2VDQB

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
total genus 130
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdqB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdqB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdqB03
2VDRB 2NUTA 1YVRA 3K71B 2VDMB 4MMXA 3V4PB 2ICAA 4HQNA 3TCXB 5KYXA 4MMYA 1QC5B 3FCSB 1ZOPA 4O3TB 1LFAA 4UM9D 1ZONA 2XGGA 1UEXC 4MMZB 3EH1A 1OLZA 4K3JB 1M2VA 1XDDA 3T3MB 4NENA 3OKWA 2QTVA 1IJKA 1YVPA 1M1XA 1RTKA 2P28A 3AL9A 5KYUB 3QA3E 2UZYB 3N2NA 1BHO1 3EFOA 3T3PB 4PN7A 1AOXA 1L5GB 1MJNA 3K72B 4G1MA 1JV2B 3VI3B 4HQOA 2ODQA 3NIGB 4M76B 2XWJI 1IJBA 4WK0B 1YUKA 4GZ8A 1IDOA 3AL8A 1BHQ1 5KYWA 2WW8A 2NUPA 3HXOA 1MF7A 1N3YA 3EGDB 3FCUB 1AO3A 1M2OA 4WJKB 3VI4B 3IJEA 1FNSA 3EOAI 1M1UA 4WK2B 3K6SA 2O7NA 1JEYA 1SQ0A 4A0QA 3OL2A 3ZQKA 3EH2A 1AUQA 2M32A 2NUTB 1PCXA 4MMXB 4HQKA 1M10A 3IJEB 1IDN1 1CK4A 5KYXB 4MMYB 4IGIA 2XWBF 5E6UA 4G1EA 2VDKB 3EGXA 3ZE0B 1FE8A 5KYYA 1JLMA 4CN8A 5HDBB 2VDNB 1T6BY 1MQ8B 1M2VB 3BN3A 3M6FA 3OKYB 4NENB 4IXDA 3PPVA 1M1XB 1NA5A 5E6RA 5KYNA 2VDPB 1SSLA 3IBSA 2I91A 4JDUA 5KYYB 3ZDZB 4O02A 1PD1A 2VDQB 1JEQA 3TW0A 1QCYA 3EFOB 2VC2B 5E6SA 4UM8B 3ZDXB 2WINI 4G1MB 4CNBA 2IUEA 4NEHB 4FWWA 2ADFA 4JX0A 5KYWB 3AL8B 4F1KA 4CN9A 2NUPB 2B2XA 1U8CA 4Z7QB 4HQLA 4Z7NB 4BJ3A 1DZIA 1PD0A 3K71A 3PPYA 3V4VB 3K6SB 1Q0PA 5HJ2A 1JEYB 1RS0A 4O3UB 4WK4B 1QC5A 3FCSA 3ZE2B 3OL2B 3Q3GE 5ES4B 3BQMB 4DMUB 1DGQA 3F74A 1TYEB 1XDGA 2I6SA 1V7PC 4MMZA 1OAKA 2P26A 3NIDB 1MHPA 4XW2A 3TXAA 3ZE1B 1N9ZA 2ODPA 4HQFA 5E6UB 4G1EB 1ZOOA 1RRKA 3EGXB 1RD4A 5KYUA 3AFCA 2VDLB 4C29A 3BQNB 4FX5A 3F78A 1XUOA 5BV8A 1L5GA 4IHKA 5E6RB 3K72A 3HXQA 1JV2A 1SHYB 2VDOB 3EG9A 4Z7OB 1MQAA 5HGJA 5LN1A 1T0PA 3PPXA 1U0NA 4O02B 1PT6A 1JEQB 1SHTX 4C2AA 3HI6A 3E2MA 5E6SB 3ZDYB 4UM9B 2X5NA 3EGDA 4F1JA 3NIFB 1MQ9A 2I6QA 3EOBI 1CQPA 3RAGA 3GXBA 1ATZA 4WFQA 3EG9B 3NVQA 4C2BA 2NVOA 3TVYA 1U0OC 1SHUX 1U8CB 3PPWA
chains in the Genus database with same CATH superfamily
4F7WA 3EVCA 3DCYA 4KDFA 2OHHA 1IQ0A 4N49A 1KZ9A 1NA8A 2VKXA 3ZL4L 4XB1A 2COQA 1NVEA 3W0WE 2C98A 3BA6A 4HSAC 2W5UA 3GEDA 2F4VB 1H0HA 2YV5A 3TO5A 2W4MA 3WICA 3IMVA 4WNQA 1YS1X 3PHIA 3VD1A 4YRDA 1RE0A 2Q0SA 1PX2A 1RJZB 3HAEH 3QVGB 1H1TA 3MRDA 3HA7A 3GT4A 2VQ6A 1WIOA 2YGOA 4QZVA 3FB5A 3E3OA 4XGKA 4Q12A 5TF4A 3JYOA 1L4GA 4K9OA 3LOQA 5EN2A 1Q1EA 4YMWA 4LI0A 4LPXA 1XFDA 5JBQA 3H87A 3EHBC 2YGNA 2VLRA 5D71L 4O4JB 2GXUA 4DSZA 1Z13A 4AENA 4KGVA 1E2MA 4TYUA 2IUEA 3VFNB 3WN5B 5D01A 1AR1C 4JX0A 3OKPA 1S3KH 3UTTD 4Y9UA 2GCOB 4EF3A 4FOTA 1UJ2A 3OZCA 2EF0A 4BEVA 4NS4A 2YOCA 4JK3A 3W38A 2Y92A 4ZYLA 2P42B 2G88A 5A3SA 1RYBA 3WD5H 1C3JA 1QASA 1ZV2A 2ADFL 1KOAA 4XB8A 4YBLB 3NSCA 1XEWX 2WWYA 5D6OA 2YQZA 4XNYL 4W82A 1U4FA 1PHPA 2A7BA 5IH7A 4ZPVA 3ZUNC 3VXRE 1F5SA 4QXRA 3EJYD 1JS1X 1SHSA 1ZWIB 3ZR4B 1QYGL 4JFHD 4CMAA 3CUEF 4I8DA 4H17A 1CLEA 3L5WA 4G0OA 4QF1B 4EEEA 4OM1L 3N5KA 2PS0A 1SCIA 2QM0A 2JTDA 2GI7A 4XBPA 1VLQA 3ROLA 2YOAA 1PUJA 3S2IA 1U2GC 5H70A 2G82A 1OXMA 3ZHTA 1C81A 4GZ8A 4K6OA 1W36B 4TSRA 2E9IA 3ZGIA 1S7CA 1DIAA 2YINC 3AG1B 4TNWF 4B3CA 3NACL 2R97A 1TTRA 5DNYB 2JJ8A 3RS0A 3JV4B 3VFGH 3OPZH 2O5ZL 4G1FA 2VFAA 4ZCMA 2FDRA 2B3TA 2R7AA 4NNPL 4DT1B 4FDAA 1I10A 3CDZB 3HA5A 3EHBD 5FUVA 2YBDA 1R0AL 5JHLA 4ZAFA 4JLKA 1WDMA 4UNNA 4JBXA 3JSXA 4BL5A 4DB2A 4XAWH 3PQ7A 4HIJA 1HE1C 2BTQA 1AR1D 3BXGA 4JA0A 4GX2A 2OQRA 2LOEA 1I1AC 2R29L 1U7ZA 2FTKE 1N2OA 2OHIA 4DUYB 3PDIA 3VFDA 3JU3A 3AEUA 3JWDC 4PC2A 4X1KB 4M49A 3M82A 3B7TA 5HUQA 1MO5A 4IUYA 3LJ3A 3SQBA 3GDOA 3NTXA 2DWOA 1BRMA 1N4AA 4NZRL 2OR8A 3HI6A 2PUJA 2AZ4A 4YCLA 2LLGA 5IHLB 1CFVH 2ZUEA 2JFHA 1WD5A 1MPAH 3ULVF 2EU8A 4RVOA 4CUJA 3EWIA 3A1FA 3K2QA 1XT5A 1TO1E 3LDGA 1KFCB 2VK1A 3OQHA 4W9CC 2BNQD 1FIGH 3LVRE 3LN4B 3X13B 4LQ1A 3ME0A 4COKA 1H8LA 4M48L 3ZUGA 4KKBD 3QIUA 1A64A 1GTJ1 1IDOA 2YVLA 3HCRA 1F6BA 2K9FB 1T1EA 2G6TA 3WIEA 5EJ7A 3CBGA 5E2TL 3WKMH 5T1KA 3EA0A 3GMRB 3WV0A 4IDOA 5DI8B 1IPFA 3RTBA 1NBYA 3FPCA 3VR4A 1KTLB 1H4TA 4PVNA 2ICEC 1FZTA 4HC1H 4FN4A 3G3LA 1NM5A 3PEWA 3O3AA 2E4AA 1FU7A 3TMYA 3W9UA 2B1JA 4G07A 4DC0A 3G8AA 3PQ2A 1VFNA 3BJEA 4WZBB 3KKPA 3N9GH 5FUWA 1A7NH 2QW8A 4A26A 1RZJH 4FQXB 1MT3A 3F74A 2E1PA 1W4AA 2R0WH 3MILA 2FN9A 2FX7L 3DC2A 3O8BA 4JJ8A 3VU8A 2FMTA 1BGXH 3VI3A 1RWVA 3EOZA 1H3WM 1GSAA 1HNWB 3JV6B 2IW1A 1SU4A 4EHLA 1O0CA 3AP2A 2AFHE 2MNUA 2F43A 5AVRB 3D3WB 3O6ML 2MSKA 3M70A 4FG6C 4JAMB 3S7TA 3HG2A 3PU6A 4CSPA 3PB3A 1L1EA 3MBXL 2GAZA 2NUBA 1JU3A 2ITCA 4PJ5D 3K7UA 4F56A 3D6NB 4LF5B 5ES3A 3ZE7A 1MX3A 2WSYB 1XLTC 3U1TA 3KYNB 3HCFA 3MRLB 1T2JA 4AZWA 1T91A 2EQDA 2I9KA 4KLAA 4MS8D 4FEEA 2CL6X 2DSTA 3DUWA 3LXXA 1WXIA 3ZUPA 4JFHE 3IGUA 3BPLB 5HIJA 3ZJTA 4FXGB 1MW3A 3TC9A 4L74A 5CLGA 1AY0A 4YDMA 3U4DA 3RRYA 1SDDA 3MO1B 2OX5B 4EDHA 5B5SA 4UTNA 1HMYA 2ADFA 2GRUA 1FL9A 4FHCA 5EBMA 1SEQL 1N25A 4R2WA 5B1SA 4DLZA 4JJ7A 4IIYA 4D0SA 2DT8A 2DVMA 2GJ6B 2XUGA 3L49A 2GD1O 5FUMA 2Y1XA 1NJ1A 1YL7A 3AOEA 3N0RA 2FOIA 3W3AH 1EUCA 2C1PB 4OIAA 3LLMA 3H5NA 3PHAA 3VFSB 3OE5A 3ZTEA 3THMH 4RTMA 5IBCA 4G26A 1WAEA 1WCYA 1Z5OA 1KF0A 2VXSH 3GJ3A 2XTJB 4YIQB 2ODHA 4ZVLA 4WFQA 2N1MA 3NANA 4F57H 3PQ6A 5ADOL 4NYIR 3FWYA 3SJ7A 3EGIA 4Z0NA 5LXTB 1BIHA 1R9JA 5I26A 1FDVA 5KNCD 2CIKB 3NC1C 1NFAA 1ZK0A 2BDEA 3QVKA 4MXVF 1XDZA 3LKQB 3BSHA 4AYFA 2NO1A 3NW9A 5TV2A 4D57A 3IJ7A 2DKUA 1KJ9A 5JMRA 5HHXH 4NQEA 1P5VB 3QTLA 1TE2A 5T4EA 4I5EA 4NNPA 4BO9A 1A4RA 4A03A 3ML1A 1E2EA 2QN7A 2HLAA 3BFJA 4MWCA 4W6WB 1DWPA 3FBTA 1ACMA 4JITA 4MITA 3PNRB 1O5IA 4S1QL 1FNSL 5IP4A 4H25A 3BXZA 2VHCA 4G01B 2W4QA 1HXYA 2CDFB 3LU1A 4G6JH 4PGEB 1IYZA 4UARA 4Y6QA 1CUYA 2R29A 3QXHA 2NY6D 1FFOB 4JFDE 1DANU 4RZKA 2BNQE 3LD8B 3ENVA 4IQ4A 3OE7D 4MAYA 5AVVA 2VRWA 4AQ8A 4DYDA 3MYRA 3OAAA 1YRWA 4IRSA 4OF4A 2JIXA 3SDDA 3X12B 2FU5C 4LAQH 4NM8L 3C5VA 2IODA 4MKXA 4BUHA 2EFHB 2RGEA 1XA3A 3TQIA 3SE7A 3BVVA 2OBGA 5IKCA 1NFRA 2ZBUA 2F6AA 2LBPA 4XWYA 4AJ0A 4N8CH 5DS2A 4AY0A 2XA8L 2CSXA 2G4VA 3DX9A 3SDCC 4OGLA 3BD4A 2IZZA 3DDOA 3PRYA 3GG2A 4QYIA 4EFMA 3QZNA 4QQNA 1UOVA 1O87A 4BFBD 3U4AA 3ZEIA 4LEXH 4YCDA 4YRFA 7YASA 4MUMA 4WHCA 3E22A 4HXAH 1QVOA 1NGQH 3AROA 3FSEA 2WK2A 3A10A 4J8QA 5K93A 4NFLA 3HXMA 1JSYA 1DKNA 1RR6A 1RVFH 3PJNA 2YN3A 4KZDL 3D3JA 2IEDA 3RGBA 3S4SA 5GGVY 1SGWA 5IB5B 3HZOA 4HGMA 3GXOA 3KGUA 4B3HA 3ZTJG 3E7XA 3H42H 2BFCA 4OGFA 2GPAA 2NQCA 1NCBL 1IEAB 1ZR2A 4HUUA 3RVRA 1PYWB 3M5PA 5C3TA 3BF7A 3LH2H 1IU1A 1UEIA 2J9RA 1P9MC 3EXG1 4PE5B 4P49A 5CLWA 3H2BA 3HM2A 4AYMC 2YAEA 2OCDA 3BULA 2O5XH 4OD1H 4UULA 4PJ5E 4DBZA 3UTZB 3C6LD 4Y2YA 5CVDA 4XPAL 1FFRA 5HHOE 2AEEA 4M1TA 2IKQA 3QX3A 1IHUA 3PHOA 3DEAA 1ZO8A 1T6NA 3FFDB 2YSTA 3U6RA 4BIIA 4AO7A 3L3GB 1YZHA 1GGIL 5GSVB 4A8JC 5CYGA 2ZUSA 1MCPH 2VUOA 2GSGB 2FJGA 1KDRA 3IQIX 1KVQA 5FUOH 3SDCD 3HWRA 5KVDL 1GRNA 4L22A 1GZPA 4C0KA 3E8UL 2GO7A 1RIUL 2WQ8A 2AZMA 4MUKA 4LQCA 2WF5A 3PDOB 5DB4A 3IPFA 4OHWA 3IBYA 3QU2A 3GSWB 3LQKA 5ICXB 1RUML 2EIHA 4D02A 4TKMA 1RKRA 1H9AA 1WCIB 3PWZA 2DXIA 3PQYE 5E94B 2OM5A 4PG2C 1URLA 4WO4A 2VSDA 1GW6A 3UB4A 1YCGA 3NCCB 3BESR 3JT2A 3UXEA 2E7LA 4ZQIA 4HIHA 2X38A 4ZMVA 4RBNA 1CJVC 2HYDA 1NW8A 2JKTM 4DHLA 4ZAGA 3UT5A 2I99A 1YR1A 2IKSA 3RTEA 3U2QA 1Q1JL 3LP5A 4JXJA 3RVXC 4AEIL 4G5HA 1COBA 1RAEA 2ZKIA 5L45A 3KBOA 2DH5A 2B8OT 2ETVA 1MFCH 3TNMA 1TLFA 2OOSA 4DN4L 3ESOA 5KSWB 5JWHA 3ETBJ 3PKIA 3ONWA 3QEMB 2WUCH 1J1OL 1KF9B 1KDPA 3TZKA 5EP4A 2FSEA 4COOA 2Q3EA 2FE0A 2P62A 1EX0A 2PVPA 1XA4A 4XXWA 3VXPA 2OFPA 1OMOA 4I50F 1UACL 2XB2A 1JJFA 2WHEA 1RFDL 1A7QL 1A6WH 2Y24A 5GGQL 3WHE0 5LBGA 5TC4A 1DQTA 4NOMA 1X8JA 2R1XA 4OEHA 4FKZA 1WXDA 1JQLB 1NLBL 4NNYB 3DV4B 1PLKA 4YLQT 1XNHA 4H35A 3V1KA 4RM2A 3WKQA 1RYNA 4D9EA 1FNSA 2ZUDA 5KOJB 3S5JA 4NBRA 5L3ZA 3FB6B 3EVEA 3TH5A 4CEHA 4LQDA 4HLUA 4YCNA 2JDIA 1SBHA 2Z8SA 4YGYA 4XWGH 4A6DA 5MF6A 4ZS7L 4C01A 4ZMOA 5HBGA 5EG5A 5ECDA 5FCUH 3E3QC 3SS9X 2J8UB 3RWCA 4PPQA 3BWAA 3CBKB 2C5HA 4CC4A 4WCFC 2E86A 4LCBA 2P2DA 2F1KA 3ZW7A 1NBZA 4V1DE 3STLB 1JH9A 3TIIA 5GJTL 1DSFH 3SXUA 3HO1A 4N2GA 5F1NB 1REQB 4B47A 2VRAA 2AV7A 5HYJD 4HAZA 2QRGA 3BQMB 3HLYA 3QTBA 4ZUUA 4U1JB 4HF5H 4L0YA 3QVSA 5CK5A 3ZZSA 2XLCA 3DE3X 1ZSDB 4ALAC 2FYYB 3WAGA 3UF0A 1P2GA 2FJSA 2HIMA 1JLRA 4J8RB 2AJLI 2H6UA 5AKZA 4EJMA 4L5FL 3U6XS 3DZGA 1AV6A 5I1LB 1DUZB 1U7DA 3EEQA 1E3WA 4AM8A 5K8LA 4RVBA 2IBBA 4G8IA 2B2XL 2SEBB 4YXFA 1M5TA 3G5YA 1FDOA 5TE6L 3KUXA 1NWOA 3UKDA 1FMTA 3QQDB 1IC5L 3NT0A 1F20A 5FHAL 3P52A 4BVKA 3G9QA 3BZDA 4LVNA 5IH3A 3U19A 2JD1A 2N0KA 4Y8DC 1OQOA 1RZQA 2P1DA 4TNVF 1EEHA 3BIXA 3LZCA 1O9ZA 3KV3O 1N3YA 4OQEA 3L1VA 4GBXC 3TXYA 3I6LE 3WZ2A 3ZMNA 5C0CD 1NVMB 4IAOA 1IZ0A 2MT9A 4Q0XL 4U6YA 2JTYA 4M1WA 4Q4CA 1UJ3B 1VAHA 2XDQB 2AFIA 4UC0A 3U09A 1NKOA 2JFQA 1T6BY 1JTEA 4RGOL 3VYVA 4ZMRA 4LHUG 5SV2A 1JZGA 3U36A 1VEOA 3VNYA 4E12A 4EZLA 2AJ3A 3P96A 1JI0A 1C1HA 3EGOA 3G9AB 4HIXL 4YI5A 2A5JA 2ACWA 4CTOA 3KAJA 4C83A 1CULC 1VLHA 3UCQA 4ABYA 3RIXA 5CCDA 2WWMC 1NG1A 4XVQA 4GY4A 1GR7A 1ZVJA 4OD3L 3LUJA 2YA2A 2BELA 2O6LA 3VVBA 4IGKA 5COQA 4R26H 1BZ8A 1QFPA 3OKAA 4Z7OE 4EPTA 1MFVA 4NUQA 4N22A 4YWGH 1EP2B 3CNLA 3KHKA 3MRJA 3AUKA 5H80A 4FFOA 1XCQB 2GPWA 4G0YA 5I9MA 2BP0A 3HZVA 4NYJQ 4TV3A 3HCPA 5C5EA 5MEND 3WJ1A 2GK6A 2HDWA 4BZXA 3H7BA 5BV7A 2YEVB 4NPJA 1WW2A 2ZWKA 1P2DA 4C88A 1JK8A 1BTOA 4OH7A 3V5KA 1MDTA 2BWDA 3SDAC 3TH3T 4D8XA 1UJMA 4AUJA 2OV1A 1EHNA 4KO8A 3F7YB 1YR2A 1GNRA 3LNHA 2NQ2C 3UO8B 2JK1A 5DI9A 2FV8A 1M56B 1QFXA 4NO0B 3L8EA 1YGPA 3BG5A 3ORHA 1TVBA 1RPTA 5K5YA 2C04A 4K2AA 5FBWB 4N8VA 3GGGA 3PWJA 4X42A 1EJBA 4Q3KA 5DD0H 5EBLB 4BWWA 2PXYD 3N0PB 1IRXA 4RGNB 4GRWH 3AAZA 1ZESA 4H15A 2X70A 3E38A 3Q6IA 2EHJA 2WLKA 2UAGA 2HXAA 3OICA 4G0VA 2WB1A 1U9CA 3PFBA 3U49A 4I6GA 5FWYB 4RS3A 3HUJB 1KK2A 4ZW5A 2K8QA 3WGNA 1S96A 4BRVA 4PCSA 1WOMA 1A7BA 5IJKA 1XALA 2ET6A 4O4IA 5E3JA 2F61A 4OQXA 3ZWXA 5AESA 1JDTA 5BSTA 4PYMA 4LS3A 3EFHA 1OFTA 1FBTA 3G2MA 1SEPA 4U6HB 1Z7JA 4P58A 3O95A 2PMFA 1AB6A 2GFHA 4DMUB 4P4LA 3KWMA 1MKYA 1N5YH 1OWLA 5CGBA 2I8LA 2XT9A 3I2CH 1B8NA 4AECA 4KXQA 3PT5A 1WSBA 4K9SA 2IMMA 4N0UA 2KT6A 3YASA 3ZG6A 5T6MA 1MMFB 4UAGA 1DG1G 4E3WA 1JRHH 5BVPH 3MJGX 1ML4A 4AV0A 4X66B 5F7NC 2VDMB 1ZA6B 5AKRA 1MREL 1E4XI 2X58A 1AE6H 3SDAD 4RETB 4P99A 1LPOA 1MX9A 4V1CB 5DZNA 2PRJA 3TIEB 1VLLA 2XI4A 1PDKA 1NDTA 3VI4A 2X87A 3WEAA 3L3IA 1EUDB 3OO1A 4F9TA 4JLSA 4ZT6A 3COYA 4R1OA 3BRSA 2CF6A 2GYSA 4YCJA 3TJRA 5AL0A 5D2LA 1ESEA 2QPAA 5T7BA 4OM0H 4Z7WA 3C1TA 3VU9A 5JRJA 2XB9A 4BAUA 5LPNA 1HE8A 1DQIA 4PIVA 4RKQA 3DJRA 1YVEI 2ZQKA 3FLEA 1H5BC 1AHHA 3C1OA 4XBEL 2OB2A 4O2CA 1W0CA 5EF1A 3HVNA 3VYOA 1PSDA 3G2KA 4LLAA 1XJ5A 2PZGA 4XH2B 1VSCA 4DV4B 4JFZH 43C9A 2DUMA 3KL0A 2Q4EA 3ZZTA 1O8BA 3C5ZA 4NV3A 3MNDA 3RYHA 2ZG3A 4AOFA 1GFZA 3AMKA 1R0SA 2DQJH 5AYUL 1BDJA 1PZFA 3HG1B 1JXMA 1ZD5A 4XDGA 3C97A 4E5VA 3RNQB 1D4AA 4D25A 4QFBA 4WF7A 5C0CE 3P45A 3G7UA 1SHYB 4WE3A 4K7FA 1WF3A 2DUWA 3IUMA 2GY7B 4OBSA 2FWRA 3QUML 2XNKA 3CLUC 5CGQB 4OHFA 1OWNA 4U1IB 1NT4A 4PJCA 3ODPA 4MCYB 621PA 7PCYA 3TT1H 4CG1A 2BFVH 2Q3BA 5DBOA 4ALLA 3DC0A 1JXOA 1MW9X 4LIQE 4NENA 2Y72A 3DV9A 3AUFA 1L0QA 3WUWB 5BUQA 4K9EL 4GNRA 1JQKA 4REQB 3KXDA 1EJ6A 3C5SB 2OJZL 2ACVA 4M5SA 2IO5A 1X9QA 1HQRB 4WUUB 2F90A 4MAAA 1BYIA 3VDRA 3SSAA 3B3JA 3MWKA 3FFAA 2PUCA 4FYMA 3B2VH 5C9JB 4ZKEA 4WKPA 2OMVA 5EC1B 5FYLH 5F1YA 1ZAYA 5TQJA 4CIYA 3CUYA 4KFUA 2FMIA 4GOMD 3UFIA 1MLCA 3CN1A 3R20A 1X7GA 1AXRA 1XZ0A 3QPAA 2AXGB 4A68A 2B14A 1ZQ9A 1PTKA 1IG0A 2ZUVA 3TW8A 3RUHA 3HWSA 2KLRA 2RJOA 4OLVH 4IFBA 2UXTA 2BE7A 1E9OA 1KKUA 1OI3A 5ESVB 1GT6A 4MUNA 3N6YA 1IN8A 3STZB 3M0EA 5HF9A 4JP2A 3HC4H 3LM8A 2DAPA 3TCTA 3JQDA 5KBDA 4MCAA 4KR2A 1HYBA 2QLBA 3BF8A 1BLNA 1RFLA 2QUHA 3TKYA 2P5WD 5L4JA 3ER6A 1MJHA 2WAAA 4R5VA 4Y89A 3UTOA 4RKYA 4O4HB 1X7YB 4QUHA 3WHXB 2HX8A 1AS3A 4KH1A 4G6KH 4MWBA 3UJTL 3HBAA 1DEAA 3NXSA 4QM6A 3N44B 3IP1A 3NYQA 4YAQA 1C0PA 1YVUA 4QOHA 1S5HA 5TPWB 2WNSA 2P2YA 5EPMA 2IPTL 4U7JA 1DTEA 3AJ7A 2CJWB 1E65A 3IAM1 5DVLA 1FBNA 3BE5A 1R5VB 4MV7A 1Q9KB 1YPZB 4NQSB 2J9YB 2DCMA 4ZFZA 5SICE 3WNCA 4V0LA 2R59A 5H94A 5KWSA 1UDAA 1M1XA 4AWAA 4Y5XA 4IHOB 2OHXA 3ILSA 3AJAA 2QFPA 2XFXA 3II3A 2ZRBA 3CFUA 3L8QA 3RJTA 5DJ2B 3O41B 3EJ6A 5EWMB 1HDGO 4I0CC 2ZKHL 2XOKA 2VN7A 1MU0A 4MK4A 1MCBA 4E9SA 4L5IA 1K8YB 4EXKA 1Y63A 3PDGA 2CDEB 4LNAA 4UVDA 2VITB 2WSDA 2DC1A 3QY0A 5T5NF 4I4WA 4DRYA 3N41F 1SD5A 4P0TA 1ABFA 5I75C 2P9RA 2ALAA 5HJ3A 2DI8A 1IL1B 3OPMA 3MCKA 3HBNA 2I7DA 1NUUA 3EMKA 4CF4A 5FBHA 3KS0J 3BMWA 3ZDCA 2LNDA 4BKSC 3TCKA 3KEDA 2WJPA 3L7DA 5IXJA 2A0UA 1B8PA 2AJZB 1TO6A 3AFHA 4M1SA 3L6UA 2DIEA 2E4UA 5C0AB 4PRDB 3SQOL 3HU1A 4AJHA 4D46A 2X6TA 4OMDA 3QDAA 5IMOB 3D5OF 2P2SA 2GAAA 4L1HA 3QWNA 5AKVA 4XJTA 2Q27A 4NQXA 1CF2O 3L4YA 4MJ6B 1GLVA 4DVRH 5BQFA 4B95C 4HUVA 2K2QB 2VT7A 3ELDA 2JHCA 3PWTA 3I6GB 5JBNA 1YDFA 1FVEB 5F7DB 5D4HA 4OQNA 4OHOA 4O3TB 4W5HA 4XPGL 4I5BB 2BT4A 5SYAA 5IJ0A 2R69H 3O4LA 4LARL 1S7GA 3U7YL 3ESRA 1E6KA 4GQZA 2QD2A 2CVHA 3WLKX 1A8QA 2JI4A 3NFNB 2I9LB 2WNXA 4QEGA 2QXTA 2VXCA 1U2RA 3HAEG 4X5WB 4FQHB 3F01A 4NC2B 3TNNA 5E5RB 5L7TA 5IDYA 4XN2A 2ZT6A 5IJ9B 4HX2A 3SYPA 3LFUA 4YSSA 5KYXB 5HDQL 3CSUA 4DJEC 2K4AA 1GVNB 2J09A 1CNFA 3AGPA 1XDBA 1OLXA 2WD8A 4D44A 1JDDA 2AD5A 1KRWA 3L5XH 1W94A 4M1GL 1U8OB 3I50L 5F9FA 2W2OA 1IT9H 5KVVA 1LNUB 4H2CA 1I0LA 3L6BA 3I9KA 1SYVB 2EJTA 5DH9A 3I9JA 2NGRA 4YLYA 3M1AA 3GEGA 4AGNA 2ATPA 4R0NA 3GX1A 4RRPG 5E6IC 1UD2A 2JFWA 1QSEB 1J1XH 3ZE1B 2XCIA 3EXIA 3QUMA 1FNBA 1BE1A 3CT4A 4N9WA 3FQNA 2ZSHA 2FJUA 5B7QA 2ZJ3A 4NWTL 2X8BA 2OSWA 1DWOA 3EDEA 4BDTA 2QE7A 3FN3A 2EXXA 3CX6A 1AMNA 2UX7A 3LCVB 2Q0ZX 3RNKA 3ZS8A 4N4YB 3MJRA 1XCMA 3O1JC 4P57B 2OXEA 2GFIA 3NJFA 4QXTA 3VRJA 3GUYA 5FKAB 2NW2A 2RHMA 1LGVA 5G3ZA 2VJDA 3ENWA 3TN7A 5T41A 4JY5H 2PPDA 1P4UA 2R8SL 1P0MA 4IKKA 5DWQA 2IVZA 3HC3H 1EWHA 1HSOA 4OQ4A 1CXHA 3K94A 1Y8ZA 1MENA 5EZJA 2NXCA 1WXGA 1JZ5A 3WIAA 1ISRA 3M1LA 2DPKA 3KL4A 2GA9A 3QFTA 1FJHA 2OCXA 1PYGA 1U2EA 5THXA 4C7OB 3NWJA 4XNQA 1HDZA 4FQ5A 3BE1H 1KEUA 1YFJA 4LASL 4LCIH 1DMRA 3HFMH 4MQBA 3BD3A 3QE4A 2EC5A 3GGOA 3SGLA 2BEWB 5CP3A 5LGHL 1DC7A 1MIOB 1TCAA 4B5ZA 4KWEA 5JIPA 4O3FA 5BV2P 3HKFA 2PTHA 3L8MA 4EH1A 4MZXA 2I2DA 5ALBH 2G0NA 1Z6XA 4LLWB 2V33A 2AZDA 5TQ0L 2FGWH 2ITFA 4RAVB 4YBQC 2D13A 3V4OA 2A9FA 3FR7A 3VGEA 4EI5B 3HLAB 2Z83A 4AMKH 2OK7A 5E6ID 2HF8A 3NEOA 1TPZA 3DAHA 4JEHA 2QQLL 4C20A 3VUAA 1I3GL 4HDAA 3APFA 1JXJA 4ZAKA 2YX1A 4D96A 2W1NA 3SIPA 3CPLB 4RPGA 5DBEX 1SJVA 1EM8A 3VFUB 4QOIA 3JWNE 1T0PB 1R4AA 1I0IA 4HHGA 1A4JA 1SOUA 1X9LA 1D3CA 1R5NA 4XQGA 4MMZB 4K0RA 2KBFA 4RZQA 3B9QA 2Q3FA 3OPNA 1LQ2A 2BFOA 1UAYA 1FL3A 1PX0A 3FYCA 2XCTB 5ALQA 1QFUH 5DLEA 5DM0A 1VZHA 4BKMA 5A0TA 1M83A 2IUFA 2B69A 3ZYJA 5CZXD 2W6NA 4G0ZA 2FR8A 3OJMB 1TX4B 3LVEA 1L5HB 1NJ8A 1EA5A 5EF0A 3W3BA 3K1KC 1O89A 4JG9A 2UVDA 4GPZA 2GJKA 1E6LA 4HJXA 1EFUA 3ZT7A 3F6CA 5INDA 3DTXA 3PAUA 4KK5D 5IROA 4M1DH 1QFHA 5SX4I 3K2EA 5D5MB 2IYFA 2A6KA 4LSPL 2YV1A 4W9JC 5A4AA 4FWWA 3SQOA 4Z7OF 2K87A 4HKTA 2G9HA 3KZ8A 4UXHA 4DDHA 3G6JE 5A1JA 1UWGH 3DECA 4QTHB 2RK6A 4KJPC 4QA9A 5E4YA 3HABA 3JAWA 1AQKL 4F7CA 4YBQD 1FSKC 3RUDA 4QLOA 3O38A 4UINL 1IY2A 4H7HA 3I3DA 3NNDA 1YEGL 1AHIA 4CPDA 1GR1A 3UM9A 2YMTA 1EK2A 4EN2A 5T5FL 5C7XH 4MRCA 1GJWA 2QKIC 3TIGA 2PMDA 2XV3A 2Z91B 1H3FA 5BS0D 4FQ8A 3DVSX 3JQGB 2D5AA 1QQ6A 2XG4A 3GPLA 3RLFA 5I7RA 2GTWA 5HZGA 1WXWA 2UZIH 2BCKA 4ECNA 5CVCA 3AQZA 5FPPA 3B53X 3CXDL 3D25B 3FZEA 4YAKA 4EJFA 2I6TA 2QVIA 3MT7A 2WLNA 5HDQA 1P74A 4B3FX 4UNVA 5ALSA 1FBIL 2X3YA 3BBPA 3K1JA 3MLBA 4I18B 3BGDA 4GZMA 1O4WA 4OFYA 5FM5M 4NOBA 1WWKA 1RYZA 4FMVA 1M6VB 4C7JA 1ZS8B 4CN8A 3VDQA 1PJLA 4PV9B 4LHVA 2X3FA 2LGNA 1FMCA 3R3WA 3K31A 1E5ZA 3GMNB 1IE3A 3T77A 1C9YA 1JWUB 1NU6A 1TQWA 4EKGA 2XDYA 3OESA 1FYTA 2ZP8A 4GO1A 4KJPD 4NJ9L 5EFIA 1FFGA 2OXRA 3RABA 5DEZA 1SXNA 3E15A 3I9V6 4HT1L 3QO1A 2NXWA 4HQFA 4MNHB 5E5MB 3CGTA 1O6SB 2YSSB 4XB2A 3NJJA 5LR6A 35C8H 1IN1A 1M74A 3SOZA 2OOKA 3RUPA 5D3MA 1BAFL 3SE4A 1ZHBB 1TQDA 3ARGB 3UJNA 3WIFB 1QSZA 1R4MA 3WSTA 3BE6A 2CXHA 4EUPH 5F7XA 4QGHA 1APBA 3GHBH 3D7RA 1B0GB 2ZI7A 1D2CA 2XUZA 3DBHA 2WQZA 1ICEA 1PAMA 5IEKB 4U2YA 2E76C 1FRGL 4DW8A 4XUCA 4XP1H 5F3FA 4BK4A 2C2GA 4APXB 3FDFA 3O4HA 4KKRA 5ID0A 1PL0A 4MBOA 3BMOB 3Q6FB 2NXEA 1UWXK 1CICC 4XN5A 5BRZB 4NO3B 1FORL 2Z93A 4GSXA 4U7SA 1MFPA 2F48A 4JZKA 3BN3A 2VDKL 1SJEA 2ZQZA 1X5XA 4LCWA 4OB5L 3F1LA 1EHAA 1K9VF 2ST1A 2MQ3A 3WB2A 4YL9A 4NV0A 2C29D 5DBFA 3HL4A 4DVBB 4NBKA 1FYVA 4NB7A 3IP8A 4I1VA 3TA3A 9PCYA 5DRTA 3OWEA 3HC7A 4J8PA 4KMOA 4DQXA 3I9MA 1CUZA 2JE8A 4JLDA 1V7MH 4JVSB 2JVJA 3RZCA 1XH2A 2VSFA 1K85A 3FMPB 3RIEA 4BYHA 5AI6A 5HDWA 2CVFA 4AUKA 3DEJA 1GT91 1JVBA 3FM9A 1TM5E 5EZYA 1YS9A 5KW9L 4K6GA 1HK6A 2VT6A 4WFHD 1TIUA 2QQKL 3BEWA 1T9CA 3TEJA 2X4NB 1RXEA 5GS1A 3M6WA 2ZT5A 3LSOA 4BSWB 1I85A 2DQ6A 4W8HA 5JNWA 1DJXA 1IMHC 1MRFL 3QUKB 4I2NA 2JIBA 3I02B 3T3MB 2EJWA 1EDEA 3MUGA 3K73O 5D6DC 3JQRA 3ZDFA 3HLKA 2ZXEA 3RM3A 2WNKA 3GMQA 3RJOA 3ZZMA 3BPCA 5T33H 4GYBA 4DXAA 3HUUA 2P28B 2CXPA 3C48A 2VDPH 1ISPA 3IT2A 2FFJA 4PVLA 2YHUA 2NDFA 2ICCA 3T0EC 1OO2A 2SICE 2NY2B 4XN9A 3LK6A 4Z5RB 2OQJB 2R6R1 4B6ZA 3BMCA 3O9WC 4BNJA 2GN0A 3W5SA 4H0HB 3ULVC 1LK7A 1LDYA 4EJSB 1NOLA 5G5DA 3O6FA 3WIHL 3LFTA 1F90H 3KQKA 1UAAA 3QNZB 2PYZA 4PZ9A 1HXHA 5C31A 4R96A 3KXKA 4G65A 1EUTA 5D72H 1BJMA 2PDAA 4ZFGH 2OCJA 3OHMB 5ALHA 1RZFL 1KZQA 2VJMB 4RDQF 1T9BA 2HJFA 4X1IA 4JYBA 3LQ1A 4G42A 2IXQB 1HYHA 3MTAA 3VR3A 1XRJA 1E7UA 1M6OA 4JUSA 4KHTL 5BVJB 1F9EA 3VJLA 3PGFL 1MZYA 5AJXA 5LZ7A 1LBHA 4F2EA 4Y4KC 5ADPL 1G4AE 4RSMA 1EG7A 2JLSA 4TMPA 4MWFA 4OP1A 2Y7MA 1FP4A 4QT4A 3BHMA 2ATCA 1POXA 3NTVA 4TTSA 4KN6A 2ZCLL 1XD9A 3BFXA 1GKEA 5AHWA 2XHEA 3DV0B 4XEUA 3KPMB 3BKMH 4GZ6A 2XA9A 4U0KA 2E18A 3IDMB 1VADA 2PABA 2PLNA 2H8KA 2ZB7A 4W9IC 4N0QA 3D3EA 4DJFC 3BZEB 1JZ3A 2G67A 4FCVA 4V2UA 4NLAA 4CADB 1Z5LB 1NT2A 4QODA 2VR7A 4WGFA 4FNQA 2MNJB 3TFOA 1SKUA 4LV8B 1T89C 3F7PC 4PP1C 3QFGA 3CPJB 3ITKA 1E8MA 4WOCA 4TN9A 3WA7A 3MC1A 3NAAL 4MQ7A 4U2KA 3T0ED 4FZVA 1YYCA 2FSSA 3JZMA 5AVSB 2ED7A 3O9WD 3A4EA 2V4ZA 4ACBA 2X9NA 4RF3A 5KN5B 1QA9A 3AIOA 4BV1A 3ULVD 3HR5A 5H8DA 1D04A 3TN0A 5I76B 1WE5A 4BFEA 4CGUB 4G97A 4KAAA 4PAQA 4YNBA 2WXPA 5FO2A 3OFVA 4Q4AB 2OLEA 3T04D 1NCIA 3QJTB 4JUCA 4J1TC 4BFFA 1GJRA 4FHFA 4FTDA 2UZ3A 3UG4A 5C08A 1TJIH 2Y9RT 3FFCA 5KVFH 4HK4A 2IXDA 1UBCA 3OSVA 1DO8A 5IB4A 2WPNA 3IXTB 2RARA 2O1WA 3WNOA 2J25A 4U3CA 3RC2A 2CKBL 4YHHB 1FFPB 5HR5A 2AMGA 2SCUB 5EC8A 1U8JB 3L1FA 4MNGA 2XX0A 2EGGA 4Y4KD 4AS3A 1WBZA 3GFFA 3B1UA 4QBFA 4N7JA 4TPRH 5JBIA 1MWAH 1U21A 3REFA 1WICA 5T3XH 4NMXB 2VLME 4I9WE 5TH2A 3CE6A 3FF4A 3O0TA 5CKAA 3A4MA 5IZCA 3V1UA 3BL6A 4XO4A 1ONNA 3UV6A 4ORGB 2Y6UA 2ZCVA 4KV7A 3TJZA 5EKXA 1BS9A 3OKWA 1TVKA 3WEXA 4JL8A 1P4IH 4L4VB 4DA6A 4RVNA 1KTVA 4X9GA 1XB3A 3PTZA 5EL0A 3MV11 1NLYA 3KSDO 3L0BA 4PP1D 1YQQA 1YRQA 1ZLYA 2QW1A 1ZU5A 1SQFA 3M49A 3C6XA 3V3KA 1PSZA 3VYTB 5CB0A 5LZ8A 3VR6D 1YFZA 3EDRA 4WI7A 3NRFA 1UOWA 3LDHA 3AVPA 5MHTA 1DBJH 1ACLA 1DAIA 2YJ6A 3K1AB 3OF3A 2O20A 2LIVA 3I05A 5KQSA 2OBMA 1NW9B 4TYWA 3VWJC 2L7QA 4Y6OA 3GLUA 4Y2OB 4RHCA 2H0QA 1NF2A 5H4ZA 1ZUIA 2ZYDA 3QUXA 1W91A 5CEZH 1HKUA 4ZGWA 5I1EH 2GBIA 3P54A 4I6EA 1GKIA 2FB4L 4XFKA 1A77A 1S9YA 1UD6A 5JECA 1NBEA 4FHZA 4M7LT 3CUTA 4YHYC 3D6GA 3QRWA 2Z8ZA 3APCA 1QTQA 4IGAA 2I26N 4UTXA 4K0OA 4Z3DA 1I94B 2IELA 4YYEA 1WZUA 2VYCA 1FLAA 3RWDA 2V2TB 1P5UC 5DEOA 4FNLH 1QWNA 1HYGA 1WHPA 5E5UB 2MTBA 1T4DA 3WMGA 3HDVA 5I74B 4ODUA 3OT5A 1X9RA 1VG0B 3QZOA 1MEXH 3OTGA 3R4DA 2J3QA 4ZWNA 5JZ9A 4FFBB 1M5UA 4QRHA 4FIDA 2O2GA 4TZTA 3QZLA 1NUAA 2CLMB 3RGVA 2VQSA 1EI9A 4L4ZA 5ETUA 4JZJC 4J0KA 1SHMA 4RQQA 3U7FB 2YV2A 3KLSA 2YWRA 3WIHA 4ETIA 4ONFH 2IBZX 4RJIA 3U1QA 4HDSA 3PE6A 2BNRE 2G5GX 3ZHSA 4AQ1A 2V5YA 3SDXE 1SBZA 4GAEA 1HM5A 1M2VB 3GLGA 2I87A 4YE4L 4UPDA 5DISB 3Q6GH 2BHFA 4MWZA 5LBVA 2P5EB 1JZFA 3HB3C 3QVWA 2WKQA 4R5MA 4PJ8C 2CUHA 3JAKB 1VL5A 4DEWA 4HSGA 2OUIA 4QAJA 3VWJD 2I6XA 3I6ZA 5AB2A 2I9PA 2QD5A 5D7JB 2BFWA 3GPCA 1HETA 1E64A 4EY8A 2OC4A 5I9IA 3H9SB 5AI9A 2DR3A 1WZ2A 3N7UA 4D8YA 2BSCA 2HM7A 4YSPA 3LKPB 1USGA 3H3BC 1CBJA 2Z95A 1FX0B 3KOUA 4LDAA 1UM9A 4KKCC 3D08A 5H37H 2Q3CA 3GFGA 1GAWA 5D5QA 5B1YA 2P24B 3MXWH 4EXPX 3U0PB 4YOKA 3K2UH 3GNMH 4QDKA 1T9AA 3CCCA 2LU4A 1I0ZA 4F1SA 3OXSB 1TTUA 1YC2A 3OE4A 3C43A 3LNDA 5JTWA 1NMAL 3EA5A 3KZXA 4FQQB 2IGBA 3REQA 5C70A 4XIJA 3KJGA 4JZOB 2BW0A 4YAUA 3SN6N 2BP7B 3ASNB 2R4SL 3DVGB 4EIZC 3I3OA 5U9CA 2NVBA 2PZLA 3O3CA 1FP6A 5JSZA 4JFRA 1DWQA 2G9NA 1XJ0A 2ZB2A 1ACXA 4GG8B 5KYYA 1T2DA 1QLEH 3FSAA 3G6JF 1DVSA 5IF3A 3N91A 3P2KA 4YV7A 4L08A 2VA9A 4B6SA 4NKQB 3K53A 5JJIA 4UMFA 3HB3D 3QQ9C 4R81A 5K1ZA 1JK9A 3CLKA 5KYWB 5DCUA 3K30A 4CN9A 2CKBA 4NZ9A 1G4UR 2AOTA 1COWD 1ZCRA 4Z7QB 3LKRA 1TMGE 5AM4A 2GARA 1NAKH 1LY1A 5I1CL 4YGVA 2ARJB 2JJTA 3T2NH 3VACA 4DUWA 4AMBA 3ULSA 1KP3A 4DP1X 1GILA 1QNLA 5EOCH 1NMCC 4UJ3A 2CDGA 5SYNA 4OZIE 1CG6A 1B3BA 2QADD 3C74A 3A04A 4M7LL 1XRMA 1I8KA 3NTOA 2NY5H 5EMJA 1H3UA 4KKCD 1THGA 4HYQA 4IDJH 4KV5E 5CR1A 3AOGA 1V2GA 2YUIA 2OYSA 1BFUA 4PP2B 3VGDA 3QG5A 4UU8A 3T9AA 1QB7A 1Y3DE 3FF7A 4D8TA 4G59C 1CP3A 1CDUA 1T26A 3WS3A 3S8GB 3DTUB 2RR3A 4FYIA 3T0FA 1A6TA 4TV9A 1AOXA 4KFCA 1FDWA 1FNHA 4M4PA 5E8OA 5HHQA 3CH8A 5FI5A 3BVWA 1FZMB 5AHKA 4Q9KA 3MCLH 4FQ7A 4Z7VA 1ZJWA 3GSOA 4UQCA 1T5IA 5C0JA 2BM3A 3D7MA 2WUFA 3U3MA 3ZI7A 2IYYA 1GAEO 5LBSA 2FUG1 2E0IA 2K0RA 1CR9H 3BAJA 1CT9A 1GP2A 3AYXB 3P3RA 4JO2H 2JARA 1IZZA 2H2AA 2ZRAA 1P7WA 1AI1L 4BSVB 4P2BA 5ALIA 2EDJA 3VNAA 3ORSA 4Y7DA 2BH0A 1FEZA 1ZRNA 3ZHVA 3RVWC 1JW9B 2IDTA 3UK2A 2JH3A 4Y2XA 2E7CA 2QTCA 1O6ZA 3TURA 2HG0A 1MRZA 5CJBA 3S6JA 5IVKA 3GUTB 1Z5UA 1BHGA 1FV1B 4M5ZH 1N6NA 4X4XB 3CT6A 4TLDA 4X9BA 3SPGA 4BM7A 1IE5A 5KWEA 3HBLA 4ACPA 3ZWQA 3WB0A 2ZOLA 3F2IA 3BCFA 4IBSA 3C12A 3CX8A 4EJ6A 1CR0A 1XPJA 2O59A 3DDNA 2CNYA 5KOHA 1HK7A 1CG9A 3R1GL 2AK4E 1E1DA 3MCZA 5FEUA 3WGMA 3MSPA 2BGRA 5BVGB 4AQAA 2IITA 1YZLA 3MFQA 4KI0A 1TTCA 4D3YA 3HTLX 2CLKB 3CHQA 5FO8A 3GXDA 1TQVA 4QTXA 1I3CA 1X3SA 4K3JB 1U2PA 3OZTA 1KSFX 1TU4A 4B7LA 5FCDA 4B0PA 4N5EC 5L9DH 3MJDA 5C8VA 2VHVA 5IW1B 5CFPA 2HT2C 3DVLA 5JQGA 4Z95L 4GI9A 4DY6A 1BCRA 2KI5A 1VA9A 3U37A 5I1DA 2Q7OE 3KT3A 1Q6YA 4QULA 4Y19E 2H57A 2Z92A 2NR6A 1LD9A 4Q93A 4EMBA 1CDHA 2QDXA 3UAJA 1MX5A 2FEJA 3A9SA 4JREB 4OKDA 3W0WD 3SZ3A 2BIIA 2NO6A 3LWBA 2ZXFA 4ND2A 5DI3A 1TO5A 3RVPA 1EV2E 4G7YH 3OQ3B 2D7TH 4BZ1H 4YDSA 4ELDA 1FA9A 2OHGA 3QX9A 4NCHA 3EYQD 3D51A 3DC7A 3FZUD 1XE3A 1QEWB 3U3XA 3RVWD 4RZ2A 1BOYA 3T61A 1GGTA 2Y9MB 3EUUA 1Y07A 4Z4HA 5AKTA 1X9GA 3F65A 4TWJA 4XTCS 2A57A 1A3LL 3L9BA 2P5PA 2YFNA 3DOFA 4JN1H 4IPTA 5HE8A 2GTQA 5GISH 4EMSA 3VSVA 3LUHA 4WKOA 2HJLA 4XARA 2Z3WA 1YQUA 4G4SP 2VR6A 2XVGA 4F37K 2PV0A 5CM8B 4LGPB 1AUOA 2WUBL 4PJ9A 1X7TA 1IQWH 4XD7A 2HT1A 3X1JA 5AL8A 1X7QA 1ORDA 1NQAO 4RC9A 5JS7A 1XR9A 4D45A 5EHXA 3PT9A 4N5ED 5CJ2A 4E08A 1C50A 5IG7A 3KGTA 2PLAA 3ZX1A 2JZNA 5C80A 4PEEA 3WYRA 4DIOA 5LU9A 5IKXA 1SXJE 3HNSL 2I6FA 4YFDB 3F8SA 4W4TA 4YPVA 4F04A 2PP9A 3PJGA 1KKLA 5J1AB 1T0MA 3TM6A 1NAMB 3CMMA 1SC6A 1QHNA 1VDGA 3BRWD 5I5IA 1D5MA 3DXYA 4K88A 4NABA 1ST2A 1V8PA 2VR1A 7MDHA 3TQCA 3ZE0B 2ZXQA 5LN8A 2D0OB 2ZE0A 4GNKA 4L3AA 1BXZA 4M03A 5FNVF 4KKLC 2EH7L 1AKUA 1OD6A 1A4BA 1TK3A 1BWMA 1F2TB 2RKBA 4KHXL 3AKCA 3V0VA 1ECFA 4KK4A 3NPMA 2P1ZA 1A9EA 4DQ0A 2IP2A 5JAQA 3ELWA 3QRBA 4DHWA 1NCTA 4GQIA 4N25A 1G43A 4J1UB 2OG2A 1Z2PX 1QVZA 1YC5A 2ZT8A 5A2FA 4B4WA 2JW5A 4NUJA 1T4KB 2V17H 4OXNA 2H92A 4MVJA 4FX5A 4PU2A 4BGDA 1KEWA 1FJXA 5TGBA 4IJVA 3BH8B 4EGFA 2I6UA 1NEPA 4UTCA 4HWOA 4AL8C 3L7JA 1IL0A 1L8AA 4E30A 4CCYB 1OAQL 2RBLA 1H6FA 3FY4A 3TXXA 2WLZA 3OY7A 3KFLA 4YCBA 4A82A 1ZEMA 3C5CA 3S3DB 4MWSA 5KCZA 2CZCA 3SICE 2JCXA 2D0IA 3W9EB 4R0LA 4KKQA 1Q72H 1V3UA 3EG5A 2XW6A 4FXTA 1P4HA 1RBZA 2PZEA 1EX7A 1CDBA 1CK0H 4PJIA 4LXHA 5DHVA 3PR2B 5HIMA 4XR8C 3BOSA 4YN3A 3GRBA 3OR6A 2V58A 1DVXA 1CK4A 4OCXH 5AUPB 3W6NA 5KJ7E 3F71A 3WNLA 1RACA 5CR8A 3L7KA 4YSTA 4KKLD 3S99A 5B39A 3IP7A 3QIBB 2GM5A 2GQHA 3B60A 3FZQA 1PVHA 3UMYA 1OLUB 1X8KA 1AZCA 3TH2T 3BHNA 4GRDA 4X54A 5IV2B 4HOXA 5DD6A 3DCIA 4WOJA 3BAFA 2N42A 3I0NA 2NIPA 1FTYA 5AAMC 2C5DC 5ALUA 4Q9QH 2J30A 1YEEL 2HWYA 4AO6A 4EPVA 3T0XA 4FMDF 4BNMA 3MTXA 1DVFB 1O9GA 2EDLA 3H18A 1SIBE 3GY0A 3QO0A 4I3GA 3TNJA 1TO2E 3FQ1A 1SURA 2JGMA 3TP4A 1HXKA 2FO1A 4PQXA 3AHHA 2OMWB 4YH1A 2I3BA 2BVQA 4GGPA 3LQQA 3PUHA 3V4PB 3KD3A 2K6YA 1KZ7B 1ZT1B 4R7NB 4PHXA 2I9TA 3LN5B 5BN4B 4U3JA 4LVOA 1V3KA 2PS1A 1JYNA 4KQ9A 1BBJA 1JEDA 4XGZA 1K4KA 1X7WB 5HA5A 3VPSA 4ADIA 3VC3A 3BL5A 1GWNA 3H97A 2XBLA 2F8OA 2ZSKA 1XGZA 5IXYA 2I60L 3JXAA 3P71T 3G89A 5DHEA 2IQIA 4A5SA 4YDLC 4KYTA 2OMXB 4QNPE 4AK1A 1YEFL 3QDJA 1KJVB 4ZI3A 5AB9A 5E0FA 4MDIB 2VK2A 1ZRUA 4DLNA 1HDMB 5K59E 4AZ3A 3RYMA 4YXLL 4RWEA 2IF0A 2FE1A 1N4XL 2AXWA 3IAQA 2W2LD 2DQFB 1S3RA 2QY6A 2GI0A 1XD2A 3MINA 1HZHH 1DG9A 5K33A 3SLRA 1U8KA 4JQYA 1B4LA 2E48A 4OKSA 2R96A 4IIXA 4CC0A 3PGXA 1IAKA 2CXRA 1U8NA 1NMZA 4UD2A 2YWBA 4ZVNA 4OXYA 1VKJA 3T7TA 3Q2IA 2IBMA 3V95A 3D2UD 2F6RA 1KYQA 3E9UA 1A4UA 4OF7A 1JHAA 3ZDYB 3BDXA 1SVUA 4BFWA 4G0MA 3LZ6A 4ILKA 5F5LA 1CQIA 1NKRA 4KKBC 3GEHA 1G21B 4Y4HC 1EIBA 3KYBA 2VZ3A 3KLHC 2V5RA 3OEYA 5FYJD 3GUUA 1XTTA 1JHKH 3TSYA 3HKDA 3X1XA 1IXZA 2W8CA 1IQRA 3VXOB 1C9KA 4HMQA 1GA2A 3A14A 5THQA 4W8OA 4U8HA 2YUTA 4HBCL 1L5ZA 5EIIG 1FNDA 3BH9B 1CNEA 1EAQA 4F15C 1AHNA 3RVSA 3FQWB 3CR7A 2A9AA 3LIUA 2I34A 2VLKA 3SDXF 2NXZD 1KFEB 2A9NH 2VHUA 2XWPA 4IQ8A 2FEWB 3COVA 2AI0H 3E9DA 1AGEA 1E0KA 4JJ5A 2DBRA 4MA8L 1MCCA 4D8PB 3RUGB 1J2TA 1KXQA 3IVKA 3T7EA 2F19L 1HEZB 3D69A 2GBAA 5DWDA 2LT9A 3AH8A 5MEOB 1Z0SA 4FZEL 3QGVA 1HQ4B 4I2XA 3QU7A 4B6FA 2EABA 3FL7A 4IDAA 2UYOA 1WPGA 3GLVA 3KDSE 4IXMA 4RS4A 2VXTL 3TT3H 4FINA 4JQCA 4KC0A 4ZCQA 3R6GA 3QNYB 1CT8B 3HBJA 2H9GB 4GXTA 2I07A 5LWQA 1MSPA 4PJFE 1HSBB 4MLCA 4N6OA 4KSCA 1QQBA 3RWMB 2ZULA 3RTAA 1X5KA 4FU0A 4GR4A 4M0UA 2ZG2A 4G8JA 1WZCA 5C32A 1U1EA 2GJSA 3QXTA 5GS0C 1DUSA 5I1GL 4RPCA 4JFDD 3T65A 3DPUA 1A7OL 3O8XB 4FA8A 3GLHE 2OA9A 4JI4B 1PY4A 4NYMR 3GJXC 3MA9L 3GXBA 2ZUYA 3G1TA 5SWZE 2O1AA 4XP6L 4BRUA 3WFDL 1VERA 4Y4HD 2FG5A 3PL6B 4LWPA 2APJA 3KLHD 3TS8A 5DWUL 3HHPA 2OKGA 4NCDA 1GFSA 4MS8C 2ADMA 5H8WA 4MCHA 3P9IA 4G0PA 1EFKA 4TTPA 4NE7A 1GTRA 1AXSB 2ID7A 4RISL 1XH0A 2FWOB 3D48R 2ORED 2NY4B 2VXQH 1HL7A 2FK7A 3O8LA 1ZM9A 3B5JA 1KJ2H 2EFCB 1MIEL 3TMKA 3S2SA 4C0QC 4IDBA 3C2AL 1N2CB 2XODA 3C5JA 2JIMA 4AWXA 4C7MA 3RJ5A 1ILUA 2WZAA 3E7JA 5CD9A 1NZDA 1MVUB 2QSJA 4LSSH 3AM4A 4LMQI 1R0ZA 2MOVA 1MZZA 2ON6A 2TSYB 3NYWA 5LZ4A 5FOBB 3I76A 2PXXA 1GLGA 3VNSA 3DHYA 3UIZA 3TI9A 3IDYB 2X6UA 3GXIA 4OZIF 2QSQA 3ASWA 4UQ9A 4ZAYA 1II8A 2J1WA 4XVHA 5C8JB 1Y34E 1JHDA 1BVUA 2ZSUA 5SZJA 4KV5F 4FQIH 1VJCA 1K7SN 2WT8A 5FLKA 1PT8A 3KSUA 3JPWA 1AZVA 2WKLA 5GS0D 4P2YA 3I9PA 1V5GA 1AYRA 3DAYA 4FDTA 4Z0BL 4BE7B 1GU0A 1KCRL 1W6LA 4FHJA 1BC5A 1JU4A 4EUPG 4AMZA 5HHOD 1A3ZA 4NBTA 4XCQA 3F2VA 1BD3A 5AO9A 2CHFA 4FBLA 4Y98A 3RJZA 4OHCA 3CBJB 5K8VA 2D1SA 3HJEA 2XYBA 1QFZA 3C70A 2F18A 1QO3B 3QIVA 4E70A 5DGRA 5AJWA 1HDOA 2XVZA 4FQJH 1E9VA 1OW0A 4JFTA 5ECJE 5EJ4A 1YI8A 3PQ5A 2XIQA 1CFSA 3LOWA 2XGMA 2G3NA 3TLGB 4EKEA 5DMKB 2OCFD 4IW3B 3JD1A 1RSYA 2V0GA 2NY6C 2WXOA 4J0CA 4TTAA 5HY9B 4EOWL 3AT9A 4R3WA 2KUTA 1LLUA 1NRJB 4ZDIA 2BF7A 4JLRB 3KL2A 3HPRA 2WMDA 4PBDA 4PAZA 1EVZA 4DDKA 3OIUA 4UT7L 5AQ0A 3IBOA 4XUDA 1T3FA 1ZICA 5FYJE 4Z86A 4ZT7A 2IHUA 2ROYA 3OZBA 2DEUA 2WINI 3OG9A 4NVRA 3FB8A 1I7TB 3PQYD 5DJXA 3PIRA 1ZT7A 4B97A 4JP5A 5CDYA 5GGVH 3ZBTA 1QBBA 1VIAA 3KPWA 4XP5H 2QM3A 2WKOF 1XEXA 3O7MA 1W8IA 1AQDB 2H2WA 4JFXB 3ID6C 1E62A 1M7IA 5FX2A 2VE6A 3MBEA 1N3NB 1H9DA 2LTAA 1AQLA 3FFWA 4J9VA 5C52B 2IX9A 1BD2B 1JGDA 4UUJA 1BVOA 4B0OA 4P23A 5JR3A 3DAPA 4ZREA 1J05A 2A38A 4PGGA 4WI9A 5J9FA 3KPRE 3KBHE 4LPUA 2PSDA 2DQKA 1CE8A 1U3DA 3ANTA 3H2YA 1D6EB 1OGAA 4M56A 4YDKL 3NHAA 1IOZA 1NUPA 3VDAA 3O92A 3R75A 4M3NA 1CTNA 5ICFA 3JQCA 4CCSA 4XPBH 4AXXA 2O3QA 2IAMD 2ADYA 3FETA 2GCEA 5L7YA 2PANA 3TBVA 2A0KA 2NNFA 4QWWA 4Z3HA 4JHLA 1I9RH 4DP0X 4DPBX 4AJOA 1BSIA 3ICCA 2H2DA 4EKNB 1NJ5A 3WMFA 1XRSB 5GZND 4LU5H 3DX6A 2PWBA 2NZIA 1FDLH 2PTTB 1T1SA 3AHDA 4J28A 3ZHRA 2C8NA 3CE9A 3C6LC 1I80A 1HFWA 3NOOA 3DXAE 5F9AC 3GELA 4MQEA 3Q8FA 4EGSA 2X8JA 3LGSA 2VDNH 3LDFA 4DJ5X 5BSFA 4AN1A 1W5TA 4L28A 1KYTA 1PG5A 4L4UA 1NQWA 3IKVA 4RAUA 3UBXA 4O4LF 3ZHYA 4HSQA 2W2PA 3ZGHA 4AS1A 3TPUB 1WBBA 4PZDA 3T34A 1TT5B 3OZDA 3K2KA 1ULHA 5K4AA 2Y1WA 3PVZA 2FSFA 4R71A 2Z9BA 4Q9CA 4FSHA 4OV6F 2XSZA 2DERA 4UAVA 4V1DD 5FFFA 2Q6VA 2VNJA 3D05A 3QJRB 2Z2YA 1IM8A 3OPXA 4J3JA 2OVFA 1KI6A 2XXMB 1PP4A 1MCQA 3FQYA 2HC9A 4KFRA 2UUOA 1NGWA 1GMEA 2BGGA 2ZKLA 5ALTA 5EIQA 4EVNA 4UTAH 1G87A 2OB1A 3VG0L 1JR3A 3SQDA 1HH6A 3IDGA 5K0BA 2CKDA 4PXYA 1RTKA 2XCMC 1D5XB 3PSHA 4YNYB 4NP9A 2J45A 3C3YA 3G5VA 4F7TA 4V39A 2ZK7A 1S7TB 2CVQA 3MRRA 5B38G 4APQC 1DVUA 3BWSA 1M71B 1S8OA 3ALWA 4R8LA 4UM5A 1CFZA 3RAPR 3L4ZA 5FECA 1ACJA 3BE8A 2X4OB 3OKLB 1MUJB 1IIKA 5HGAB 5ABZA 4LSRH 3QDGE 4RAHA 1VG8A 1IZ9A 4GR5A 1MQ8B 3F6EX 1P4LA 4Z0XA 3B2PA 1D4FA 3WE7A 4UUMA 2C2XA 5IDXA 5DSXA 3OR7A 4N12A 4E0RB 2G5BA 4H77A 3I6LD 4GE3A 1P6FA 3RW9A 2QD1A 3RUEA 1NONA 4XBGA 4JQOA 4MLSA 4OSUH 4UYQA 1U9ZA 3V7FA 4AQYB 3L77A 3S98A 2LKDA 2UXBB 4Q6KA 4II3A 2QMKA 4N18A 5K5EA 3KW8A 3CW2A 3K0SA 5B1JA 3TBCA 3FPYA 3UT0A 2VLIA 2IPKB 1IWOA 3R5SA 3ZW9A 2DQCH 2OSXA 4J75A 2GRJA 4CTJA 2RHHA 1T15A 3ISYA 4NP4H 1X1BA 4NU0A 1IBLB 4M5YH 4NOJA 3SLGA 1T5XB 1ADFA 1ZWLA 3E27A 3KYDB 4P0DA 5JLZA 4UEQA 3VVVA 1GPOL 3PXUA 2PCFB 4YHZL 1IEQA 4R0VA 5KQMA 5F0MB 4IVRA 4NRXB 1WDAA 3QCTH 2AQ1A 2JVIA 1FFXB 3NBXX 1YUKA 4APQD 1G8AA 4KNQA 3LQYA 4TVKA 3ZDBA 1T4WA 1S7XA 4J0JA 5DJYA 1NJ9B 5K0LA 2WBJC 1XVSA 4M93B 1QBMH 4FUQA 4NQQA 4B32A 2IPOA 3GTTA 7ABPA 4P81A 4H1VA 5G55A 2FBOJ 3RUIA 4ZAZA 2CLHB 4MH0R 3JTMA 4EYGA 3DHMA 1BJ8A 1H3XA 1LP9F 2MCG1 1TJ5A 2Q8BH 5FUZH 3FULA 3R09A 1NE7A 5L3QB 3AY3A 1KY6A 2E7DA 5FO9B 1AU9A 1XF1A 2ATKA 1HNXB 5ARCA 2UV3A 3USES 1NWPA 4LXYA 1AD0B 3QULA 4FZ8L 1JPGB 2WLMA 4A66A 5E4FA 1XCJA 3OL2B 5F4BA 1EP3B 2VPIA 4C4SA 5C0ND 2PWAA 2V6HA 3RPIA 1TVMA 4RORA 4NBYB 3OWXA 2VDRL 1IRAY 1RU3A 3CRRA 3HN2A 4C0SA 1TZHA 4BC1A 3OE1A 1QH1B 3F7VA 3MRIA 2G7ZA 4MJ5B 2TECE 3NZHH 3QUCA 2ZE6A 4C4UA 3JV7A 3NIFB 3S3BB 3FB4A 5KS2A 5GWXA 1IBFA 1SHUX 1TMCB 2VSNA 3OMWA 5ABDE 2GEDA 4IDDA 4E41A 2C1XA 3EWAA 2AZAA 2H3KA 1QCZA 3HUTA 2JSFA 3SHTA 4ZQFA 3PFWO 5LXVA 4A38A 2OCKA 1J42A 3OQIB 3MJ8A 4KY1L 1A6VL 1INDH 3C1UA 2OTUA 2XN9E 3N0TA 1FGNL 3S96B 1GS7A 1OH8A 5E99L 2VQUA 4CEIA 1XD8A 4O2AB 4QO8A 3US1A 2V54A 3E5RA 3CFJA 4GMKA 4XPTL 1OX5A 4QNPF 1TM7E 1A0OA 1JIUA 3BZFA 3KDPB 4QRUB 2WBJD 5HIAA 3IAAA 1H1LB 4LOAA 2PKXA 5K59F 2D1FA 1HL5A 4JK0D 1PQZB 4X6DE 1AX9A 4BLWA 2OMNA 4IHJA 4NPAA 1YYLL 4ZV9A 2Y1GA 4QCIB 4NJAH 1DBML 4HCRL 2VQ1A 1V5FA 2VDQB 2H0FA 3MN1A 2A7XA 4LYDA 5HE9A 3ROFA 4NKIL 5DJ6A 3HUDA 3RG8A 5J6GB 3HEMA 4GT1A 1ZLSH 2AC4A 1BSVA 2E59A 3ESCA 4XE0A 4K26A 5FYKL 5L4FA 1X2BA 4AKIA 1I7ZA 4GPBA 2G75B 4D0RA 4TL9A 1DJYA 1RZKC 3SE3A 4NHCL 1Y1KE 1GQ2A 1HNFA 2PYEB 4QYOA 1FGVH 2EIJB 4KDEA 4Z2AA 1V16B 4Z3EA 4LXIA 1V9LA 4YGAB 4Y2LA 4DP2X 5F7YC 4O02H 5H37G 2N46A 2HRRA 5EPUA 4PWFA 2X6VA 2VF5X 3MV9A 3ENQA 1E7MA 3CX7A 4ZEMA 5FK9B 2PXYC 2G80A 4HQNA 1KPHA 1NXPA 2R6DA 3ZTDC 3KYMA 2V7XA 4ANVA 1Z45A 4E36A 1OKKA 3JZFA 4XXDB 1BQLL 3KWVA 2MFNA 5AKSA 4U8GA 2QAGA 2QDVA 4P86A 1XTLA 1ONBA 3ZXYA 2G09A 2PLFA 1N6KA 2V65A 1T2QL 5DHUA 4AX4A 3FT2A 1TEXA 4RMWA 2EAEA 1BFOB 1BNCA 2JAWA 4F9FA 1Y7TA 2VYNA 4WY7H 2WXNA 1KZHA 1RRPA 3MCYA 3FPFA 4PJFF 5DTMA 2AVDA 3FT4A 2IZ6A 2QIOA 3U3ZA 1ZKMA 3CAFA 3VQ1C 3M4XA 2NUPB 3P26A 3LMJH 3HUFA 4BZYA 3STWA 4KXMA 1O6CA 3EXJA 2IWKA 3QYPA 1BM3L 2I29A 5JHBA 2VUUA 4OZ4B 3OZWA 1OGTB 1OWPA 4S1SL 4NKRA 5IHXA 4TULH 4IV0A 1M34A 2C57A 4FL4B 3RPKA 5G4LA 1MLBB 4OZHA 4IOFC 2FWPA 1NIBA 4ETNA 4B3MB 4X5LA 1A7UA 1E2JA 3MRGA 1J8DA 4NOLA 5FPTA 4JKKA 4IUDS 1QAMA 2E75C 2JAPA 4EZIA 1TYAE 5FWXB 1G66A 4JPVL 4ZIRB 1N5KA 1N5AB 3K3QA 3PXAA 2AABH 1AZZC 1KGXA 3GEMA 3SYMA 1OE3A 4EL5A 1OBOA 4HETA 4QIRA 3P4MA 3CZSA 1JLLA 1EDOA 1BXVA 3F1KA 1LS1A 3O8NA 3EDQA 5JTTA 3QZBA 1OZFA 3K4QA 1Y98A 1VEPA 1QSFB 3ZCQA 2A0YA 2EV9A 1UM8A 1YE5A 1U8TA 4OHYA 4ZSOE 1OCWH 3U0BA 2NY1D 2OXHB 1W73A 3CSFA 4ZMTA 1J18A 2I3GA 5ECYA 4D98A 3GFVA 4WW2A 4ADSG 1SIWA 3NYIA 3EF7A 4WA7A 1GDHA 4KH2A 4H0IA 4RLDA 4FCHA 4RXUA 2VN3A 4G1CA 2AOUA 3CXFA 4GRAA 3HKEB 2O6CA 1J49A 3VYRB 4XNZB 1TK2A 4B82A 2R4RL 4NH4A 4S1WA 5I0VA 1E4WH 1G7LA 3ABLB 1SEBA 4ZT4A 5JD5A 3ICPA 4UDTA 2JCCA 4PTTA 1ODIA 4UHBA 2NPFA 3TLXA 8ABPA 5ADVA 4YQFA 1W72H 1OSPH 4ZQEA 4V0RA 3MMEA 1V3VA 4IOFD 3OPYI 4RZIA 4F4DA 4GKVA 4DXHA 5A06A 3OA2A 2E47A 5I17B 4I99A 4QICA 2AV1B 5JMWA 2R7KA 3N2KA 4HHAA 3ULUL 3HFGA 3KH4A 2D0FA 4KUGA 4KRPB 1WC7A 3WS6A 4N3BA 4UAJA 1Y4ZA 2X4PA 1H2FA 4CKBB 1E92A 1NEZA 2ANBA 3DKIA 1X5ZA 1JNHA 1E1QD 1ORVA 3TVTA 1UTDA 1GSIA 1MEEA 5HIKA 3BGWA 5LUMA 5AW7A 3RILA 1SDAB 4DEPC 1XQ1A 4HCRA 1PAZA 1VZGA 1TL7C 4YMLA 2I7SA 1DVRA 1K6IA 1OYWA 2C2YA 3HJAA 2QTMA 3BKWA 2N7BA 5DFWH 1E2FA 3B38A 3RA7L 1IH8A 3LH8A 3KYAA 2GBGA 4J23A 4JKPL 4QRQB 4IJTA 4O0LA 1KYVA 2B1RA 2B2XA 4JGBA 1YAJA 3X2EA 4CLRB 4V3CA 1OU4A 2YPVH 1KN4L 4GICA 1Z2CA 3MOGA 2GIXA 1MH9A 3D3NA 3C14C 2X19A 3MQIA 3ICVA 3NDJA 3R8QA 1JAHA 1VE3A 3SKOA 1ZJ6A 1CLZH 1HYQA 4XM1A 5JSFA 1Q15A 2ZJSH 3GPEA 3I64A 3G17A 5BUCA 3ABZA 4OZFH 2HIGA 4UDNA 3DUFB 1IXKA 3PPWA 3T3OA 3NP9A 4ODHH 3VOBA 5K7SA 2J3MA 2REQA 4XO8A 2IIPA 2C3VB 4UQIM 4S1PA 3TEZA 1Z18A 4BVAA 2PL9A 4FDLA 1F6AB 3VE0A 4A55A 1DG3A 4CIWA 1D8AA 5G0WA 3JWNC 3LP6A 4ODVH 3DURA 3L3JB 1OM3L 3P0VH 1A2QA 4ZYKA 2O2YA 5EUKB 2I76A 2C9QA 3SAJA 5JW4N 4B85A 4K7PL 2G17A 3H6GA 4HFMA 5JJ5A 3KEQA 3GFPA 1YTUA 1IFXA 3OHPA 4K46A 2R6GA 4ONHB 4YJHA 4BRJA 1LEIB 3O93A 3NHKA 4BXSV 2XECA 2OCIA 2WMOB 4BMOB 3GHEL 2AJSH 5JXIA 5DHSA 3WHPA 2B7DT 2GZMA 5HGHA 4OUDB 1GTFA 2HQOA 3PPSA 3BHBA 5JXWA 3DAGA 2Y7OA 5KJ1A 1XX6A 2XA2A 3I62A 2KKQA 4BP8A 1DBPA 3DPBB 2PL1A 4L1SA 5E1OA 1JE0A 1SMAA 1KR2A 1CYEA 1E7WA 3WDJA 4U3SA 3PQCA 2EKLA 4NBVA 2D9QB 2FA9A 2M98A 4A7GA 2BLNA 4K81B 5AR1A 3LV3B 4D7BA 3VPAA 4KODA 3SF8B 4C29A 1NXXA 3DF9A 4FZ5A 4J90A 3DT8A 4L0ZA 1JBQA 4GW1A 3COJA 2HU8A 3A32A 1F7UA 2ODBA 5I6KA 2HA2A 2F54E 4AQOA 3ILEA 3MRCB 2XQYK 1Q11A 4LMQE 5ISZA 4JM2B 1SBSH 3ASUA 3IDUA 4HJ1A 1M05B 2YXNA 3F6IA 1A25A 4LGSB 3X43A 2G3XA 3W11C 3UPDA 2EDWA 1K63A 3HNTH 2NPLX 1ENPA 2FUCA 4ZXBA 3R4VA 1YA8A 1HT3A 2M6RA 4MZDA 2WXJA 1M66A 3ARZA 4HEPA 1XIVA 5EKDA 1DHRA 1QMGA 3LRHA 3KPSA 2MSLA 1GHTA 3DFZA 1XGQA 2YMQA 3Q9SA 2DR2A 2F58H 4GG1A 1UOQA 4OG2A 4M8LA 2XSKA 1XD1A 3GRZA 5A3JA 1BZDA 2CLSA 2CHWA 2JJUA 4PRPA 3SBRA 1C1XA 5JNYA 4JBYA 1PFCA 1IBBA 3HG4A 4R8VA 3PWPE 4LSVH 4Y2TA 4P46B 2BH9A 4LBWA 1QRUA 3K3PA 2QX9A 1P4BL 1OF1A 1I1HA 1BGVA 1W8EA 1DDGA 1OV4A 2PKQP 3G2IA 1CBVL 2YC2C 4CQLA 3D8BA 3ROQA 1Y80A 4B3XA 3ILVA 1KTKE 3ZVNA 1DARA 5EQTA 4A16A 3RYIA 1ECZA 4X2UA 2MWMA 3QGMA 1QRNE 4Z7NE 2DWUA 4ZW3A 2HTFA 4NZYA 4X24A 2Y1YA 5JIKA 4CU7A 5CDTA 1GZ4A 1GL9B 4WWKD 3BT2L 3BPOB 1LNSA 3MJ9H 3PYXA 2VSCA 2D4HA 2ZT9C 3ZHDA 5DTJA 1KBGL 1YBHA 4HZ1A 1RJWA 3WADA 3SY6A 3EF0A 1NMEA 1Z4LA 2JJSC 5D8JH 5BUGA 3A37A 3W11D 2C3YA 4WENB 3FO0H 4KG7A 5F8RC 3KC2A 3NFSL 4HEME 3EDFA 3O11A 4WVLA 3X1BA 4ODTH 2JJYA 2PMWB 3GA0A 4I4IA 1F41A 4DJDC 1U41A 5IAAA 5DHFA 4WUKL 4EHAA 1OP5H 1FDSA 3TVMB 3B9KA 4Q6IC 1A04A 2BEKA 3WMSA 4X4YA 3DA8A 3BLBA 4X9FA 3IRPX 4YDJB 5C8XA 1FPTH 1Z3RA 4IQGA 1I1OA 2N0MA 3MRPA 4RFNC 3TSZA 3IMKA 2B0JA 2IP4A 3EDKA 3OD5A 4X0KB 4ZYVA 5CIPB 5HUJA 5HJ2A 5JSYA 1F2VA 1HKLH 1CD1A 3GARA 4D81A 1XHHA 2JGJA 4F3TA 3A3YB 3CZLA 2ACEA 3T7DA 2VEDA 1WWBX 3CFTA 1KIUA 1QCDA 4GQ9L 4HD8A 2IH5A 4NQCB 4PBSA 1SZPA 1I2AA 3ZCRA 3AX6A 4DF3A 4OJQA 2ZG1A 4C22A 2Z56A 4JE4B 4DE5A 1WLSA 1LZLA 1FG2A 221PA 2ZYTX 1H69A 3L5KA 4D4HA 3K9GA 7FABL 1TM4E 6REQA 3E7DA 1T9GS 2OP0A 1V3MA 5C07A 5CZXC 3SDZA 2XQYA 3TV3H 2FEOA 4G70B 2ZOKB 5IUCA 1YEIH 1L1QA 4P2OB 3Q5GA 1H3TA 5IJBC 4Y67A 1TCUA 1YVPA 2A9JA 1PKQB 4CN6A 1QEXA 3MA0A 2YS7A 4P84A 2D73A 3PRKE 1L9XA 2WHVA 2APSA 4IU3A 3H9UA 3LBFA 4EYKA 4X6DF 2RMKA 4KK5C 1LO5A 3HCOA 2B9BA 5DJ0B 4F3RA 3P0HA 2RHTA 1C2YA 1YEJL 2CHZA 4LSZA 2IH1A 2R5WA 2REOA 4ANFA 1XEDA 5E2AA 1KPVA 4MMXB 5EOTB 1A7PL 3G49A 1IJ9A 3H3JA 2WWKO 3FNHA 4CL7A 1DQNA 3U4CA 5BO5A 1NL0L 4DA0A 3LB6D 1PZGA 4C5CA 4PJGB 3MLUL 3AJDA 1NP6A 2GB2A 2VDVE 2H08A 4JANA 4FLQA 3T95A 5J5CA 3AV3A 4PZCA 1MORA 3QEHB 1DQRA 4O58H 3AG2B 3PWLB 2OESA 2G77B 2TMKA 3P11H 1QYCA 2G0LA 2MCAA 3VGBA 3IPEA 2XZPA 4Y2RA 5GRUH 3IPRA 1HX7A 4BNWA 1Y1QA 2H2IA 4AQEB 4ZI7B 3MS4A 1C30B 4AL8H 1IGYA 4W4OA 1NYQA 1I6MA 1WGOA 5JAPA 2MQ0A 1GUDA 4HGWA 3WSVA 4IVNA 2UV8A 3R3VA 1S78D 1ITCA 4PGMA 4AT6A 4JL5A 5IMKB 3NABH 2EIZB 4NG4A 4HJ0C 2VWPA 3MNWB 5LQSA 4P3CH 1N7MH 2CGRH 1JSLA 3DS8A 4P9HH 3OKEA 4LDLB 3WV5A 4IYRA 1O9VA 1C8LA 4GYYA 2VERN 3UTSB 5CCJA 1E9PB 4HH1A 2H48A 2DKNA 4Y1RA 4XXCC 2XWSA 1MPTA 1SVZA 2EBWA 2JFZA 1MCJA 4QREA 2WR8A 1BHO1 5J12B 1U0HC 3AHEA 1ZH8A 4RF4A 3EOBB 2X42A 1SWVA 2WKPA 3FFBA 4JI6B 2B9EA 3MD0A 3QEQA 1UKYA 2Z3ZA 4XCYB 3CU5A 1DIBA 4G0UA 1U8IB 1E2WA 4M62H 4O2FA 2XE4A 3CA8A 1JXDA 2VRQA 4BEWA 2BNUA 4Y18A 3PGCA 2GT9B 3SJVD 3LUAA 2ABWA 1DFBH 3TDNA 4YMUA 2ZTMA 2BI4A 5E0QA 4H8WC 3BERA 2C03A 1MY7A 2YXBA 4JDUA 4F3YA 4MR7A 5DP2A 2DBYA 1UM4L 1Z07A 2H8PB 1BWPA 4PYRA 5F7FA 1PCSA 4CVNA 1S8DA 5BWOA 1HS6A 1SLUA 2J88L 4A1FA 1FYHB 1SCKA 4B6RA 5JW5B 3HYCA 4RJJA 4YLCA 3CF0A 4I9NA 1YIDA 3UZQA 4WTOA 3TUIC 3ASZA 4R16A 3FO1A 2JNWA 4WNYA 5K3EA 1XTSA 3Q7IA 2Y3IA 2DQGL 3VXNB 3QQXA 4H1LB 3RKUA 4G6MH 1XH3B 2I3ZA 5DJ5A 1Q6ZA 3QAQA 4DW2L 2O26U 1UGKA 1PG7H 1MT0A 2RJMA 1IEBB 3PJRA 4DADA 2IP1A 4LXTA 2AVGA 3A06A 3KSRA 4YWJA 1GQSA 2WQSA 3DM5A 1I8IA 5D9SB 4HJ0D 4TXJA 3NAZA 2DBQA 1HE4A 2IH2A 3MV8E 5LAPA 3QBTA 3GRFA 4UOW1 2ECKA 1WZIA 2QTVA 3FHJA 3CDYA 4AJJA 1T0NB 3GMSA 3VH8B 5KS9A 4F4HA 4PJDA 2EDAA 3S5LA 3SE8H 5F12A 4LN1A 3LG2A 5D96B 4EQ6A 1NFDA 4FZ3A 3HZYB 4O2BB 2VTBA 2BP8B 2YHBA 3UROR 3QE9Y 1K7FB 1PKEA 2A88A 1D5BA 2V2WA 3ICEA 1KMHA 4HPOH 3RIAF 2J4WL 3N40P 1NP7A 4ABUA 3NDIA 4FFYL 4Y9GA 3V4VL 4OK3A 1ID1A 4NMLA 2EFDB 1R9NA 3ZDZB 1K3FA 3MLXH 4QYMA 3PXXA 3KJXA 2MNWA 1SOSA 2Y1DA 5IDQA 3WP0A 3LEVH 3DV2A 1KIQA 4ZHSA 3L4BA 3F6SA 2RGNC 1Q84A 5J2TF 3MRDB 4OI2A 2ISCA 2J7PD 1TJ3A 4OHZA 3QNXA 4NCC1 4KIWA 2D7MA 3KR2A 4WXMA 2VXVL 3FB5B 3EZJB 4I13B 1B90A 2G4CA 5E2WH 4CR8A 1L9MA 5EN2B 3JVGA 3KALA 1NANH 3CZFA 4IOJA 4A7VA 4BFZA 4RGMB 3F5FA 1H4QA 3BT7A 1C8BA 4PZPA 4AENB 4A2HA 4YUEH 3WDMA 3AI3A 1VCMA 1HIMH 5TPZD 2WN3A 2R0LH 4Y9TA 1B1CA 4QYWA 1OAOC 4G3XA 5EOQL 2XYVA 4YDHB 1LB1B 5CT9A 1PT9A 3A1CA 1C14A 1A3CA 3IDNA 3ZQJA 5K8UA 3OFSA 3SOPA 3BP5A 4JHAH 5AOVA 4M54A 5BNTA 4NPKA 5IHUL 3L0IB 4ZPVB 4DP4X 1MOSA 3Q88A 4AG4H 5F0LB 2VLMD 4I9WD 5TQ0A 4AW7A 4TX1A 4OBBA 3D2AA 1NKGA 3P5SA 2O7NA 5CAEA 4E88A 3JWDH 1JFLA 2FX2A 4D9LH 1UKBA 5BRPA 4MHOA 2ITEA 1M8PA 3U26A 4TWIA 2H1SA 3HS0C 2GUWA 1M1SA 4RESA 4Q1VA 4TSCL 2PT6A 4XBPB 3ROLB 1L7IH 4CSZA 3DEYX 1B1AA 3UC0L 4KXNA 5HKKA 4IWYA 1ZH6A 4DDMA 1Y1UA 5A6MA 3KYCA 3U1SL 3C7AA 1DQJA 3KBFA 4AUEA 4X80L 3U0VA 1Q3KA 4C6RA 2LAGB 1DQQB 4UNTA 1XP5A 4RCAA 1RK0A 4O3UB 5KOIA 3GEIA 2HB0A 2LZ0A 3HNVL 4KVCL 5CD1A 2EYSA 3NP7A 1KY4A 2JCVA 3NIDB 1EUYA 4K7PX 3TINA 1MC8A 3CN9A 5D86A 3VTMA 5JZBA 1R8QA 4HPJB 4NQVA 1CZOA 3II2A 3SJVE 4D0DA 1UF9A 1EDHA 4LYAA 2VNIA 4GSDL 4IH4A 2IANA 5LP1A 3PFFA 4MD4A 2PWEA 2OYMA 4YJFA 5LWYH 1SOXA 1G20A 1V9SA 1Q9LA 3AEUB 1A1MA 2YKLH 4O5LH 4BHUI 2HGSA 3USZA 4BFJA 3OZIA 5JQ6H 2PS9A 2F62A 3CLVA 1Y1DA 2E6KA 3SQBB 5GGSY 4YUVA 3DFMA 5JRZA 1GGHA 1JPFA 2V6GA 1CIUA 1NM9A 4C3UA 1F0KA 2OHJA 1RM0A 3WIVA 4DL9A 4J94A 3C8UA 4BVJA 2AFVA 1CVSC 5KBLA 2RHBA 4LHEA 3U30B 3W34A 1QKZL 1KMNA 2FAXA 2EE0A 3QJQB 1EMTL 5I28A 3RI5K 5T5FA 3B52X 3OF2A 4R7ZA 3R5FA 4UE2A 3W5AA 2P69A 1L2TA 5PCYA 4JLVA 3EZ8A 4JQIL 3QIUB 2CIIA 1KCWA 3LCRA 5CGZA 2QKSA 2RH9B 4C07A 3HYNA 4CLOB 5KNCH 2SNIE 2BNRD 2OMUB 2VPZA 2RALA 1JEOA 1TJYA 5CGMA 5TK2A 1F56A 5T1KB 5AK6A 1SOAA 3TLAA 1QKJA 3T41A 4Y5YC 1OILA 1XO1A 4FNGA 4F8EA 2PO6A 3FBWA 1DLFH 4FTWA 3GLFA 1NBYB 3R5XA 5IY5B 3GC3A 3T9CA 4H6VA 1E9QA 4RZXA 3O3AB 5J4LA 1C3LA 2OR9H 4QDTA 1W88A 1XAIA 1BFDA 2W2XA 4OJCA 1ZN7A 1AK2A 1QV7A 1D2PA 3ZO9A 1GHFH 5EEXA 2GR9A 1YH3A 3DX0A 5J4HA 1D1TA 3ZU2A 2F8TA 3VI3B 2VXBA 4HY3A 2PD3A 2ZTLA 1Z7GA 4G7VH 1RYDA 3I4FA 2ZPKL 3ARXA 1F17A 3V4VA 1EO8L 1KFAL 2F43B 3H3FA 2ERXA 2DQEL 3DTDA 5DXWA 2VSYA 1Z16A 1ZTXH 3WNBA 1U8AA 4FX2A 2F7SA 1CS0A 3WGKA 5ICZA 2L4OA 5CH3A 4LF9B 3M6DA 4U7PB 2ITCB 1MAUA 3VXMB 3CHYA 4D4GA 1WXQA 3LZFL 3VDCA 1G7IB 2JH8A 2ORVA 3TRJA 2QF7A 5EKTA 4PTZA 4XCNA 3VD2A 1P0QA 1R47A 2LW7A 4BNIA 3FU7A 2Z8YA 3AR7A 1AYOA 1OF0A 2ONJA 3GJEA 1OSNA 1RZGB 4Z7NF 4PLOB 1H23A 1G8KA 3MM4A 4FEIA 2CK0H 3W1VA 2PLTA 4OU3A 4PY7A 4UAOC 1MHEA 1PZAA 2W70A 4MYPA 3KT6A 3D6TB 1XSOA 2DSNA 2JANA 4PJXB 1Y3CE 3OY2A 3IIKA 2J85A 2XYRA 5L3RA 1FRNA 5CDUA 1W48A 5JVDF 1SDD