2VDQB

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 130
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdqB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdqB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdqB03
4IXDA 1V7PC 4FWWA 4GZ8A 1JEQA 1T0PA 1AUQA 2UZYB 2VC2B 2IUEA 1MF7A 1ATZA 1U8CB 1QC5A 1PD1A 4PN7A 5KYWA 4Z7QB 1U0OC 3OKWA 2ODPA 3ZE1B 4HQLA 4O02B 3K6SB 5KYXB 1JV2A 1M2OA 3AFCA 3VI3B 1YVRA 4CNBA 1M2VB 5BV8A 4FX5A 4MMXA 4MMZB 4UM9D 5KYYA 3EH1A 3ZQKA 4NENB 1XDGA 1TYEB 3FCSA 4WK2B 1IDOA 2B2XA 3EG9A 1YVPA 1OAKA 4UM8B 3BQNB 1MQ9A 5E6RA 3NIDB 3ZE2B 3Q3GE 5E6SB 1SSLA 3EOBI 3EGDA 1PT6A 3PPXA 1ZOPA 4A0QA 1SHYB 3HI6A 3EGDB 4M76B 5E6UB 1N3YA 2NUPB 4UM9B 5LN1A 1CQPA 3NIFB 1FE8A 3N2NA 2VDQB 1U8CA 4Z7NB 2XGGA 3FCUB 1T6BY 1CK4A 1IJBA 3VI4B 4O02A 2VDPB 3K6SA 3TW0A 4CN8A 5KYXA 3ZE0B 1SQ0A 4WK0B 1L5GB 1M2VA 3TXAA 3HXOA 3EGXB 3K72A 4MMZA 2QTVA 4NENA 3V4PB 3K72B 3V4VB 4C2BA 3GXBA 2I6SA 2P28A 2ICAA 4F1KA 2M32A 3EOAI 4HQKA 4F1JA 3PPYA 2WINI 5E6SA 4HQOA 3NVQA 4G1MB 1M10A 1JEYB 2VDOB 1IDN1 2O7NA 3ZDZB 3AL8B 5E6UA 1RRKA 1SHTX 2NUPA 1SHUX 5HGJA 5KYUB 1JLMA 1N9ZA 3ZDXB 4DMUB 1XUOA 1IJKA 3BN3A 1Q0PA 4MMYB 3F74A 3OL2B 1QCYA 4WJKB 1RS0A 1ZONA 1FNSA 2XWBF 1L5GA 2NVOA 4JX0A 4IGIA 1NA5A 3EGXA 4HQNA 1ZOOA 1RD4A 1UEXC 3PPVA 2VDNB 1AO3A 4JDUA 1MJNA 4HQFA 2X5NA 4Z7OB 3PPWA 3AL9A 3F78A 3IBSA 3K71A 2NUTB 3T3MB 3EFOB 2ADFA 3IJEB 3K71B 2XWJI 2VDLB 4G1MA 3TCXB 4C29A 1JEYA 1M1XB 4G1EB 3QA3E 3M6FA 1OLZA 4C2AA 4WK4B 3T3PB 2VDRB 3AL8A 3OKYB 2VDKB 4O3TB 3E2MA 3EH2A 5KYUA 4WFQA 1BHO1 1XDDA 4MMYA 3OL2A 5ES4B 5KYNA 1JEQB 2I91A 1U0NA 2WW8A 2P26A 1MHPA 5KYWB 5HDBB 4O3UB 1QC5B 3ZDYB 3HXQA 4IHKA 2I6QA 1DGQA 5HJ2A 1AOXA 1JV2B 1MQ8B 4MMXB 1YUKA 3EFOA 2NUTA 4CN9A 1BHQ1 1PD0A 5KYYB 3IJEA 1LFAA 3NIGB 3FCSB 3EG9B 4K3JB 1MQAA 1M1XA 4G1EA 4NEHB 3RAGA 4BJ3A 2VDMB 5E6RB 4XW2A 1DZIA 1M1UA 2ODQA 3BQMB 3TVYA 1RTKA 1PCXA
chains in the Genus database with same CATH superfamily
2BRUC 2DL9A 1U2SA 3CV3A 4MZ2A 2QRKA 2P0AA 9ATCA 1DAOA 4ZUVA 3RB7A 2CBXA 5C37A 1ZP6A 5C0BD 3S2CA 1ANKA 3B53X 1VGKB 4KLAA 5DRZB 5TDNB 1JPVA 3J07A 1XNGA 1SSLA 2L42A 4XWYA 5K8TA 1PR0A 4LIQH 3ZHYA 4EELA 3AM3A 4F4UA 1Z5LA 5BR1A 3V0JA 3IT0A 3L8MA 2WUGA 3R9IA 1NX9A 1CVIA 2NQ2C 3VO2A 3COWA 5DCCA 1OLUB 5JAZA 4II2A 5JPNA 3W1ZA 2ERXA 1G1AA 1WF3A 1CFSA 4JT8A 4A68A 4KJXA 3L41A 3VV2A 1OAUH 4L9DA 3GROA 4AUNA 5FTLA 4FD3A 2R4SH 5LQNA 3ICPA 3H1TA 4PD4K 1A8QA 2RG7A 4RKFA 4FDUA 5EP1A 4ES6A 4U2FA 3RYCA 1TJ3A 2NSJA 5ABAA 1O6SB 4AYSA 3O6FB 1XMSA 2E59A 1D3AA 2NY3B 3DWTA 3WMFA 5IZ4A 1M6UA 3WTVA 5IMOA 4AYXA 4Y4HD 3NMEA 5GZ3A 3UACA 2WM8A 3P20A 4UZGA 1B0AA 3RVXD 1NNEA 4N2FA 4MUGA 1RYDA 5LXTB 3T6QC 2D4HA 3VYSB 2Y06L 1HQRB 4FINA 2HO5A 3HVJA 1RIVH 1ULZA 5E2UH 4FWWA 3DPIA 5KYGA 2QR5A 4ZMRA 3LPMA 3DMDA 1IY9A 3DR5A 1CFNB 1NDGB 4U33A 5EIWA 3FT2B 4G7RB 4NT6A 4X6EB 1WDWB 1J5IA 5KVDH 3ACCA 4MQFA 5IKPA 5EUOA 4IS6B 5KN5B 4HGRA 4J3OF 1TYEB 1L7EA 3C8ZA 4N28A 1FBIL 2ZE0A 4OLYL 3EBGA 5KDDA 4M4RB 3AJEA 4IZOA 3X2SA 1CK0L 1ED3A 2DQGH 2Y76A 1DQTA 1VIVA 3RTEA 2IDTA 3EASA 2KQMA 4P81A 5BSKA 3IDGA 2O6PA 4IBQA 3FO9B 1IE3A 3B51X 2YVLA 5DYYA 4PP1D 2ZPKH 1TGYA 4AE0A 3NC4A 1ODKA 3L8CA 2ZYTX 3T7KA 1A9EB 5TGTA 4P08A 4F57L 4CI9A 1SWWA 1JAIA 2VNCA 1FYWA 1GN8A 4JK3A 1ZCZA 4QYIA 3CAFA 3RX5A 2PV0A 4FQLL 3MUOA 1IFXA 3MRJB 2VK2A 2G40A 1XF3A 3UAAA 1NGQL 1GDHA 2DQEH 3CURA 4KX5A 4QXWA 4PJCA 3TZLA 2DLEA 1LBTA 4QRHA 4QNRA 3HN7A 2VTDA 5D1XC 1TEHA 4J7CA 3CNEA 3EFOA 4QRRD 2OCIA 3WFHB 2DR2A 1GEEA 4K07A 3KLAA 3MACH 1WVZA 1HILB 1S6YA 4KJZA 1V8FA 5DX8A 2ZQZA 1XZ0B 4MVJD 2YJQA 4XARA 3MNDA 1QLRB 4QTHA 4P4KD 1C12A 1KVUA 1E1MA 5LBSL 1AHMA 4ADSG 1LQ2A 2X2PA 3RFRA 3GMOA 2JI4A 4F06A 4PGDA 5IJCC 2P5EA 4W93A 4ZYUA 1ORHA 4UM8B 4ZOBA 5DJAA 5KJ7E 2ZSEA 3IVAA 3VBEA 5LDDC 2C92A 1N6QH 2O8VA 3EDDA 4TYMA 5IB1A 2OL3H 3WKDA 3H9EO 1J9TA 2HX9A 3NJFA 4O02A 2VA9A 5FT9A 2WUCL 1TJNA 4IOIB 5DXWA 5JZ9A 3CDCA 3MIZA 4OZIE 4A10A 3U3ZA 1YAIA 1MJHA 2W0KA 3IJHB 4HAOA 4C0AC 5L7YA 2Q1UA 1OW0C 2HYMA 1P1ZB 4M5ZH 3KEOA 3HM9A 4YK4B 3DZKA 4Z76A 4Z4IA 3A14A 2N7BA 3EGXA 2IK8A 5DQDH 4JYBA 1D8TA 4OF4A 4I4NA 1RUQH 4ARSA 5CIPA 1GUDA 5DURB 3VFRA 3ZKND 4LK4A 3K2QA 5KSBF 3RFXA 2HU2A 4GFTB 2FATL 3EAFA 2IS2A 2X87A 3S2GA 4ZXBD 2DKNA 3QJVB 1VF5C 2BHUA 2H48A 1DO2A 1K6MA 2WG2A 4RFLA 2BNUA 3HB5X 1ML4A 1E2QA 2OYCA 1P4BL 1Q20A 1X5ZA 4RH4A 5HHQA 1DRVA 1FX0A 1K08A 3P9XA 4XE5B 2R0KH 2XTJD 3ZY6A 2GHIA 3CYFA 2GZHA 3SEZA 3RSFA 3S3DB 2LU5A 4PJ7E 4OSUL 2VRCD 3OD1A 3LE8A 1MVFA 1M5RA 4FYRA 2HMWA 3O9WD 4TTQA 4BUZA 4RAUB 4ZRNA 3AG3B 2FQEA 1BWSA 4UNSA 5SWZD 1P5UC 4AG4H 2I3DA 4GOLD 5TDOA 5JMTA 5E5RB 2JEOA 5ISZA 2CHUA 1TRKA 5IAOA 1N8SA 3N8HA 3ZZQA 4GR5A 1OGAE 3ORHA 1N2CE 3OOEA 1PFGA 4TKVB 1W96A 3PP3K 4KRNA 5ALCL 3VQ1C 2SECE 1FSKC 3AF1A 3GPCA 4YAEA 1TJYA 5C0GA 4EFNA 1ZPUA 2XA9A 3KHKA 1SXJA 4KFMA 2MSWA 2X7LA 4FR2A 2QDKA 2W2PA 1URZA 4MUKA 1F4PA 4U1SA 2FF5A 3FSZA 2HKIA 5B1DA 1KBOA 2WMYA 2R44A 1KLGA 2VJMB 3R4DA 2AC2A 1CVRA 3WJAA 3BWEA 5CF3A 2Z6VA 1X7ZA 4FZEH 1T4CB 2C9RA 1NU8A 3O1IC 2FBRA 4B81A 4WXYB 1NBMD 3LVBA 4LLDB 5HBGA 3A3YA 1INDL 1LDMA 1MNQA 3LUDA 4KPHH 4XVSL 5DQ9B 5FK9A 4B3JA 5KANI 5E8PB 3X43A 1OI4A 2J3EA 2WIDA 3FO2A 1WSAA 1UP6A 4IJUA 1K7SN 2Z08A 1BIFA 2XN9A 5T3XD 4WKNA 5LZ5A 4HG4K 5FKJA 2B3RA 2REBA 5ACLA 1GCOA 3PRZA 3H4HA 4WECA 2W60B 4JL6A 1OSNA 3ZKXC 4D26A 1GOGA 5M5BA 2ZWVA 5BR4A 3HYNA 1HX7A 2IZOA 3D8BA 3P9NA 4F58L 3R3HA 2Y1AA 4PJDA 4UQOA 4EI2A 3UTSE 4LVOC 4YQEA 3MPUA 1QFWL 1RZ8A 3H9JA 3IELA 5IJ9B 5EINA 1R8QA 2DMKA 3D59A 4C2UA 1LO4H 4BP3A 4KXYA 4NEQA 3GS0A 4DAGL 5E4TA 2J08A 4I14A 3PXGA 4FNMA 4P35A 4QGAA 5FCDA 5IU6A 1V10A 3ZIDA 4JQVA 1CRQA 4NC1C 1IGCL 1TJHL 4GG6B 3ZR4B 5DUBA 4BOYA 1GGEA 3LDAA 4P5PA 3BBPA 3SE4C 1WIUA 2AZ4A 4QLBA 1A9SA 3ZYOA 3AKZA 4M6NL 1CR6A 4LPWA 3WAGA 2GJ6A 3RL2B 5KW9H 1CQJB 1ZJWA 1UKTA 1JBKA 3UEOA 2MTBA 4QJ3B 3VH8A 1DC8A 1XPRA 2PQ6A 2YUVA 3PVCA 5I8WA 5ADWA 3WK5A 3RIFK 1ZR4A 4MB2A 1ZT1B 1Y1KE 3WN5A 5H70A 3EXHA 2EF0A 2JLYA 4QD3A 4XPIB 4K1LA 1US8A 4C06A 2QKYA 3R3XA 1XKQA 2IUEA 4KBPA 4F2MA 1D6VH 2QVXX 1E30A 1FF5A 2EDQA 2PT6A 4P23D 3A10A 3KLHD 1MCFA 3MJWA 5IC5A 3G6AA 5DK0B 1U2HA 1YVPA 4M48L 4B31A 1T5HX 4F9PA 4V2BA 1AZTA 1NFIA 2J4CA 3VC3A 2GFIA 2VDRH 4XO5A 2VDOH 1EAYA 4E2YA 3TO2B 1NZDA 2GJ4A 2I2BA 1T6XA 4HC1A 5CAEA 5C31A 5CBEB 3DO3A 4DDHA 3WHKA 1OIOA 4NNPL 4KXAA 4GLRH 3VXTB 1UPXA 1BVLA 4R8WH 3QKTA 2VUOA 4DW2H 1E3QA 1X9HA 2JH2A 4PRPE 4XZUB 4R1NA 3V1TC 2Q9AA 1KI4A 1CRZA 1QIKA 3ASNB 3HCDA 2CAKA 4JQOA 2IX3A 2HX8A 3GRWA 4R97C 1YKGA 1PJWA 1DC3A 2FG7C 1D9KA 4PJ6A 4JY6B 2ZYSA 1T3TA 5PCYA 3JVGC 1INLA 4CM9D 5CFZA 5EIIA 1RIFA 2PVSA 4FW8A 3DGFC 1BMZA 1TM2A 4QOIA 3DZIA 1I10A 1SULA 1DL7H 2WXGA 4OFYD 2ZDQA 4FMBB 1LSUA 3L9EA 4JUBA 4YHPA 1L4KA 3EYSH 1I1YB 3VRHA 4HEJA 4YA6A 5IVXA 3VTAA 1FVHA 1LX6A 4XM2A 3ZIYA 4GLFA 1EHYA 5CEZD 4M8KA 4BNDB 4IQHA 3IP5A 4FKZA 1A82A 1YZHA 2ZUEA 4FPXA 3DROB 3ILYA 4H0CA 4GOOD 2WLJA 5L2JB 2IQ9L 5EJIA 5EORL 3PC6A 4KO9A 1A6WH 1JGLL 4NBLA 1GHFL 1D0SA 1RYYA 5FTWA 1JD7A 2JNWA 5GRYA 1O9GA 4L0PB 3VVBA 2OY0A 3RUDA 1RQRA 1T5KA 1JA1A 3T9BA 1DCKA 1BQ4A 2Q5FA 4UM5A 1U6IA 5HIIA 1PDOA 1GAFL 3VFPB 3MV8E 2JB5L 4A6YB 2GYSA 3TOCA 1NN3A 2X8JA 5CEFA 4QJIA 1GUBA 4ALIA 3CS3A 3EFFB 2FR0A 3VSAA 3VXUB 5AK6A 3FQXA 4K5PA 1V3VA 5IMLB 2R1TB 1IBYA 5DJZB 1JWSB 3ETNA 2F8MA 4WZAA 4HQKA 3VSEA 4RESB 4KOEC 1IE5A 1K4YA 1U6JA 3C6SA 3KJXA 1BDMA 2VXSH 3DZGA 4JGBA 3V2HA 1VB9A 1U8PB 3QHPA 2H7CA 1K98A 1KK1A 1ZN2A 4P4UA 5K01A 1IAII 3COVA 2OBNA 1K5DA 1GPUA 2IX9A 3GXUB 3PWVB 1SXIA 5K9OA 2PO6D 2YVQA 6FABH 1QYXA 1IBLB 2GK4A 1OASA 5EXDA 2GBAA 5C0IB 2BMJA 4GRLB 3VACA 1SJHB 1ADFA 4JJKA 5BVHB 3MYYA 1KB3A 5TQ0A 2V0CA 3STZA 2ZCKH 3CMGA 4L1SA 1TUGA 3VX3A 3GFSA 2M83A 4Z7OE 1A3RL 3ZKAA 4YQFA 2EECA 2Q2EB 2HREA 1A72A 4P7JA 1OFUA 2ZXBA 3RJDA 4BHUA 3PUKA 2LU7A 2GTWB 1A6UH 4F8OA 1LWOA 3V1MA 1MDTA 2Q27A 4JBGA 3HUJB 4PZLA 2EFEB 1J2JA 1C50A 1D4FA 3DXAD 4I99A 2ZIAA 4J0CA 4AZTA 3MRQA 5DYFA 2V6IA 4ZJYA 2RCSH 3FWKA 3THOA 3A3PA 1UBOS 1VL1A 1DU4A 3GUUA 4JT9A 3GPLA 3GRCA 4Q9DA 2DJIA 2OJEA 1R5OA 4XDZA 3TRJA 1LTXA 3VRLE 4YCCA 4G0NA 3T5TA 2BM3A 1HZHH 4W4OC 3L4VA 4HFWA 3ROFA 3BGAA 4YGVA 4Z95L 4FMDF 3WO1A 4JUDX 3FB8B 3U40A 4B3FX 4GI7A 3LKQA 1GR0A 2BLLA 3B52X 3BFOA 4M62L 1M3IA 3BREA 1XB8A 1MI5E 2Z6AA 1B73A 5C07D 4ODSH 1TLFA 1GL3A 4N2GA 4O02H 2WQVA 4HDRB 2DQCL 4YNYB 2WLHA 3RY4A 1L9OA 4YHZH 1NC3A 1E6OL 1QBML 4Y2UA 3DE0X 2VITB 1M76A 4OQFA 3PYCA 2XODA 1X7QA 4G7VH 2NY6B 4XBEL 3OSKA 3SG0A 3P94A 4UREA 3IAM6 4II7A 1GSOA 3BUYB 3KPPB 2P26A 4ZVMA 3OB0K 3LUAA 4DBLE 3NFPA 4U1LB 1LS6A 3R0QA 3VPGA 3S37L 3ZOKA 4Q7JB 2ZI5A 2FGWH 4BSVB 4NC2B 2C5SA 3QORD 1WB6A 3SYMA 3ZJ5A 1J8HD 4PC1A 4G1EA 5D1QA 4JFYB 1VKHA 5CIPH 3KR0A 4DQVA 4CJ1A 3OKEB 1BYOA 1FFQA 5LLDA 5JHDD 5M7QA 5F3BB 1FGNH 2WQ6A 1V1MB 3BTUA 5HKKD 5CXXA 4WUUD 2EKZA 4AITA 4NBKA 1QW9A 1OX4A 4WTZA 2GN0A 1ZSDB 1NM5A 4YJ3B 3GP8A 5E95B 4IYJA 2BVOA 2XXGA 3H11B 3T3NA 1VPTA 1QQTA 3IDIB 4XTRD 2ZE8A 4HDMB 4G8EB 4TRRA 2DWEB 1X9IA 1A76A 2CLDX 3VM7A 3BUIA 5BVPL 4HIEA 1N7HA 3QQ9D 3AY4A 4UNUA 3OZIA 4APQB 1FFOB 4AMKL 4CFZA 1OF2B 1SXSA 3FY4A 3NOXA 2F54A 2PUCA 2ERYA 3HTLX 5HYJA 1JMXA 3K05A 1JOIA 4POZD 2FB4L 4ATTA 5DJ6A 4OAQA 4LDEB 4FNQA 1A9RA 3L79A 1L4BA 2J6EL 5AKTA 1V39A 4B73A 4UQ2A 4AN1A 3JXAA 3OJ2C 1AMXA 1W4LA 3CLTC 4IZIA 1GTNA 4UCXA 5B6JA 2BNQA 2GJSA 2DQYA 4PYLA 5BSHA 5LCXA 4B96A 5GISL 4AM0B 3C2AL 2O0LA 3TQIA 5TPWA 3BLKA 4R9SA 3HRPA 4PJ5D 1UXOA 3ONVA 2XWXA 1L4LA 3SBXA 2VUTA 4CODB 3FZNA 3SDAA 1F7UA 1RCUA 1EDEA 5KYYB 3LBIA 2JARA 1IGJA 4Y6RA 2V3EA 1AQDA 3QDJA 3LN9A 1IBSA 4I4TF 4RACA 4K8RC 1DKLA 2WWTA 3AU8A 1QYWA 3RYHB 3G6JE 2CJUH 1DBAH 2JFNA 4R9HA 2P2GA 2WOJA 4LESA 4NN6C 1MRFL 2K0RA 4BEBA 1HPLA 5CX4A 3AP1A 3IKCB 4QT5B 4GZ3A 2VM9A 1Y6QA 3NFRA 5GM2A 1CUOA 4OZGB 4FKHA 1AU9A 2ZYAA 1R5VA 3H55A 1P2GA 1ZSNA 1I4OA 2Y6SD 4ES8A 3RNKB 4HWZB 1COBA 2BSTA 2JVJA 3TMKA 3NGBB 2BHNA 2X13A 5REQB 3KQTA 2NVUA 3FU8A 1AFVH 2OVFA 1T5XA 4TLBA 4FQJL 3LB6C 1PNCA 4PLJD 4DC9A 2JEYA 4W6XB 3CDYA 4PIRF 1AP2B 3QWOB 4PY8J 3V8CA 1TX4B 2AOXA 3IKMB 1DHRA 4JKYA 3ZZUA 5BS0D 2FPSA 3H7BB 2F8SA 1JHMA 1UEXC 2QENA 4RSHA 2P1YA 2IYYA 4NF2A 1BC5A 1L7IL 3RK1A 3FU6A 2HUEA 2CXHA 3P4OB 4HADA 3WK4A 2JJMA 3CPJB 1SQ2N 3HSKA 3ZIAA 3T0EE 1LTHR 4J49A 3AAZA 2P9ZA 5IT0A 3PCTA 2J88L 1CMOA 2FN8A 3EBLA 4XLZA 4QGSA 1RPTA 5E2VH 1XVSA 4Z78A 4GS5A 2FSVC 4KO6A 4KJQC 1A7NL 4BH7B 4UEQA 1E98A 3JRNA 1HQKA 1Z4OA 3RFCA 3H7AA 1PX8A 5BV7C 1H5UA 1LPMA 3CCFA 5J9PA 4WKZB 5AAMA 3C09C 3CXDH 1P2DA 1SEVA 3NC1C 1SA0B 2UZIL 2EH8L 4H9GA 2LDBA 5CGQB 4CGZA 3DBXB 2RHMA 4QGTA 5DT1L 2BV3A 3W11D 2Z92B 2BY3A 3BC1A 1O3YA 1YEFL 3QPDA 4NABA 1BD4A 1MEEA 3SF0A 4Q1CA 2HQSA 4YGAB 2PUHA 2P6UA 1WUJS 4X99A 2HXGA 2XKBA 2AJZA 3G04B 5FXMA 1CICB 2CFSA 3V4UH 2I69A 1FJ1A 1NYTA 2QTVA 3HJHA 1VGQA 1HYGA 3SPVB 3ILPB 1OP3H 2BCKA 5EEUA 3WJMA 1ESEA 3HNVH 1K86A 3S8FB 2H2SC 4XVCA 1CQXA 2OD9A 1UAYA 4IRJB 2R0LL 3DDFA 1I6KA 4JFPA 2ZT7A 1K4DB 3KHQA 3THWB 4RK0A 1UMDB 2NUBA 2RHDA 1SVKA 1G20A 2NAPA 3SBPA 4OU3A 2E2WA 1L5HB 2GQHA 1NDHA 3OQVA 3W57A 2NXJA 1XHHA 3S5JA 4ZRGA 5IW1A 1AOHA 1BOFA 2F9LA 4F6RB 5LCVL 3ZL2A 3ZHZA 4IRSA 1WT5A 2E8YA 3APMA 3GZ4A 4B9FA 1ODLA 1ZUIA 2ZAOA 2BFEA 3I5YA 1DKRA 1SEQH 1I7RB 2FX2A 3MA9L 4M38A 4PJ9C 3U9WA 1E3FA 5KYWB 3ULUC 1P44A 2GD1O 3DCNA 1IXKA 4RISL 1CC1S 3CIOA 3NTVA 4IDCA 1X15A 3P3YA 4WEOA 4FFRA 2Z58A 3FSGA 3KPNB 2C1EA 4KXFB 2DAPA 2X4RA 3JBG7 4E88A 5DR5L 1IHYA 2OORC 3UW1A 3NWOA 3LRTA 2GA9A 5B1BB 3BKWA 3QI9A 1NM4A 5JO5B 4XVUC 1J5PA 2OCDA 1E9AA 4NCNA 2J31A 3PL6D 4MIEA 4KHXL 1XDGA 4YNBA 3SPIA 1MB3A 3TL6A 2WI8A 4MGZR 1T66D 1X5XA 5LWHA 3LS2A 5AB0A 4XGIA 2WIIB 1S7RB 1NFFA 1RJYA 1Y1QA 4W9GC 4JVSB 4QUKA 4XCVA 6LDHA 1NW8A 4NZTH 1YMMD 5GS0D 1RUPH 5JAUA 4LKRA 2N0KA 1YS4A 3JWOH 1CNEA 4N0QA 2V2WB 3WEXB 3ZQ6A 4TTRA 1G7MB 2B7LA 4L6CA 3FRUB 2YOGA 1W2HA 3G59A 5A0FA 2V1XA 1YN6B 2NTNA 2PX8A 4TSCH 5HOEA 1CDOA 1NKTA 4K5NA 3LPFA 3U4BL 3TF5A 1NVWQ 3ZTDC 2HQRA 3M82A 5EEGA 1XIWC 2ZJBA 1AVTA 2D7CA 3Q2VA 4PG4A 3RVWD 4UARA 1H23A 5FL7D 4RBPH 3NFNA 4NIMA 4K71C 3EYQC 1QOZA 3FB7B 2PD4A 1HXKA 1UZLA 1NRWA 2AYYA 4O3UB 4ER3A 1SKQA 3A9CA 3EXG2 3IURA 4BKMA 2C9UA 4GPBA 4X7TB 3TV3L 5E38A 4DVRL 3QQ3A 1P17A 4MQLA 3VWJB 4AJJA 3BEOA 2C0CA 1U31A 1PBYA 3CE6A 3CUEF 2EHDA 1C80A 4JM4L 4MJHA 4INAA 4D0SA 2QNIA 1ULVA 2MPAL 3SE8H 3QI7A 2HJRA 2XBTA 1A5BB 5A3RA 1U28C 2FEXA 2J9FB 4QOGA 2RJ3A 3QDMD 2HFGH 4HO1X 3SQOL 5IVZB 4W1TA 4MJ6B 1MC5A 3RRJA 1AT1A 2AJVH 3NA4A 3FHTA 4PJFA 1E9VA 4P5MA 3MB8A 3QIWC 4WHYG 2QLFA 4XCXA 4Q58C 3OOWA 1HLPA 1CP3A 4Y2NA 4O29A 4PGFA 3T0GA 5L7XH 1FDRA 2HJHA 1PAZA 1SD5A 1Q1BA 2DT5A 2VXOA 3ULKA 4AK9A 4HSQA 1KA9H 5D5MA 1KBPA 4ZO8A 4PC2A 1EHCA 1N3NB 5FA4B 4POYA 3DTXB 1AKQA 4X0NA 2X53A 2IYNA 3RHFA 2OULB 2CJYA 1KB5A 5C4GB 3ARGA 2AV1B 1EFCA 4MUNA 4JHUA 3QIVA 4FK8A 1NFQA 3M5DA 4C4AA 5DO8A 5LXTF 1L6PA 3P2IA 3FHAA 3G5LA 3MJ9H 2KZWA 2WBJC 3KR9A 4REMA 3ZJ4A 1E7RA 2YUXA 3R4CA 3M17B 1RI5A 4H4EA 4FA8A 3EB9A 4LVNC 1Z2NX 3FR8A 1WOYA 4RPHA 1A5TA 5D01A 1MKYA 4GIBA 1D5RA 1KDRA 5A6LA 1QPKA 4RQAA 4A6YH 2KERA 1NIDA 1J0JA 4Y4FA 4ZWNA 2YKGA 3BWBA 1XWWA 1U4SA 3B9KB 3WSQL 2OXRA 4JR0A 3BKYH 5TQ2L 4BFIB 1LPSA 5FBWB 3GZKA 2VSMB 3WXVL 4FZ8L 4Z2YA 3L4UA 2ZBFA 1RXLA 1FB5A 5I17A 4KH2A 2EF1A 4H59A 3WMQA 4ZUUB 1MJUH 1P7KA 3IKTA 3UAJA 3NRQA 4BASA 4OQTA 4JVWA 3JWNG 4P4LA 5C08E 5CCHE 4FNLL 4UE6A 2ZB4A 1P0SE 4OFQA 1AHHA 3S3BB 3ZSTA 4TYYA 2ZRCA 3AC0A 4UXHA 4E46A 3F7OA 5I6OA 5H2BB 1EEYA 1R3KB 4XHJD 1ZIDA 5DDIP 2DQKA 2AJSL 4KMSA 2DYPB 2PD3A 2J85A 2I3ZA 4N0CD 3RV3A 5B64A 4RMUA 5G41A 4Y89A 1CFTA 4U0JA 4FCTA 3NSXA 2EXTA 3ASWA 2LD4A 4YSRA 3C3EA 2NNRA 3ROLB 2WHVA 4EUKA 3CFUA 1V3QE 4GG8A 5FKPB 5T33H 3DZ8A 3UROR 1VZ3A 2IXGA 2DE0X 2PW2B 1M9NA 1UB5B 2KB0A 2FPXA 1JAYA 1W2WB 2DBRA 2ZB8A 3CF6R 3M3HA 1I7UA 2X70A 4OHKA 5I9SA 2VRNA 3RBXA 5C5EA 5LIPA 4LMQE 4AX3A 5AB1A 3TS1A 1GDTA 4KDVA 4F7PB 2AW5A 5TPWH 3HMKA 3LPAA 1R5IA 4ZT5A 4GO6B 3THRA 3QULB 1GZHC 4OZIB 1QRND 3TT1L 1ZWIA 1NBQA 2VJDA 2PUGA 5F89A 2Q3CA 1JBQA 5F6HJ 1L5NA 3K8MA 1E43A 5JHBA 2OSBA 2Q5EA 5JHLL 5IASA 5MEQA 4FDWA 4PCVA 2VH2A 4QTYA 1IM9A 4LHUG 3QYJA 5ENWB 2ZWPA 4NZFA 1GIAA 2PR9A 2P2DA 1ISPA 4NYJR 1TOAA 2RAPA 4TKUB 5TF1H 2H1LM 3W2EA 1T21A 4LRIA 2H2IA 3IQEA 3RPEA 1Q1PA 3QLUA 3MRBB 3Q7QA 2WLYA 2LFEA 4TWJA 1RP9A 4QHNA 5HF6A 4AZ3A 4D79A 4S2EA 4US0R 3BWAB 4KRLB 4HDIB 5JCOA 4Q12A 3QGVA 2RGRA 3FCTB 3HXMA 1UOEA 1PGRB 4YP0A 2DEYX 2B1AL 1AQNA 2OJZH 4BSWA 5CSZB 1UT2A 1UM9A 3BO8B 4JY4A 4PJ7B 5DJYB 2Z6FA 4NK4A 4PS8A 1EVIA 4U4BA 5I74C 5AW1A 4LYJA 4KV5F 1P2SA 1EINA 2H52A 2AK4E 2EP6A 3AERA 3THYA 5D72H 3GSNL 2LCFA 5CLQA 4KFSA 2FLWA 3KO8A 1OGAB 5KYXB 1N2CB 4ZO4A 4HEHA 4B0PA 4FQ1L 5MF6A 2R2EB 1XWFA 4N1CA 5HDRA 4JC8A 4ZMTA 2UY7A 2VISB 3W5UA 4P8QA 3T3IA 3W7VA 4N5DA 4ERNA 2MSKA 4PEEA 1TKRA 3CFBA 3AF3A 4TTIA 4YC2C 3WA7A 5K3EA 4H8PA 2J0UB 3R7SA 1LM8V 4A2HA 4BNKA 2QTMA 5EHFA 1I6WA 1B0GB 3O0RL 1WO2A 3GFRA 4DIMA 4BB0A 1CD8A 2OXGB 3H3PL 1YEIH 4OP1A 5DK3A 4DN4H 1K8QA 4WEUD 4MMYB 2WIFA 3KALA 1GT91 3VKFA 2QQLH 1GYVA 3M6MD 2JFZA 1Y7HA 4JDUA 1D6NA 1YRWA 2J48A 3WL9A 2Q5OA 3AL9A 3M89A 2J3KA 3V1YA 2HM7A 2R47A 3M45A 2G67A 4W9FC 1XDDA 5F1PA 2IXQA 3GF8A 5IB2B 2PMFA 1XZNA 1QFZA 4NV1A 2QUJA 1EUQA 1DBQA 2WKLA 3IB6A 3UEZA 3CQ9A 1G3IA 3RGVD 3CWQA 1G7SA 1CRPA 3LKVA 2PLWA 4U6HB 3RIYA 1Q77A 3AESA 4WDRA 5FOTA 4M87A 2DQZA 3V32A 3J7TA 1QO3B 1UIMA 3UTSB 3P26A 3QWQB 4CVXA 3LZOA 2HT2D 2DJ4A 1AGBA 3GFUA 2OSWA 4BL5A 2I4MA 2IZ7A 4HF7A 1ZAYA 4JANA 1Q4NX 4MW7A 1JPSH 4XOAA 3ZVRA 4HMQA 4RY9A 4KXQA 2HV9A 2CGRL 2CQVA 3EYOA 4R8LA 5IC6A 4UJ5A 4R4JA 5I8KL 2VTKA 1E6JL 1EDOA 4CDGC 3VNBA 2QELA 1YQVH 3ICQB 2P8JA 3ABOB 1L6IA 4MKTA 4FEYA 3SMQA 1RYNA 3RWJA 3ELDA 4I1UA 3GLIA 3BP7B 4X6LA 35C8L 4G09A 4GG6F 5FDWB 3JAKA 3RTAA 4ZI8A 4KBFA 2FHSA 3CWGA 3V4ZA 1NPYA 2RARA 3MBWA 1R6UA 2C3MA 2UVPB 3BE6A 5GZOC 4JFQB 4V1CA 4CF3A 3RRNA 2MCPH 1J8MF 2WCGA 4IBSA 4ODWB 1RRFA 4C6TB 4LOHA 5AK3A 1WP6A 1PWZA 1V8BA 4GNKA 5DGTA 5CFOA 5EZJA 4MX7B 1HT0A 1FG2A 4JJAA 4MCIA 5GADl 1CDDA 4N20A 4Y1GA 5JJIA 1PLJA 4TMXA 1G4UR 1V2GA 3WYCA 1ZPLA 3Q98A 3VYUB 1BQKA 1CL7H 1FO0L 3N1FC 1ECBA 1XEXA 1SBHA 1NQUA 3O3MB 5A3IC 3F58H 1K2VN 3R74A 3HNPA 4MA8L 4G9DA 3RZCD 4KJWD 3OKYA 1VRVA 4H8WL 2MOGA 3SC4A 2FSFA 1EUDB 1FUEA 1RC8A 1A6AA 3N8IA 4FQXD 5EVJA 2Q8AH 3S5LB 4MAYD 3SDCA 2C1PA 2IEYA 2Q4OA 2YWCA 3ANLA 2FE0A 3JWHA 3MK31 3TOPA 1MFZA 1KIPA 4PRPB 1CQKA 2A6KB 4V11A 4J3NA 3JQGA 1CY8A 1JS4A 3A6OA 2ST1A 4BCCA 3TZEA 4BV1A 4L3AA 1RZVA 1YQDA 3PQYA 2I60H 2OWEA 3RRFA 2YGPA 2YRLA 5JAOA 3BESR 3T1WA 3QIBD 3INGA 1W19A 3ATDA 2ES4A 5E00B 3AM8A 5B4TA 5C51B 5AYUH 3IUMA 3G13A 3F6YA 3HZVB 3E6HB 3C6MA 1T1XA 1BU8A 4P46D 4M37A 1R6BX 4F11A 5GJSL 2P79A 1SUCA 2A0UA 3HKBA 3AS2A 4G8GA 4MK4A 1ETZB 2VDLB 4MNHA 3OEHA 4MYSA 3BH9B 2I9LA 3ME0B 2Y2VA 4D96A 4YDKH 2IPNA 3L77A 3B4NA 4X71A 4F8PA 2BIMA 4IOFC 1RU9H 2M8XA 2WM9B 4IIJB 3NHAA 1CBJA 1DARA 5GP1A 1JAXA 3FQWA 2PR4H 1DIRA 3EN0A 3MBEA 3CMMA 4N8PA 4IK7A 3MV8B 4OCYL 1ILEA 2WWYA 2VERN 2JGFA 2ITDB 1I0IA 5C0DA 3T4YA 2CK0L 1P6QA 2W6JA 2UXFA 3NNSA 3WNLA 5I7AA 4PGGA 4BFTA 4I77L 5DHVB 1ITZA 5J9FA 4WOBA 5CWSA 4BDVB 1W6RA 2DB8A 1WKCA 1TJGH 4NPYA 4UYQA 4EPXA 4XVHA 4XX1A 1KTBA 1KXVC 5B7FA 5FR2A 3L16A 1H2FA 4TGLA 2QR0A 2IAND 1KTRL 5KBLA 3E22B 3V4PB 3ZKWB 1G7HA 5IDWA 2GTHA 4RD1A 4NJAL 2HT4D 4YXHH 5AD0A 1CPUA 3RX7A 1U8YA 2FPWA 5FOWA 2G07A 1QQBA 2NCMA 3EF1A 2APTA 4DDUA 1EIZA 1WUZA 3N53A 3RD5A 2BCGY 2QP4A 1GFWA 3D6AA 1RWOA 1NPNA 4Z7OB 5A5EA 1KK0A 1XD8A 4YXWD 2WQSA 1QUPA 3I8SA 3HBMA 5G0UA 5KVMC 1P91A 1M1SA 5FDYA 5DMGC 2IG2L 3C24A 1KDIA 1XH3A 4QYSA 3KEGA 3UJ3X 1Z08A 1KXQA 3SEQA 1EUUA 3HUJF 4P9HH 4OXXA 1BU5A 2B1HL 1M83A 3DMFA 2FWUA 4WUVA 1EFVA 3IE4A 5KBMA 4Z51A 1DANU 1TNDA 5DNAA 4XN9A 2HF9A 4MQ4A 1D1TA 3P1VA 1OUMA 4UHKA 5EE0A 1IXRC 3W79A 4B45A 5B38B 2OCJA 1VJ1A 1UM8A 1HT2E 3B43A 3WLMA 4KMTL 3BJRA 4WH0A 1Q95A 4FYWA 1KY7A 1KFJB 3TFWA 3RVTC 5KSBA 3V1LA 3H05A 1FYHB 3NAQA 1Y37A 1KXJA 2XDWA 4PG7A 1AXTH 2OECA 4PTTA 4FEIA 3IHKA 3UG5A 5BQDA 4KDEA 3UF0A 4XWGA 2WXPA 4QGYA 1YKFA 1MI5B 1WA1X 3FUEA 3I01M 3QUYA 2B6HA 1ID8A 2XMRA 1MB9A 1C7QA 3S2EA 2DZEA 1MG0A 1SCKA 2VHXA 4E2WA 1TUIA 2OXCA 1L9RA 1N6PA 1XZAA 2ZIXA 3ZRCC 4MR9B 3ZJVA 2ZYDA 3WSWA 3DURA 1N92A 2UYQA 4XAWL 5ABPA 4MR7A 3FKSD 4ANFA 2AQSA 4WQOA 5IJWA 3EYUL 3I9GL 4KO5A 1RPUA 3X1KA 5EJ7A 3GEMA 3AADB 4LEBA 4CQMA 3DZJA 4TS1A 2B2XL 1P5ZB 1QBGA 4P5EA 1U21A 2I7VA 3OZDA 4ZK8A 2GOYA 4JN1H 4BZ2A 4H20L 5JYBA 4ZAKA 2X9ZA 2IZZA 2ZRMA 4AZSA 1Y9ZA 5CUSL 4OZ4A 3TBTA 1GGIH 2XXFA 2W92A 1I2ZA 1DJOA 2RKWA 2J25A 2EWMA 4I55B 4BZYA 1XEWY 3GMQB 3FSWA 2OT3B 2H5EA 2HJ9A 2A6IB 1CV2A 4G4SP 4G0MA 1M1XA 4U2BA 3DBRA 1IWOA 2A67A 4YJ3F 4V0KA 3MRPA 3ISYA 2RAFA 2X76A 2F8XC 4BXVA 3BZ4A 3HFRA 2NW3A 4MPDA 1XKXA 4JLPA 2J41A 5A03A 3AHCA 4D3YA 2B21A 3C3CA 5I1LA 2EO1A 2G4EA 3PXHA 4A27A 4B6QA 3PGCA 3CBJB 4HEMA 1TL7C 4CJXA 1FL3A 4TRPL 4OM7A 2Y2YA 5FO0A 4S35A 2VWPA 5TK4A 5I24A 2PQ0A 2EX1A 1QANA 1SBZA 3PKIA 2VF7A 1RKBA 4XH2A 4LV5B 2ECPA 1QGYA 4NCKA 2ANBA 2LABA 4AENA 1CHNA 3OMNB 1OM3L 1N7JA 2VI5A 1NPDA 1BD3A 1NMCC 3I2JA 2BPOA 1LBHA 2VLKA 1URLA 5ALDA 4XQCA 4LSTL 4IZ6A 4ID3A 3HABA 5HGJA 3OKDA 4K3HA 2VTEA 2REQA 1AE1A 5AW7B 4ARZA 3C6XA 3JV7A 1J8SA 3DMMB 2B8JA 1BOOA 1ACYH 1P5HA 4RTKA 4JDZB 3IXMA 1RZKH 4L4TE 3OPYA 1W75A 3REGA 1FFSA 3THXA 4YCNA 2GJ8A 4LXTA 4GBXD 1GCAA 2ZJFA 3G0BA 2IPTH 3G6JB 3H9HB 1E58A 1FV1A 3R4RA 2VUHB 1F3DH 1IHUA 3ZPXA 4EKXA 3AYXB 5AW4A 1CYGA 4AL8H 4RVNA 5B58T 5CYPA 3D81A 1T2AA 1YS1X 4NXKA 5F76A 1FPTH 1XJ0A 3PFHA 1BF5A 3A6FA 5CILL 3IIEA 1KOGA 4OZGF 4MROA 1ZG3A 1YJBA 2ZR8A 4BYMA 1MB2A 2YPKA 1WLYA 2WTRB 2PS9A 2NWQA 1DBML 3IETB 2O2ZA 2ZKHH 3I6ZA 2DQTL 3FJOA 3EOTL 4A0HA 1ICIA 3D3NA 3HHSA 4L8SA 3EGDB 3RVRA 4JK0D 4RJKA 1RXYA 3WKYA 2P5UA 5AW0A 2H32A 1HRDA 2XG5A 1OAYL 2X2UA 1NASA 2NY4B 4MQ6A 1ACJA 3M5CA 1A95A 3UHFA 2Q4EA 2AZMA 3FWNA 3BXNA 4EECA 3KYNA 4EAQA 3AONB 3GMIA 3OBAA 1ZMBA 2XSZA 5ITBL 3CZMA 4MVJI 4NI6A 3T0EB 2DTSA 1LNZA 2ADGB 4JO2L 2ACWA 4CM4B 3UWMA 2HFEB 2Z93A 2YZKA 2XCSB 2JAHA 3CC5A 5AG9A 1DPFA 1GWNA 3A0UA 2EIHA 4FHDA 4I7ZC 3QEHB 1MCDA 1THMA 2GC4C 3ZJYA 4D6XA 5FUOH 1YZGA 1DEEA 4KQ1A 1UBJS 1RD6A 1ATIA 3EYAA 1JILA 1S8NA 2CLHB 2HVKA 3EO1B 3CVVA 1RAAA 4CL7A 3TD6A 1KJWA 3MV9E 5TRTA 1TYRA 2E9JA 2NT3A 1DELA 3FGOA 3NHLA 1NMQA 1RLWA 3ABQB 1JD9A 5C46F 4PTZA 2VEOA 2B4YA 2QVBA 1HFUA 3C60C 4GQQA 1YDGA 3F3KA 1ISIA 2BOBA 2OCLA 1HH9B 2R6FA 3V0AC 2BH9A 1R9FA 4M5YH 1HT3A 3JPYA 1MN6A 3PNYA 3ROQA 2WPDD 2WVGA 2XUAA 3NTXA 1HU8A 3RVOA 4QRUB 3BTOA 4W8HA 1JYSA 5B58C 4OLZH 3DR3A 4U1IB 3DRQA 3WICA 5B39A 2NNAA 2B9EA 4N41A 2AJTA 4HWSA 4AV0A 2FRXA 2ZIEA 4A8HA 4PB0L 3FH7A 2MINB 1R8XA 5SV2A 2C8KA 1EIBA 4R0LA 2F1KA 2WWOA 1EP9A 2FJHA 3U82B 1I6MA 5GRVL 3B38A 4UF7C 2EKSA 2SEBA 4CN6A 1TADA 5EWJA 4WBXC 5E9DE 2P5WD 3WI7A 1Z7JA 1OLSA 4ZO7A 4RL6A 1RZRA 2R8SL 4KKNA 4NKDB 1WYJA 1NLBH 4HBQA 1LEIB 1KY5A 4MS3B 1HA3A 4UAGA 5JQGB 2OFPA 1HE3A 3JR3A 4R4ND 1EO8L 4R9UC 1U0JA 4MKFA 4R3WA 1SXAA 3STLA 3O03A 3KWVA 4EHIA 1IB5A 3R06B 1Z8FA 3UN1A 3N2GB 3U0BA 3VYNA 2ITEA 4J3OH 4W9ZA 3CRVA 2V7HA 5HI4D 5BRZE 1D9ZA 5DWPA 5CXUA 3CBGA 5DBEX 2X4PB 5DHXB 3M6AA 4FZ5A 2JCXA 1NN0A 2C9QA 2VWEC 4DM4A 1KYZA 1GSAA 1X2BA 1OI2A 2Y23A 1GFSA 3DKKA 1OD6A 5I9NA 5HOQA 4JP5A 5DT2A 3RIGA 1CY1A 2ERJB 3KEFA 3TXXA 5HCIA 2WP8J 2YWDA 3UTTD 1PZXA 4Q9RH 1VSVA 4QNPF 4TQEH 4LDPA 5LVAA 1HQCA 4DMRA 3FYTA 4OFDA 4HMOA 4BECA 5D1XD 3D7MA 4EPVA 1SBTA 1N57A 3FQTA 3VXPA 2V55B 5LMCA 1JKFA 4JY5H 2L2QA 1KORA 1WDTA 4D80A 1B0RB 1LI4A 4N8VB 3PJNA 1VDMA 2X1VA 5JRDS 4M5SA 4P9NA 2CO3A 5LP1A 4PP2A 5AUMB 2WIAA 4QYTA 1W48A 2WAAA 3OCCA 3CISA 3PHBE 4QPEA 3V9AA 4FQIL 3CMOL 1FC1A 4J8RA 3I75B 4YSTA 4TUJA 1G9NL 4IFIA 2YRBA 2HB0A 4FF9A 5LQRA 2VNIA 2VL4A 3WIHL 3TIVA 1MG3C 2OL3A 4P2RE 1TT7A 3HXTA 4KX8A 4OA8A 4ZFZA 2I91A 3VD1A 4TXLA 3ZHVA 5F96L 1JWMA 4YAFA 4FYHA 4JDTL 2BD0A 1NR7A 2VDWB 3AI1A 3QJ5A 2COQA 4I4WA 4XX0A 2OQ2A 2R86A 2WTPA 5JNWA 3OQIB 3HYTA 2AXEA 2JELL 4F2DA 1PCXA 2FQFA 4KZDL 2J3DA 1IM3A 2V0AA 5ADOL 1IEQA 5J06A 4YHIB 3RG1C 2G77B 1F11B 1L7OA 3OFVA 5B7EA 4I0PB 5FM8A 3ROPA 5C0CA 3ONWA 1N9KA 2P69A 4TXMA 3T6XA 1QFPA 3A4AA 4DR1B 4OK6A 4FE7A 3KW8A 3U7YL 2WB4A 4FHZA 1IC6A 2ZCVA 4KJPC 4Q02A 2FEPA 4ZFFB 1NGZA 3EHBB 1NRJB 3GVHA 4EHHA 1JRLA 2IWEA 3OJMB 1FZJA 4YEFA 2IODA 1EFTA 3A2KA 2YY6A 1WZCA 2QSTA 2ALWA 4JQXA 1E0OB 4QIHA 8GPBA 4HN2A 2FPIB 2VDLH 2GH1A 4OT1L 3G85A 2XCTB 2GTZB 4NK5A 1XL6A 2VPTA 3GWJA 1JP7A 3U39A 4WLUA 8MHTA 1P9MA 3K1AA 3N2IA 4EF3A 2R4RL 4WJKB 2YJZA 3ENQA 4FYKA 1MZPA 3CRMA 1H6CA 3OMAB 2Y77A 3B85A 3JV4A 1BE8A 3CMCO 2FHFA 4HKTA 1A8JH 3DI3B 2D1QA 4CC4C 4LASL 4Y9SA 5KX5A 3G08B 3IBEA 1D5IL 3D31A 4F5WA 4W82A 1KCRL 2IOYA 4CW1B 3UB2A 4EVQA 1F6WA 4OI1A 3W2GA 5DSCA 3O2DL 4CBPA 1S7QB 2HL6A 1S7TB 2KPNA 4Q4HA 5DHVH 3GZTB 1QG4A 2JFWA 1JIBA 1U1DA 4AICA 5DI3A 1IQDB 1I7LA 4LZJA 3RIXA 1XMEB 2JBHA 4FYPA 4FG6C 3IVMA 4C1BA 3HDHA 1UWCA 3T6VA 2IGFH 2O3QA 1V3UA 5I9BA 5EJ9A 4XNZB 2X1LA 1U33A 5C08B 4U3JA 1GXSB 2CXQA 1XF4B 3N41B 3FB5B 4A2LA 1GIGL 1C1XA 5HCNA 2IPAB 1UENA 4XB2A 1Y18A 3DF7A 2FSEA 3VU1A 4PLFA 4HB3A 1AA9A 4AB1A 3CFDA 4FJYA 3EYFB 4I4TA 1R34A 4YPGB 2EZ8A 2ZD0A 2QZ4A 4TMTA 5TMPA 5SZKB 2LIVA 1F4HA 3F6EX 1N77A 3U61B 4Y30A 5I6LA 4C83A 5DGIA 3NBKA 5HE8A 3TEFA 4NP4L 4QOKA 2QU8A 3O45A 2ORYA 1BAPA 1XGUA 2DMHA 4PBTA 1AKJD 2NZYA 1PUXA 1AG9A 2QRVB 4B47A 4K3DH 4OB5H 1T2VA 4GKSA 2H5JA 3SZ6A 1PZ2A 1E2WA 1B7GO 2NLOA 5E70A 3KD2A 4HB4A 3SXUA 3KYJB 3AUTA 4AQAA 2RALA 2QQ0A 4G1VA 4AF6A 2QRMA 2V1UA 3MKKA 2K4AA 3PS6A 2YWHA 4RMQA 5J1TC 4QDJA 3LY7A 4KR9A 3R1GL 5IROC 1LSJA 5CVTA 1QZ3A 4OZIF 1V8PA 1QVOA 1VLXA 1KOFA 3SZKC 4NQCE 3HBAA 1HCFX 2H0FA 5DCWA 3A6LA 3B9RA 3P7MA 1W8OA 1UDBA 1Y9DA 4D8OA 1K8DA 4EO9A 3FUVA 2R8OA 1EK3A 4JRXD 2Y36L 3HP4A 5ELXA 1ZJ5A 3MOSA 3C08H 2OSLA 4KQJA 3DVFA 2HPAA 1RJ9A 2HK9A 3ZLTA 4YCSA 3CU7A 1ROWA 5G2NA 3G1WA 1RYEA 4TN9A 5EC8A 5C0AA 2DFKB 1U3DA 1K8ZB 3VNQA 3AVEA 4JLDA 1QYGH 3B9AA 3TCLA 2QX8A 4KIUA 1MCOH 4EVSA 5INDA 1UJ2A 1IYZA 2WOOA 4FFWA 4MRSA 4GXTA 4LSRH 5EU6D 3EJZC 4A3SA 4LZWA 4PJ7F 2LHAA 2RONA 4DLZA 3HN8A 2IYTA 3QKRA 3ZDZE 1P2CB 3QA3A 2VXUL 4HUQA 3GDWA 5NULA 2AK4B 4OBWA 1NFAA 1UQSB 5ALBL 4CLXA 3PDOA 3I9IA 1RQ7A 1U0NA 4XMUA 3K5PA 2PSHA 4AH2B 3P45A 1X77A 5HJ2A 1GGCL 3BLPX 4L5JA 1KU6A 2FR8C 3N0PB 2JH3A 4LRTB 3X1ZA 5KZCB 1KIQB 1EWHA 2ZWAA 1WG8A 4MCMA 5DVPA 5A4FS 1YZQA 5DISB 4ERSL 1M5TA 1ESDA 1MVNA 4Z4GA 3D3EA 4RUKA 1KRHA 2E7ZA 3RWIB 5EE1A 1HYRC 3FUMA 4UIKL 3MLWL 4HSEA 3EDMA 1G9MC 2Q21A 4CBZA 3G9UA 2VHEA 1BS9A 4ZVUA 2VMJA 1IBHA 2XTLA 2RC6A 3GUHA 3U9UB 3QO0A 4YIQA 3WV4A 4CW7A 4PJBE 3KB1A 3SAJA 3PXDA 4ZPVA 3CLWA 4XMKL 2A73A 4W4NA 5FUZH 5IW6A 2EP8A 1Y8QB 4P4TA 1I36A 3UYRL 4RDCA 4JJ7A 4G0XA 4NFHA 3JD0A 3ZCQA 1OXUA 2W7TA 2GEVA 1XZPA 3LUBA 2IKSA 1UJ6A 3GHBL 2LXNA 4DEPC 3LX4A 4KXDA 4ZD3L 2AN9A 4K87A 3OF5A 1GU7A 1HTWA 2R1WA 4UB0H 2VDMH 1ZSHA 2EKQA 2YXBA 4IY1A 5FULA 1NXQA 2OMKA 1FMCA 1KEML 5ECYA 4XXWC 3QPWA 2HXYA 5JS8A 2ZI7A 4QGBA 3SYRA 4TKMA 2YV3A 3PT5A 1TZIB 3TE7A 3TO4B 3T7EA 2FZWA 1V6AA 5IJVA 5BW7C 4JFOA 3GRRA 1U3HA 3E2MA 3MUJA 4WENB 4DNQA 2CG9X 5TE7L 2ZUYA 5DK2A 2A1WH 4DCNA 5MHSE 5EN2B 4CLRB 4BO0A 3GX1A 3R6GA 1PF3A 3W78A 3GXTA 4FGWA 4W9MC 2GX6A 2DHCA 4HDCA 2HEIA 1YCDA 1ZN8A 4G59C 3CF4A 4Y1AE 4P0TA 2GEFA 4WJ5B 2P8LB 2WKPA 1IQPA 1QHGA 4INOA 5TLSA 2RHJA 1WS6A 2Z0MA 1E7QA 1AHWC 4IGBB 4A7VA 3G8BA 3HYLA 1E7MA 4QYWA 4NCC1 2DTML 4JEGB 2RGBA 2E4ZA 4LN1A 3Q3JB 3RUEA 2ZEJA 3EH1A 1GAJA 1J88A 4UT7L 2EDKA 1PZFA 2VPWA 1L4IA 1L4NA 2WIKA 5TDHA 4G6MH 5EZ5A 1MB0A 1FBIH 2WFLB 1OZTG 4V03A 5KBDA 3HBLA 4YHOH 1NMZA 3BRWA 1OXKB 1Q15A 3INOA 3UJPA 2EUVA 1JH9A 2VDVE 1O0CA 5AKGA 1VGKA 1TFRA 5DRZA 3TB4A 5TDNA 5BV2P 1CDYA 5I0ZA 1V4VA 3C8KB 3GPIA 4LJYA 3BGMB 4A91A 5ECJE 2JGRA 4NM8H 3KG5A 2MSLA 3G7NA 3CH1B 1SCUB 1TEGA 1QHSA 2FL5B 4CIDA 3EY9A 3E8SA 2NUAB 1OLUA 3NONA 4G11A 4A1FA 3NWJA 4CXMA 2D3NA 2YZ8A 1R4XA 1ROCA 1CZOA 1XHLA 2XMSA 1E1LA 3QG7H 3QHQA 4OG2A 3FPXA 3VR2D 2C8NA 3BHNA 3HBNA 3SPGA 2AC0A 1MOZA 3H5NA 4ZAGA 3CVBA 5DEJA 5IQNA 2GZMA 1E5VA 5BSMA 1Z0ZA 1PLLA 4JODA 1DXQA 2HN7B 2WVHA 1S8AA 3DDNA 1XCQB 4FBGA 3G02A 1AJ7H 1O6SA 2J3LA 2WUFA 2LV8A 3IJ5A 4PNEA 2UYCA 4NOBA 1R8SA 2Z6QA 3SU8A 3GFGA 3QZLA 1W4ZA 2W0MA 2F7IA 4HAKA 4PCAA 2B5IC 1OP5H 3UZUA 3K0BA 3E1ZA 4UNVA 1RP8A 2A1TR 4Z4FA 4JMPA 3E0GA 1BREA 1J9CT 1O87A 2ZUXA 5CMLA 5LXTA 4WZ9A 2Q3ZA 3HZMB 4GXVH 1LQTA 1HQRA 2PPLA 2UVEA 3LWNA 3MJHA 5EIXA 2CVHA 1MXGA 2YZ1A 2DKMA 2GN4A 5EERA 5JW6A 3R41A 2PBZA 3K70C 1CFNA 1NDGA 4WWOA 4NZJA 3FT2A 1T2EA 4X6EA 2VYFA 5ESQB 1QI4A 4JG0L 2WUCH 2I5PO 5IN5A 4IS6A 5KN5A 1DCMA 5LMUB 3F7PC 2ZPAA 1YC2A 1ZD2P 4BQPA 3Q1KA 2I6SA 2MPVA 1IFGA 1FA9A 1EIWA 2H4XA 4LECA 3VKUA 1NG9A 4M4RA 3JWPA 4L4SA 3L3IB 2JK5B 4YHLH 2O5ZH 4KK6C 1HDEA 1KC1A 4IIJF 5EZLB 1MG5A 2FSPA 3I9JA 5FUVA 2GF9A 1P4JA 3FO9A 4Y2PA 3B2DC 1MFDL 4XM1A 5EY5B 1Y1LA 4L23A 3S1SA 4FOSA 5J6GB 4ODTH 1PEAA 3IIMA 2D03L 2F1BA 1C5BH 1A9EA 3CLEL 3JYBA 4MAUH 2DBJA 3MILA 4JZKA 3R7WB 5E6YA 4W5WA 3O3UN 5A9TA 3MRJA 4Z3DA 1P4BH 2QZJA 3HHEA 4UT6H 1NQWA 1OH5A 2P48B 3ZHDA 1R10A 2VHWA 5IEJA 2PHZA 1UJCA 3QFJE 5MENE 3CLTD 4CVUA 1G63A 4RFEB 3D51A 2Q1TA 2KBGA 4BV8A 2CV2A 1DS6A 1HXMB 3WFHA 3WGVB 1SHXA 1K8XB 2BIIA 5BW6B 4NXMB 4MHHI 5K3AA 1IBRA 1A1NA 2DIAA 2D1YA 1XZ0A 1O7DE 3Q5EA 4X24A 5LZ7A 2IHKA 4EB0A 1QLRA 3FN3A 1KKLA 4PTLA 4J5VA 1WWAX 3S35H 1LGYA 1OWNA 2F2TA 5P21A 1LHZA 1T8UA 4HVAA 3T4EA 5GRXG 3UENA 4UM8A 2WU0A 3SBEA 4K8RD 4DCQA 1WP9A 4Z7OF 4OKVB 4R7GA 4ZV7A 1NCWL 1H65A 4CMJA 4M9PA 4NYLB 1CY0A 3AG4B 4OI2A 3RRXA 3QLTA 4IOIA 3IMCA 2IAMC 4N2NA 3PS9A 4PGMA 3IJHA 1BA2A 2C3VB 5F7AA 3L7CA 2ZE6A 1OL0A 4NBZB 3FYCA 3U5TA 1P1ZA 4X84A 2DLDA 2RBEA 3NCTA 1WHOA 4KKAC 5WRFA 4XI9A 4MWOA 1H8HD 1M8GA 3LW7A 2PXYC 1EHIA 1JV2B 2BVTA 1JDJA 3VRLF 4WLNA 3LB6D 1SHSA 1Q7RA 5CD1A 2P52A 3DA0A 4U2DA 1QSFE 1EO7A 3U26A 1NKGA 3OG4B 3C5WP 2Y05A 3C2SA 4M89A 4BX3A 4RMGA 2VC2B 4KVNH 4OCNC 5BQ3A 4IKEA 2EYRB 2UWEE 1PR6A 1ES0B 3VFSB 1A8PA 4AJYV 1VJSA 1SIOA 3K0HA 1Z5WA 4ZI7B 2GJAA 4UNIA 4Q9KA 1E3EA 4UDUB 4FHEA 4XE5A 4F58H 2C59A 3DULA 4KGVA 2HF2A 3GJFB 4DVGA 2VSDA 1OTHA 4MMXC 2B4CC 3EAQA 1QO0A 4KWTA 1QFWH 1M2WA 3BK7A 2IPUG 2IH1A 4KJQD 3M4JA 1EVUA 4ZT2A 3G2JA 5FGCE 4Q39A 4GL2A 3OCVA 3ARQA 3JWDH 4RAUA 2EYUA 1XXHE 3ISVA 1M2KA 3ZNPA 4XI5C 1MJJB 1NY6A 1PDKB 3GFOA 2L19A 1D2PA 5HIJA 2BHSA 4EMSA 2HBZA 3PQDA 4UUAA 5F2EA 4PRHA 5F88A 2J8HA 4RWZA 1Z0IA 3K0CC 3NYWA 3DO5A 3ZCTA 3DC0A 2QGEA 3GC3A 3AI3A 4JPQA 5EIEA 4CM5A 4I5EA 5ESRA 4ZT4A 4I55F 1GYPA 3RVMA 2W6ZA 2A9VA 4RPCA 3FSAA 4GVXA 3H6GA 2GNPA 2PP7A 2VJMA 5F1SA 4R16A 4XJXA 1C0EA 5DBHX 2H2SD 1Y3HA 1P2VA 4UTAH 1OV8A 1P39A 1OR8A 3PFGA 1A97A 1QRSA 3TEMA 4YDZA 2EQAA 1RYMA 3FPGA 4LLDA 3NAGA 4HA1A 3ZWKA 3VU9B 4ICXA 5DQ9A 1SBSL 1KYTA 2BZGA 4FGLA 5E8PA 1NFKA 1MLCB 1X70A 4X9XA 3R19A 1JNNH 3MF4A 4C5BA 2H4JA 1O0VA 1KIFA 3VHXB 1EHLH 4WXMA 2P6RA 5IQ9B 1LLCA 3PP4H 4YCDA 4L3CB 2JI3A 2AS5M 2YNMA 3WIVA 4ALMA 4F3FB 2YW2A 4XCYB 1SVIA 2JRLA 4YPVA 4PJ9D 3ULUD 3P9PA 4P2QD 4H7KA 3GH1A 1VFNA 4ZVSA 4NHCH 1YC8A 2MOVA 1XGQB 3RODA 4HKXB 2A6JB 2W60A 2D4FA 4L4TB 3O9MA 1L0XA 4F7KA 3FM9A 2NNFA 1ZD6A 2JANA 3NBYC 4GKBA 5C6TL 2AHRA 3P2BA 1Q7GA 4EKYA 4XVUD 1M66A 2WXQA 3OQBA 3E7DA 3G6JF 2O26U 5I6MA 1ZEAH 5TMBA 1OAAA 5JPIA 1QFHA 4TS4A 4KSCA 2ZB2A 1DQMH 5DOZA 3ZXUB 1VDGA 4EBFA 1V9LA 4C0LA 2WAYA 4OM0L 3WJJA 1R0AL 3LYAA 2DN7A 2ILLA 1E9OB 5GIOE 1W85B 1ZRNA 1R3HB 4PXSA 3MLYH 4GG6A 4IICA 4Q24A 1U0HC 3EZLA 3MSXA 2XNHA 4YCMA 1QTPA 4TM8A 3RL2A 1CQJA 5EEHA 3H5OA 5D6DA 4WV1C 1HWHB 3JQPA 3OAAA 4QJ3A 3ZXAC 1JT9A 1VA9A 2FKNA 4KXUA 5SY4A 2EQDA 4W6QA 1NX6A 3HR7A 1A4JB 1XIWD 5CTAA 2GTPA 1JBEA 1ZT1A 3UP6A 1NUQA 2ZKLA 2PKWA 1ZGAA 5L9DL 3T0IA 2QV2A 1I8IB 1W8IA 4Q1EA 1GAFH 2N4IA 4XPIA 2ED6A 3EYQD 3B7PA 4QAWA 1DVFB 4Y5VC 5EMKA 4NS4A 1SOUA 2Q76B 4Q7DA 4MRVA 3WGQA 4ADGA 3TLXA 3TFKC 3D5EA 5TQ2B 2RMNA 1ADYA 5JLAA 2HRQA 1PK7A 3GMDA 1OW3B 3BORA 3V6FB 3FFCD 3QVLA 5DK0A 2IU0A 1I3CA 3SQDA 3HFFA 3G89A 3IHTA 1FW8A 4AIEA 5I18L 2HSEA 2GIXA 3TO2A 4TTDC 5LXGH 1CQYA 4XB7A 5CBEA 1WV7T 2XKSA 3VXTA 3QUSA 4D3SA 1I8LA 2HRHA 5DP2A 1JFLA 4XZUA 1I3VA 3MV9B 3V5DB 4RMSA 4CPDA 4KXWA 3SMVA 4PZDA 1MZZA 3OF2A 4PG2A 4M2LA 4Z49A 2BOCA 4YJ2B 3T1VA 3NHPA 2R29A 4NX0A 3V7UA 2JVKA 4G89A 1A3RH 3ZJTA 3NLLA 2VLME 1JJBA 4GUDA 2NSXA 1Q11A 3BA6A 3DE3X 5K8IA 2O6DA 1I1YA 4WUKH 2IDKA 4B9IA 2XUFA 2P3OA 4JFED 2OR7A 4YAKA 4AM0Q 4BNDA 4JFTA 2KHZA 3T7IA 4HGNA 3DROA 3GFPA 5L2JA 4X7PA 3L4EA 3G7UA 4Q21A 5D96C 3Q3GE 2YOFA 4AY0A 4D9RD 3MJ9A 2WBJD 2X9VA 3IRPX 1XCMA 2NR6A 5JQ6L 4MV5A 1SU7A 5E9DB 2XWDA 2AC7A 2WWNA 3BN3B 4MKGA 1T6BY 4FHGA 3A3KA 3OO1A 2ICWJ 1OB1B 2D3VA 2X4IA 5KJCA 3SKUD 4WO4C 4QO1B 3VFPA 1JGEB 1ZSYA 2WNXA 1GG5A 2NPOA 5A6SB 4A6YA 3RWEB 3DGGB 3MREB 5JQGF 5JC8A 4BEJA 3H2KA 3EFFA 4HDKB 3PPSA 3VXUA 4G6AD 1T9DA 4MUYA 3Q44A 1IUOA 2J1YA 1V54B 3UICA 5IMLA 2R1TA 5BRZB 2DQCH 5DJZA 1JWSA 2IDFA 4RESA 2EDCA 3N0WA 1JZ4A 2CCKA 2XIJA 1KZ6A 2ZJOA 1W91A 1DANT 5HM6A 1U8PA 2C03A 4XBEH 3INNA 3BYTA 4RD6A 3WRYA 1HF3A 1L4GA 3RADC 2VM3A 4ZP1A 1CZUA 3GLKA 3PWVA 4AVIA 3S37H 1LKZA 3RI5K 2Z2YA 2WU8A 4EEXA 3QRGL 3BRGC 1WIWA 2OO5C 3GJ5A 3B1KA 3E9CA 3CR8A 1DKOA 4RTRA 3LOUA 5FWYB 4GRLA 1SJHA 5L95A 5BVHA 3OIVA 2BWIA 2I33A 4P3PA 5IMMB 4E70A 5EQFA 5LMZA 1ECCA 1Y4UA 5DM2A 1YQUA 3TUIC 4QIRA 2ZT6A 2GTWA 3VPDA 1J1PL 4I9FA 1XZKA 2XOKA 3L4TA 3HUJA 3TTXA 3WYNA 3GSNB 4XUDA 5FXCH 1B14A 2GBTA 2QN2A 1E2KA 3NVAA 2JI7A 3TMYA 1C5CL 2B7BA 5F35A 3AF6A 5DI8B 1A4IA 4ZX4A 4W9KC 1UVQB 5CJJA 1E5DA 5EHZA 1QTIA 3FO0H 1VG0B 4ENSA 1ETUA 4OIMA 1P9LA 4P2RB 5HTKA 1T6WA 5JAMA 2ZAHA 5I1GL 2WYVA 2F5AH 4JKLA 2CLLB 1RFDL 4N3UA 4ZQGA 1SDAB 2NADA 3LZQA 2D7QA 5AQ0A 5IG2A 3FB8A 4DFHA 3V8NA 2XRZA 4U1NB 1MRNA 3OP4A 3SC2B 3G0CA 3CH8A 3ARFB 2WZ6A 3F6SA 4QGHA 5EJGA 3RNQB 1ISGA 2EZ0D 4HDRA 2QU7A 2N9UA 1T1YB 5FCSH 4JHZA 2MQ3A 5FWQA 2J3HA 4WI1A 3V9EA 1YU9A 2DJ5A 1P1RA 2VITA 4LVHC 1GY1A 3AACA 1BOYA 4XMLH 2EOAA 1IC4H 4R4BA 1WQ3A 2W8BB 4YP6A 4DJTA 2D8KA 3BUYA 1BIIB 1F2XK 2VJCA 3LZRA 3KPPA 1ONPA 1ZT7B 4F91B 4WAUA 3S29A 1Z4NA 4U1LA 3L3DB 4H5SB 4Y9EA 3STXA 4BSVA 3LLSA 5DD3L 1U2EA 4O59O 1X6NA 1EX1A 3G9QA 3QFGA 1ISRA 3WTYA 3LBAA 3C5JB 4DJ5X 2VOEA 4YDHB 4BAUA 2Q49A 3OKEA 5GRJL 1F56A 1DQRA 1AB6A 3JVDA 5F3BA 4G42B 1V1MA 1RU3A 4ND2A 1IC1A 3UBXB 2P41A 3FCYA 2Z7UA 1ZSDA 4YJ3A 5E95A 1VBFA 3FOMB 4DYHA 4QLOA 3AFGA 3H11A 5C0JB 1GL9B 3IDIA 3E3MA 1X9QA 3LUPA 1C2TA 1BVNP 4HDMA 4G8EA 2QT6A 5L0QB 1SUBA 4Y16C 1T2JA 1UDAA 2DWEA 3JQOB 4LF3B 4BO4A 3KJ6L 1BE1A 3MLEA 1V48A 4YL4A 4APQA 2X5JO 1FFOA 2NZWA 1OF2A 2GFHA 2V45A 2AC4A 4XVJH 4ONHB 3WK6A 3HZRA 2QHLA 1GG8A 4RTLA 1T9GR 4H0GA 4MUMA 2EH7H 4JSRA 4KXBA 1FFRA 3FUJA 5CMAB 3IPFA 3E1F1 2DMGA 1WA5A 5KI6A 4HUUB 1KPGA 2V7WA 5JJBA 4YXLH 1CRLA 3U4AA 1ZHFA 3TPZA 9MHTA 3N41F 4J0KA 5DTMA 3SJBA 1XSOA 4AM0A 2DD8H 4EGJA 3I2YX 4HV4A 1IKFH 1FO0B 4EBQH 4L76A 2JH8A 3LQ4A 2FMTA 3ZJUA 5KYYA 5E7BA 3LFHA 1D7FA 4RTSA 3W82A 2ATVA 3GSWB 3AEXA 3NABL 1T7VA 2QE7A 3RYHA 4P84A 5JTUA 4HYTB 1L6XA 1HE8A 1JR3E 1L7MA 4M0EA 1GDDA 4EI9A 4PVDA 3O47A 3KZMA 3IKCA 2J4WL 2G9QA 3KZKA 4QT5A 2OUKA 4UZSA 4HUWB 3EVZA 2CLCX 2VKQA 1MO5A 4DW8A 3V6OC 3DDGA 4DG5A 5GRUL 3VR5D 3RNKA 3A04A 4ETMA 4HWZA 4F2HA 1B2WL 2XYBA 4NE9A 3ESUF 3RKUA 4YVUA 1A3CA 1JHPA 4DLXA 2XRAH 5REQA 2JGNA 4B3CA 3RTQC 1C14A 2AEQL 1AKTA 3OUZA 3BDBA 1XQ9A 1G7PB 1ZA2A 3GLRA 3QU4A 1N4XL 3GNLA 3QJQB 4FFBB 4CCAA 1AP2A 4BD4A 2AXWA 2PQMA 5KC9A 1JIQA 2FO8A 2VC2H 4NQCB 3H7BA 5LG6A 2BGUA 1A4AA 5K0TA 4Q3DA 2FCBA 4KDFA 3H1GA 2X44D 3P4OA 1VJGA 4ZZ2A 3WMWA 1R0XA 1EVYA 1VEMA 4RGVA 2I1QA 4NNJA 3C74A 1MH5B 2GCNA 4IM8A 2GCPA 4MV4A 3NMUF 1FSPA 2VLIA 2WNKA 2PIDA 4FHFA 4BPBA 5HX7A 4BH7A 3MCAA 4KHXH 2NSQA 1XFAA 4E0RB 3ENZA 3TLAA 3QNWA 1R0CA 3DIFB 1HKLL 5A3ID 4WKZA 4Z0PA 3AREA 1H8SA 3FNFA 3UAXA 3ANSA 1SA0A 1EBPA 5BPPA 2APSA 1HNXB 1OY1A 2DL2A 3VPSA 3ETHA 1N4DA 1PFWA 2J30A 1Z37A 1X9RA 5C53B 4QATA 2VOJA 3V0WL 3MODL 3NC0C 4B4UA 3D9QX 3WY9A 2Z92A 2X6VA 2ODWA 5LSAA 3DDUA 3ZDZB 2CR0A 4IMKC 1POWA 4TMWA 4II3A 4XCQA 4ACTA 4N7MA 2F4VB 2WIJA 4GW4A 3G04A 3DXYA 3WNDA 1CICA 3D5OF 3U4BH 2JWGA 4LZAA 3F5QA 3SPVA 3ILPA 4YXFA 5SYAA 4GYBA 5AW3B 2I03A 4NN5C 4ZTEA 4BDSA 4BFSA 4IRJA 4W9IC 1NDMB 4YRNA 2FXIA 4JXXA 1KYFA 4NWTL 1QGAA 1K4DA 1CBVL 4EJ6A 1GPKA 3QK0A 1UMDA 3PPIA 2FK7A 1L5HA 1Y07A 2G0NA 4E42B 4B41A 4F6RA 2NXZC 4EO5A 1JT2A 4DKEH 2FQWA 5JDIC 4PJBB 1I7RA 1DAPA 5KYWA 2VTVA 5C9ZA 4LZLA 2R29H 3C7KA 5FHAL 3T0BA 3KPNA 2ZWYA 4IOFD 1JLHA 3SQOH 3IOYA 1ZA6B 3Q7PA 3B5HA 2A74C 3DHPA 2KZKA 4HWBH 3A6PC 5JO5A 1DQNA 1PZDA 2QM8A 5IUNC 5CVDA 1ABBA 12E8H 3O4HA 5ALMA 1HHHB 2EDRA 4DDTA 1KMIY 2P5TB 1Y81A 4F3NA 2WJAA 1E0SA 1PY4A 3C6LC 5EP4A 2WIIA 1S7RA 4JPKL 3RE1A 3PYMA 1QCYA 3HB4X 3TRKA 1SBQA 3CZLA 4F04A 4B33A 2XHZA 2G2RB 2HJFB 2C88A 3WYBA 2H4EA 3H9CA 3F6RA 2AJUH 3FVRA 3TSWA 2V2WA 3WEXA 2E5FA 2UDPA 1G7MA 2IT1A 1R5WB 3FRUA 4Y1AB 2QL5A 1JXAA 5DWUL 4Y2TA 2BKUA 1YN6A 5JXJA 5U4XA 5KPJA 1ND0B 3A7DA 3SZUA 5CP3H 2CMRH 4QHPA 5D71L 4FS0A 1PY9A 2Y0PA 1V8HA 1E4JA 1QQDB 4WXRA 2ZVDA 1IBCA 2GRJA 3H7IA 3ADOA 3ER8A 5TC4A 2CIIB 4U2EA 4FE4A 5C2UB 4HJ0C 1CUAA 3IEVA 3FB7A 1ORSB 5TGBB 3U9LA 4D8PB 4I18A 3MWEB 1DVTA 4KRPB 4EDHA 4GU5A 2D7MA 5TQ2H 2X2OA 1A0QL 2HT3C 3T4AB 4QVKA 3BUQA 4X7TA 5DD1H 3M7IA 2XJKA 5ALFA 2MWCA 5DYNA 3PLRA 3WLJA 1L1QA 1NVVQ 3VWJA 3L4SO 3QIUB 5C09D 4QHSA 3E2HB 4TLLB 2FN3A 5DVKA 2IIVA 1FZOB 5EQDA 3VDNB 3L7JA 4YSSA 3GA7A 1FDOA 4L0CA 4IG4A 2CZCA 2XYRA 2GJPA 4H2DA 3MRHA 4QJ5B 4KQFA 3BHIA 1T26A 4G4SO 2J9FA 1PJ8A 1IQWL 2X2IA 4MJ6A 1CZ8L 4ZUTB 3BMOB 4RWEA 1XD2B 4CV0A 3WXWH 1W34A 1J48A 3V42A 2AJSH 1CZKA 3RVTD 1X6LA 4DQ0A 3OZLA 2YAFA 1YIOA 2BTQB 4Z3IA 2I1VB 1J1ZA 1LC0A 1E2PA 1Z8HA 5EIAA 1YIDA 2O3TA 1VXRA 3C97A 1N3NA 1RHRA 3EFDL 3RWGB 3E9DA 1QORA 1BJTA 3DTXA 3MCG1 3KDPA 1PJ9A 1EVEA 4QI3A 1Z66A 2AV1A 1F6AB 1MAAA 4NKQB 1MA0A 3L4KA 3T9WA 3ELBA 3KM2A 4B5ZA 3T3PE 1EX7A 1Y9EA 2ADOA 3NZHH 1ZA3A 2QD5A 3E3AA 1EA5A 1TJMA 1X86B 3F47A 1K5HA 2H1RA 4Q1BA 3ARDB 1G3MA 1TQWA 2O2IA 4ZQIA 5B7MA 3M17A 1CGYA 4L9AA 5C86A 3LQAC 1HDOA 2FLMA 4L9LB 2P80D 1ET7A 1NNLA 2WMDA 4MV8A 1Z45A 2GZ2A 5E6IB 1PW3A 1GA6A 3W5NA 4YAGA 3K7UA 4N68A 5HDLA 4EIGB 3QG5A 3B9KA 3T4UA 5LGKA 3Q48A 4BFIA 1JHDA 2YYAA 3IQGX 1JIIA 1J2UA 1Y3IA 5KSVB 2LW7A 1PWYE 2YAPA 1I14A 5ADHA 1YB5A 3FUNA 3B9VA 2I2AA 3FHLA 3WJ1A 2QAGB 3EOAI 4MGYR 2KS6A 5F7XA 2EKLA 4ZUUA 3KPTA 4Z3OA 2XUKA 3C41J 3OTGA 3PGFH 2D0HA 2YPLE 1G6VK 2Y7SA 4EN3B 2YEVB 2CA4A 1GGKA 1G6RL 4GPEA 5D3KA 4PRLA 1VE3A 4PF1A 2W9DL 3CFEB 2NSYA 4Y2GA 3CN3A 2IS1A 1NULA 3LVRE 5FI3A 1DEXA 2NX5E 3D4GA 5B5SA 5IQLA 3SYOA 4ZVNA 4DOMA 4P3NA 5H2BA 2C8LA 1VMAA 2C7RA 3ZU5A 4O3TB 1R3KA 1H9VA 2C3PA 3UK1A 1BM3L 4AW7A 1NW5A 2R5WA 3LHIA 1T8TA 4H15A 3QFJB 4JB8A 1RULH 2B1AH 4OVUA 2WK1A 5MENB 4E94A 1CCWA 2GO7A 3WGNA 4ABYA 3F3MA 4HNAB 2FW0A 5CGMA 3KKKA 5DN6A 3ROLA 2ENSA 2W4IA 3ESVF 5GJWC 3R7DA 1FYDA 1X5HA 4XYMA 2WKOF 1QK5A 2AH5A 5FKPA 1B0IA 3HI6L 4WFKA 1YI1A 3GSNH 4M1GL 3STVA 2YXNA 5TVKA 4DP9X 1QSGA 4GP8B 1TZGL 4XOBA 4LNVA 2PW2A 3DLPX 1UB5A 3CVWA 4TQIA 1ZS8B 4FYYA 3B2UC 4MINA 3O21A 3GCDA 3EDRA 5ALJA 4FX2A 2NSLA 3BQUB 1FP4B 1AQ6A 4J0QA 4Z9FA 4RA9B 1W5EA 4KFRA 1PQYA 2WKRA 3MLBA 5KSAC 2PUEA 5AK5A 2MH4A 3U0WL 4F7PA 4I9NA 3QO1B 4HN9A 4L4JA 2EUXA 2ECFA 1TZKA 2OFWA 3QULA 4R8VA 4OZIA 4OTXL 4LSZA 1Q6YA 5DJ0B 5SYNA 4N22A 2Q8PA 1F8YA 3IQHX 2IOFA 4OGXL 3MMNA 3ZGVA 1ZK5A 5A71A 4DZRA 3O0RH 1U3UA 2AQQA 2ENYA 1JDPA 3MT9A 1WHTB 4KZCA 4UUBA 4URVR 1HQYE 4HG2A 3C87A 2D4AA 1AHNA 1Y7IA 2YRWA 4KC3B 4Y6QA 5ENWA 5F7EH 2XMQA 1XH0A 1NOFA 3AJRA 4K9EC 4R1TA 4U7MA 3JW8A 4RZQA 1QSFB 3WGUB 1KDTA 4GKKB 1UZGA 4X4XB 3KGTA 2IW3A 2IBSA 3DJRA 3OKAA 2IDQA 2C2BA 3MRBA 3QXDA 5KBKA 5FYQA 5T5FL 2JJ2A 2LLLA 2UWEB 5ID0B 4BZQA 1JVOA 4RPGA 5JJ5A 3FW6A 4ZTOL 4Q3KA 4PW4A 2DTXA 4RXUA 3BWAA 1L4UA 4D0GA 1XX6A 1OZFA 3F9IA 4ZI7F 4X5LA 5E08L 3MGGA 4UV4L 4BMVA 2ONKA 1VA4A 4PN6A 5CSZA 3L95B 3RRYA 3BO8A 4PJ7A 5DJYA 1H22A 4YIHA 2NXEA 4UQCA 2C00A 2VHTA 4MMZB 1BVNT 5FGCB 2GN9A 1YMHB 1KE1A 1XXHB 1GGTA 1N5YL 4OV6B 4JQIH 2I2FA 3UJBA 5IUJC 1TCRB 3O2WH 4M3JA 3PJFA 2BUBA 3F5DA 4NYMQ 3JRWA 4NO0D 1OQAA 4HG4J 1YL7A 3TTWA 4ALNA 3KHUA 2PCFB 1OGAA 5KYXA 1N2CA 4DTGL 4MKRA 3OE1A 4C2TA 2H6OA 4ILEA 2BH0A 2R2EA 4GAGH 2M32A 1D5ZB 1DL5A 2IOIA 4G1MB 3R5KA 2IYFA 3UO1L 1J9EA 4FNAA 4JA0A 1I6LA 4FU0A 4YT5A 4XOEA 4Y4KB 2VISA 1QLWA 3HVRA 1FDSA 4Y18A 3D2LA 2YWGA 4AJ2A 2W07B 1GC1H 2J0UA 4NATA 5ESDA 1NT2A 4XEUA 1J8YF 1B0GA 4YT4A 3SSMA 1J49A 1F13A 4Y5XB 4M98A 5GAJA 3EUUA 2FZCA 2NY1C 2F17A 4MMYA 2QIPA 2VAMA 3DKPA 3D6JA 3WISA 3LD9A 2Q4TA 3G5WA 1O2DA 4N2EA 4JLKA 2B1JA 1D5MB 4LDZA 4YMSA 4IDBA 4CIAA 4ZAZA 2R96A 5BJTA 5F73A 4ZEOA 5IB2A 4Z5RB 3LYUA 1UWGH 1ET5A 4PAOA 3PXUA 2G71A 3EXFB 5AJZA 1H93A 5T3XL 2YC4C 4XRGA 3SE3C 1ET8A 4U2YA 3FZQA 1NEZG 5D2LE 2WVSA 4U6HA 3U4EB 5A2LH 3R44A 3FSOA 2OHOA 1QO3A 1WAMA 3UTSA 4LY3A 5FEMA 2PZLA 4KXMA 3QSKB 3GSXB 5E2JA 3R3VA 2ODIA 1ZH8A 4X4MA 1CTMA 2QUKA 2PUJA 1FMFA 4WNAB 1XDUA 5JNVA 3STYA 4HFNA 3IE0A 3AUAA 3OEWA 3GHHA 4UEJA 4PVMA 4NQDD 4ORGB 1FEZA 3OZFA 1NNSA 1KZYA 1I9JL 3VXMD 4CSSA 1BFDA 2F7OA 3BP7A 1NWCA 2VUKA 2CA3A 5FDWA 1PZAA 3GRUA 3DONA 1EZSA 2AV6A 3H84A 2HG0A 4DLLA 1IBGL 1A6TA 2H1HA 3FKUS 4U7SA 3ULVC 5JIKA 4K94H 3JZIA 5DXJA 4ODWA 4C6TA 4KTVE 2HRLA 1HMPA 2NXNA 4FNRA 3UTPD 4LEXL 4BN5A 4MX7A 5LKAA 3IDXL 1LF5A 1EZZA 1EXWA 4AKSA 2CUMA 4V2IA 2WU1A 3SR4A 3V7FA 4F8YA 2PGJA 5SY6A 3KD4A 4JAMB 3QX9A 1BD2E 5GSVB 2OFQA 4PO8A 1RHMA 4LHYA 3U1SH 4G5QA 3A9SA 1B4JH 2CK0H 1Z75A 2QPUA 1SC3A 4B9CA 4Z9YA 1KB9K 1ADQA 3IMWA 1OFUX 2PGDA 2R65A 5C0NC 5F23A 1K27A 1BWQA 1DSWA 1SLXA 2WKSA 4Q66C 2XI9A 1AY0A 3MJ7B 1EUDA 1Q3TA 2GK7A 3O6KL 4JNCA 1UFQA 1NM9A 5I45A 821PA 4O8ZA 5D51S 1P5RA 3S5LA 4JUAA 1XMJA 4AE1A 5L8VA 3PGDB 4H7EA 2GCYB 1MJ8L 4PRPA 2F53D 2A6KA 3VVMA 1OEZW 4F96A 4HJ1A 4HGYA 4NJAH 3RRQA 1CULC 2XBDA 4WZ6A 1FP7A 4OTZA 4LSGA 1NL0L 4CU5A 1N8ZB 3IH5A 1S9YB 1N7IA 3ZBUA 2QF7A 1S1MA 4HUTA 3I39X 2UZ1A 1XDSA 2R66A 1NQOA 4Y6PA 4UIMB 4YJ2F 4OA5A 3A1UA 2ZGVA 5DBOA 5DMKB 4KJPD 5D4QA 3NORA 3H4IA 4KRYA 4LNHA 3O4GA 2JLSA 2IG2H 3HZVA 4D0CB 3PL1A 1ZHKA 4L4VE 1DFBH 4N90D 2XFXB 2XIIA 4FD2A 3LH5A 4XAKD 1OCZB 3IPLA 2WZDA 3K0EA 3AEUB 5E9WA 1G5HA 3NQ41 1ISJA 3F7MA 2BN4A 3MC1A 3KTOA 3GMMB 3C7AA 1ETZA 5FL3A 2VNAA 3S2AA 3NBUA 3BH9A 3E3LA 3ME0A 3TRFA 2GBFA 4INPA 1GGBH 4J1SA 4DV6B 3KPRE 3Q3GB 5IN4A 4OAOA 5I0YA 3L2NA 1QAMA 3O26A 1BVOA 5CEZL 2OHFA 4AT6B 4IIJA 4U05A 1QGDA 3FH8A 3SS8A 1FOEB 2IDJA 2VDPL 3ATEA 3WIEA 2QMYA 2PUDA 4BFJA 4MV0A 3GJ8A 4GUOA 4IMPA 4PLVA 1NMYA 3MV8A 3V8BA 4KWUA 4JHAH 4E32A 1Y89A 1MA3A 2YHAA 3TR6A 3KQKA 3FU0A 3PF8A 2ITDA 2D5BA 3GMRB 1RUML 4AQ8A 5HHOD 1WPQA 1AC6A 5DHVA 1B0ZA 2V6JA 5EUKB 3C8DA 2RGNC 2G9KA 1AUVA 5EU4B 4BDVA 2EIMB 2NDFA 3GAAA 2MIIA 5AVKA 1DUYB 4FG6D 3FI0A 1CFVL 2XT0A 2WZBA 3CX6A 2QKIC 4Z7NE 2DTEA 2XF2A 4LHJB 3KBOA 3I9AA 2UUPA 2GBVA