4Z7OB

Integrin alphaiibbeta3 in complex with agdv peptide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-IIb
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
total genus 115
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4z7oB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4z7oB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4z7oB03
1BHO1 3NVQA 1JV2A 1MQAA 1NA5A 3EH2A 1OAKA 3NIDB 3ZDYB 3K72B 4NENB 1U8CA 3ZE0B 1AOXA 3IBSA 3F78A 3N2NA 5E6UA 1YVRA 5E6RA 5KYXA 4G1MB 4MMYB 4MMXA 1IDN1 3AL8B 1JEQA 1T6BY 2VDRB 4IGIA 2I6QA 2ODPA 5KYWB 1RRKA 3FCSB 2UZYB 1SHTX 2M32A 3ZDZB 1MF7A 1M1UA 4O3TB 1IDOA 1UEXC 5ES4B 3PPWA 2NUPA 4CN8A 4JX0A 3AL9A 4XW2A 5KYUA 1MQ8B 3NIGB 3EG9A 3T3MB 5BV8A 5KYYB 3EGDA 3PPVA 3K71A 2NVOA 2WINI 1JEYA 1PCXA 4Z7QB 3IJEB 1ATZA 2X5NA 4HQFA 3K6SB 5E6SA 1SQ0A 1XDGA 1BHQ1 3HXOA 4UM9B 4NEHB 4WK2B 1M10A 3BN3A 2ODQA 2VDNB 4BJ3A 4WK0B 4K3JB 1FNSA 3EGXB 1M2VB 4C2AA 4G1MA 4MMYA 3ZE2B 1LFAA 1PD0A 5HGJA 3AL8A 1QCYA 3RAGA 1RD4A 1YUKA 1ZONA 5KYWA 2VC2B 3FCSA 1MQ9A 3VI3B 4M76B 1OLZA 1SHUX 3HXQA 3QA3E 1RS0A 1M1XB 1YVPA 1TYEB 3PPXA 1IJBA 1N3YA 2ADFA 1JV2B 4WK4B 5KYYA 3EFOB 1JLMA 4C2BA 4HQKA 2P26A 3E2MA 5E6UB 5E6RB 2O7NA 3IJEA 1QC5B 4Z7NB 1V7PC 2XWBF 4WFQA 4GZ8A 2ICAA 4A0QA 4O02B 2IUEA 1PD1A 1MHPA 3EH1A 3GXBA 5HJ2A 3T3PB 3EOAI 3K72A 2NUTB 4NENA 3TXAA 1PT6A 2VDPB 4G1EB 1L5GB 4UM9D 4DMUB 1AUQA 4MMZB 2P28A 1AO3A 3ZE1B 1N9ZA 2XWJI 3EGXA 2VDOB 3BQNB 3EGDB 4UM8B 3PPYA 3Q3GE 4Z7OB 3F74A 5HDBB 4FX5A 1U0OC 5KYNA 4C29A 3OL2B 3HI6A 1SHYB 1DZIA 3TVYA 1M1XA 1ZOOA 4CN9A 3NIFB 1Q0PA 4HQOA 3V4VB 4IHKA 2WW8A 1ZOPA 1CQPA 1U8CB 3EFOA 5KYXB 1M2OA 4FWWA 4MMXB 1FE8A 4PN7A 3OKWA 1JEQB 2QTVA 3AFCA 3K6SA 1QC5A 4WJKB 4IXDA 2VDQB 4O02A 1IJKA 1XDDA 3M6FA 2VDKB 3ZQKA 3OKYB 1DGQA 1MJNA 2I6SA 2XGGA 3VI4B 2NUTA 3ZDXB 3V4PB 4JDUA 2NUPB 1L5GA 4G1EA 1CK4A 3FCUB 2B2XA 4HQNA 3EG9B 1M2VA 5KYUB 4MMZA 3BQMB 4CNBA 4F1JA 1RTKA 3EOBI 3K71B 5LN1A 1JEYB 2VDLB 1SSLA 1XUOA 2I91A 3TCXB 2VDMB 1T0PA 1U0NA 5E6SB 3OL2A 4F1KA 3TW0A 4HQLA 4O3UB
chains in the Genus database with same CATH superfamily
2OTUB 2W5PA 2A9CA 5JVDB 2Z6UA 3S34L 3PITA 5PGMA 1NTDA 2NYVA 1P7QD 3Q6IA 2B9AA 2HX9A 1OT2A 4EATA 5EKSA 1EK0A 4P4KA 3QIUA 3TBVA 2GITA 3M3HA 1JRLA 5FHAH 2QVFB 1RP7A 2Y0CA 3UJ8A 1KC5L 1EWTA 2FXIA 3TRKA 4LDJA 1J10A 1Z56C 3LHIA 2FX5A 3WJ1A 5T3ZD 1FLRL 5IK3B 1SQ5A 3BSFA 4YREA 1GUAA 2XB6A 2W6JA 4HUCA 3CX2A 1PWYE 3KHUA 3P20A 4FGSA 1XZBA 4CKZA 3MR9B 2D7JA 2XX0A 2C5LA 4YRRA 2CBQA 3OHXA 3EXLA 3OZGA 1FQOA 1PJLA 3ZBMA 2WWIA 1SJVA 1VKZA 3H17A 4WOKA 4MQ7B 2IUFA 4JO8A 4JMXA 1OYYA 4KWEA 3DXAA 4JBSA 1RYDA 2GARA 3OUZA 4NBKA 3OX2A 3BWEA 2A6DB 5FUMA 4U3JA 4B7IA 1VGEH 3ZTJG 1KYIA 2E87A 4MV0A 4KYTA 1A7RH 3IEIA 3EIHA 1AZRA 3FR8A 3KR3L 3V4SA 4KXAA 3I64A 2UY7B 3P4OA 2P8PA 1IAII 1VB5A 1RRGA 3NOVA 2HPTA 4FHCA 4PJAA 3MJHA 4DW8A 2CDEA 1MOQA 3IMCA 4EUHA 3TL6A 4DIEA 3NTXA 3W5JA 4U7PB 2YKKA 4UT7H 4H3VA 4IRZH 3ZE2F 3FB5B 4HKBA 1J49A 1N0XH 3RDPA 5EIXA 1FL6A 5E1AA 4DLWA 1WXIA 1KP3A 3VAEA 1BYNA 1VP9A 3VZBA 5CEXB 2ZSKA 2XWRA 2F0CA 4BFZA 4B2LA 3VXSB 1ZGCA 3ERCA 2R69L 4OD2B 4Q4HB 2WHPA 4LJKA 3T0AA 1R3JB 3BEVA 4CUZA 3ZOZA 5LMUB 4J3TA 3B2XA 3QEAZ 3HC3L 1HILB 3ZYZA 4PCUA 5AKTA 1QDUA 1SUJA 2BN4A 1NCCH 4PHFA 2C4FT 4G1EB 4QL3A 4FQ2H 4KKBD 5F0JB 2UUOA 4PAGA 5E1HB 2DCMA 5EP2A 2W2MA 5JANA 3GUYA 1A7BA 4NAJA 1V6CA 1A97A 4ZAGA 3H0KA 1C5DA 3K9QO 4TYQA 1TJIL 1DJZA 2AT1A 1LB1B 3KD4A 3UZQA 1WY5A 2YZ7A 3FZGA 1A4JA 3JQ9C 3LCMA 1GM5A 2QRHA 3BKCL 4QASA 2XTJB 3X13B 5EQDA 5D8JL 3GJ8A 2PL3A 4OHUA 3GJ7A 4P82A 2AFVA 2A9FA 4QEGA 3LV3A 3LYLA 3DHMA 3N87A 4JQXC 5M7QA 4WERA 1OTXA 1HZJA 3B1JA 1RU9L 4MUXA 5D96C 3GFSA 3NVDA 1A6VH 4J6EA 1OF0A 4K8RL 1X5KA 5TSDA 1LLAA 1FG2A 1LDMA 2F62A 4F4HA 3U2IA 3KSBC 4WHDA 1DVFC 5FIEA 4B9CA 2BPBA 3O2DH 1NVVQ 3G7UA 4YT5A 3NN8B 3UG6A 4EEKA 2IH3B 3Q2CA 5DXWA 5EUOE 5IQ9B 1OGJA 2HWZH 1D5XB 1RZUA 1PW3A 1KBZA 1E4EA 4BJLA 2GF2A 1N4XL 3RKSA 4LDOB 1RSZA 4PBTA 1IXKA 1U0RA 1QQDB 5JS1A 1KACB 3NHSA 3BERA 1A9PA 3PLYA 1YS7A 4B31A 4U1NA 5AENA 1AGEA 1JYWA 7REQA 5HHQA 2HV8A 2HZ7A 4XBEL 5DGQA 1IXYA 3VKFA 4MA3B 1AKEA 4IMRA 2VERN 3OV6A 3NFYA 5CB4A 3OQIA 5FGSA 5F7EL 4Z7OE 4L5FH 2BHZA 3RHFA 3V3TA 4P7GA 3VXSD 1NVWQ 2OL3L 4PJBF 4GM4A 2APVA 2DEUA 1I1QB 3PGMA 5IB2B 3WIEA 2A74B 1X7YA 1PX4A 2OLDA 5FOBA 2K2WA 3D9QX 2OORC 4FCHA 1Y5NA 1KI6B 5A2JH 4RWHA 4Y4KA 1EE9A 3EXEB 4YDJA 4OYHA 3LW7A 4WAUA 1U8AA 1FO0H 2J4WL 1PSKL 3FQXA 5JS6A 3V7AG 1O94A 3T0DA 2IYQA 3A8TA 3VFSB 3OMIB 1FOEB 4GRLA 4KDCA 4H60A 4ZHSA 3B4NA 3S3CB 1TIBA 3AP3A 3T0IA 4XX1E 3SKVA 2HT2C 1X7HA 1AOXA 4YDIL 2H4XA 4LWOA 1C7TA 3R8BB 3KC2A 4HAZA 4IOKA 2OXEA 2XTJD 1KGCE 5I1HH 4QDUA 3MCLH 4B73A 3VSAA 2RSLA 3RJ9A 1GXSB 4R6XA 2R29A 4HXFB 4Y9UA 4IMKC 1KJ2B 3O3BA 4M9OA 2NY7H 3I01M 2JFHA 4HAVA 2YOHA 3U3XA 4FI6A 2YQ3A 3E3AA 1P2CA 2P24A 2VW4A 4WW1B 1KI8A 2KQMA 4GAGH 1QF7A 3EY4A 3CN1A 1FIGL 3Q48A 2IW3A 1QZXA 2QUHA 3KR0A 4F2EA 1MAJA 1J2EA 2DY2A 43C9B 1QHNA 1CJMA 2Q50A 4L4YA 5E7MA 3EDFA 4EIBA 4L1DA 4OHCA 1WZLA 2BX5A 5HDBE 4DMUB 2LD4A 3QVSA 4ES6A 1MJ7H 5D6DC 4CG3A 4MR7B 1YQUA 2FPGB 3DDCA 4D4HA 3IMTA 1YA6A 3K9BA 1T1ZA 4GGPA 5KDOA 3CC1A 5AM1A 3WS7A 2RGYA 2FQGA 3GS0A 3PE9A 1JXJA 3VTZA 1O5TA 2Q9OA 4F3FB 3M46A 1UASA 2ZCVA 3QVUA 4LHUG 2I1VB 1MZYA 4EF6A 4WN9A 4XPAL 5IVDA 5FO2A 4G2AA 4QTHB 5JHLH 3KLSA 1LVUA 4FM9A 3VFVA 1BC5A 3OKLA 1WFMA 3TUZC 4I18B 1RZVA 5ETJA 4N3GA 3FIUA 4FAAB 4YQEA 4UJ3A 5IMKA 2A67A 4ZVPA 2AJ3B 1P5UB 5AWNH 1D6VH 2DM4A 1X4ZA 2NY0B 1SLWA 1I9GA 2J20A 1E20A 3D2CA 4JM0A 4DBZA 1N3IA 3X1BA 2UWEA 2ZP0T 1ENZA 1POWA 3FQ1A 3K31A 1T66C 5EZLB 4BFSA 2XY1A 5F0LB 4DYVA 3IP5A 1N59A 3II1A 1EGAA 2Y1KA 2KJQA 4R7DB 3BA6A 1B0ZA 3H5OA 4DR3B 1V0JA 3N0AA 4CVNA 2BHRA 4FE3A 3CTPA 4E12A 4YIKA 1TU2A 3GPEA 1ETHA 1JK9A 4PY7B 4RWYL 2Q3EA 2BVQA 4EVNB 2EKPA 5D93B 2MCAA 1MJJB 4UQ2A 3A1TA 4WFED 4BV1A 1UC8A 3QEOA 2GCIA 3SXUB 4A0QA 3NW9A 5C92A 1QLEL 1M8JA 5DE3A 2WQ7A 3WS3B 4W63A 3IRPX 3KEQA 4GD3Q 2XWJI 5I1DB 5DFVD 1Y9JA 3ZHNA 2DHRA 2VATA 4BQCA 3TEXA 2EFYA 1UPCA 3KZ1E 5DSCA 1W1IA 4FGKA 2XUOA 4E0RB 3ENQA 2K7ZA 5H02A 5ALMA 4WA8A 2EJBA 3P0VL 3GPLA 5IVNA 1SZCA 2YH2A 4XTCS 3FLEA 4WSKA 3P5BA 1UZ8B 3LB6D 1BXAA 4BUQA 3RIAF 1A5BB 4UEWA 1RULL 5LAPA 3S1LA 4E9VA 3EO0B 1JZSA 5LA6A 4LAJH 1M7HA 3GP3A 2PYFA 4P2AA 3TCLB 3IO5A 4NYJQ 1AH1A 2OCCB 4TT3A 5DNCA 3UMSA 1PVVA 2VI5A 5CAYB 3EIXA 2EDOA 2XX3A 1IQWH 3O45A 1QLFB 2J3KA 3UERA 1OBFO 4HWPA 2ODIA 3NBQA 4I0WB 4JKYA 3LYHA 1D4OA 1C1DA 4MYTA 3EOYG 3O3AA 2JCBA 1ZD1A 1TRKA 5DWVA 4Q66C 5J3HC 1XCLA 4AEIH 4HAUA 5B8CC 1N1DA 2HNAA 1F4LA 4PFEA 4X00A 2OG1A 4RKRA 1F38A 1CVIA 3GHEH 2X8AA 2NY0D 4JK3A 2WIIB 1UT1A 2VHYA 2PWDA 4DLNA 1I7SB 4NMMA 1CO1A 1YMHA 3NC0C 1XIWB 1QD0A 4FQCL 2HLAA 3ILHA 1Z34A 2AUNA 3VVWA 1GYWA 1JMKC 2OD7A 4OATA 3M4YA 4G4SO 5IH7A 1O6VA 3CFUA 5B38B 1NGWA 1J5CA 2XTSA 4X1YA 1QUNA 4TMXA 1S9YA 4LBEA 2ZXWB 1SUEA 3L8EA 4G23A 4LQFH 3PICA 2ZP8A 3KPVA 4TZTA 3CZLA 4YC2C 4JN1L 4ZO8A 4CEIA 3WP1B 3JV4B 5CT8A 1DJIA 3PDHA 5DVOA 1W36B 1MAVA 3K09C 2BELA 4LX8A 2XODA 2YRWA 1ES0A 2HSJA 3WMEA 1IB6A 2JDIA 3TWCH 1V9SA 3FN3A 2NO9A 3L2LA 2PRSA 5FDWA 5DFAA 4Y6PA 2AJUH 5C3MA 2R8YA 4A8JB 4WUKH 3T3HA 4IOFD 3H1EA 4NKMB 4HV4A 4OY3A 4RESB 1R4NB 5AG9A 5I1IL 2OHHA 3MMSA 1JGDB 5JRZA 1AO7E 1PBTA 2CUKA 1ZHNA 3LL7A 1HDGO 5JW6A 3A4NA 4BQ6A 3PE4A 2JIOA 2ZLBA 5CVCA 4HDNA 4PG5A 4PJAF 1GMEA 1IAKB 4BZ1H 4WGVB 3MLEA 2Y1YA 2FN8A 4JQOA 1YEKL 3IN2A 1DAKA 4JG9A 4YAEA 4J3VA 3V6LA 1U3HB 5HGAA 3MWLA 5C8VA 3T65A 2CHEA 2ZJOA 1KSGA 4HPOH 1AF7A 3HKCB 4BAGA 2HCFA 4KR6A 1G0OA 5IQNA 2NY4B 1ITCA 4F7EA 1NFDE 3R5TA 2FW7A 4P7KA 1DP4A 4U6VH 1HL4A 1JFLA 1T8WA 2BMKA 3NGMA 4MUHA 3UAEA 2C9DA 3MV8E 3KUDA 5AVQA 3JQOB 4UUJB 3US1A 2V3CC 2VAXA 4PZPA 5EU5B 1FZJA 3VWJB 4ORGB 2QYTA 3FFAA 1XN4A 4GBXB 4AM8A 1KVTA 2WF8A 1W5SA 1XIWD 1FMLA 1OAAA 1RQ5A 4Z49A 5IMOA 2JFWA 2J3QA 3SHSA 3QEGH 2FY8A 3KVOA 2PZ8A 1X5MA 3MSPA 5A6MA 4MR8A 4K8OA 4FLOA 1KIQB 1KFGA 4PIPA 5JPMC 4MKHA 3ORFA 2GPYA 3DSFH 4POYA 4AKHA 3B2NA 3GP5A 3EDJA 4GKBA 4BUZA 1OTSD 5JHMA 1Z6YA 1VGQA 2BUCA 2YRXA 1HXMA 2ZOKA 1W36D 4W9KC 5I2IA 1NAKL 2KS6A 1LC3A 3LKQA 4RFNC 1T1YB 4MVYA 1AY1L 3IALA 2DFTA 1DDTA 3ZJTA 5JJLA 5JCOC 2HAZA 4DZBA 5KWEA 2PTGA 5ADVA 5AJTA 1A2YB 4MROA 4O51A 1T3FB 5FWXB 1J0DA 1T9GR 1OP5H 5BUGA 4U3CA 1KCRL 3QYNA 4ELMB 3RIXA 4YO8A 1NGXB 1YAJA 1X1SA 2GJ6A 3NRBA 5MHSE 5ILGA 3ZIMA 3JRWA 5LXGL 1XD9A 3JYOA 3NYRA 4JKIA 4H2DA 4FDUA 4FL4C 3L8GA 1K2WA 3GLAA 3T8XB 3UYPB 1S4MA 2G28A 1R5IA 3NSYA 3JQDA 4DESA 1TGYA 1CHNA 4FYPA 3HVDA 2XXGA 4UTOA 1PNCA 2DGDA 4J0HA 4ES8A 1U3HD 2BTQA 2K3TA 1CY1A 3MCZA 3IFSA 2I7CA 2A9NH 2AKYA 3L18A 1G1OA 5B1KA 2NY4D 4D5EA 3HVNA 1QNFA 1XFAA 4WU5B 1GADO 2QB5A 4NNPA 3P0JA 2XV0A 2GZAA 4LDQA 5BRNA 1NU8A 1BJ1J 1OBCA 3G6DH 1CGXA 5CB4F 3W3AA 3BD9A 2IBSA 1G7HB 3WHIA 3AROA 5JWRA 3LDAA 1IFHL 2Y1AA 4Z7WB 5HZGA 1YUBA 3BGVA 4XYMA 3VWJD 3CFJB 4GBXD 2C07A 3PPIA 5H4ZA 2IP4A 2ZOUA 3MV9A 4ZW7A 2ZOLA 2W6IA 4DGQA 1MNUH 4HMQA 4MXDA 1E5ZA 1PZGA 4JVPA 3RWBA 4DGVH 3T4YA 1K2VN 4LZAA 1W87A 2BHYA 4A6YL 1M56B 3VTTA 4WKOA 2UVPB 3TJHD 4DQLA 1DO6A 1A9YA 2EBFX 1UBMS 2C3XA 4DHLA 2B4QA 5F2FA 3HUJA 1RD4A 4QYXA 5F1PA 4BQOA 5BUPA 1STOA 4D4GA 1Z36A 5J1TC 2YPLA 1Z5LB 2YD0A 4QOGA 4UFNA 4OXNA 4MJ5B 3PAVA 3DBRA 3WUZA 4NM8L 4B40A 1NY6A 2IBTA 1YEGL 3LNCA 5BO0D 4MVJE 1EEXB 4F33A 4TLSA 3KUUA 2VTDA 2FEOA 2JJ2A 3RDTC 2PBFA 1YYML 1X13A 5K0JA 4KO2S 2ZTVA 2C9XA 5D55A 5T6BA 3HFSA 3OZVA 1E2PA 1DIHA 3V6ZB 1AD0B 3NGXA 1V5EA 2XVBA 5EVCA 1LK5A 3PQ8A 5C5IA 5F93C 3D5QA 2YEQA 3AHDA 3ZWNA 4CODB 1WG8A 4GIBA 1DS6A 2HNBA 3LPAA 3VOSA 1WDLA 3EYQC 2CJFA 4F15B 1YBFA 2J59A 1C30B 4E70A 2HK8A 2IOOA 1JDZA 5JALA 4M6NL 5LLIC 3B1XA 2M6LA 3KDMB 2YMXL 1E60A 1IEHA 2DPLA 1ZAYA 2DL9A 3SKMA 1SC4A 1ZRUA 2XT0A 4GG8B 4OFQA 2XJ4A 1NMEA 5AI0A 2YRPA 4PV8A 1W6RA 4QT0A 2NU9B 4WV1B 2CFRA 4A5SA 4NYLB 5AUMA 1YMUA 2YC2C 4I1SA 2V4MA 3L5WA 4JL5A 4BRJA 2PMKA 4NTZA 1Z0AA 1D03A 4KKLD 5HGBA 3TR6A 3MFGB 2IVFC 2HJLA 1K98A 3BIOA 2DTML 4EJ0A 1WCBB 1SG9A 2ZCHH 4LYHA 4IUCS 4ODVH 3ZWCA 1HL5A 4JUFA 4KPYA 4PW4A 1OP3K 2WJAA 2FSGA 3JQ9A 4QWWC 1PLCA 1UWXH 1IHXA 3D2AA 3UYLA 1FTWA 2CDGA 3E6FB 4LOIA 1A9BA 5JW4R 4RHUA 4R7TA 1VCAA 3TLMA 3U1SL 3H54A 4DCPA 3N40P 4BLQA 4JQXA 1X5YA 3LSTA 4HC1A 3V8PA 2MKLC 4BQBA 3WWYA 2QQLL 2WW8A 2B4YA 3VV3A 1DUYB 2NU6A 4PJEA 5HTKA 5IVPA 1XL1A 4XB6B 4FLMA 1DIOB 4UC0A 3GRPA 3LPGA 2Y23A 5E4OA 5IT9A 4PRHA 1TR7A 2EBHX 2VJDA 1DVFA 4XQCA 1JEYB 1H8LA 4ZJYA 2P3SA 3NH6A 2EC5A 5FIUA 1T0NB 4V0KA 4D56A 1F2XK 3TAUA 3KWJA 1CYEA 1ZW1A 2XCQA 5K0ZA 2R2EA 4OLWH 1FBIL 5I9NA 2CMRH 1R15A 4AP9A 4RK4A 3AQDA 3ULUF 5G2OA 3TL2A 3FUDA 3L6RA 2A4KA 3MLSL 5B7PA 2H1RA 1QACA 3UTPD 3OH8A 1JR4A 2DLEA 4D0NA 4FXKC 4YEDA 4URZR 5GSRA 3D43A 2Y36H 1KJVB 1ZHBB 5DK0A 4O2EB 5DTIA 4QG7A 2XECA 1IIRA 2FB4L 2W8CA 4C8XA 1YFKA 4YK4B 1YS4A 5LA6F 4YHPA 5EU6B 2FR4A 4XASA 3V5HA 4EAEA 1HEIA 5DF1A 2J9FB 3QO0A 7FABH 4NRYA 3M7OA 4OM0H 5BSTA 1KJ3L 3GRGA 1O6TA 1RJLB 3CZKA 5JPNB 2PD6A 2OORA 1A5FH 2FG7C 2X4IA 4QEDA 3GBSA 4FHDA 1Y1QA 2SKEA 2X77A 2ZOOA 3F6IA 1ID5I 4CU7A 3K0WA 3ZK7A 5C0FB 1ZDMA 3QJZA 2WIKA 1TM4E 4YX9A 3RC2A 1ECYA 5EFIA 3HCCA 4KO7A 3ND9A 3ZE0F 1MEXH 1UIMA 5A6SB 3IYLW 3D18A 3A3OA 4AYDC 3RREA 3CSPA 4ODSH 2EXYC 3S1SA 3M6DA 5DDHB 3FZQA 3PR3A 4BNDA 1IC0A 3HLAA 2GTPA 1GHFH 3FJOA 1NCJA 1SJXA 4IMKA 2YAEA 4NO3B 1JXAA 4Q4JB 3KE9A 2JELH 3M70A 4NE9A 5TE7H 2ICCA 2ZB4A 3NYWA 1U8OA 4FKKA 3L7NA 2A86A 3A3YA 2E18A 5MFZA 2RJ3A 1L5VA 1ICEA 2QAJA 3T12A 3CR3C 2O59A 3T5TA 4MVJM 3OAYK 1GPLA 1YNKH 3PE3A 5BP7A 2PWPA 4HZUB 5E99L 4B3BA 2WILA 4R3SA 2QY9A 3H2GA 4XPZA 5JNTA 3IQGX 5CD3A 1MUJA 3RGHA 1Y48E 4MPPA 5D6DA 4RK7A 4V3BA 3IEPA 2AJSH 2R86A 4CKXA 3LO5A 2MQ0A 1DAGA 4CIDA 1J1XH 1F8TL 1I10A 4I66A 3CAFA 3QC5X 1ZMBA 5FLYA 3STLA 4AGPA 3KJGA 3FPYA 3OT1A 3GKZA 1PJRA 1YC2A 1RRPA 4I08A 5J4YA 1DCKA 5MENE 4DPRA 3OX1A 3H7LA 2BSSA 2FNAA 3C08H 5EU6D 5DHEA 5IWAB 1EUYA 4R1MA 2GFBA 3Q7SA 5I8CA 4G5SA 5EI5A 4BQIA 5JSZB 4F8NA 2FLWA 1PU2A 2WXFA 4X7BA 3KD2A 3OQJA 2O6HA 3H11A 4AFNA 3ZD9A 2W00A 1CL7H 1NCBL 1VMAA 2H1VA 1NOFA 4WWOA 2QRKA 1RC1A 2FN3A 3D4LA 3ORHA 5HGDB 4WACA 5TC4A 5DTJA 3NKFA 3N53A 4I3GA 1TVEA 3Q6NA 1G6RA 4GZMA 3WS6C 1ORQB 2QTRA 1C7ZA 5I5GA 4XP1H 4AZ3A 3ZWAA 5EIQA 3L9EA 5KBNC 4P32A 4OCXH 4CSSA 2E4AA 3UTTB 4GP5B 3W0WB 5DJZB 2DJ4A 1U65A 4OI2A 3ZWYA 5IYZB 3O4JA 5BRPA 3P9NA 5J2UB 1M1NB 2EAUA 4BBWA 1Q1NA 4GS7B 2HDWA 2F53B 3RNKB 2GEJA 3K73O 5TQ0B 1QKJA 4HS8L 1ZZEA 3PAYA 1DQIA 1F0PA 2AJYH 2CSPA 4U63A 4EHKA 1IE4A 3DE5X 1O77A 4XEUA 1JFSA 1I7TA 4MW4A 3NTUA 3MLWH 1D5MA 3NXSA 1T9DA 1Z0UA 1B0GB 3R3SA 5LDDC 4YCSA 4MAAA 4EFLA 2UZIR 3FMGA 4WL0A 3MCAA 1R46A 4I55B 3T38A 2C7QA 4Y4HC 3NCYP 5IAKA 1OGIA 4AYBA 4OBWA 1A95A 2YBEA 5JXED 5CD5D 3UATA 5TF1H 4XMZA 3MRTA 5IROD 5FRDA 2G60L 2J3SA 3AU0A 1VBFA 3QNUA 2VSDA 1VJ5A 2C7BA 4G83A 1ND0A 3X1KA 3IP1A 4YACA 2CCVA 1PS8A 3WHKA 3KQLA 3F7PC 5CLTA 5FNVB 1W9HA 4FC3E 2QV4A 1EUUA 3RU3A 1E2HA 3LUPA 1OILA 4K9KA 4QUAA 2W42A 1C1EL 2GPAA 1U63A 2AJXL 1Q9LB 1NVUQ 1T0PA 4ZKEA 4H1TA 5AQ1A 1CN4A 3HFRA 3H8VA 4FXGB 3M9XA 3LTVA 3QQNA 1EXWA 5B8CA 5I6MA 3B7YA 5EJMA 3P0EA 3PV6B 2YPKA 1FHGA 4ROSA 3UBXI 4JKPL 1S8DA 4Z7QE 5HIIA 3MO1B 1CDCA 1KN4H 1NQUA 4FTWA 2VZ8A 3HI1B 4IK7A 4F1SA 4JJ5A 2O5XL 3GMLB 3S2FA 1B41A 5G3ZA 4UD2A 3E8MA 3BCFA 4E4TA 5BZXA 4CFYA 2QMJA 1CXKA 3AUJB 2OXHB 1YCSA 2EJCA 2JC3A 4WEOA 3VU8A 1SXZA 4A7UA 3LPMA 5F33A 2Q6IA 3QRWA 2FX9L 3UTTD 3S35H 4PC1A 3W0WD 1N2CB 4LSWA 3BKJH 5JNSA 5AAPA 1PSWA 1KYDA 5FQNA 2HN7A 2ZAYA 1EEUA 5JR1H 2F53D 4NZFA 3H87A 5COBA 4OSEA 3IFNH 1NMAH 5DS8B 1KLUA 3BUIA 4MHOA 3TXAA 5I0XA 2DQKA 4EF5A 2IPAB 3PUKA 3W7AA 1M0EA 2P7HA 2BIFA 1NASA 1OAYH 1BZOA 3K09A 3YASA 2F74A 2C9ZA 1TL7C 5CJ8A 4J3XA 4JX9A 2ETXA 2CUZA 2AN9A 3HUJF 3W9UA 3MS2A 2J3HA 2W65B 1HLDA 3PWTA 3IFPB 7TAAA 2IPXA 3LU1A 1J9ZA 2BBSA 3AB3A 4QVIA 4YJ2B 2EE6A 3LUHA 1A6TA 1KQNA 1FRGH 2NQDA 4Z0TA 1ZSHA 4ICWA 3IQZA 4Z4QA 2QG4A 5IKOA 5HIKA 4AQ7A 3KLKA 4IQ8A 3C8DA 1J9QA 3V55A 3FFDA 3M8KA 2X15A 3S29A 5JLZA 1Z9NA 4RFEB 3HBFA 2WIJA 4I2NA 4LSPH 5DSTA 1FVEB 1QRTA 4RZSA 3OESA 4F2MB 1D5IL 3CSUA 1WUNT 1W0WA 4N82A 5HA5A 2F90A 3MLAA 3TOSA 5AKXA 4JLDA 3UG3A 1M71B 1SFDA 2PMFA 3RRQA 1ZRMA 2XIQA 2XKSA 4XC1L 3THML 2GYSA 3SN6N 2C3MA 1L7MA 3VNSA 3HXKA 4CGZA 4F9PC 5F2KA 5JU6A 1R3UA 5IOPB 3T3PE 2ZXDA 4QRIA 3BGIA 3RAJL 3H1AA 1GNLA 4C54A 5JADA 4OLFA 3CF0A 4O59O 4OP1A 1E4WL 3CO0S 4RE6A 5AVTB 1J33A 3BXZA 3L3HA 2GK6A 2XAAA 1B6DA 2J73A 3ZVNA 5JPMA 1LE5A 4AYMC 1J9CT 1HV8A 1ZGLP 2J9XB 2JAUA 2CLZA 5F52A 2I6SA 3E70C 1FJ1B 1G9NC 2OJEB 5LJIA 2RKBA 3LYUA 2K6ZA 4JPIA 4GU5A 4P49A 5C0GA 2AFHB 1PNQA 2X0VA 4PJFA 4AQ8C 5DR5H 5JCOA 1UXWA 1C29B 2N01B 4QYOA 5CCGE 2FV8A 1CP3A 3BK2A 3HKEB 1GQQA 5EZJB 3UGKA 4WI0B 2P9YA 1U8UA 1EFXA 4PJEF 5ITBL 2X4RA 5SZIA 3G0IA 4N85A 3QV2A 2DWEA 3QXUA 1N8TA 5A1TA 3G5XB 4PO1A 2MINA 5JG7A 4AVHA 2AQRA 2PSDA 1G4UR 5HHOE 5H37A 3NJ8A 1CFMA 3CLRC 5J12B 1ZPDA 5CCBA 3OQ1A 3LXCA 1Q38A 5LPNA 3RAEC 4WZAB 4XN5A 5DI9A 2YFHA 3SR4A 1FB5A 3AWIA 2J56A 5HYVA 4AENA 2HPVA 3N40F 4YAOA 1IU9A 4JFSA 2V17L 3M1CA 3TVMC 3H2IA 1T8YA 2YWEA 2X8WA 2YWCA 2PL9A 1MN6A 1QHGA 1W34A 2CL6X 1KB9J 4DT1A 1AUPA 4KKNA 5CUSL 1IT9H 4FFNA 5B12A 2AQTA 5ENWA 3VOAA 4AC9A 1I6LA 2ZBQA 1ZIPA 1SM3H 1U8CB 1IPFA 4XPBL 2G04A 1JHTB 4S35A 4DOHE 3AFCA 2PUDA 4YONB 1S7XB 1I7PA 2B1RA 4MJLA 2OBYA 2ZI3A 1HH6A 2HJFA 1LW7A 4LO9A 2D7QA 1XYVA 2QKSA 1THAA 2W11A 4P23B 1MB9A 4ZZFA 2UYOA 4W9JC 4WEBH 4AS3A 3W78A 3GUCA 4BNGA 1KIFA 1ZSVA 1ZT7B 1YBHA 5KSVB 4DF9A 1N2BA 3T5AA 1YYLH 2R4QA 3RP1A 4ZX3A 2HLPA 1GS6X 4WTWA 1Y7HA 2OD9A 4M4RA 4X65B 1YD7A 4B9IA 3FDJA 3LUKA 4YP1A 4XMPL 3VYSB 4K2UL 2CD0A 1XMWA 5IF0B 1SQGA 2QJRA 1MA0A 4TQ9A 4K8RC 4HFJA 3GMRA 2IF0A 1UC9A 1MI5E 5CU9A 1F6WA 1B2YA 1PG7L 5EZYA 3L07A 2IHNA 2MQ3A 1EGVB 1LX7A 2Y06L 4TYYA 3RDTA 5GRJL 3P2EA 4LQ1A 3IPCA 3F7RA 4MQXD 4QBKA 4OXKA 1MNAA 2XLCA 3TSWA 4LU5L 1DL7L 3ZHXA 4AMVA 2ZXAA 4G8GE 3X1YA 3LX6A 1UZUA 3IB3A 4JPQA 1OZGA 1UT2A 3QK0A 5E5RB 2FGWH 1ZTXE 1JHZA 3IWUA 4AMXA 3MNFA 3EJUA 4L5AA 1RQRA 3DI2B 2O2EA 4PREB 2BIQA 2PN1A 4LTDA 1F2VA 1HORA 1ET5A 1Q44A 3LKZA 5K09A 1KZHA 5JO9A 3L8CA 5D01A 4I4CA 5IEKA 4UNRA 2RFXB 5KU1A 4FNLH 5MENB 4IIZA 3SGJC 4N2IA 2JWGA 3CZRA 3HDHA 4JROA 1B43A 1PZ5A 3OGCB 5IFKA 4FFYH 3R5HA 2PKYX 4UCFA 2X14A 5J58A 3ZGLA 5IZ4A 3W2HA 1ZS8A 1UBNA 4I88A 2IVFA 1EUQA 3FYHA 4LOUD 1IUZA 1LI5A 1XGTB 3GPCA 3GTVA 1UA6H 3UPRB 4P23D 4CF5A 3ZHVA 4UQBA 3V95A 2ON6A 2MR6A 3KLOA 1VE3A 3N2IA 1PKQB 2HJKB 5CF3A 4UVHA 1JG2A 1H6CA 4QWWA 1SUDA 5DGDA 3PL6C 4QC2A 1M6NA 2SICE 4O29A 4WKBA 1GQOA 1SQSA 1JKMA 3FB8A 1U7DA 3HGQA 4CMHC 4C22A 4IDJL 4YGVA 5ETUA 4PJXF 3O74A 2X9XA 4B41A 4JAMA 2Q5JA 1SO8A 1ZC3A 2PMZA 1YR1A 5FBHA 5BNWA 4RGMC 4O4LA 3RVDA 3DP7A 3RCBA 3UABA 4B7ZA 4OBEA 1UURA 2C9AA 1OYWA 3BQVA 1HKUA 3KZXA 3X2SA 4TWBA 4CIXA 4M1DH 2CNKA 1PYGA 1BM7A 1B23P 4WASA 5DYOA 1R0AL 4FE9A 1I1YB 3C3JA 2OZEA 1CXLA 5ERWA 3UCRA 3MRIB 4I6JA 3UNXA 1G4AE 4CA4A 4POAA 1TQTA 2AHOA 3ABLB 1ZO8A 2XDAA 3AHGA 2Z2YA 4IDPA 4MXQD 5HVHC 1YEFL 2DAPA 4ND3A 4TRPL 4FXKA 1DZ0A 4NGHH 4DETA 4AJKA 4E9XA 3NJHA 1G2QA 3MLTB 2ATPB 3IDAA 2SCUA 3WZLA 2XFXA 4PJIA 2XYQA 2ZSJA 1Z8FA 2X0KA 3NRFA 3KYCA 4KKXB 3UHPA 3HLTA 1ZUIA 4J27A 1Y0LA 4D92A 5GZ1A 3KJIA 2RTTA 4DREA 2TYSB 5MEND 1QO0A 2WINA 4ZAXA 4X45A 4EGAA 1J0JA 3LECA 3STUA 3UXHA 3BUYA 1VFBB 1JVLA 3SP1A 4UAJA 1RWNA 4LN1A 3BTVA 4PTTB 4KYVA 4HUJA 5JLAA 3KSRA 3M6WA 3LC1O 4I48A 5U4XA 2ZT8A 1V1MA 3KLAA 2JE8A 5B1EA 1OH5A 1MX9A 3MLBA 2G75B 1ASPA 1QI5A 2V6JA 3OJCA 3HZHA 1IC7H 3OQPA 1SBNE 5INCA 2YPVH 4JKMA 1SXBA 4R4BB 2QN3A 1UATA 821PA 5SV4A 2VSCA 4AURA 1E0OB 4X1OA 3D7RA 1WJ3A 1KLFB 1DQLL 2VDRL 1VHTA 1Z74A 4G8CA 1KB5L 2A6PA 1CY6A 4IMLB 3I62A 4MVJH 5F7MC 4L27A 3D05A 4M0MA 2Z8XA 3UMVA 2XZCH 3L4BC 4ZVRA 4PWIA 3C1OA 4RTSA 3NJLA 1IJKA 4J0CA 4NFYA 5TR9A 3HVIA 1KQPA 4ZTUB 1NM4A 5L3SA 3KEHA 3EH4B 3EOBI 2AI2A 1Y1UA 4KX5A 3BSHA 4KMRA 5F6HJ 4EZKA 4DKFL 3U7QB 1WHPA 3W5DA 4FK8A 2IXTA 2HQBA 3JWDL 1FYTE 4ODTH 1GCFA 4KROC 3A4MA 4PO9A 4R2MA 4ZRMA 1SFHA 3EGSB 4PC7A 1IX2A 1NJFA 4K2HA 3J7AC 3K0BA 4A63A 4ZS6C 1XDTT 3DO8A 5TQ2A 4M6OL 1RZJH 2YNMD 5T1JA 3K5RA 5THQA 2WD7B 5IAJA 4NO5B 4AG4L 4HJTA 2IANB 1XEXB 2NZJA 2ZE6A 1G7RA 1NBEA 4BX3A 1EFCA 4H8UA 3ZHSA 2HJVA 3GSUA 1GUFA 2N75A 2CGRL 3EYOA 1LRJA 4AZSA 5LLTA 4GMTL 4B1FA 1F1AA 3LHAA 2XKNB 4DR4B 3GVIA 3HG1A 3D59A 4EJ2A 3TV8A 2PWEA 5LNK6 3GUUA 4BLPA 3BMCA 3IBOA 4F04A 1N25A 1U6AH 2VO1A 2A1WH 1KZQA 1ZM4A 2AEQL 2VDOB 3LRKA 5DWQA 4OJYA 1YC5A 1NEZG 2UXGA 4X94A 4OM1H 3DJRA 5CB0A 3ZHUA 4GO6B 3WS6A 4DH2A 1JBKA 4RSYA 4UQIM 3E9MA 3QF4A 3ZDZF 1D0VA 3RG2A 2I7XA 2ALAA 1CR1A 1DVUA 1YEHL 1Z6TA 5D3QA 2JD0A 2ITDB 2HFFB 4J9UE 1MAUA 5CZXD 2XXFA 4FUQA 2PPFA 2CRYA 2E89A 4URWR 4JRXE 5C08E 2WT4A 2OO5C 2GSMB 3G5WA 1AHHA 4FBLA 1CJBA 3MACL 1LPMA 3MLRL 2FL5B 1UACL 1JBJA 3SPVB 1GZUA 1FFTB 1E98A 3F00A 3FU7B 3CJJA 2DTXA 3IJ8A 1RLIA 1TDJA 1B7GO 4Y4HA 5CGMA 1OFUX 4PGEB 1JQBA 5G40A 2M1KA 4XB8A 2ZUFA 4X93A 2IWHA 1DQML 2VQEB 3V9FA 3O4GA 1Q0LA 3CSDA 4PJFF 5B3JF 2VF7A 4DANA 1GOHA 3CMOL 1SXGA 3KKPA 2XNAB 3KPSE 3LQRA 4K3DL 2C3UA 4HNSA 2DLFH 4DMFA 1XKXA 3QNXA 2YXPX 4QHMA 3VVMA 3N6RA 2R7EB 2IAND 1E3DA 2BFAA 3BE4A 3QUMB 3C16C 2FEJA 2H2GA 1G55A 3CW8X 5C07B 5IVKA 3PDOB 4Q7DA 1PZ2A 4N2CA 3EVTA 2F8SA 1RYEA 1T6ZA 1V8HA 4IUYA 2EEDA 1HOCA 3HACA 5HKKD 1Z0MA 4IZHA 3MVSA 5IXSA 4S1NA 3DOEA 4R1TA 5EEWA 4PXYA 3F64A 3QF7A 4BCCA 4DO4A 1OIWA 2BOCB 4TLKA 1MIOA 2GCOA 4FE4A 1HYEA 4GC9A 4MVJI 2BGWA 1IN4A 1V6SA 3UAJC 2RGAA 4F6RA 3UAWA 5I6OA 1XCBA 3DZDA 3IR5A 3TRJA 5FYLH 1INQB 1XTIA 4BZ2H 3A7DA 3BYZA 1JQKA 5K93A 4QAJA 1ECLA 2FSIA 3CSYB 3T6VA 4L3EA 4N2EA 3G6AB 1Z4LA 1XGYL 1JZFA 3SEZA 4KDTA 4K5MA 3JWGA 4H8PA 1U1EA 1B76A 4GYJA 2ZYSA 5GGRA 2G5RA 2ZXQA 3ZZNA 3NHKA 1R0XA 2C9BA 4K46A 1KS9A 3C70A 5IUKC 3ULKA 2NPFA 3QBVA 1BZDA 5DN6D 1ML3A 2IG2H 2HKAA 2BNUB 2K78A 4Z3KA 4H8HA 4HCRL 4XYBA 3NQIA 1EU1A 1LO4L 3JQ8A 4U7KA 5D2LA 2SKDA 5IHZA 1J25A 3FGPA 1ILUA 4HUUA 3RYHA 5DO8A 1YQXA 5F3RA 2VF2A 2BY2A 3VFGL 3DDOA 3K72A 1ANKA 4CBVA 5JS8A 4B3EA 5EZ6B 3V7YA 4UI2A 1BX0A 1TTGA 3ZTTA 4TUKH 3AVWA 2ZZUT 1E42A 1MI5B 1X5LA 3DMMB 4WI6A 3BZ4B 5F51A 5J7CC 4PN6A 3MJ9A 2KZKA 4LDZA 4XARA 3S98A 4O2CB 4W9DC 5DHAA 1T7YA 5AW0A 1P2GA 2QE7D 2E86A 1U3GA 5EZYF 3DPUA 4A6DA 3S8FB 4WI9A 3O82A 4NARA 3KW7A 2X5JO 5CXPA 3T94A 2J8HA 2NW3B 2L4OA 4S3MA 3Q11A 4K15A 1IVTA 4WLEA 5SX5H 5CEEA 3NA9L 3DOIA 3TCXB 4J7CA 2P91A 5C07D 4QM6A 3ZE8A 3U0TA 3GEFA 1EMDA 4PHCA 2IPKA 1F2UA 4JHVA 2NNRA 1GKLA 4UNSA 1ZIOA 4J4BA 2QR5A 2GX6A 4M8LA 3NWBA 3U13A 3AJ8A 1U2GC 3THRA 3CFKB 2Z9TA 3UUEA 4OI9A 3Q41A 4F9PA 4JVUA 4X5WB 4X9IA 4MQSB 2Q2VA 2VLRA 4LARL 1TTCA 2X10A 2NW2A 2Q20A 3JALB 4Z0PA 1I7DA 4WLCA 3IDYB 4R6WA 3O8CA 3CRVA 3QW9A 2VTEA 5BNZA 3EVZA 1HYHA 5CJJA 1BGXH 2DIBA 3UUWA 4BWTA 3FU5A 1T4MA 5D6CA 1XR3A 4XYGA 4RKEA 3BJIC 3LUDA 4U6QA 5CA1F 1HE1C 3DYIA 1UPFA 3MLVH 2GD6A 1XH3A 3F7LA 1RM4A 2WD0A 4FFZA 2O6CA 3VSUA 3CCHB 3QZWB 2FUCA 1PKOA 2OWDA 1RM0A 3ZKQD 4TLCA 2VWPA 2GB4A 4Y0NA 1JE1A 3GSQA 1M7DB 3ZGVA 1S7QB 2C2XA 1W35A 2BFBA 4MIEA 2ABWA 2DMHA 3KAAA 4KLZA 3JWNE 1CFVL 1KEGH 1M72A 2ZYHA 3KJ4B 1BFDA 3ZS8A 4P0DA 5A3QA 3LWNA 4AQ8A 3BQUB 1Q92A 4KMMA 1H2RS 2WUFA 5E4YA 5EWLB 4WTZA 3TEZA 1W46A 2D5BA 5PAZA 2OC4A 2H7VA 1P4BL 1A7UA 4I8XA 3QG6B 3LMKA 4YWHA 4L7QA 4N6RA 1VLLA 4QEZA 2NP6A 5FUZH 4KZDH 4O4LF 1IN7A 1JWBB 3DMMD 1L4HA 2J2ZB 3VFWB 2H5UA 3OKAA 4YDKH 5L2KB 1VFMA 2XMCA 2HWKA 2JI9A 1UHVA 4KNTA 4PUBL 4MJ4A 3HCVB 1Z4IA 2OC9A 2OYSA 1DV1A 4Z7UB 1N9GB 1B00A 3VFOB 3ZWVA 1SZJG 5HPOA 4ZK8A 3R3XA 4Q9JA 4Q4AB 4P08A 1GRNA 4A6XA 2I55A 4Q1CA 5L51A 4WBNA 3RB5A 3TVMA 4L1LA 4XAWH 4YLEA 3CFYA 2IHTA 2LFGA 1AS3A 2G8LA 3CZFB 4KBGA 4R5MA 3PNMA 4S0ZA 3S8EA 3A1FA 1SUHA 3LEVL 4XRRA 3OKOB 3OPYB 5BZDA 3M3DA 2FWIA 1CDDA 4PJIF 2X1VA 1A4KB 4I13B 2J6CA 3PUHA 5LDUA 4NQEA 1LBSA 4JFVA 1M1YE 4G6AC 2BFNA 2ZRIA 2ID4A 2WYIA 2ARKA 2IELA 1Z0IA 3ZGXA 3NACL 4KTGA 2D5AA 4A23A 5EFOA 1O0VA 4CQLB 4HEHA 2ZX6A 1IKOP 4C29A 3DTVB 4NQUA 1AHIA 2BP8A 1OPOA 3OM1A 2A4EA 3MNZB 3H6AA 2BMJA 1PQ4A 3RE1A 1TT7A 1E9BA 5BQXA 3VH1A 4KW7A 4OD3H 4R7LA 2ODEA 2MNWA 1RQPA 4J3BA 3T61A 3QUKB 5DHMC 5ALRA 2VPTA 2IX3A 3NTQA 1M05A 2AKEA 1GZ6A 5C80A 1HXYA 3OSVA 1FY2A 2H59A 2QT9A 1LD9B 2Q3HA 4Z95L 3QP9A 4B50A 4COOA 5JHBA 4W9CC 1QSEE 1E2KA 1AS6A 4ZQFA 3BP6B 5F98A 4AB1A 4U00A 3BQUD 3UJHA 1D1TA 3WNVA 3VX3A 5KYWB 4NJAH 4JT2A 1OFHA 4JENA 5AB1A 4K9NA 1RWKA 4DN6A 3T77B 2AVNA 2A4ZA 3FU8A 1R0RE 4MNGE 4N47A 3F7VA 1CTQA 3IP8A 4CUCA 5LNEA 4UE2A 5ICCA 5DC0A 4Z1MD 4UILH 4YDLC 5EZSA 5KIAA 5L2KD 2H3EA 3WKEA 5DMKA 2CFIA 3F9IA 5JRJA 1AQ8A 3CVUA 4GB9A 6PCYA 4JS0A 1EGJL 3SJBA 2B3IA 3WWCA 3DYBA 1QJ4A 4JRYE 3L5KA 3SSMA 3VO0A 4WJ5A 2V7WA 2EUWA 2VDOH 4LC9A 4QLBA 4HT3B 4QT5B 2AVDA 4J4PD 4QGAA 1MREH 2H7CA 2HO4A 1AZNA 2F3PA 4BQNA 4X6DB 2OL3A 2Q3BA 3ALPA 3GDCA 4MCMA 4OLZL 4GG6A 1G20B 1V37A 2VLJA 1SY7A 4D97A 3F8TA 2VMFA 4UIMB 3AY0A 3SGJA 1GL6A 2GK0B 3KE0A 2KZBA 4P7FA 3KVPA 1YCDA 2PR4L 3JQEA 3L3GB 1YDEA 4D3SA 1FO0B 3BXXA 1PJ9A 3AMKA 4LCVA 2QTVA 1R2QA 3AM5A 3L7MA 3V4VH 4RBPH 3MREA 5TFSL 4H31A 1N2GA 4WSJA 1THGA 4RQUA 3L1JA 3D3VE 4Q6IB 2I29A 1GCGA 4X4MA 2WABA 3Q8BA 2ZK7A 5IEHA 4M7JL 4Z4GA 4KE8A 1D4AA 3DTVD 4YJHA 3PL6A 4KRNA 3U81A 2B5IB 4XOBA 3EQ8A 2HN9A 2K7FA 4AQAA 1G21A 3OQVA 3BXGA 1P1IA 4FA8A 4CMHA 5HJ7A 5EKDA 5B7EA 3MZTA 3OLQA 5TVKA 1HHIB 5F9DC 5TPWH 4M8NE 2I9TA 1C7RA 2FH5B 2AK3A 3WLMA 4TKUA 3BE6A 4BDTA 1EVJA 3HHPA 4W99A 2R0ZL 3PS6A 1BXRA 1GZHB 3L6FA 5EOTA 5ESQA 3TIXB 4DOMA 4N2FA 4JRXB 3QX3A 4ETNA 3I6LE 1H2FA 1VYHA 1ENOA 3G9XA 5DRWA 4XPTL 2DI7A 1FZKA 2DICA 3DUSA 3VZDA 3COWA 3WHLA 3P2IA 4FMCB 3WKDA 2R2BB 3AFOA 5MF6A 3QJVB 3ZE1E 3GZPA 1MGOA 5AXBA 1QF6A 5CU5A 1CE1L 1F6AB 3C6QA 3OR6B 4ZEWA 5HYSB 2Q6KA 3UTSA 4P2RE 4WUUE 2Q6WB 4ZARA 4UMFA 2W2NA 1EFPB 3CLEH 3NIFB 3KP1A 5I9QC 1ZXXA 4X4YB 2YC1A 4DE5A 1NOKA 2XG4A 1I36A 3WV0A 4DDKA 3QA9A 4F7MB 3M45A 2P9RA 1BXGB 4XWKA 3ELUA 3WDMA 1NN1A 4OJMX 3VRJA 1QQBA 3SDXE 3SF8A 1GNVA 4MD5A 4EQ3A 3SBPA 1C80A 1G7SA 3BFVA 3EYWA 1L8LA 4AJ2A 1U3VA 3OHSX 3OTIA 2GA8A 2ANCA 2V4ZA 1ZGZA 3DBSA 5C1IA 4IY1A 1H9CA 5JTUA 3T4UA 1UM9A 2P2SA 3EG9A 4FGLA 3L7EA 3DE1X 4TM7A 3OOSA 4QRHA 2J32A 3B6JA 2FPPA 4DWHA 2NSJA 2ZUDA 3FT2B 3QPQC 4LC1A 5FKAA 3UB3A 1OV8A 2H26A 3CHYA 3RS2A 2L69A 2N47A 4R3UC 1V27A 5FYJU 3DX8A 4M6WA 4S05A 5MEQA 3TBWB 4FP9A 1PI3A 5JHHB 1JF1B 3VYPA 2DSNA 3N0RA 1FI8C 4GHWA 1DAIA 4N1EA 4L6AA 2FO8A 5FO7B 1DFGA 3QWHA 3CCCA 4PI0A 1MCQA 3L4BA 1S78D 3H1PA 2ZROA 4PJDF 2XWCA 2J45A 3R5JA 2IFFL 5EXPA 4XAKE 4U7GA 3DE4X 3HY6A 3V2GA 1WDMA 3KZ8A 5CH8A 1JDAA 1MY7A 4JRXD 1VPLA 4RPJA 5EORL 2P67A 1SXJE 2PZGA 4BIKA 2IIBA 1NDHA 4HDIA 4P2OB 1BF8A 2V7UA 1UINA 1J2UA 5D2LF 1YKFA 1ZTXH 2EUVA 4TSCL 1MEJA 3QAZC 2BCEA 1RXYA 1IG0A 5I9MA 3SJUA 2X6VA 2IJ0C 3CHPA 2RG7A 3TQFA 4PJ7B 2YHGA 2VPWA 2WVVA 1T0JB 2V7HB 2GN1A 3FG9A 3NIDB 3HEAA 3X1MA 5EMYA 3VNRA 2YKLL 1UENA 4HJJL 1N3LA 2RGXA 1Z3GH 4ODWB 4K55A 2YAMA 2ZWSA 1XJ5A 4PLWA 3UHOA 3LUJA 5CT5A 3KS9A 4XVHA 4M7LH 3E3QE 5C7ZA 1VGKA 2CWDA 15C8H 3RKPA 1U7XA 4HNVA 2BFEA 3CLKA 1O5DT 4Z3GA 5IQMA 4G5GA 3IKCA 1ZMYA 5F1SA 1CY8A 5CJBA 5H68A 4XHJD 1D6EB 2DH6A 4HJGA 3MTXA 1U8MB 3ELBA 2W9EL 4ZTPH 1R3LA 1PT8A 1IE5A 3FAWA 1KYUA 3R7BA 3E9QA 1CLCA 2B78A 1MQKH 2L7UA 3O8RA 1E62A 4BE5A 2CM5A 5GGVH 1FUYB 1GVNB 2UVFA 3OD3A 4ZUVA 1N9ZA 2VSFA 1RUPL 5KX5B 3LNEA 5CP3H 1I3KA 5DLDA 4PSRA 3PNLA 4BY9E 4FZ8H 4JFTA 3UBMA 2AXNA 3GHBH 1HRDA 1EX6A 5JIBA 3VSBA 3V4OA 1W47A 4D0DA 4K6FA 4K71C 3I50H 2OO5A 3DBHA 3F7KA 3NM4A 5E2UH 4NQDE 2W6QA 3VACA 5D7IA 4K87A 4U1SA 5ALCL 4FKMA 1RHRA 3QPXH 4MXWH 2JAQA 4OB6A 1J70A 4KY2A 4OIFA 4MZ3A 2ZIZA 5EOQH 5C0BA 2IC2A 3SR0A 4L1BA 5KOIA 1E1QD 2BW0A 4P2OD 4EDFA 1A8HA 4G5ZH 3FZUC 3T3MB 4L0QA 3Q2IA 5IC6A 4PJHB 1ZJYA 4OHVA 5EKUA 4KQ2A 2QLNA 1G9SA 3HY3A 1EVKA 3OC0A 3G04A 4PRPA 3DM9B 3RSZA 4B87A 3UN1A 4BNUA 5CNMA 1ECFA 1DAFA 3VFUA 4XXHA 3TAHA 2BZ0A 4MIYA 3DZIA 4MA8L 3I6SA 5AVUB 5CEZL 2HU8A 2IH4A 3OEHD 2DOKA 5BYAA 1VHJA 1O9BA 4KXZI 5D7JB 3TYGL 4PS3A 2FJHB 3VMPA 3OB0K 1LK3H 2A94A 4F2GA 2QQ0A 1XLVA 4G0ZA 2N0MA 4G9DA 1SYSB 8MHTA 5HBBA 1AO0A 4H7PA 4ODUA 5ESVB 2BI7A 3N1GC 4OQ1A 3UAJA 3QPBA 1SCAA 1SEBB 4WBNF 5DHQA 3EBOA 2X4TB 2AXHA 3ELDA 3R1GL 5I4CA 1HDEA 1LPSA 3TD9A 3KQPA 2Q1SA 2ZX8A 1P0MA 1T03H 4Z8FL 1M1YB 2OMTA 2EEFA 5KJ6A 3UWKA 1E1RA 1Q0YH 3GI8L 3HDTA 4PHTA 4JKLA 4X5XA 1XBTA 2ZSBA 2QEJA 2IWRA 1OC2A 3CZ9A 1NAIA 5FOXA 3EPLA 4U1MA 3UWDA 1CTMA 3ZZMA 1JPTH 5CCDA 2B82A 4R2XA 3EXG1 4NCBA 3KYNB 3VDAA 4J16C 4X6BB 2YXDA 1PK9A 1E1KA 4HUQA 4PWHA 3HE6B 2PS3A 5D3MB 6FABH 4ZXBB 5GIRA 2NVWA 2KMWA 1CLEA 2I5PO 2PZLA 4I2XB 4D8XA 1EHAA 4X6CE 5A2BA 4MVCA 4NYIQ 2MHCA 2R8OA 3TUIC 1R24B 3AR5A 3SIWA 3ZHBA 1MO2A 2XBZA 2R8EA 2O3UA 2SBTA 2ZRBA 4BH7B 1ESZA 2VQUA 4KBPA 1E9VA 4E5PA 2NNAA 3AMLA 4OB8A 4B3HA 4MD4B 5AKGA 3KVQA 1CQXA 4PRBB 3WKYA 3NFNB 2DWDB 3AG5A 2JLWA 4MUNA 3ADKA 5FM8A 2WTRA 1B74A 1QBKC 4Z76A 2VB5A 3S8YA 4MNGB 1FYWA 1FVFA 4EUPG 4OQYA 4G4SP 3ZU4A 3OAWA 1AGBA 2B1AH 1Y1TA 2BVOB 3HKZA 3AX6A 3MJSA 3FOEC 2VHUA 2WXGA 4JDVA 3DX9B 5K7SA 1VPVA 5E2BA 4LK3A 2EKZA 2BEVB 1YMME 3LS4H 4IW4C 2NIPA 3HBMA 4JRYB 3HCEA 4WU7A 5D7JD 2XMRA 1RRCA 3U4MA 3AGQA 3VO8A 2CXPA 4LSDA 2D0GA 1KFCB 3K5WA 3LGXA 1T7XA 1UMKA 1H1TA 1U2GA 3ER9A 3W5VA 3FOZA 1YK0A 2QT1A 1U0NA 3ZTNL 1SU4A 4GG6F 4XJSA 5D6OA 1RMYA 4OL0A 3C5JB 5EIAA 1E99A 5KG9B 3FFCB 3SY0B 1LBHA 1X5ZA 4WNJA 1AP2B 1QRRA 1B2LA 4HYQA 4JWTA 2CV2A 1ZK9A 4HWEH 4IDBA 1U8PA 5IJ9A 4Q9IA 2B6NA 4ZCTA 1NBOA 3QQPA 1AXSB 3I9OA 1G1MA 4L4VA 1XD8A 2J7PD 1MB2A 2XQYG 3KALA 3TNMB 3FUFA 2IITA 2M1ZA 4M02A 4G72B 1JU3A 5JBQA 1I4TD 2X1QA 3HE6D 4JC8A 5M34A 3ADCA 4L1KA 4AROA 1WUJS 3QJSB 1NQWA 1RZRD 1WS8A 4ZXBD 3OXSB 4N3TA 1DE4B 1YJBA 3UPTA 3IO3A 1XGPB 1ZQ9A 1W8IA 3QELA 3WQRA 3NNNA 2WWRA 5DHSA 2OVFA 2GXQA 4U8HA 3GLHA 3LX4A 1X7WB 2F1KA 4MO9A 2G7MC 4YUWA 4H8WH 3D8NA 4KXDA 3K8KA 1QVOB 1RPQA 1U4NA 2HMSA 5L0QB 1UFOA 5K9JL 3MJTA 3MTEA 1ZAGA 1DBMH 1B0UA 2F8IA 4YRNA 3C1TA 1I80A 3SJZA 4C06A 2YYZA 2XDQA 3WIVA 2R68A 3OJLA 1DAOA 4L9RA 1IILE 2OSVA 1E9OA 2IHYA 1XRQA 3IKMB 4H6WA 3ZDEA 4FFSA 4FNAA 3TA3C 5HPMB 2ESVA 5DQ9A 3I2YX 4JRYD 3VR1A 3D0KA 2Q0SA 3WQSB 1I7NA 3C75A 1YJ5A 2B4CL 1RP9A 2I6QA 2OSLA 4WCYL 4ZO6A 4OF0A 3CE6A 3VD1A 5ALJA 3MAAC 2RHEA 5IKXA 5KN5A 4JRFA 5D1ZB 4XVSH 3T1HB 4BLOA 3QZMA 4LYGA 3W8NA 1I7RB 35C8L 1T04A 1P84J 3ZK9A 121PA 2MSDB 4A4DA 4ISVB 2OMBA 1IFXA 3FFCD 3MJ7B 3FNKA 5J5AA 4ILKA 5A06A 1TXGA 4L8DA 1JXOA 3LRTA 3GA7A 4NZUL 4OCSL 3WR5A 4V2UA 3CIAA 1PGOA 3ML1A 3MUFA 3NOOA 3BZUA 2WIGA 1QQ7A 4YZFF 3EPKA 2C2WA 3Q6FA 1HJCA 4KLRA 4ZTBA 3LZLA 3OMZA 1JZJA 1WXFA 3QFRA 1UKQA 3VGBA 3NUQA 3UK6A 1HL8A 1MV8A 2O8BA 4ZAVA 1B0RB 4E4RA 1N57A 1T9CA 3IIJA 5P8WA 2Q1UA 3B78A 2FJUB 2Y71A 3ZWDA 3NCJH 1GEEA 3BGOS 2FBJH 2HRPH 5INDB 1IBGH 5KBLA 3SF0A 4PLHA 2R7NA 4XHQA 1RZFL 1Z68A 4HF5L 4YJDA 1RLUA 2X7XA 3IV9A 5TE9A 2PT7A 4M7RA 3L3DB 1M67A 3FLAA 1NCGA 5HCUA 3S3DB 3H9YA 3ZU8A 3POCA 2LR0A 1R6UA 4ETQA 5KYUA 2P47B 2VOEA 2P3YA 5BXFB 2CGZA 5GGSA 2ZJ8A 3I53A 1R3HB 1TENA 1PR5A 1HSOA 5HY9B 5IJDC 3NSXA 2X09A 2OMWA 4C07A 1XF2A 4RY9A 3DEZA 3PLRA 4AM0A 4KDFA 3WE6B 1JGUH 3V0JA 5D1ZD 4CT5A 2EDFA 1Z7EA 5D1QE 3SS7X 3IEUA 4J0IA 1DEKA 1KJWA 5K8LA 2XSZD 1YJDC 2BYTA 1CXZA 3CZAA 4YT8A 4RFSA 4XP6L 2E47A 1V7NL 4H4EA 3BIBX 1KDYA 3SM3A 4Q7KA 4N48A 4OK3A 1I1CA 4AGQA 4KXNA 4LT7A 3WV4A 2HKIA 5JE8A 1TK3A 3T6XA 3D39E 2EF1A 2W0SA 3PUWA 2B92A 1IGMH 2VLMD 2KI5A 3UBXB 3QQ4A 1N7JA 3WFBH 4MWSA 4YSEA 3SKNB 3JWNH 3VXRE 1FFOB 4G5FA 3FQ4A 1L7TH 2JJWA 5JAOA 3OKPA 4I0PB 3KYBA 3K5HA 4IHJA 2G9HB 4XP9L 4GI6A 1AQKL 1V7ZA 4JQCA 3IBFA 4A7SA 4AJLA 3NH7L 1B26A 4F4FA 2O30A 4KGVA 1URIA 1OJ7A 4ZV4A 3IOYA 3IGFA 1ULAA 2PSEA 4JB2A 1CV2A 2CG9X 2X6AA 5HJGA 3NEPX 2P5TB 2PGNA 5LGJA 2XYBA 4TQEH 5JQIB 1PZSA 4Q3NA 2Y0DA 1UZMA 3ON5A 2PPLA 1OAQH 5FPKA 3GTNA 1RXCA 2ZB2A 4LYDA 2FEXA 3LVTA 2O6PA 4WHTA 3M5CA 2QM7A 2XRYA 4RENA 3S81A 4CKWA 3IT1A 4IOLA 3D0VB 1F3JA 3LQAL 3WG7B 4BN4A 4E1BA 1R00A 4CTJA 2FUQA 1XMPA 4WPGA 2P6MA 3GLVA 4KAQL 3FTGB 3R40A 2GHTA 1CBVL 4WGFA 1AJ7L 5FEUA 2DV6A 1N7MH 1FGNL 3IJHB 1BFOB 4RHYA 4UM8B 3B2DC 2ZZNA 2Z08A 4M5YH 2AS0A 5FTWA 4AO7A 1N2RA 3X44A 1VBMA 4KQIA 4LVHB 4RGOL 1C16A 1WGOA 4RVBA 4DAEA 4FPXA 2Q5HA 1Y1DA 3MBXL 4FOPA 1ST3A 1NHGA 1U9ZA 3ZHLA 2CK0L 1ZKAA 5JXHA 1QK4A 3GQBB 5GJSH 4RMWA 3CG8A 4OLXL 4C2TA 3KKEA 3WFCH 5DD0H 5HF6A 4HIXL 5C7LO 1M2VA 3BLPX 4IDNA 4P86A 4KO1S 4JZJB 3H1ZA 1BWSA 2YMQA 1ONPA 1MN4A 4JLBA 5E1DA 2GBAA 2WMNB 3QWAA 2EEPA 1RMFL 4K94C 3ZL4H 1F17A 3OLZA 4JQIA 2ARJB 2FG6C 2N1MA 3QCUH 2LKCA 3FTNA 2CHFA 1LQBC 1KPRB 3OCUA 3D7MA 1I1FA 3K2IA 4A0FA 3DZ8A 1IM9B 2GIMA 2RD2A 3BMNA 3SPHA 4TWRA 4UBKA 1VRVA 1NLUA 4NV0A 4I0PD 1A6ZB 1X7XA 2IOQA 2VYVA 1U0GA 4AP6A 1AZUA 5EUOB 4IQGA 1U8KB 2DEWX 4PXAA 4TTRA 1QVZA 5D7SL 1R33A 3BVNA 5FA4B 1IQPA 5CJ5A 1AT1A 2C5GA 1MTOA 3A7EA 3STXA 1ETJA 4H88H 4YNBA 3WO1A 1X5JA 3I74A 4YVUA 1WXQA 3X12A 2YYSA 4Q3DA 3I4CA 3ULAB 2HH0H 3HS0B 2P0YA 3GRUA 3FTPA 1CE6A 4Z7OB 3OFNA 2ATVA 3GRBA 3LNDA 2QY6A 5C8JB 2JB5H 1XGQB 1RIHH 3QARA 4GQQA 3CJRA 3AF5A 4AJEA 3J27A 1GPYA 4I77H 1RJFA 1ZCBA 4LYYA 3TDKA 3V0AC 5I6XC 4NF2A 5E8OA 4OUDA 5DBEX 4UMDA 4XSHA 2EIXA 4JI2B 4IBSA 1WETA 1ET8A 4DLRA 1JJFA 3NORA 4TS4A 3B3QA 1VL2A 2HP4A 4FYSA 1OUMA 4RAUB 2GTQA 1AMXA 2ERJC 2HXGA 5AOVA 1IBCA 1ROCA 4TWAA 1HAWA 5FLXA 1ZIYA 3G3EA 4XOIA 3FGNA 4MP8A 4MQ6A 1OH7A 2IVZA 3V0GA 1ZANL 4P5KA 4XGZA 2VHZA 1T36A 2H54A 1R4MA 4OJTA 3MWKA 3RROA 4X64B 4MTCA 4N0YL 3I04M 5EFZA 1HXKA 2G9NA 1GTNA 4FHKA 1CDJA 5ADHA 1TJHH 1W49A 2WE7A 4LSUH 5DHVH 2FEDC 2JGDB 4MP3A 4NWUL 1BFTA 3KVYA 3LQKA 1PLAA 5DWUL 4QTIH 3TBTB 1P6XA 3FTWA 2PZMA 2ZUSA 4OFWA 3O3EB 5FYJE 3LFUA 2ZYGA 1XVIA 1NDMB 3PWKA 1F5NA 2XSKA 3JWOL 4HBQA 4KQ1A 1IM9D 3FOMB 3VR3A 4GQZA 4YT2A 1W88A 4LI0A 1BZEA 3HXTA 3Q0EA 5EHQA 1WL8A 3ZHKA 4FQJH 1L5GB 4HGNA 3C5ZC 3EAQA 2D9CA 1YI8A 4PRIA 3VKGA 2QJOA 1VMDA 1C7SA 3D25A 5HDBB 3RA7H 1TQ4A 1NLBL 2UXCB 1ULSA 4HLCA 4ZW8A 1QG4A 4HKZB 3K9LA 3TLXA 3T4XA 5E2AA 3N9GH 2PETA 4P48A 1WYJA 2Y68A 2FO1A 1WBJB 2ZUQC 3W2DL 2YJ3A 3U31A 3UP1A 4N3UA 4GQRA 2D0IA 1PJ2A 3QVGA 1UUSA 4FHEA 3GARA 3N41F 5JWHA 4OLAA 2YBRB 2Y3AA 4D8VA 4FG6C 1J1PL 4OIIL 2EZ8A 2IADB 4KHTL 3SYTA 1XZFA 2LCQA 4KIUA 1KH1A 1QGZA 1U95A 3W57A 3CKKA 2K9FB 1T1WB 2D4FA 4Y88A 1XT6A 3VFTA 1DSWA 2E56A 2FZLA 3UIYA 5I76A 4OP2A 1M2FA 5C0AE 4NHOA 4E5XG 4FQLL 4X44A 2ZJ2A 3QWFA 1A6PA 2EX0A 3IU3B 2UWEF 2KPWA 1XWVA 4JHAL 4JC5A 3DX2A 3VSVA 3DV6B 2B0CA 4NBLA 3ABGA 3CFCH 1BVUA 1MT3A 4NZZA 3O3DB 4ZV7A 3T8MA 1KJ9A 3L4JA 4KK3A 1PVOA 2FYYA 1P4JA 2QFPA 3CSTA 2GJKA 4ZVLA 1KGCD 1R12A 2B37A 2BE7A 1YS2X 4MAUH 3ZRSA 4HEME 4MA7L 2Q5BA 4XCEA 1O2DA 2YWDA 3MCKB 3CMMA 1QFXA 3LN5A 3SPXA 2WKSA 1ODTC 3DX4A 3JV7A 2J57A 3N2KB 1UKAA 1TIUA 1JNLL 2PX4A 2EUZA 3VI4E 3KYMA 5KOMC 2RI6A 5HDWA 4J16A 4XPIB 4JGNA 5LNGA 5LQKA 3DFMA 3DWTA 1U4SA 5LBSA 1WB9A 4YP5A 1QX3A 3P2MA 4AE1A 2IKSA 3QITA 5L6MB 4X8HA 2HT1A 1K3FA 2F00A 1LQSR 3BVVA 2OENG 3S7TA 2UXFA 4KNYA 5FGCE 4C4UA 4HAIA 2QRJA 3MA7A 5EMMA 2WKOA 1DFIA 3ARPA 4FFOA 4LZKA 3LRMA 2WBKA 5BO1H 2O8DA 3HUTA 1CFZA 4LLUB 5F88A 3TLRA 3MUNA 4XWGL 1MVOA 1HRKA 2I69A 2HBYA 3L43A 5JNYB 3PEEA 3NHZA 3M17A 2GT9B 2JWYA 2V0GA 4LCCB 1E9DA 5J9PA 1MUUA 2CJWA 3JZ7A 3CBQA 4G7SB 4GOJA 3L7IA 1CCZA 2OJZH 2YAOA 1G6KA 5CIPH 2C57A 3KWUA 2QVXX 3NYQA 3L48A 5K6RA 4O8CA 2IXFA 3UEZA 1PCSA 5CHNB 1M2HA 4Q9RL 1EDZA 3GWGA 2R56H 4EIZC 2BVUA 4LFBB 2J1WA 5FYLE 1CYXA 4Q7JB 4W7IA 2K4AA 3K0AA 3R7FA 3CLWA 4ZUWB 1ZOOA 4DAGH 3QVTA 5CFRA 4PS8A 4HIEA 1Q83A 1M8FA 4OU5A 2KM1A 2OUKA 2IMMA 1IEAA 1LXCA 1HFWA 2C3YA 4U0KA 1GTSA 1DJWA 1Z5GA 2C3WA 4JPWH 4EBFA 1U3DA 3A6CL 3RB8A 4D2NA 5HYJE 4EYSA 5IXJA 1XZCA 3GEPA 5I5RA 2X1WL 1LF0A 2QVZX 3UZVB 4MUAA 2FDXA 4NC9A 4CM9A 4I46A 1G3RA 3O7MA 1KZ6A 1T6YA 4BNNA 3GI9L 4YXLL 4N7BA 5HI4C 3I61A 4EDWH 5KQLA 4FFBB 4PINA 3EXFA 3LH2H 3CK0L 3TLBA 3FN0L 1DXQA 3F67A 4DGIH 4E9LA 5LQBL 2N46A 2AV6A 5ULLA 4Z4HA 4YY3B 2BVPB 3VXUE 3UHJA 1AO7B 2A0WA 1U92A 3AU1B 3DIVA 4XIJA 4JJ8A 4CQMA 1H0HA 3SAJA 4FA7B 1E8DA 1QYWA 1X9HA 1E2BA 4M5TA 2Y7NA 1CF1A 1XELA 1AURA 1UWVA 3ZCXA 4AVKA 4PLTA 5A05A 2WFMA 2WQ6A 3I9KA 1HQRA 1MHEB 3K6FA 3RSFA 3GKWL 3LY5A 4YHBA 3UWSA 3PHJA 4Y5VB 1M5TA 3LP8A 3Q2WA 4MD0A 4O9HH 4XBGA 4TXLA 4NKDB 4U2YA 4IBZA 1F4XL 3I4LA 2EADA 3LQMA 1P2SA 1EHYA 1ISMA 3MT0A 3EOBB 3FFXA 4FGWA 1NFDB 4N0FA 4C4TA 1JG1A 4QJ4B 1T5BA 1G5GA 3MV8B 3KVVA 3TA3A 4RIGA 5CGTA 3BMQB 1IARB 4Y1RB 1NJ1A 6GPBA 4JDZB 3U7JA 2N3JA 5TRTA 1K2DB 5E6YA 1WCIA 2EF0A 4PJCA 5G0UA 4Y1SA 1XF5B 1H3TA 3UGQA 2VXVL 4F9GA 4TQAA 4W9RA 4P59H 5BQ7A 4CN8A 3NFRA 4U3XA 5BRZA 3EPJA 3BN3B 4R8WL 4QHKJ 1FORL 4EA8A 4ZZIA 2G1KA 1NONA 5JAQA 4ABWA 1UFQA 4Q16A 1QIMA 5CAEA 1CS0A 4MJIA 3Q9LA 5LBTA 2V3EA 5F4ZA 1O6CA 5C0JB 3EUEA 5ICZA 2B0SL 3CZEA 1G41A 2W0FA 2XIIA 1KKLA 1FDIA 1IBFA 4NDMB 5EDSA 4Q6WA 1QR1B 3ZQJA 4Q0MA 3G5UA 3QFFA 4PVBA 1DIGA 4XD7A 1RZKL 5KWIA 4DCQA 1OLZA 4PRAA 5CYOA 1LK0A 1KIPB 2ZSWB 3M5WA 4RISH 1SCUB 4W5WA 2ORBL 4IK6A 1ZMRA 4PTYA 3QEKA 5DNYB 3QSGA 2QHXA 1AO7D 4V39A 2JQZA 3KZVA 1RUKL 3PKJA 5LP6B 3ARBB 1NKVA 1GIGL 3WENA 3E6AA 4YIHA 2ZIDA 1MJ8L 5I1GH 3IDGA 3BKYL 4E5YA 3F6PA 3X3GL 1WLSA 1KNOA 3ZDFA 4L37A 3GDBA 2UYGA 4DMHA 1M6VB 1VCIA 1C3EA 3ACDA 4M9PA 4IS6A 4ZFFA 3ZVKA 4YGAB 4W5TA 4GIPD 4EVRA 4D44A 5BNIA 3WNNA 3P73B 1V5IA 3L46A 3OTHA 4IOIA 3K71B 2XT6A 1J4AA 4A2PA 1SHXA 5BRQA 3KOMA 2WUCL 1SIWA 3DV0A 4CMBA 3MV8D 4BX0A 2YFQA 3GEMA 3CONA 3G2LA 5I4KA 4BE4A 3FCSB 2DRIA 1I2DA 2GD2A 4UOJA 2ZWZA 1ESCA 3MGAA 2P1RA 3X1DA 7YASA 1I9IH 2YYYA 4U1HB 4KDTC 3DGEC 3NDIA 2NX5E 3GL9A 3GFTA 1MPXA 1JLKA 1E7WA 1T26A 4NEGA 3O8BA 2D0FA 4GXVH 2WBLC 2FPSA 4LRUA 1IQDA 2ROYA 4OQXA 1OLSA 2JIQA 5F1IB 2UXTA 4L4TE 3RVWC 3HNTL 5HDRA 1ODSA 3EF3A 3CEHA 1TKCA 5CM2Z 4Q52A 4GPZA 1CJUC 3LBAA 1QASA 5HCIA 2GQ0A 4HUMB 2YCBA 4M03A 1RBYA 2BOBA 1A25A 4NCNA 1R9NA 5L4MA 1VCOA 3E22A 2WGNB 3X17A 4CBPA 5BN4A 1QWNA 3G5YB 2FSHA 1KB5A 3GCXA 3BRWD 5C81A 3G08B 3TDMA 2DULA 1R9FA 1G8MA 1OSZB 2GJJA 1S4QA 4FD2A 1HBJA 3PHLA 1OHHA 1GW0A 1T2QL 1GPMA 2C7UB 1JEQB 5CDYA 3PGLA 2Q86A 3ARBD 4H0IA 1AIPA 3O93A 3LJKA 5MHSD 2IU3A 2BM9A 1QGDA 2ECFA 2FJGB 5IN5A 2PYEE 5TT0A 3BE5A 1HKFA 2Q07A 2VDNL 2VJBA 4WJG3 3GLZA 3E3NA 1PSDA 4KMOA 3L1KA 3L1VA 1NCHA 3A6KA 3X1EA 3TR5A 2KT6A 1RHMA 3DYPA 4JKKA 3PFKA 4M3KB 1UWYA 3CX6A 4V2CB 4CLRB 3TQOA 1I8KA 2GBCA 3IVAA 3R7LA 2UY6B 4YUAA 3VMOA 3CUEF 1M3SA 3OLEA 2BIMA 2XTNA 2AQ3A 5CR8A 1L7IH 1BVRA 3WHE0 5B7MA 3WIOA 4N0UE 1W72L 1FFSA 2A5FA 1F3DH 3MT9A 1SBZA 4C83B 3TA4D 5E6IC 1E3LA 2FCAA 5AVZA 3GHHA 1BPLB 4TUJA 1USVA 4PEVA 4GQAA 2V5VA 3F47A 1AGCA 3W2GA 2ZRNA 3IHWA 4JGMA 4UTXA 1CY0A 1Y9EA 3KBFA 1Q77A 2EHDA 3U9TA 2A6JA 1JS4A 4G1FA 1LP9E 3CBGA 3ZKSD 1OROA 2C2YA 4DG5A 3NTCH 1LDPH 2Y2WA 3T9WA 2JTDA 2KYIA 4R26H 4M9XA 4F5YA 2BEJA 1QRAA 3O84A 4OFZA 3CXRA 2Z64C 3BZFA 1PDVA 5AXCA 3S7ZA 4EB6A 4APQC 4H6VA 3UC0H 3L9YA 1M8KA 3Q0TA 4UVEA 3FQWA 1JD7A 3KYDA 1F8FA 5D8DA 4BO9A 1EMTL 3L81A 1NT2A 3ZH2A 5EUCA 1N12A 3I76A 1L5WA 4GMDA 1CFQB 4ZOBA 2ZCKH 1TUPA 2VRWA 1K6QH 1RCFA 5FQOA 4MVJD 2C0CA 2CIKB 3CZQA 4I5BB 4DO5A 4QGBA 4G5AA 3OURA 1FWXA 2AJZA 4B8WA 3Q8EA 1DL5A 2XR1A 4MSWB 4DC1A 1B8VA 3GEDA 3RL2A 4MA1C 3LL4A 2CJ3A 2V7NA 1YEEL 2IPOA 3A6JA 1I8TA 5KW9L 4I5EA 4H25A 4QJ5A 3WIFB 3CEAA 5ANHA 4YCNA 3CVDA 4GW1A 4HV8A 4R9SA 1QNLA 3ZDRA 2E4YA 4LGRB 4KOAA 5KSUB 5EWJA 4JVWA 2AK4A 2PL1A 2Y3NA 4X4KA 3ACCA 4J2OA 1NBMA 3ZL2A 4R05A 2Y1EA 2QSCL 4L7VA 2G7ZA 4BVFA 2VJCA 2DLIA 1Q1AA 2CT8A 4XNZB 2ZSIA 3OWRA 3ILXA 4N6QA 3OG4B 1KDJA 2FE4A 1PWZA 3WGUB 4JEUA 1U8ZA 2WKOF 5E6UB 4G0PA 3UWPA 2OCPA 5F3BA 4XC3H 3GWJA 1Z12A 2NSLA 1HLFA 5A71A 4PBRA 4V38A 1L5MA 2ZTBA 3K70B 3IT0A 5B1SA 4F97A 3H5VA 3Q3CA 2P3QA 4J6RL 3RSCA 5JPCA 5KSPA 1YZYA 4NY1A 4JPVH 3BFXA 4AM0Q 3NRJA 1M6OB 2NYYD 2CHQA 3N6XA 3I83A 4DLAA 1ZTMA 3DT8A 1CZ8H 4ER7A 4P9HL 2GQHA 3S88H 2N9UA 1R6XA 2PPAA 5DD6A 2WHVA 1T43A 1BA9A 1TM2A 4R2GB 1EFRD 2IJGX 3PWLB 2YD9A 1ARZA 2VJMA 4ESHA 2Z8WC 2P3OA 1QB8A 5HRAA 1VB3A 4BFCA 4WSGA 3OQHA 4J3SA 3AEQB 1VA4A 2C1EA 4XO8A 2WXOA 4BWFB 2OMVA 4KDEA 3RKDC 2ZBEA 4HLNA 4P4UA 2H2PD 1OANA 2ICES 4HIHA 1EG7A 3H5WA 4RRPM 2YMLA 1CXFA 1H8EA 1MLCA 2H3KA 4B53A 2E7HA 5F5XA 3C5ZA 4ZTEA 3R7AA 3BSSA 1JRHL 1KMQA 1T20B 1R5WA 4XCCH 4XWOC 2PIDA 4RUKA 4Q7QA 3TTVA 4LNRB 3TOZA 5E6RB 4AEFA 4ZMPA 5EWIL 1XMSA 3GBVA 1M7BA 4AMYA 4BQFA 5C7XH 3BAYA 4UATA 4YP7A 1NWCA 3ECCA 4ZK6A 1YA8A 4IEFA 4AJYV 1CUIA 3AYXB 2GAIA 2DFKB 1QX1A 4I9WE 1IC5H 1G5IA 1V3UA 2P5EE 1M5RA 2YN5A 3WCYA 3ARGC 4BK5C 3FBTA 3UWOA 1NBYB 4B17A 3ZDXE 1NC2B 5CNKA 1KWGA 3PABA 1TD9A 1XSJA 4O4IB 2FUNB 1XB2A 2VWHA 1TC2A 5BUCA 2GBTA 3M2PA 3K70D 4WCFB 3HKBB 2J3IA 3NRQA 1JSRA 4ER3A 1NCTA 4C14A 3H3FA 3HUEA 1PVHA 2VC2L 4OVUA 1BX2A 4LV6A 3QFJA 2DHQA 1HQ4A 1JTFA 1AV7A 2QBYB 5TQVA 4IWYA 1QUFA 4FYTA 4TQHA 1VKNA 2PD4A 2VZ9A 5HD8D 2PWHA 1TVMA 3N44F 3PJRA 2R8PA 4DW2H 2WJVA 1JBEA 5FYLD 4MBOA 1WUYA 4R2GD 4KNUA 2R62A 3FT3B 1SXIA 4PJCF 2C9QA 2ZIWB 1S1CA 4CU8A 2AXFA 5BMVA 4Y19A 4LLWA 3AHCA 4BFUA 3U56A 4LRQA 4HA1A 1KY7A 3DO6A 1ISHA 2WANA 4YMGA 4ZUUA 1XQ9A 4NJMB 2BFGA 4TTQA 1T2DA 1ZMXA 2BPOA 4EMUA 4MXVE 2G08A 1G6Q1 3FSVA 2PZAA 4CLOB 5E70A 2VQDA 3I9PA 1YACA 4CSPA 3CLVA 1ATIA 2YC4C 4AJOA 4RCVA 4EKNB 3EAGA 3QX9A 4IDAA 3RU8H 1JAHA 3BE8A 1YY8A 5EF3A 3RTEA 4MWDA 1UEMA 1Y4DE 1ZCZA 1SY6A 1OAUH 1IBYA 2HUNA 5E9AA 2H1OA 3IHKA 2NR6D 1QX4A 2PYIA 4AYWA 3KHTA 4HEJA 2IDSA 4M5ZL 2QTAA 4JYPA 4KXLA 4KC0A 4CSTA 4HDAA 1J9TA 5DIZA 3ZV6A 3ZU5A 3T0EE 5EE5B 1QKZL 2V55B 3EEYA 3KYJB 3IE2A 2FLMA 1NC2D 4ZXPA 1QP7A 2ZTMA 1H19A 2YWRA 3VYTB 1CC3A 1UEXC 1DYZA 4FABH 3B7UX 1ZH2A 3VRLE 4EG1A 5FO1A 1K06A 4EFKA 2EL9A 2VXBA 2MDTA 3FO9A 5E5LA 3MPUA 1VDGA 3X11B 2R8BA 4Z7QB 3QQDB 3BT0A 3D8HA 2B4CC 3GLIE 4IZ6A 3MS4A 2X6QA 1SD5A 4U6YB 4F8PA 3D52A 4P46B 2WWOA 4BKLA 2FO4B 4YPJA 1DQJA 3NFSH 1D5BB 5IANA 1YUKA 3CU1A 1Y7PA 4ZCSA 5HI5C 4EI6A 2YXNA 2VWGA 3ISJA 2IV3A 1QTYT 1BVNP 3WLSA 3OOYA 4EXKA 1UKCA 2OXIA 4Y16B 1J5XA 4HUKB 2DQ4A 1HDYA 4G7VH 4KCGA 5EIBC 2NX5B 3SQOL 1ODFA 5HZHA 4ZAZA 2CHUA 3KJXA 4KO3S 5FYJH 1MG5A 1MVFA 5E1GA 3KPQA 3Q5EA 3IJ9A 3GFRA 4P5TC 3IPXA 2V3DA 3JQGB 2X2UA 5EUQB 5JO0A 4J2TA 3KU1A 1JJBA 5ECJE 3PF9A 4RTKA 2X1MA 1MENA 4LS3A 3ABKB 4TPRH 1ZDQA 4BEWA 4NQCE 4RIRB 1M76A 1ZCFA 1GPBA 4M1OA 2CKBA 3KPYA 5DRTA 5SZKB 1RW4A 4CLXA 5BN5A 2ADMA 3I28A 5FTMA 3EYVB 1CLUA 4QRRE 1LDEA 2ADGB 3HI6L 3DPIA 1EFHA 2GJ8A 1ODJA 5CJOH 3QKRA 2I32A 2H32A 2IO5A 2YJNA 1FCCA 5FM4A 3KQKA 1A9SA 3A6DA 4QWMA 4ZVKA 3VDQA 2AK1L 3TD2A 5B4TA 3MC1A 3E9DA 4DLKA 5EBMA 4J39A 1TCVA 1P29A 3EHEA 1G7MA 2EP6A 4M48H 2YGVA 3A5VA 3DMNA 1GG8A 1ONOA 5EZIL 4XP5H 3HMXL 4ZMTA 2OQJB 1BOFA 4AT1A 4KLCA 4LXIA 5CNJA 5FO8A 3T3PB 4QVKA 4S11A 1IVYA 1WMEA 1LD3A 2HT4C 4P46D 3HRHA 2BFDB 3DX7A 3FCYA 4CL8A 3LP6A 4RPKA 3DTNA 2BP5M 3V4VB 3OKDA 3HG0A 5DYTA 3ZUCA 3SYQA 1YSCA 4U1LB 4DQOL 1NGZB 3BJLA 2GPBA 3ESNA 1QDLB 4Y16D 1Y8RB 4ADGA 1PR0A 3PUUA 1LP9B 3ULSB 3CVBA 3WMGA 5A4IS 2B9BA 1QIDA 3BXFA 2XYHA 3O2JA 1TQDA 1OU4A 3AQIA 5E95B 1MWOA 1YZQA 3EOTL 3G7TA 1SBHA