA 2J8HA 4RIEA 5EQTA 3TSWA 3O8XD 1KIAA 4HX1B 2VLJD 3ERXA 1KAOA 5KYUA 3S9DB 4X7SL 2ED8A 1TTFA 1KJMB 3EVCA 3U1PA 2RK3A 2MQGA 4LQ1A 5LU9A 3K1TA 3F47A 2ZAYA 4KXBA 1XKTA 1THCA 4YX2L 4LLUB 5GJSH 1KLUA 3NCJL 3ELBA 5ARCA 4DQOH 5JXED 2NQTA 2RI6A 1Z1WA 2FEMA 2Q4BA 3Q3GE 1MI5A 3NHYA 5TK4A 1ACCA 1QAQA 2GZ3A 4OAPA 4HVLA 1D3CA 1BFTA 3QFHA 4BLTA 4XBEH 4FR5A 5F1YA 4I3RH 4BFEA 1MOQA 1JBKA 4G01B 4U6SA 4ONOA 3L0OA 1WBJB 2L04A 5H2BA 2MCG1 4LJAA 1LWJA 5E94B 1F8FA 3AFOA 3GB7B 1UJBA 5EEYA 4PWZA 3PRHA 2GXUA 3AESB 2KE5A 1ZJWA 3UP6A 1MY5A 4CLHA 5CD1A 4L05A 3WY2A 1I7TB 4RMRA 2R8PA 3KZ1E 2EZTA 2COEA 4QGBA 1N0XH 5GSVA 2FWAA 3BS4A 3O2JA 3IDNA 3OQIA 4UBJA 1W59A 1LWOA 2FSPA 1UD4A 3QIUA 3KGTA 2GCOB 4E5PA 3WLBB 1NF3A 4PU0A 4BFOA 4S1TA 3Q6FB 4OUUB 4CUJA 1FNGA 5ALBH 5KBPA 4TVPD 3QU5A 3UA4A 3MWLA 2PAFA 2FWSA 3BL6A 1R3DA 1SRDA 4HA1A 2FWRA 4KGJA 2UDPA 4G6KH 3DO5A 1B6UA 2EJVA 1UA6H 4FG0A 1O3YA 4MV7A 3CIOA 1A7JA 4XPTL 4X54A 3V9CA 3EJPA 4XPGH 2YQZA 2VZEA 3NCTA 3R8QA 3KJ6L 4BLVA 2AOWA 3FLMA 2YRBA 1YI0A 2J7PA 2ANCA 2PT6A 3B1FA 1CPUA 2ISSD 1WFUA 2CL5A 2B08A 1I3CA 4PJIF 1QI4A 3MROA 2Q1YA 3PCRB 4NHUB 3O3CA 4P8RA 3DULA 3L3JB 4WY7H 4X1KB 3TNMB 1EWRA 4FI6A 1Z36A 3KLDA 3J81k 1JG3A 4PJ8A 3FDZB 2AB0A 3Q7TA 4L27A 2XQKA 4Z7NE 4Q1DA 4QRRD 3TA3D 2QN8A 5KMGB 1Z9SB 2Y1FA 5KW9H 4ZTUB 1HEUA 2GN6A 1M8FA 4BO7A 4GPTA 4UNVA 2XFGB 3E35A 5DJCA 4WK0B 4CDGC 4FK8A 5FYJE 3FUMA 5JPNA 5DUPL 5JISA 1AQDB 4Q4CA 1ZISA 1QFWI 3NOOA 4W4TA 4PRHB 3JUZA 1HQRA 4R2LA 3U0TB 5C34B 3S4YA 5EEXA 4HKJB 2XNAB 1ODJA 4LSZA 5I75C 3DR5A 5AAMA 5AW2A 5IVZA 4F85A 4URYR 2OXIA 3VMFA 5DNYB 4NUQA 3P0YH 4MMXB 1TSRA 1VG9B 1HEYA 1U8ZA 3VXRE 4CNIB 4AW4A 3F4LA 3RU8H 3QWIA 1F17A 2E85A 4OHBA 3JWPA 4R26H 2JVJA 3ZVKA 3NR2A 3E8UH 1E9DA 1EUZA 4HWZB 4AF8A 4R5MA 5KNLA 5JW5A 2LDBA 2NT3A 4IZIA 2C77A 2AJVL 4NLLA 3IKMB 1PLBA 5K6TA 2BI7A 1HKUA 1A4BA 1M6EX 3NI2A 5L6YH 4MR8A 2PW2B 4PLNC 1ZXXA 3F6BX 4HEQA 2R39A 2VKXA 4C4OA 1E6WA 1P53A 3ZXUB 2XZAL 4EZKA 3BGMB 2AKRB 2OI9B 1JQ5A 1N18A 1UZ6F 1K98A 1Z7GA 1WXGA 3IE0A 4GWGA 1VACB 4N8VG 5IU6A 3VWKB 2QBYB 4KPYA 3G82C 2V7PA 1XRPA 3U3MA 4I4TA 3G3LA 3QPXH 5ACZA 4Z9YA 4GKAA 1QB8A 1SHMA 1G38A 3IKLA 3KL2A 1N57A 1I80A 5DXJA 4LSUL 2O2CA 2BVPA 2LR0A 4D3CH 3TIVA 5ADOH 1NQUA 4K3EH 1NUFA 4AJLA 8OHMA 3UJCA 1ILUA 3RDTA 4XO9A 4E1BA 4WSJA 4FYIA 1CXIA 1WTAA 3IUSA 15C8H 2ZIAA 2ONJA 4B2IA 1HDXA 1QUFA 3H2YA 3VG9C 4BZ2A 1UEMA 2WO4A 4TUYA 4U9IS 2VRNA 3AM3A 1KPHA 3FDWA 3V48A 4ZU6X 1F11B 1MRDH 5L88L 3RR2A 1AGRA 4UI2A 4V0MA 2F8OA 2BOVA 4P5TC 2XTJC 1ZXBA 1NUTA 2QEQA 4V1DE 1EWYA 2I4IA 1WE5A 2N3JA 4H25B 1AO3A 1MH5B 1U6JA 5D7JA 3HYLA 3UA3A 4OLZH 3D4LA 4JQXC 4GRDA 5JV5A 4IHOB 1VCIA 2AFIB 4ZJ9A 1SHZA 2JJ2A 1JVKA 1DVRA 1TQ8A 2HLPA 3LYAA 2O5EA 2C4XA 1H4SA 2C96A 3TCTA 4QM6A 3BAKA 1MXDA 2IC5A 2WINA 2CBXA 5JNVA 1SHJA 1Q0EA 2AV6A 4KN5A 1F4HA 4AVYA 2C9OA 4MVJM 5LZ4A 1ECPA 5BPHA 3RAEC 4FZ3A 1URZA 1B1CA 4FFBA 5JASA 4JOSA 3KPVA 4GUQA 2Q7OE 1U9IC 4IUBS 4I18A 4QQNA 1ICTA 4IUCS 3P96A 2X22A 4N9OB 2HYMA 5DC0A 4OZGE 1VM6A 3LSYA 2GTWA 4NZZA 3QVWA 1AKEA 5JH7B 1GNPA 4YE0A 1XTVA 1UJCA 2FPKA 9ABPA 3EQZA 5TJ9A 2AIRA 1T1WA 1XF9A 4EI5D 1DC4A 4F8TA 4TPKA 4MW2A 3MFQA 1Y3IA 1YZZA 3DFKA 4WKBA 3F7NA 1XTUA 3P2DA 3E3QE 3VU9B 2L0XA 1OLUA 2ZUVA 1WD9A 3MRLA 2JFPA 3VO9A 3THYB 1DVFA 4IEFB 4ZCMA 3PEUA 2GJSA 3PUHA 3M4NA 4ZMXA 2FPWA 2EGUA 1F6BA 2RGNA 3RWHB 1QFXA 5ESDA 5A03A 1OSYA 1HNFA 4JFHD 1E9BA 1IBCA 3KYOA 3WIOA 4JFQB 5CIPH 4ICWA 4DN3L 3D5TA 4NO2A 4JR1A 3HJGA 2MMCA 3TQFA 1M34B 5IDWA 5HUQA 2VNCA 2JGAA 4YAUA 2RJMA 4EHBA 4F8NA 4IRJC 2K8MA 4ZMZA 5J8OA 4CKBB 3PICA 3BP4B 4PB0L 5DZJA 2BJVA 4WOJA 5IAGA 1UEJA 1G6VK 4HT1L 3RNOA 2EC9U 5CGZA 1XGZA 4M7ZB 1EEXB 3LL7A 2VL4A 3T0EC 4B3SB 2CXSA 3JWIA 2H0FA 4FP8H 4BO3A 5CBEB 3ORRA 3SKXA 1IUPA 3DQQA 1D7BA 4MIEA 1EBAA 4P34A 4WX2B 3A5VA 4QPZA 3B12A 3BVNA 4DV7B 1GRQA 5IS2A 1E63A 4E9XA 1ZDQA 2JB6B 3OU6A 1CS0B 1A7RH 1UJ3A 3RUHA 4CV2A 3OCCA 2ZUTA 4D0CA 1DIAA 4P9HC 3ESAA 2IL1A 2HM7A 3UAOA 4YXKL 1WISA 4UUNA 3I4FA 3OO1A 2JIDA 4CSPA 2C7UB 4MVBC 2ZXAA 4U2CA 2C8KA 3U1SH 1NJ9B 4M6AA 5EOCH 1MCRA 5DHPA 1DBML 2XEXA 3AP3A 1JRHI 4FNSA 5TGDA 4A7QA 1FUKA 4GMTL 4X98B 1X5XA 5C09B 3L95B 3OT1B 2KERA 1H6TA 5EWLA 5BRNA 1BBJB 4MTLA 1ORIA 1F8UA 5DUMH 4NARA 5DRWB 4ZQCB 1DXQA 4AYFA 3QHTC 2C2HA 4NQEB 4CU7A 2IFFH 2YSSA 4RK0A 1UPXA 4ZXBB 4XLZA 4YGXB 2L82A 4FFZH 2PX0A 2AMGA 3ARDB 2VDOB 3OCVA 2F00A 2EDEA 5IC6A 1WSDA 4ES6A 5D1ZA 3JQ6A 4PV8B 3R7RA 2VMFA 1PU2A 1IB6A 3DOEA 3UTPE 1DBAH 5JR1H 4HVTA 4QBFA 3VPCA 4WXEA 1VPWA 1BVRA 1A14H 3U82B 3BKCH 2GTIA 2OULB 4Y2PA 2DMRA 3LN5A 4L3EA 5IV2B 3O6FD 1BJMA 1KGIA 3UPTA 1ZGHA 3WV0A 5HGJA 4AP6A 1Z39A 4N2KA 3BAFA 4HQFA 2GSWA 1SYSA 2ADJA 4H35A 4TL5A 2CL7X 1CFJA 2YIVX 2QQKL 1PNOA 3HCVA 3UXHA 4EGJA 2H9GB 3F78A 3PWTA 1N8KA 3Q6GL 5IJVB 2FYYA 1Y8AA 4M3NA 3U7EB 4MRCA 4TT3D 1GZHC 1ID2A 3O1JC 2Z6FA 4LQDA 1F2QA 1ZUNA 2QUKA 1SBCA 1UBCA 4HR7A 1Y4DE 1PKQE 1ZD8A 3N8HA 5FOQA 2CUKA 3DBHB 5EFIB 4J94A 3FX2A 5IZ4A 4HIHB 1U7HA 2QQLL 1P61B 1JMYA 2Q7YB 5I0YA 1ABBA 4F4JA 1TT5B 4PLTA 2VE6B 2IW1A 4O5LH 3OX8B 4EN3D 5DWUH 2AR0A 3V79C 4PWKA 3WJ1A 4MWEA 5FYDA 2ESVB 1AYOA 1F3JB 5HVWA 3SDBA 3X43A 1C0LA 3PJDA 1R4MA 3JQ7A 2A84A 3TPFA 4PJHE 4RADA 1R17A 3U6XA 3T7EA 5FLUA 2F74B 2H1CA 2GN2A 2J0VA 1X0XA 4WNQB 1A1NB 4PVCA 1EHKB 2PMFA 1QSEB 3KTAA 1UEXC 4N4AA 3DPUA 4JITA 3BMNB 1UKVY 5B8CB 1EZZA 1MRFL 4DRYA 4IXWA 1IEWA 3T77B 1LWRA 1BMDA 1CG9A 1CDCA 5I1HL 3MODH 1ZVHA 1IOZA 3ARFC 5EBMA 3ETLA 3MLAA 4DV2B 3TTVA 1HT1E 2RAUA 3HZZA 3KZCA 1VCOA 4AVJA 4GSQA 3H4HA 4F2PA 2CJTA 3HE7A 3ANNA 2G80A 4JRYD 3N6VA 4EFMA 2D2EA 2BHFA 1HDEA 1Z4QA 4KQCA 2O2EA 3HS3A 3KLPX 3MNVA 4Q37A 1CICA 4HGWA 1J42A 2EF0A 2P79A 2XODA 4P83A 3D07A 4JANA 4G89A 4FQLL 3IFNH 2KQUA 1U8KB 1DANT 1PT9A 1UP4A 4FQIH 1EXMA 1VLHA 2MKLC 4KZEH 5DD0H 1ID1A 4M93B 4C88A 2VTFA 3QF7A 2BR3A 2YMOA 3L8HA 1NUGA 1WCBA 4AE1A 4ZVMA 2GEKA 4ASUA 1MJ7L 3GDFA 1ONNA 3A31A 4QICA 1QQ6A 5EH1A 5EZYB 1FC0A 3CVOA 3D4CA 4NBVA 1TJIH 5M2QA 5A7FA 2YGOA 1L7EA 4TWJA 4ANXA 4HUXA 3WHXA 3KM2A 5IT2L 1V1RB 3C5SB 2CD0A 1NNLA 4V2CB 4WNSA 1NZFA 4MI3A 5CEFA 1XF3B 1H5QA 2W60B 4CDRA 2ZUCA 4RJJA 1Y4SA 1EUDA 4MX7B 3RRMA 1T5BA 1P4LA 2F9LA 1E60A 1HMYA 1CF8H 4KRXA 3Q1LA 1YJ5A 1YL5A 1U8IA 3VOSA 4C3OB 2ZRHA 1APBA 2CYAA 1JHDA 5ALOA 1NURA 3JWNE 5EJAA 3WADA 4JB0A 1RQ2A 4LPSA 2VAAA 2QLLA 4OZHA 4N26A 3A6EA 4IEIA 1RPJA 1N5KA 4N8PA 2RGCA 2H08A 5D6DC 3I1IA 1CE1L 3A7DA 1QQTA 3CUPA 1NULA 5FORA 4ZSOE 4AMKL 4MWBA 1V3QE 1FQKA 4R6UA 4BVGA 3KE8A 5SWZB 3FVTA 3KVYA 1KYFA 2ZKWA 2HX9A 1CP3A 2VQDA 4UBDC 1SD1A 3N9IA 3OLZA 4B5KA 5MGBA 1A9EA 2YWZA 4L9AA 1JXDA 2VJ0A 2ZE8A 3KB1A 1I2AA 4EKJA 2EDLA 5CB4B 1OKEA 2NY1C 2EC5A 2W6JA 3BWDD 3CPUA 1MVYA 1MVNA 1BWQA 2WN2A 3MZTA 3AUAA 9PCYA 5MP6H 1RMQA 4X6CF 1M9SA 2WAHA 1VL8A 2DM3A 2VR7A 2R0KL 1QRAA 5B58T 4BFIB 4X94A 2OHOA 2O59A 1XEDA 3PEFA 3JVFC 1BEZA 1GQOA 2D7JA 4AS3A 4O2EA 5EWMB 2YPVA 4NQCD 4M7OA 3WK4A 5HY9B 2RARA 2WV3A 2GR9A 2BRRL 2FN7A 3I9GH 3MRPB 4L37B 4WECA 3NBZC 4YP9A 3C2AH 2D5IA 2CK0H 1AJ7L 3TXYA 1AD9B 2AOUB 3DROA 3HC2A 4PMEA 4CN4A 3BUIA 3O1IC 4J2XA 2UUDK 1XSJA 5ISZE 5F7MC 1N6PA 4OX9Y 5DVPA 2ZCKH 2ZANA 1M5RA 3H9SE 4FLRA 4G9DB 4PGBA 3WB1A 1KR2A 1AKNA 4FX2A 3KQWA 2VLJE 4OHZA 1JIKA 1KFAL 2ZWPA 4B2LA 4PVDA 3MT7A 5IUNC 4INJA 4BFSA 3OKYA 1XGQB 2DU8A 4Z7VB 4Y98A 1L4LA 4UPDA 4O9HL 3SX2A 3DHUA 2BNRB 5HYJA 3P4UA 2J8UB 1QLHA 3IQIX 2QROA 3S8EA 2ZSBA 4ZFZA 2BOCA 3PREA 5BRJA 4GB9A 4NI5A 5KNDH 5JRJA 1MCLA 3EX7C 2H5EA 2QP9X 4B7AA 1JHLL 4B41A 5ESAB 3O90A 1JWMA 1DKUA 3SYNA 4UVEA 3I2JA 2HJSA 3FYUA 3L4SO 3RASA 4HJIA 5F7EL 5DTFA 1P2BA 3OHXB 1POXA 2GK7A 4MVXA 3PFWO 2CKNA 4AVKA 1W9HA 2XWJB 1YE8A 1Z35A 4TMFA 3SGKA 4KL8S 2O5XH 5I2IA 3T1OA 2VATA 3ARED 4TLDA 1F14A 3BDAA 5GGVL 1FZKA 3BPNB 4LIQH 4LXHA 5FO9B 3AY7A 2VSYA 1S7UB 5LNGA 3BJLA 1ULTA 1H5BA 4AH2B 3HRKA 1EGAA 1CQWA 5JCJD 1WQVT 3IAPA 4TVPE 4GLJA 3GNQA 4BJLA 2WXMA 3VI4F 2HK9A 4N0UE 5GISH 4NE2A 3L1VA 5E8OB 1CC3A 3CFKA 1NDUA 2O23A 5JWOA 1GY1A 4N0CD 3WL6A 3W9EB 2IEIA 1U1IA 4XXCC 4PJGA 4F06A 1Z25A 1GKOA 1A3QA 1HINH 4MAUL 4EF6A 2DBJA 5I1LB 1DO8A 2J25A 5KS9E 4H7FA 2ZBFA 4XCNB 1JN0A 5LSAA 3CF0A 3QIBD 4MP6A 4O4YL 5DX1A 4LQ4A 2UYOA 4JROA 2Y1GA 3L05A 1KEKA 4RNRA 3BW9B 1EFQA 2D7NA 1OI3A 3UG4A 1LPBB 1YMQA 4GYBA 1NPUA 2PKYX 2Q49A 5DMKA 4ZMQA 4Z18A 4W5HA 3V4FA 1I94B 4MDEA 3HSKA 4FOOA 4OI2A 2R751 4P4KB 2MDTA 2VKWA 2WO3B 4PBWD 4XPAL 4MJID 3G5TA 3CVWA 3FMPB 4KXVA 4JFRA 1EEYA 4UD2A 1OX6A 4QRRE 2JCVA 4DLYA 2ZUEA 4WLNA 2YIMA 4IJWA 4LV8B 2OMZA 1GPBA 5AVWA 2J1LA 3A9WA 3MRFA 3UCQA 4PCAA 4KKVA 5M7EA 5AW7A 1V8BA 3D4ZA 3IVXA 3WGKA 2QPSA 1KCBA 2IAAC 3TN0B 4EI7A 1JDSA 1Z38A 1J1OH 2PH5A 4I13B 2DLEA 4UHHA 1YECH 3EW9A 1PR2A 4P04A 1R5WB 1U2SA 3CH8A 1SLVA 1O8CA 4X8LA 2OZNA 3JR7A 3DXAD 1FUIA 3MRNB 3SQBA 1FVDB 1T4KB 4LJYA 3R2JA 2WPNA 4FCWA 4N0YL 3OPNA 1N8ZB 5DMGD 1MNQA 4WL0A 3M3DA 2NPLX 3JALA 3FPBA 5DC2A 1TCRA 3EGIA 3STHA 4RPIA 4LSVH 2OCPA 5AK6A 4BO6A 5HIJA 1WG3A 5TMDA 5FPSA 3FC8A 5L2KD 3ESZA 2BFOA 1KH1A 2C1OA 5CFPA 3CN3A 1YY9D 3K0HA 4O25A 1Z6GA 3U26A 1KGCE 1ORRA 2SEBB 1AFVH 2G2NA 5CLHA 1JL3A 1G84A 4WACA 1OGSA 3SKJH 4AJ9A 5CZXC 3K4AA 3H65A 4ORZC 3MGBA 3PGA1 3AF6A 5PCYA 2CLDX 2NLOA 3E3MA 4WFGD 1DL5A 4PTLA 3VR2A 2GDJA 2DB8A 3VU8A 1GZQA 4M8VA 3QFDB 1ZU5A 1P7VA 4I5BA 5AWNL 4YHLH 3G68A 4ILDA 1T2CA 3ZY6A 4J23A 3TIDA 1OO2A 3A1FA 4JR0A 1JNLL 2OSLA 3T2QA 1NPDA 3BUBA 4BKQA 2EXTA 2B8OT 2IALA 4WKZB 1S8DB 2OYCA 1UANA 3CQPA 3SPCA 2C2MA 2Q46A 5DIZA 2WZPA 2FIKB 3ELYA 1WHSB 3NHFA 4E08A 4TQPA 3PX7A 1AGNA 1I7RA 1JLMA 5LIRA 2V3WA 5I7AA 4EXKA 1L0PA 2M98A 3EF7A 2ZYHA 1UAGA 4X6YA 4P23D 3LF2A 1UXHA 2XN9E 5ALZA 2AJUL 5DHRA 4JFDB 3BKJH 4X5XB 1D2AA 1A4KA 5FUYA 3E53A 3S7GA 3L4KA 2CKBB 1CUJA 3CGGA 1QK3A 1Q57A 1UH2A 2XY2A 2E5LB 1RH8A 4WUTA 4ERXA 4IFBA 1SD2A 4LMQE 5LC1A 1FDLL 2IOOA 5I24A 5IMBA 1PZCA 4YSOA 4C0HA 3WLEA 5A2AA 2PBLA 2VHWA 3QPCA 3WQRA 3RA7L 3LUCA 1AV7A 1U1EA 4TVBA 5JTTA 1MRCH 1G7JA 3MELA 2L19A 3CZQA 2D9CA 4B9YA 2EXYD 2O6DA 2AYZA 1FYFA 1H05A 5F7WC 4ENED 5B7MA 4URWR 3FSJX 2P6NA 2QLMA 5BYAA 5JY1A 2P8LA 1OL0A 1XGYH 3PDIB 1R8SA 2VPPA 3G23A 3KRTA 4CILA 2F54B 3LDUA 2WXOA 5FR2A 4MQMA 2AS0A 2ATCA 5ITFA 4NJEA 4WTQA 2MOVA 4IIQC 4EHFA 3IIJA 1ESZA 3IA2A 4YDJB 3I6GA 3NEEA 3K2EA 2ZZUT 3VR5D 4C4XA 1RY7B 1U9ZA 3AO0B 3PP8A 4JO5A 4NOFA 3SE9L 2X0NA 4EPRA 3F6IA 2H06A 4CQJA 5AB1A 1N9ZA 4MQFB 4HIXL 2KLTA 3DDSA 4D57A 4JFHE 5EIWA 5DCWA 1BXXA 3GMNA 1G291 3QJYA 2FD6H 2H6UA 3EZNA 2OXTA 5DP2A 3P2TA 3MERA 3EXEB 4GQBA 2EVIA 1NP3A 5DNUA 2I4RA 2OMEA 4ZCRA 4ZYLA 2BEUB 4IYKA 2CZNA 5ANME 2VQUA 4GIAA 4UXHA 1P69B 3OMLA 3JYPA 1ITBB 1YY8A 4TLKA 3L3GB 1KQ3A 3TB6A 2HUEA 4R2MA 4TTGA 2PWAA 3O3UN 2YOGA 5LNDA 5EC1B 2R6AA 1P4BH 1NMCC 2A9FA 2QX8A 3LC2O 1FPMA 4FZ8L 5K8IA 4G8AC 4Y9CA 4FMCF 2NMSA 4LDOB 5JYDA 4YR9A 1H8EA 4PW4A 5IASA 3CCHA 1YEFL 1NANI 1N5LA 1NLFA 3VNSA 2IH1B 3G0CA 2A5GA 4C7XA 2IMNA 5T33H 3V5NA 3F5DA 4ARVA 1A6AB 1P5ZB 2XGMA 3M1BA 3TVDA 5FCUH 2NUTB 3VFTB 2RJOA 4DFHA 3HRHA 1KJYA 2WQVA 3TTSA 2OPCA 3H42H 1P9RA 2I80A 3L9WA 3NM4A 5ELLA 1ORWA 5CCXA 1XIWA 4DK3A 4CM8B 5C6TH 3UABA 5I1KL 3USZA 3BC1A 3LCJA 1G7PA 1Q94B 2VHCA 5IT5A 4JHWH 1DTWB 3KR3L 5E8PA 4XQEA 3HCBA 4FE4A 4IMJB 4MS8C 2H8GA 1JG6A 2Z8YA 4XP4H 3WWPA 3N50A 4ZAKA 3K32A 4BGUA 2AKEA 3LKQB 1G6KA 2IV8A 4W9RA 1I9JH 1RM5A 3JQAA 3VDMA 4WK2B 1TZGH 1FNCA 3NDIA 4GE3A 4UNQA 4P9HL 3BQ9A 3L6DA 5LBSL 1OLXA 3S1SA 2C42A 4YRPA 5KUKA 3V9AA 5M29A 1MIOA 4GF5A 3N2GB 3AB3A 5CHEA 4LV6A 2A77H 1ZCBA 4V38A 3R7DA 1T9AA 2BR4A 5K9QG 3GMDA 2B94A 2YY6A 3MRHA 1ODCA 1KK0A 3B9KC 2PF6A 5LQNA 4M6OH 1TU2A 3NZ8B 1PLGL 3Q5DA 1BFDA 4JM0A 3GSQA 1H2WA 2A0YA 2YGVA 2AI0H 4EATA 1G3UA 4LPKA 8AT1A 3BDYH 3CC1A 2AZTA 3V4OA 5F5XA 1C7FA 2O4CA 4HEA6 2I69A 3P0IA 4LS3A 3QJFB 1GJWA 4UJ3A 4AEIL 3H9HA 2YDXA 3GRWA 2WTBA 2G1JA 4EG1A 1TGVA 4H40A 5ALTA 1ENZA 5F23A 5FW6A 1W85B 3GNLA 2P9EA 3GWJA 2EKDA 4KRGA 5ABAA 3OKEB 4RMWA 5DN9A 1Y3HA 4JKOA 1NQWA 3BYYA 3ZPDA 3F6JA 2XNDD 4EY3A 3FCSB 4IF4A 1PUJA 5DI3B 5JJIA 1Q9WA 2Y07H 2NV2B 3QNYA 4Q1FA 3E1ZA 1YJBA 1RCFA 3CNNA 2M6KA 3DYVA 4DV4B 4LZAA 4IM7A 4XGNA 3N1PC 2PBZA 1PVOA 2O5RA 4GRWF 2XY1A 4ODWB 4XW2A 5EE5B 5FBKA 1U3UA 5FYKD 3U6RB 4KXNA 2WAAA 3P1JA 3FYTA 3I6LD 3H6AA 4WW1B 1MB3A 2Z4SA 5F88B 3N9GH 4MJ3A 2V7NB 3PJLA 1F20A 2AOTB 4XFDA 3VV3A 3II1A 4TMKA 2XDWA 5IR1B 3Q3EA 5CZVH 3OI7A 1C1HA 2A6DA 1I8TA 4MRNA 2ZKIA 2HCJB 4H9GA 2CE7A 3NIGB 5FS5A 4JRYE 3I2YX 2HH9A 4PLVA 5IB1B 2XCOA 1K0UA 1YYLH 2G3XA 2EERA 1KBPA 1UMKA 4HEMA 3K0AA 2PN5A 1GYUA 2IUYA 2YYYA 1KK1A 3HFRA 5L4MA 1U0NA 6REQB 4E2YA 3DDHA 2Y1ZA 4G1FA 2YQ2A 5FKJA 2H48A 4Z51A 1SXSA 4JI8B 2GGSA 3SZUA 3Q7RA 4CVNA 4GI6A 4JEIA 3SHTA 1RZIA 2KBFA 5EG6C 2FOLA 5IDYA 3EYFB 1BW9A 2OMUA 4ZEXA 4JJ4A 4PJDF 1TQWA 4RK6A 4CNQA 4MV5A 1UZLA 2GJ6E 3JYBA 5ALRA 2OAP1 1MI5D 4WUUA 3V1YA 4LC9A 1YUKB 4BYMA 4GOXA 4BPRA 2O8DB 1AXTH 3B1TA 3DBXB 4EB6A 3QDMB 4WEUD 3ESDA 1I8LC 3BICA 3CN9A 3IPCA 1A4RA 1F0NA 4HMQA 1LXMA 7FABL 3UAYA 2WZBA 5EZOH 3O11A 1U6KA 1DWOA 4Q18A 1E20A 3DV9A 2DBVO 5I8OL 3VFPA 2ZP0T 5I1CL 1EVEA 1LO3H 4MJHA 3DJYA 1UWYA 1ZE3C 2OBXA 5IMSA 3RIKA 1Q1QA 4JVSB 3GMRA 4OGLA 2APSA 4XNZC 2XG5A 3PWVA 4X4YB 2X6TA 4YJ3F 2CUNA 5IZCC 5JZSA 2LIVA 5E2TL 4L7QA 4N8UA 2OZ4L 5C3UA 2PUWA 1NBHA 1OILA 2BSXA 4CMHB 4QG7A 1F8GA 3L8YA 3C3DA 3BIKA 2CO6A 2RHTA 2VDMH 3TBSA 1ZHBA 2QELA 3T99A 1L7BA 3EWSA 2GIYA 3MB5A 1BA3A 4MQUA 5A4FS 3RP1A 4J4TA 1KJ2B 3WYCA 2GA9A 1M8JA 1P84J 5BOVA 2AQ2A 2WTAA 5KJCA 5I73B 5JYEA 4GXNA 4IDJL 4NBXB 2QY9A 1MO3A 2A5DA 1AHWB 4S1NA 1G0XA 1MJ8L 4EZLA 1SHKA 5IFHL 2PD3A 3DE7X 5C8ZA 5IW1B 3A67L 5GONB 3BH6A 1W0KA 4G4JA 4JG1H 1F9EA 2CL6X 4E5YA 3TVMB 3KLQA 2AJSH 5DS1A 1RERA 2LAAA 1VFBA 4PJ8D 2XRZA 1X0VA 2DBRA 2QUBA 2DLIA 4NQCE 4Z5RA 1CIPA 1SF3A 1OXVA 2H0QA 4QQ8A 5C07A 3OCXA 2P6PA 2OV3A 4C56B 1IM8A 4F7MA 5C0AB 3CUKA 1X7ZB 4N0FA 3U0BA 3N1UA 4ZC1A 1D7DA 1WQ4A 2QRVB 1B3RA 1XZHA 4L75A 2ZE7A 4CEHB 2ORVA 2XSKA 1H23A 1OSNA 3AB7A 3CZUB 1GZSA 1UOOA 3PR2B 5CCKL 2VSCA 4HLZH 5L9DL 2VLLA 4OKDA 2H92A 4HDNB 2EDWA 4ZDHB 1FDRA 1G5FA 4W63A 3IM1A 1CTMA 1W581 3RY6C 4O59O 5KHLB 4AL4A 4LEXL 5AJHA 3L41A 1TB4A 4JHBA 2QB5A 2BLFA 3GHHA 3TO5A 5CYOA 2FLKA 3DVNB 1OAAA 4B83A 3CQ9A 2C9VA 1TAGA 4TS1A 2Q3XA 2CDAA 4D8YA 4F7KA 1U8CB 1NV8A 3REGA 2X4LA 1EBPA 2J1ZA 5BV7H 4ZOAA 4F37K 1HCYA 3CONA 4JL5A 3GSUA 2R4QA 4Q6KA 2JFOA 4CN8A 2HCFA 1L4YA 5E2JA 5J2TB 1ZGLB 1KIQB 4IJKA 1D8TA 1NJ2A 1RHJA 4CMJA 3LT4A 4M1TA 1SMDA 2XE8A 1CNEA 4KAXA 4BNUA 2CLRA 2EWVA 2QSUA 4HY3A 5ALUA 4P36A 4YRQA 3BH4A 1N2OA 1CK0L 4ONEA 1CRPA 5E0FA 1NCIA 2C84A 2BPOA 3C16C 3F85A 3PI7A 1DUYB 3S88L 1G2PA 1OA1A 5C0RH 4XOBA 3BJMA 3CLUD 3AFNA 4CIDA 3HHRB 4HDCA 4GQRA 1P84K 2OHVA 1LSUA 2HDWA 4HWOA 3SIRA 4UUMA 3T3GA 1VFOA 2A9PA 2XXJA 5AHWA 2PPDA 4A04A 3EC7A 2P35A 1TTAA 3ICCA 4V1CI 5JEDA 3AVWA 3RDTD 3ZEIA 1S3SA 2P6OA 5EGSA 3TLAA 4KIFA 5FA3A 3KYNA 1P2VA 3I9LA 4XDYA 5E8DH 1XPUA 3HJFA 3VGPA 3DTXA 3LH9A 4EKNB 4ZAVA 3ZBTA 4XR4A 2OBLA 3T4XA 5C1BA 4YSTA 4O2AF 3AF2A 4YJ2F 3PLNA 5D7JD 1CVSC 3M6FA 2PRIA 4XTCS 1NVXQ 4J5VA 4FGKA 3KW7A 1WABA 3OR7B 4PWJA 2JJ2D 3PGDA 1NCWL 1DOAA 1L4BA 4H8WC 2AQ1A 4WWKB 2DPMA 3UCRA 4C2BA 1A6UL 3K6NA 4RH3A 3EOAB 3DBOB 3KWWA 1T89C 2JELL 1LA2A 3I9IA 1MB4A 4MJIE 5LCVL 3MCTA 3CGWA 2HN9A 1TEGA 4B6EA 3NHLA 1GGHA 1VRSA 3AOEA 3WXMA 3QSKB 4RU1A 2UYHA 3EF3A 1N6IA 1V25A 2RHJA 2R0LL 2WUBH 1V43A 5AKIA 1K27A 1QFPA 5AOZA 2ZTLA 1AKWA 3OB0K 2GJJA 3PL5A 1G1AA 3A26A 2NU7A 1Q9OB 3SZKC 2IVFC 1AR1D 2YD7A 2D6FA 4R0VA 1CGUA 3ULVF 5TH2A 4DREA 4Q9CA 2GEFA 2B3DA 3NYKA 2Y1YA 2XPZA 4GECA 2MNWA 2QZJA 5AKVA 4M1GH 4MUIA 3SY0A 3DXAE 2GESA 2XT9A 4ZT1A 3S3PA 4NBZB 3P0VL 1DVFD 3O0RH 1K66A 3JAKA 3NTVA 2VL5A 4NNJA 4XO4A 3D3VB 3H04A 5A3JA 4XVRA 2BZCA 1AE1A 3NJ8A 3GO4A 1FLVA 2QUZA 1KELH 2EZ8A 2VW6A 3VZPA 2ILLA 2EO7A 3M3HA 4BXOB 1P81A 1OF2A 3MLTB 1CNMA 2BDUA 1J0HA 3FH5A 2HW8A 1F2XK 2OG2A 5L2KE 2J12B 3CH7A 4J7CA 1K6QL 1V3KA 5ADVA 1L5YA 3ZQKA 4HZLA 3OZCA 1P3DA 3RLIA 3DIVA 1K5NA 1Y8RA 3RVQA 2ZI4A 1I4TD 1WCXA 4ESKA 1M73E 3LZQA 3RBSA 4WFGE 1I10A 2RTTA 3MJ9L 3CG0A 3MTRA 4NUPA 1TJPB 1PJTA 5FWDA 4Q6WA 4ZAXA 3LZPA 2J87A 3N1GC 5AKJA 1UPAA 1GNVA 5I6KA 4ANFA 1OA0A 3ZLJA 3MLWL 3BE6A 4CR8A 3GJFK 1VAHA 3WJJC 2OCAA 2MQ0A 1OW0A 1T36A 1JHTA 5B22A 1GN9A 1ZFNA 5COBA 5DMXA 5JYBA 5ITZA 3QB7C 3VGAC 1IJ9A 3NIDF 1AM4D 3US9A 2G70A 3GTVA 2GCIA 1A7UA 1XYVA 2M1KA 4BQ6A 4CM6A 4Y2DA 3PFBA 4L1HA 1VIWA 3K9QO 3MFFB 1UA3A 5TPWH 2RDMA 4F4DA 4OHFA 4RISL 4F4FA 1YN6B 2WLLA 3H55A 1UKEA 1J8DA 1I2ZA 4M0KA 3KAQA 5LN8A 1E6CA 4NNPH 5EU6A 1XVSA 3C4VA 4V24A 3NGXA 5HHTA 1FFPA 1E6UA 1D0SA 5HA5A 2X0FA 3SD7A 4UQ3B 1Z5UA 3WFBH 1NBYA 2NXYD 1SF5A 1A6VH 4U6HA 3WDLA 4JFTA 4LF8B 4K6GA 1HLPA 1IB5A 4XVUA 5SY4A 3GY0A 3F7TA 5BZDB 3ROZA 1LILA 1C4XA 2O48X 4L3ED 2RAMA 3VFWA 3WOVA 2TRSB 1NBZB 3KPRD 3Q11A 4AYDC 3ML1A 5EAIA 5DUBB 4D9EA 4PH8A 3UWKA 5C0JA 1E3JA 3WXWH 3A3YB 5JRDS 4JE0A 4R83A 2IU4A 1OF0A 3IO3A 3N1FC 1HX7A 3HCNA 1FXSA 4GLRH 2J41A 3I52A 4AICA 5AZEL 5EIIA 3P2MA 4IDBA 3KS0H 3OKDB 1A5SB 3I2CH 3PIIA 1YT5A 4JX0A 3K5WA 2R27A 3QEUB 1P74A 4F58L 3GUHA 2MQCA 2D0IA 1GZPB 2R1VB 1RIUH 1TQ4A 3SQOL 1YIOA 1PFKA 3IPRA 4BNIA 5LD2B 5B38B 5IYZB 3QCVL 3WFDL 2PTTB 1KKMA 5LP6C 5D8JL 1ZU4A 1JHRA 3KKZA 5ID1A 1MUJA 2X7H