2VDQB

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 130
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdqB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdqB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdqB03
1SHUX 1ATZA 2WINI 3OL2B 3OKYB 1AOXA 3EFOA 4C2AA 4CNBA 1FE8A 3IBSA 3IJEA 4Z7NB 3VI3B 2UZYB 2VDPB 4F1KA 1XUOA 1QC5B 2B2XA 3BQNB 4PN7A 3IJEB 5KYYA 4WK0B 1N3YA 4IGIA 3EFOB 3TCXB 3ZQKA 5BV8A 3K6SB 1PCXA 1SQ0A 1ZOPA 3HI6A 3K6SA 1XDDA 1OAKA 2ODPA 5E6SB 3RAGA 4UM9B 1JEYB 2NUPB 3TW0A 4GZ8A 3AL8A 1JLMA 3EGDB 3PPYA 3Q3GE 3TVYA 4JDUA 3ZE0B 1IJBA 1L5GB 2O7NA 3E2MA 3HXOA 1M2OA 3ZE1B 3BN3A 5KYWA 3AFCA 4NENA 1IDN1 3EGXA 4WFQA 2QTVA 4MMXA 2ICAA 3PPWA 1QCYA 1T6BY 5HJ2A 4XW2A 5E6RA 3V4PB 2NUTA 1PD0A 3NIDB 3AL9A 4WK2B 3OKWA 1RRKA 5KYUA 5KYXA 1JV2B 3K72B 4WJKB 5HDBB 5KYUB 1DGQA 1CQPA 3ZDZB 2NUTB 1M2VB 1YVRA 2M32A 3V4VB 2I6SA 2ADFA 4IHKA 4BJ3A 1ZONA 2XGGA 4MMXB 2VDRB 3BQMB 1PT6A 1YUKA 2IUEA 3NVQA 4NENB 4MMYB 3FCSB 3EG9B 2VDLB 1AUQA 2I91A 4O3TB 5ES4B 1L5GA 2VDNB 3EOBI 4IXDA 3NIFB 1JV2A 3K72A 3AL8B 4DMUB 5KYXB 2NUPA 1JEYA 1YVPA 4O02B 5E6RB 4F1JA 4G1MB 3F78A 4JX0A 3T3PB 1MQ8B 3M6FA 1RD4A 4CN9A 1MJNA 3K71A 1SHYB 1M1UA 1TYEB 3HXQA 4HQLA 1U8CB 5E6UB 3PPXA 1DZIA 1M1XA 2P28A 3PPVA 4G1EA 1LFAA 3F74A 5LN1A 1MQ9A 1SSLA 1T0PA 1MQAA 1MF7A 3ZDYB 1BHQ1 4HQNA 4K3JB 1PD1A 3GXBA 1UEXC 1FNSA 1ZOOA 5KYYB 4G1EB 1Q0PA 4UM9D 1QC5A 2NVOA 1NA5A 1XDGA 5KYNA 1M1XB 4C2BA 4MMZA 4O3UB 1U8CA 4NEHB 4UM8B 1V7PC 1OLZA 3N2NA 3OL2A 4FX5A 5E6UA 3K71B 1RTKA 4MMYA 3EG9A 4HQFA 2WW8A 1JEQB 4Z7QB 2XWJI 4G1MA 2P26A 3EOAI 4Z7OB 4O02A 1IDOA 3TXAA 1M2VA 1AO3A 5HGJA 2VDQB 2I6QA 3ZE2B 4M76B 4FWWA 2VC2B 2XWBF 1RS0A 3FCUB 2VDKB 1JEQA 3T3MB 4A0QA 3FCSA 1MHPA 3EGXB 4WK4B 1SHTX 5KYWB 2X5NA 3EH2A 4MMZB 4HQKA 2VDMB 1BHO1 4HQOA 1N9ZA 3QA3E 3EGDA 1CK4A 2VDOB 1U0NA 2ODQA 4C29A 1U0OC 3NIGB 5E6SA 3VI4B 3ZDXB 3EH1A 1M10A 4CN8A 1IJKA
chains in the Genus database with same CATH superfamily
1MRCL 2IALA 4NSKB 4OZIF 4QASA 2GKSA 2FSSA 1WVIA 4OFXA 3BPOC 3GNSA 4H0GA 2YD0A 2UDPA 2PZMA 5IDWA 1UC5B 2V5UA 3M6LA 2W4QA 3ILQC 3CW2A 1XN1A 4FR2A 5DK2B 2AKYA 4BEBA 2HNAA 3X14A 4YHIA 2F3UA 2XWJA 3ABOB 3C5CA 1T66D 1WWKA 1W4ZA 4B3TB 2OAP1 5K0EA 2ADFH 3TJRA 4QTIH 1A8UA 3UMNA 4IGFA 5GZ3A 1A3LL 4NO5A 3RQIA 2NYYC 4CE6A 2BONA 4K9JA 4LSUL 4KNTA 3KPLB 4RAUB 5BYBA 4YL9A 1NM5C 2DX7A 2PCFB 5LN1A 2GGSA 2OMZB 2JANA 4JR9H 1XQYA 5L2KB 4DKDC 3SYAA 1A9TA 1DBKL 3BGDA 2SNIE 4MR9A 3VR3D 1KLFA 4UQ9A 2AL7A 1O87A 3D7SA 4S1NA 4HKZA 2HUNA 4OP2A 3K6OA 1I7UA 4FYSA 4X66B 1O1YA 4HLEA 4OMFG 1HL8A 4FGLA 3FFCB 3NIGB 3IP5A 3BGFC 4H26B 2BIHA 3AC0A 3KS9A 3JTSA 3HCBA 1UR5A 3AM5A 4UT9A 4ZYVA 5IHPA 1C9KA 3QEQE 5A4DA 1U2RA 1P5ZB 2JVJA 1YV9A 1VDMA 4WWKD 3HG1B 3A26A 3GUTA 4HMPA 3WELA 4NYJQ 4JFDD 3BCUA 4RZQA 5INTA 3FETA 1SMOA 1EG7A 1AZSC 3GI8H 4MQ4A 1V1MB 4OF6A 2C1PA 3SQBA 2ADYA 4N3BA 2Q2QA 4FQIL 5CM8B 3PWJA 3NPSC 3WY2A 1LNSA 3F6SA 1I0IA 2PMDA 3KPUA 5SWZD 4FA6A 4D7AA 4JUAA 4DGIH 5AM3A 5LB2A 2BELA 3S1SA 5I76B 5FTNA 5KYXB 4C88A 3OX1A 4KAAA 2WFMA 5JD4A 4MA8L 1XD9A 3MN1A 2IYQA 1F1GA 1QBKC 1Y6FA 3SM3A 3OBIA 3HI6L 3JQAB 2CZCA 5JDSA 5GRJH 4N5UA 4HATA 3LCRA 1SUCA 4L4TE 3ZVMA 2HTLC 2NVOA 1R3HA 2Q2NA 1B41A 3WL3A 4NARA 1T9GS 1J8HA 4NM4H 1UQSA 1U3HA 4LK3A 3FFTA 3IPBA 4N8VA 3V4SA 2EP7A 3HV2A 1Q38A 5EU4A 4B5KA 1ZMRA 2I7XA 3D08A 2Y6SD 4YXLL 5DHPA 1A9XA 5EBLB 5J1AB 5HHVL 1WZNA 3KQPA 2VDPL 4YRCA 4J8PA 4I7ZC 2G3ZA 3RH0A 2W9EH 1T4WA 4K6GA 4TNFA 1CEQA 3VU3A 4X8MA 1AGDA 2ADIA 2ZJ7A 4LLDB 1Y4SA 3GEGA 1J1OH 3WYRA 4JRXA 4LCVA 4X62B 4ZT7A 4R0LA 5LIPA 2D2IA 1RZKH 1UA7A 5AL8A 5EJGA 5JXAL 3VTKA 1XX9C 3O1HB 1PW7A 3ICVA 1HV8A 5H1YA 1UXWB 3CRW1 1EERB 2PCPB 4Z3DA 3PXGA 1OCEA 3I92A 4R31A 1CY6A 4RFLA 2BOLA 3D39A 5AHOA 1I32A 4ZUUA 4EO7A 1JWMA 4G7VL 1LK5A 1MPXA 3E9RA 3RIXA 3D8NA 3M4YA 4KJYA 3MUUA 2H4WA 3DQPA 1LV7A 2KB0A 3EOAB 4LL1A 3E23A 5HZKA 4EQZA 3EFHA 4JDTL 1KCRH 3KJ6H 2IBMA 3QTTA 1EHLL 3QUCA 1KCVL 3KKPA 2QVCA 2GR9A 1Y33E 1BMFA 1D2CA 1XF1A 3T34A 4M49A 3BAYA 2G2RB 2P6PA 1DRWA 1DDHB 2VYFA 3BCFA 3DX9A 5C8JB 5DRXA 3V80A 5K9ZA 1X7QA 3AVWA 1W96A 2YGNA 4IU3B 1BQKA 3UHOA 1ECZA 1GLVA 2I4OA 4LXYA 2IGFH 1OGYA 3JWNE 3EYOA 3QB7C 4FZEL 2B1HH 3IN0A 3NG5A 4HRVA 3BSFA 3Q2CA 1TU0A 4W70A 1BQRA 4ERNA 4ZYKB 5FKPB 3DROA 3HE7C 4A04A 3FQWB 4YDIL 4A1FA 2BINA 4RSRA 2YRFA 1WS7A 4A5SA 2PUBA 2QSJA 4L85A 1CC3A 2C3XA 3FQ2A 3F46A 3AT9A 5KDOA 4G6KL 2EARA 1SPXA 2GN2A 4GAGH 1FNMA 4BNDB 2LP4Y 4HOXA 2XNCA 5EEUA 2W6QA 4LU5H 2DWPA 4YJHA 1JXQA 1E77A 2B61A 3OX2A 5BUGA 4EA6A 4JJGA 2QRPA 2VKTA 4D5EA 3FGPA 4IJQA 2G71A 1RLBA 3LXBA 1MENA 2JJTA 4P4GA 5HK8A 1XO1A 2BMEA 2C31A 2IAMA 5D2LA 3UIZA 1YRBA 2WLKA 3MTIA 2FGWL 1PVHA 4F7PB 2YXFA 4NG5A 3UAJC 1B8OA 2B5VA 2W1NA 3TRHA 2JDID 3E6FB 1R0CA 1LFDB 1W80A 5LYJA 5G5DA 4HG4K 3ZMEA 4NZPA 2C4MA 3ZHBA 1Z08A 1U5BB 1QI3A 1WXWA 2IPNA 3ADPA 4MAFA 3CCBA 3L6RA 5I74B 3TPUB 1GJIA 1A8JH 3R7FA 2FEDD 1ZJYA 4FGKA 1OT5A 2EZ0C 5ILQA 5KNDD 1U8NA 1W6RA 1AD0A 4ZS7H 1TOXA 2IOFA 3HZZA 1L9KA 2D4DA 2OM6A 2OMEA 3DE6X 1S46A 4DT1B 5C9JB 2FHCA 2OLEA 4JVMA 1CI3M 3TGPA 3C6EA 1VF5C 3AF1A 4LZLA 4Q9HA 1U7UA 3OZ9L 1N3IA 4J1UB 1FNLA 2XV6B 2J3QA 3DWEX 1AGBB 1UPUA 2Y2UA 4UUOA 1JHRA 2DH5A 1HK7A 2K2WA 3VO8A 4FQLL 1M2JA 5HHMB 4LF9B 1EESA 4CSSA 2HRBA 3LHPL 1WTCA 4LOJA 5C86A 3QYJA 4WCYH 3E15A 1MDAA 3QX7A 3S29A 3WIOA 4FFYH 3Q9LA 2B92A 1O6CA 2COQA 3CT6A 3EGDB 2F74A 2O3UA 2BOBA 4ESEA 1MFPA 2VERN 3HKBB 3W5DA 3OSUA 3ZD9A 2EYRA 4AZUA 2HQOA 5IAAA 1MJGA 3ZCRA 4U1HA 1LNQA 1BKYA 1DKPA 3CKKA 1G7LA 2Q7YA 2YICA 2Y0SA 5GQBA 3VHLB 5JT1A 2EYRB 3BVWA 1YAIA 1GGHA 3H2SA 4XO4A 5E99H 3PGLA 1X6VA 2DDQL 5GSRB 4HNTA 4HN2A 4RMBA 1YTLA 1HE4A 3RS4A 1HNFA 5GS0C 1J2EA 2WJZB 3PNOA 1CMOA 1ZOLA 4R1LA 4Y9FA 3UHAA 1CD1A 2QPOA 3N43B 4RD0A 2VGLM 4JEGB 1G60A 3BTUA 3A67H 4DUGD 2LTQB 2AB0A 2OR8A 1VIDA 4DP9X 2BC9A 1SDDA 3GLVA 3H9SD 2QZ9A 4PGZA 3D2CA 3SDZA 5FA4B 1R6TA 5L53A 5L7YA 2QR0A 2JS7A 1LD9A 4M7KL 3QIBA 5E8RA 3EC1A 4N9OB 2F2TA 3ZE2F 2ITFA 1WAAF 3C6QA 3KS0J 1MXDA 1A1MA 3IKKA 5CYGA 2WWGA 5EULV 3CXUA 4PRDB 1APBA 3ZQUA 3LZ6A 1QWUA 1BX1A 1KJYA 4MMZB 4QRRA 3X11B 3O8XC 1N9ZA 3EFDL 2R7LA 4XPGH 4N5NA 5ICXB 5IMOA 3MUY1 4JSRA 2PX3A 4QHPA 2CMFA 3HN6A 2GN6A 2VPYA 1S2DA 2AJZA 1YQ2A 4FWTA 5FPYA 2WJHA 2G1KA 4QX6A 1PYWB 5L6YH 4PB9L 1GTJ1 1OGTA 3N06B 1TD1A 4YTEA 4F7PA 4YEFA 2IQAA 1XFAA 4IBVA 2ZAHA 5FAXA 1RJ9B 3W5MA 3CRRA 4YLYA 3LUHA 3K4AA 2GM4A 2XMRA 4PJ5B 4JZJB 4ZI7B 2JK0A 5DWUL 4EYSA 2BZ1A 3CVIH 2V54A 1HFJA 1NFQA 4Y6SA 2ZCJA 3THML 4KQ0A 1SBHA 2ID7A 3RVOA 4FQXB 3ERCA 5IQ7L 2HCZX 5FM4A 1L7MA 1ACYH 2OCGA 3QVJA 4ACBA 5HVHB 1S7QB 2I9LB 4K5MA 3HB0A 3PHJA 3VX4A 4M7KH 1UMCB 2YQ5A 1CDIA 4MW9A 1YS1X 2ALWA 1PZUB 4XPFL 4GPIB 3HUJA 3L77A 4W8GA 1ZDMA 3CJRA 4RGVA 3RPBA 1YJDH 4TTSA 1AS7A 2YVKA 1IULA 5FUCC 2V3WA 3ZHOA 1MHCA 1GZ7A 3EQ7A 5A9SB 5CR9A 2AQ2A 4WT7A 4DJDC 4P2QA 4B6RA 3ZV3A 5FUBA 5H4GA 2VRCD 4YXKH 1V1JA 1A4UA 4CT5A 3CLVA 3MS4A 1Z35A 4YHZL 4XXWA 2IU6A 3WHIA 4Y1AE 1AD0B 5EXPA 1Q1JH 1A2OA 4KY1L 3IXAA 4TTTS 3WRXC 3THYA 4HWEH 2EBHX 5K3FA 4OCMC 1PFUA 1U7WA 2C7UA 2HT4C 3CDYA 3ZHSA 1E0AA 3UK6A 3W9EA 4PRHA 2GWHA 4YJFB 1Q17A 3BZBA 1NFFA 3C1OA 5F71A 3ZIAD 1N64H 4F8PA 5TTRA 1U21A 4F8JA 2VJQA 4YUYA 5EB9A 4DIXA 3IAEA 2ZWMA 1RUKH 3GMMA 4ZT3A 3HR5A 2GZRA 1UM4H 3TWCH 3ZIYA 4IIDA 5EUBA 5FL3A 5IQ9A 3JAWB 5EZ5A 1O5PA 4DJTA 5I19H 1HDEA 1LE5A 3LV3A 1U8QB 3MHZA 3OZ9H 1VSBA 4EZJA 4GUDA 2RGNC 3IP1A 4EL0A 2BEUB 3RYIA 4ANKA 4YHKH 5SWSD 2ADIB 1T4GA 3VG0L 1E69A 2GI7A 3KE8A 4K9EH 5BMVA 3FF4A 1CF1A 1ADQH 4HSEA 5FORA 2CSXA 1GR7A 5BQPA 4CKZA 5T5FA 1O0CA 2H45A 3QO0A 4MDYA 4PGEB 2QN9A 4YNBA 3SQOA 4BNMA 1L1FA 1C1HA 3NALA 3DW1X 4QREA 4RZ3A 3OR6A 4FFVC 4GKNB 4D0CB 4G8CA 2Q1EA 2CRMA 1W2GA 1FFNB 5AZEL 1EXWA 3AXIA 5DD5L 2DBRA 1OGSA 4C07A 1YSOA 1JK8B 4PH8A 3LUGA 4E5XG 3FHEA 2AD1A 2V9CA 5GGSA 4C4RA 5IABA 1WBXA 1DQQB 3K15A 3HI1A 2ZOOA 1XF3B 5CUQA 1M57B 3OE1A 1N67A 1MW0A 1S3FA 1RVFH 2EFGA 3MTEA 1TO5A 1XCQB 2NXJA 1Z5NA 1FNHA 4EM6A 1RZPA 3ZUCA 5ICGA 1AJEA 3A6CL 2QL5A 5FYLL 2FIKA 2YWDA 5EZOH 2RGYA 4X63A 5F7BA 4KGVA 4MUBA 3TCLA 4UDUA 4I66A 3Q44A 4JJZA 5AYUL 1IRXA 3P0JA 4N3CA 1RRCA 3EDOA 2VDML 2NZXA 4TTAA 4QARA 5C0BE 1BJKA 3L93A 3FQUB 1VFPA 4BKLB 1OT4A 2WQWA 1CGVA 2QT0A 3AVVA 4AG4H 4RMTA 2ZVDA 1ZMOA 3M4JA 3NTXA 4P2AA 5D1QA 3WFDL 4YN3A 2H9YA 4YDSA 2X53A 2BGIA 1URIA 3EEIA 3BIAX 1HKLL 1JF8A 1ZCRA 2ZANA 1J5XA 3KBBA 4X5XA 2OZVA 3V0GA 2P9EA 2LGJA 4JKYA 4G7QB 4BFJA 4G5ZH 5CTJA 3Q7RA 4ELKA 3AP2A 3FB1A 1O9ZA 4X65B 3ETNA 4Y4HA 4IUCS 4DBZA 3RFVA 3KNBA 2L19A 2G0TA 3AY4A 4KVZA 1MH5A 3JQEA 1R27A 3E9NA 1HTBA 2Y76A 2DLEA 2H2SC 1JTFA 3V1LA 4J1TC 5BOSB 5B38B 3QK7A 3V4ZA 3MCUA 1RZJL 5EZYB 5G0WA 1PQZB 1KTIA 2E75C 4XGIA 4JQOA 1AQKH 4PLOB 1NSNH 1L7TL 2JFPA 3B1KA 4WTOA 5DJDA 1V47A 1CLYL 2I3AA 5ES4B 4DMUB 3RFZB 1X1QA 1D5MB 1KJ3H 2EAUA 2P9QA 1DJOA 3NEYA 3M6VA 4KVNL 4YRJA 5HVFB 4K3GA 2IQ5A 5IAKA 1URPA 3DYBA 5TJWK 1JPSL 4D6YA 3PXUA 1OILA 1AFVH 5GGQH 5BOJA 5BRZD 4ZEOA 4NDMA 3ZHQA 5CZVL 2MNWA 2P5TB 3IRUA 1HDZA 4EI7A 4NSNA 3WISA 3UC9A 4AEHH 1RIVL 3MK31 4I8XA 4NERA 4X4YB 4G07A 5MN4A 2OGZA 4A5OA 3L8FA 4HLUC 3EMBA 4EKXA 3QCTH 3DMMD 5KKAA 4HAOA 1YK0A 4DC0A 3D25A 2AG0A 1YFJA 2PO7A 1B7GO 4PJDA 1J8SA 4OSUH 1R19A 3F2VA 3H5IA 4G26A 1VL8A 2MU1A 4Z5RA 2NY2B 2Q10A 3B3FA 4YC2B 1Z0JA 3G5AA 3TTSA 3TGXA 1RPNA 5AHKA 5D3MA 1HFUA 3BRFA 4PPNA 3I0MA 4KV7A 2XQGA 2N59A 1N1GA 5IM7B 2OC9A 3SSGA 3DUWA 1H15A 4K6OA 3S3SA 3U7AA 5JPNA 1WUKS 4RTKA 4R2LA 3M5PA 3M83A 1NSTA 2RFXB 4E41B 4EY5A 2CC2A 5CD5C 3EOYG 3US0A 3K94A 2O7NA 3HXOA 5K45A 4LE2A 1JZ3A 1T3SA 4GKNA 1QI5A 2F5BL 1UKAA 3QJVB 5IW1A 2GCIA 4NY1A 1FVDB 3EH3B 4X42A 1M3JA 5AW6B 1RLMA 3UWPA 4V1CI 4LYEA 5FT9A 5EZLB 1FN4A 2Q5EA 1JF1B 1YVPA 4GRWB 4ISCA 9PCYA 2WWTA 3OUUA 4TZ6A 2BAGA 3CVOA 5IEBA 2X3AA 2JLBA 1JZSA 3UJ7A 4HXEB 4HQLA 4JFFE 3RWJA 2RKOA 1TNNA 1OOEA 5CLZA 2HV8A 3GIDA 2VUIB 2JJVA 2B0SH 2YEZB 1HN1A 1E9OA 1NEZA 4J3WA 2A5GA 4XZ3A 1BTOA 3PXCX 5HHPA 3F3MA 3DSFL 1PJ2A 3PQCA 5E03A 3S2FA 3AT1A 1EHYA 2V7GA 5GISH 3ZKMD 1JA1A 4U2DA 1IHYA 4E5UA 3THRA 5JV5A 5LMUB 1U36A 3DPIA 4K7FB 3S8GB 4TVPE 3UMRA 5KTOA 2C95A 1H2BA 5D2NA 4Z3TA 4Y0NA 1DANU 4JG0L 1NP6A 1KFKB 2MPVA 4NJ9L 4AW4A 4ZVRA 3T77B 4WF7A 5IFHH 1WD5A 1ORQA 3N2GA 3RJ5A 4B4UA 2H52A 5I7UA 4N39A 4YDVB 4AOFA 1NQUA 1CF8H 3EO1A 1P5VA 1P2TA 3S36H 3D5EA 4GW1B 1TIKA 3C8ZA 5AKLA 5C0JB 3K5SA 1CDJA 4F2PA 1VB3A 3B7GA 1CGSH 3IJPA 2H3EA 2NY0B 3TYXA 3BW9A 3R4RA 2XQFA 3V7AE 4DVRH 3MV7B 5IWLC 2TYSB 5CGMA 4BFOA 3JRNA 3ZTNL 4HAGA 4OUOA 3X2EA 4WZAA 4QXQA 1TCUA 4UBOA 1QRND 3IUNA 4CHGA 4LXXA 4E22A 2VT7A 4JPVH 3WFDH 5CB4A 4TLBA 1ACJA 3W6ZA 4APXA 4M93C 1E1MA 1C50A 4BKOA 2C4FT 5J9PA 2CJSA 2VAMA 4L4XA 3EJRA 1BIIA 2YWCA 3TL5A 4L9LB 2P5UA 5F9JA 3WLQA 3MRXA 4Z7QF 3ZJ4A 2VCHA 3VFSA 3RVNA 5FF9A 2ATPA 3HVDA 5D84A 1PG7H 1OWPA 5KVGE 3RZCD 3IXAB 4C7OA 3QHZH 2BFFA 3RTQC 3IGAB 3EN0A 2X4PA 1XGYL 4WERA 4QJ4A 1E7UA 2X1QA 5FUMA 5FUWA 3ARDB 3VW3H 4DTCA 1I7ZA 1KPUB 1M34A 2WAOA 3KAKA 4BMCA 1IGTB 3GMOA 2ATCA 4Q6BA 4JFQA 1E2MA 1KI1A 2AOUA 3SODB 1VEPA 3NX4A 4BFWA 3T4AA 3CWQA 5DD5H 4Z0BH 2KZ1B 1BYPA 1YB5A 4P80A 2F54D 2H47C 1U8HB 5F1KC 3RBXA 4UCQA 3OF5A 2FPSA 1CUVA 2DQSA 1YZFA 4FSXA 3NWJA 1T1XB 4YRZA 2XG4A 1JHYA 2DH3A 3CSSA 4FGMA 1EWQA 1B8UA 2PUHA 4DV3B 1WICA 3QIWC 3AGPA 4HDRB 3VR5H 4OIMA 4WCDA 8ATCA 3GSRA 5I7FA 3QF4A 3SXJA 4K9EL 5D5PA 4CGZA 4LLDA 4TYUA 2AN4A 5HDBB 2JNWA 2H4JA 5I76A 5KC9A 2RHHA 1IBZA 4QRSB 1W30A 1A2BA 1Q9LB 3DQZA 1ESZA 2FA9A 1T6ZA 1OCZB 5HI4C 2OP1A 3P0EA 3AB0C 1S7XA 2WZBA 5E1IA 3UZEA 2Y0DA 1H8HA 1H5BB 1J0IA 4D92A 5K0GA 5DWDA 1PR3A 3BFPA 1GZPA 3KD3A 1KEWA 1R4ZA 3E8SA 1X2EA 1L1QA 4R1NA 1XEUA 3VM7A 3HG2A 4EG8A 3B13B 1EB9A 2FEOA 1KF0A 1ZLWH 3FQNA 4Q8BA 2WU4A 5AP9A 2R23B 3DOUA 1KGJA 1P7BA 3VYTB 3RB5A 2FK7A 1SXPA 5GSRA 5HYJE 4DS3A 1M0SA 1FUUA 4W81A 3DDZX 4C4KO 1B1AA 5IG2A 5HF8A 2LKDA 3U6KA 1QPZA 4K87A 1WHTA 1L5FA 5JQIB 3N1QC 5AWFC 5DRZA 4J0CA 5DMKA 2VPIA 5DGIA 4BQ8A 3WNLA 4RDCA 5IBTH 1NUDA 3GPSA 2F5AH 1OX4B 1X1BA 1E79D 4FN5A 5JLJA 3QI2A 4QYIA 2OL3B 2FX9L 3O31A 2PETA 4WO0A 3PX7A 1BCRB 3UMBA 3MRJB 1L4YA 1JU4A 3HBAA 3KW7A 1IWOA 1I85A 5AG9A 1I9JL 1RU9L 3N2GB 3LTNC 3UJDA 2PBLA 3IILA 1KERA 5DK6A 4Y30A 1G5GA 4NOFA 4F2WA 1FLRH 4P32A 1XGQA 1NJGA 4CV0A 1MQKL 2D5BA 2Y0EA 1WDAA 3R3UA 3GDFA 4OYHA 3SDDD 1TJ3A 3KQNA 1PK7A 2UZ0A 2GPBA 3DV0A 1XZCA 2O20A 1A14H 3GP3A 4KK4A 4P06A 3H2HA 2RHCA 4DCVA 3RWFA 2FX5A 1FP2A 5DGCA 3VXSA 1C7ZA 5K93A 4KV5E 2Y93A 4YZFF 3BGMB 1XP8A 5KPDA 2C57A 2WLIB 4CVXB 3DL0A 2BCKB 4JKPH 4WZBA 4BECA 3NDPA 3AWFA 1GQRA 1A9YA 3PNBA 1M2HA 4M1MA 1ODSA 5EI5A 5C08E 3C39A 1W35A 4Z3GA 3QPXH 1CFQB 1IKNC 1RYMA 2I2XB 2HA5A 1UOLA 2WXJA 1QPKA 4X84A 5ENVA 2YR3A 1UFRA 5UKDA 2AXNA 4G09A 3SS7X 1K6MA 4AIZB 5A3ID 1S8DA 2HFGH 1N68A 1TVMA 1EIBA 2CDEA 1H6AA 4LPVA 2BC4B 3RWCB 3HWX1 4RWYH 3K2UL 5IJ0A 4E2WA 1QZTA 2FE0A 1OOWA 3N0PB 1K7CA 1ZIAA 4ZMLA 3LWNA 3Q1EA 5KYUA 5JZBA 1V9CA 4OGYH 1OXSC 3AVEA 3WSTA 1WZAA 2M2DA 3QOFA 3PL6A 1LTQA 2YAEA 1OLUA 4O2AF 1EVTC 4BJHB 4OMDA 3W11D 3ULVF 4ABYA 1YL6A 5E9DB 5I1GH 3KEGA 2C77A 1R8XA 4DRXB 1J9EA 4AQEA 1E2HA 1CR6A 3PWPA 4I9NA 3MINB 4B48A 3D02A 2BDNH 1TW2A 1UA6L 5KSPA 2B82A 5TDNA 2DMRA 1NU6A 3K7EA 1SQGA 3RTEA 1XQ9A 3QMVA 4W5NA 4FW8A 1IM3A 3GKZA 2D7JA 1JNYA 5JH7A 2C4VA 1BEUB 2EWMA 5F89B 1ULVA 2OMXB 3L7EB 3WLWD 5FWAA 4ICIA 3UV7A 5C0AE 4C4KT 1TVBA 1KPVA 2VOEA 3R18A 4RISL 3V3TA 3FR8A 3PQ7A 4N18A 3VD5A 4FXOA 4N0EA 4RPCA 1I4WA 1JGDB 5K4GA 4EYQA 3C60A 3EC7A 3CPHA 1KK2A 1GXSB 4JA0A 4UNVA 4NO3A 1T0MA 3IQZA 3W8DA 4BZ1A 3R0MA 3ZQKA 2AFIA 1XG5A 1B2RA 3HG1D 5IMOB 4IGAA 4GMSH 1LK2A 2JMRA 5K3DA 3V6MA 4K4KA 4MJHA 4FYHA 2D0IA 1LRLA 3MCZA 1E6LA 3VAZA 5D8JH 4KIWA 2J4WH 2BVPB 1DFIA 1NMAH 1ZRHA 5A2IH 5BO1L 3QWIA 2XX3A 3AW9A 4GQ9H 1V8HA 5HKKA 4HGZA 3BTVA 4XWOD 2IVFA 4Y5XC 4ZMSA 3G6KA 3S4SA 5CEZE 5T3ZD 2W8BB 1JK9A 2FEAA 1KGXA 5AKRA 1NQWA 1WLYA 2CL7X 3GNQA 4FQQA 5FKJA 3WIIH 4A2QA 1P7HL 3GF4A 2IQAB 1RFLA 2Q0XA 4XBGA 1HE5A 5TJHA 4YL4A 2G1JA 3N39C 3UJIH 4FMCF 1KZQA 4ZFZB 1IBFA 3DHJA 1SXJB 2BS71 5CBPB 2WE8A 4FHKA 5KYNA 2RGDA 3JASB 4ELDA 5KVEE 4C4TA 4D9QE 3NJKA 5FGBC 4AP5A 1TU2B 4S24A 5D7SH 2H5JA 4DFDA 2BR5A 4JQCA 4RUKA 3E9CA 1DLFL 1ND5A 2Z8SA 3WE6A 3WS6A 4MQ5A 3KXFD 4X4MA 1G20E 5DV9A 4LVOB 4MA4A 4CVNA 3DC2A 3D2AA 4I08A 4ZCLA 4LC9A 2VH5L 4RCVA 2A0YA 2OV3A 3APCA 1MQSA 1PS9A 3CHSA 2AITA 4UOJA 2FJGA 5K2MA 4ERSH 3HVJA 1VPTA 5IT5A 4WBSA 1Z39A 5I15L 3T5TA 3DWFA 4E1AA 4WUVA 1WMFA 4Y88A 1ZM4A 1ROCA 3NDRA 5DCLA 4QRRE 1A0QH 2EEDA 2WWWA 2A1WH 4J3BA 4QUGA 3NBAA 1EZVX 4YRSA 1X1CA 4BQ9A 1T91A 1VI6A 1UATA 3ALXA 4PX2A 4ELME 4EH1A 4YK4B 4EF5A 1ZVYA 1Y6QA 3L3HA 2IXAA 3FUEA 3WTXA 1MCHA 4A10A 1MOZA 3EBAA 4OIAA 1NI3A 4ZYTA 2HHAA 4TNGA 3Q3JB 3VWKC 4TMVA 4NYIQ 4MYDA 4GPZA 4Y2LA 1YDEA 1LO3H 3AG5A 3FI0A 3AVUA 2WD9A 2EXWD 5FM5O 2ZB7A 1IGJB 4KLZA 3IDXL 3RUIA 1N77A 1OEZW 4P23A 3TO2A 1TVHA 3DMMB 1X9RA 3GJEA 4L4VA 2HADA 2J6IA 3CZRA 1V96A 3EUAA 1P72A 1OLUB 2WINB 4HFRA 2LKCA 2GPTA 4Z3OA 1J9SA 2VXOA 2P8PA 5KJFA 3H9SE 4LG1A 3I75A 2J07A 3BE5A 2MRYA 1SVOA 4XXCA 1DBSA 5J12B 2X4RA 4K9KA 1FRGH 2ZUTA 2DY1A 5T1JA 2NXYD 4PAWA 4DY6A 4QJ3B 1EP1B 1PUJA 1AKQA 1TC1A 2O59A 3PDJA 2H6UA 3NT4A 3ALPA 1TJMA 1OXVA 1RYYA 1JG9A 1Z5OA 5IFAH 2BZSA 4RH3A 2OV8A 4XP4L 4DCGA 3DX4A 2IYEA 3QG6A 2G5GX 1T36B 1BCSB 1TIUA 3ZDEA 3SSNA 3STLB 3AR9A 1R5WB 4YHYC 3G5YA 1Y3DE 1K3FA 1NGQL 3VOBA 3NOOA 2GY5A 2PD3A 3BFJA 1KYXA 3MCVA 1NIDA 4G56A 1GKEA 1IQWH 3DROB 4U0KA 6FABH 1C08B 3F67A 4TV9F 1ST3A 4XX0B 3T77A 3HJNA 1SRRA 1BVNP 3FC8A 1Z0NA 3ESXA 4WHTB 3MXOA 4I4WA 4P46C 3FAKA 4DMFA 2X87A 3GO1L 4BFKA 4JO8A 1Z6YA 4QRTA 3O9WA 3H75A 2VHUA 4DLKA 2EIMB 4MUGA 5TQ2B 1QFSA 2E3JA 3U4EA 5G4OA 3UWSA 4Y16C 3RG2A 1KOGA 1T5BA 1YKFA 2FB9A 2JBHA 5FGCB 2ZM6B 2YLHA 3QJUB 3ZTTA 5ALCH 3H55A 5FYKL 4BWVA 3EK2A 3UUGA 2HRHA 1Q7EA 4S1VA 4J1NA 3OPMA 2OBLA 3NA4A 1D6NA 4OI1A 3G5UA 3R7AA 2XF2A 2OSLB 5BV7L 1HIMH 3D33A 4YASA 2N1BA 3W0WA 2X12A 1QZ3A 1V7PC 5EPMB 2XWXA 4D0DB 4HS8H 4HQFA 1GL6A 3ZE6A 2VF5X 3GBPA 1GXEA 4A2DA 2QZZA 1OXTA 3VDQA 3QEMA 5EUCA 1PF3A 1CYDA 1LGVA 3MV7D 4G6AC 4LDCA 1NQXA 2I26N 3B1TA 1CJKC 5FIUA 1ZLUK 4PGCB 2GLTA 2C2GA 4BZQA 5J63A 4B32A 4L1KA 2ZB4A 1U91B 2BFCB 2XD4A 3QDMB 1Q6ZA 1D5MA 4LSWA 3ZXUB 4MNQB 5AUPB 3QFGA 2WO4A 1SG6A 1NW9B 2XVZA 4HSCX 4NQDB 3MRBA 4UNSA 3U0BA 1SBYA 4P93A 4K07A 1D0SA 3OTHA 4AK9A 1U4EA 3FQXA 3T1QA 2R0LL 4RKRA 1LPPA 3EF7A 4JPWH 1BDYA 5CG1A 3LA8A 2DQKA 4IDLA 4MYUA 1I75A 5ACZB 1SQ5A 1WXGA 1CT8B 4UAOC 4BIIA 3X1GA 1NBMD 1M2FA 3ASVA 1CRPA 4LBWA 5ALBL 4JNXA 2WOYA 2V7VA 1Z56C 2QM3A 1R9FA 1YGPA 3L4SO 3PQYA 1WH0A 3CVJA 4PCLA 1EXHA 4PJGA 2QROA 4XOCA 5I16A 1GDHA 4TKUB 1EUZA 1HYQA 3G2IA 3MERA 3FO2A 1BE6A 2F1HA 2P80A 2YR0A 5DWVA 2JAUA 2AN3A 2PUAA 1R0AL 4E2OA 1SZDA 3DFUA 3GFTA 3E6HB 1TZBA 4H44C 4L28A 4QWWD 1UZUA 5ANMB 4CMJA 3HG3A 2YMXL 4MRMA 1TZCA 2MHCA 1XFDA 1ORWA 3CINA 4OD0A 3KE9A 3UUEA 2AR0A 2YC4C 2O8DA 4AL4A 4TOYL 2AEQH 1WFOA 2L3BA 2O4UX 3IF1A 1A4JA 3EGDA 3EAQA 1WTLA 3ESQA 5D7JC 2J09A 5BSUA 1T1XA 4Y1TA 3S6JA 2EDYA 2A84A 4UXJA 3RVLA 2OR3A 2WBJA 1JIJA 5HYSB 4GBXD 2GH1A 3FB5B 2H0EA 4HDAA 2Z64C 2WTUA 1T7WA 1QLWA 3I2GA 3HB3B 1HEIA 1M5UA 1BFVH 4IO1A 1N2HA 4GMXA 3C6XA 3EO9L 3DOIA 3QXGA 3NIDB 5KVFE 4WK2B 1KJ2H 3FH7A 1E8DA 4GNKB 4O2AA 1OB5A 3UPDA 5KSBF 2BFBB 1J8HE 2JCCF 2NTFA 2O3TA 4F5CE 1TFPA 2BWIA 3QVGA 5K6AC 4DDUA 5DT1L 3HB5X 4N3GA 5FR3A 1QXSA 2ZQ5A 4HQRA 1BRTA 4BKLA 2VE6A 1E32A 5INDA 5T3UA 3PAZA 3S5LG 2QKSA 3L84A 5FLKA 1HL7A 4L5FH 3O3CA 5CYPA 5T3YA 2AZAA 1R46A 5DJYA 1DS6A 3K46A 1EVQA 3MUJA 3T2PA 1NPJA 2YUIA 1YAZA 1VCIA 4XNYH 2ZIVB 4YMVA 5GJWC 1QRUA 4LVOA 1VGVA 4LJAA 1T4DA 5JTUA 3TQSA 4NC1E 1YYMH 4B8ZA 1XH3A 3SDXF 4M0DA 1L7PA 3OXRB 2JIQA 3GO4A 7ADHA 3M70A 2V2WB 4GSYA 2NY5H 2D4AA 3VH1A 4HO1X 3DYMA 3PEVA 5JORA 4F06A 3RC9A 4RSYA 4FUQA 3TZVA 2OCJA 3G6DL 1CVRA 2AC2A 3D0LA 2WFZA 4L3EB 1XB2A 4M9ZA 3MBOA 4ZMXA 3HPJB 4GW1A 2DP4E 3LCVB 2QSCL 3FHCB 5TDPA 1CQIA 1P77A 3HB4X 2BJVA 4GRLB 35C8L 2W6MA 2XECA 4ORGB 4BUCA 4MAAA 5LMCA 3T3IA 1L4HA 2WU0A 2W2LA 3C60B 3HN7A 4N7RA 3GSNL 2HJRA 1XRQA 3UPTA 1XR8B 3IOBA 5ELLA 4JL5A 5IT2H 1T5OA 3MRKA 1HSBA 4JLUA 3KZKA 5I73B 1BZ7B 3UHJA 1SXZA 1QFZA 3K70B 3CLFL 3TVDA 1EEHA 4QO1B 4EJFA 2HT1A 3RY6A 5M94B 1PJWA 4JV5B 1PGNA 1TEYA 5I4KA 4RGOL 4NO2A 5D51S 3MOQA 4N6QA 1JVBA 3UOAB 1QLRB 2JLAA 4YNYB 3NFPA 4Q05A 2JLSA 4WSOA 3GJXC 3RRXA 2VP9A 2BJHA 4ZTOL 2AJCA 1KJQA 2BYTA 4S35A 1RHKA 3IJRA 3ANYB 4IYKA 4J3VA 1QRAA 2RGUA 3S2CA 5J2TB 3TWYA 3D8SA 4M7RA 3O4JA 5J9PB 1X7WB 3P0HA 4G9BA 4FLSA 4JFFA 4IIGA 3H8JA 2XN9E 2I1QA 3VXMB 4P82A 5GS1A 3IJ9A 4C05A 2F43A 1TK2A 4F8TA 3FSJX 3JXAA 2FJFB 4JO2L 3D8RA 1LHZA 1NKRA 4XXWC 2YWHA 2ZRJA 4U1SB 4DEWA 3K9BA 4AF8A 2PGIA 3OFJA 4EGFA 1P53A 3DBHB 2CDEB 4IV8A 3NDBB 3GARA 4JMPA 3UCRA 2PSDA 4JI7B 5KANG 4WESA 4D8TA 2BXYA 1NX9A 1MAJA 3WL8A 3N40P 4PRPD 3OKLB 3MGKA 1U63A 3LE8A 4NWTH 4TLTA 4ZMRA 1SC6A 3DX7B 2FPGA 1KXHA 1MZVA 3U6BA 2NUTB 4Z7VB 1Z75A 1JR6A 3E1KA 3FFXA 3IDAA 3NTOA 1Z2OX 1CQKA 1G20B 1LDPH 4Z7WB 3MF4A 2IYXA 2P1DA 3S8YA 4WV1B 4J2XA 2SCUB 4B6SA 3I8OA 2B35A 1NY5A 1TEGA 3T04D 4P98A 2XN9D 1ZY2A 1UWXH 4RMUA 3U09A 4MWGA 1MC4A 3TZKA 3WSQH 2B30A 1V2HE 2I6UA 2IDQA 4EO4A 1L5KA 4R9NA 1AC0A 3HHMA 2H1LM 1C0LA 3K71B 1VOTA 3LT5A 3QV1A 1EJ2A 1LVGA 1V26A 4JJ4A 5EUQB 5JQWA 3DMHA 5K1VA 3JYLA 4I81A 2DLTA 2XYQA 4IRUB 4FE7A 3MQ4A 4DPAX 1EWRA 1LD9B 1OV6A 4EG4A 1UM4L 4NMLA 1P4LB 2BP0B 3T9DA 4GFTB 4KRNA 3LBAA 5AYQA 4BRUA 4CCAA 2ZJBA 1BP3B 4OY3A 3D3NA 2NY1D 3VI4F 3N86A 5JCXA 1M2KA 1DQNA 5HGXA 2AJBA 1O96A 4P99A 4UNRA 4KXBA 1Y1LA 4PBVC 3WGMA 1Q94A 4KK6C 3HJHA 5L2JA 2Q0SA 2ZJ0A 2P4EA 5BQFA 2WXKA 4UT7H 3JBG7 3EY4A 2CXOA 4QT5B 1DVRA 4IKLA 1K3ZA 5EJEA 3ILEA 3MT0A 2C1PB 4KR0A 3BI9X 2IXTA 3VHQA 3KL3A 3ZBUA 1I85C 4K7JA 4BPRA 4TXHA 4AK2A 2DQIL 1Q6YA 4CUKA 3O45A 4HQQL 5AKIA 2WVAA 3LZLA 1YUHA 3OCJA 3PR2B 1SIUA 1NPUA 2G83A 4GQIA 3V34A 5GGUA 5I9TA 4CR7A 4H4CA 3LXRA 3PWUA 1LEKB 1XD0A 1HZKA 1FYDA 3CUPA 4MYPA 1AR1C 1RERA 1G9NC 4DPBX 4WFKA 3QENA 2A0WA 3GFQA 1FRQA 5FO7A 3NTCH 1H2RS 3DFIA 3W78A 5ANMA 3UXEA 9ABPA 5JZ9A 3AR2A 3WR5A 1EZ4A 3CZSA 1S2LA 3ZNPA 2B4TO 3CLRD 5K39B 3VXPA 3TPUA 4PS3A 5SYMA 3BLPX 3DNKA 3UTDA 4P2RA 1KB3A 1YI0A 3QFHA 1AQNA 3F49S 4N49A 3M5CA 3UACA 3GEHA 4YP0A 3RYCB 3FPAA 4MJ7A 4XLLA 1D9KA 4MHHI 4MV9A 4PZ0A 3R9KA 4KOBA 4LOVA 4N2HA 2DTMH 3ULKA 1TPXC 4XNQA 5I8OL 4QCIB 1GAXA 3AKYA 4NE7A 4BE7B 1J97A 4KLCA 2G6BA 2Z31B 4AS3A 3AAZA 4WLUA 3NHAA 5AOJA 4Q03A 4RK5A 2LIVA 1PW5A 2ROYA 5ICYA 4YHLL 3EFDH 1G5FA 1RPAA 4LVHB 2H54A 3WXBA 4ABUA 3GSOB 2WLSA 3TINA 4TVPH 1BXZA 4BNJA 2FPIA 1TZHB 3H83A 3JV7A 3R8QA 2HMSA 2WF6A 5JSQA 2VPQA 2OILA 3LV3B 4MYSA 2XG4B 4PB0H 2J9ZB 4KO2S 1N36B 3IAS6 2C7PA 3HVHA 2HVJB 2V98A 5CH5A 1F3RB 3GEMA 2DEWX 3FG9A 1ZUHA 2XQYK 2OULB 4NMHA 3GMIA 1FAKT 3MWGA 4P23D 4I9WE 1JEQB 2QL9A 1NCAH 2VCOA 4A2FA 5FNZA 2M6LA 35C8H 3TD9A 3MWEB 3NIFF 1MW1A 3KDPB 3O21A 5LKRA 4MI6A 4FNSA 5BUQA 2FX3A 3DZKA 3PDDA 4GT0A 5JHHB 2P67A 1N9GA 3QBDA 4X6LA 4HOWA 1SVIA 5BVHA 3QQPA 3ECSA 4Z4GA 1YUNA 2BIQA 4KWHA 3RARA 2QBYA 3F6LA 2YD7A 4RNDB 1Z6GA 1XDDA 3DONA 3SDAA 3RF7A 1YZUA 3VSTA 1HC7A 1NKVA 5JS1A 4R84A 2GJ6A 3N3BC 2WMPB 1NDMA 1JKXA 3I28A 2AJ8A 1FFNA 3DBLB 4AGPA 2EJTA 1TF7A 3IC5A 1EK2A 2NXZB 4RXUA 4J7AA 2ZJ4A 3PL6B 1Z29A 4L5FL 4CFYA 1FVHA 4XYMA 3SPJA 3Q2WA 4R7XA 3L4UA 4AZ3B 4FOPA 2HXSA 4DLYA 3FTFA 3CONA 4TOYH 4BSJA 2LCFA 4YLGA 1KIQA 3DEKA 4NC2B 2YDYA 3TH5A 4E9XA 1L4MA 4TSAL 4ES9A 1PGOA 3IQHX 4KO6A 3R7DA 2C7QA 3ZHVA 1FJ1B 3CLEL 1AR2A 3RVXC 2OM2A 3BAJA 5K8IA 2PVCA 3GZTB 1T5IA 2BFWA 3EF0A 3FCTB 1P1KA 2AYXA 3U1TA 4TWJA 4KLRA 3EVFA 2O5EA 1OT3A 5JHDB 2F17A 3MPOA 5H2BB 1VGRA 3W5BA 4N8VG 4CEHB 2QXYA 2XXMB 5HVHC 4TXNA 2O2DA 5KQSA 2Y92A 4OB8A 2A88A 4URWR 5HHXL 5E6IA 1ZU4A 3AB7A 1K92A 3VKWA 1A8PA 2DT5A 3LPPA 1YN6B 4JLMA 1WPRA 1FL6A 1F48A 4AZ0B 2FEEL 4CIDA 3PRJA 5KVAA 3NHFA 3RIYA 1B90A 1UZMA 1XH3B 1RCYA 3QPWA 4IOSA 2AZ4A 1DVFA 5BRPA 1NEPA 3TN0B 2OYRA 2CK0L 1VESA 1HT1E 4ODHH 3A6GA 3BVNA 4JUIA 4HZGA 3ZDZB 3GSXA 4IKEA 1PX0A 3Q2OA 4KUHA 4OLVL 1XD2B 2XYPA 4JENA 5A7BA 1GR1A 3SZGA 1JDJA 5IULC 2OL4A 1M72A 3IPAA 3AUFA 2G3NA 2FUG6 4UUQA 3L95A 2VLJA 4WY7H 4R9UC 3GUFA 4ZHQF 4ZVOA 1GWNA 1GSMA 1EG2A 2Z7ZA 2IRWA 2R60A 3KLBA 2BFDB 1EJOL 4PI0A 2HJGA 3OV6A 4NAHA 5B12A 5A4JA 3FVWA 4BVAA 5T1KA 2B1AL 1NSFA 1NAMA 3FJ1A 4TSBL 3DZCA 4BNKA 1LS6A 2R4RH 1GA2A 1C12B 5AO9A 1OE3A 3MS7A 5FCUH 4AN1A 4PRIE 1NX6A 4HUWA 4NN5C 1AKJD 2VYQA 5KS9F 3A6ZA 5H9VA 3MBXH 4TYYA 5DJXB 2VPPA 1M7HA 1TSHA 1Y82A 1DP0A 4M99A 5D85A 3G59A 3BXEA 3E1F1 2OSWA 3ELQA 5T1MA 4L3WA 5EMLA 2KHZA 1VL6A 5FBKA 4UDTA 3LKOB 1I3CA 4FLHA 1WY7A 1IKFL 1KTLB 3T0DA 1AC5A 1CZNA 4QRRD 2XYBA 4GSDH 1PKQE 2X0DA 5IW3A 4V1CB 1FJHA 5JD3A 2BRQA 1BJMA 1TKWA 4UT6H 4ODSL 5GS0L 5BSEA 5K0ZA 4PS7A 2RH5A 4YFLI 3VXME 1G1OA 2C4FU 5DJ5A 3OY2A 4UV4L 4JB2A 3H0CA 5FYKH 5EZQA 3BEVB 2EL7A 3JQFC 2KDGA 1KBZA 3HJBA 4U6YB 5F7ZA 1YNOA 1R3UA 3QIBB 3CNEA 4KPHL 4QGFA 1AHHA 3MGBA 4PGCA 4D99A 1P75A 3L5XL 4HAZA 3SPVA 1MR3F 2JI8A 3B2QA 2XITA 1V41E 3ZSSA 3UTQA 3RY5A 4RKFA 3R9XA 4R8WH 3ULSB 4N8UA 3MN8A 4I3SH 5E1AB 1UBHS 1HGXA 1YB7A 2VXTH 1I3GH 2BLLA 1S9VB 2VWPA 3KQOA 2GYUA 1KJIA 1EFLA 1TFRA 1ZCZA 4B9ZA 4B7ZA 1GZVA 2BVTA 1S9WB 5F89A 1MH1A 2NZVG 1U1DA 1OI3A 4DN6A 5HCIA 1ZD9A 5G0TA 4MNQA 4UQBA 4GAYB 4WSGA 1NBVH 2ODAA 5DQDL 2QRLA 2HNKA 3OZUA 1H0SA 3MJ7A 3U26A 1JIXA 2OSBA 1AH2A 3ZVKA 4ETIA 4XWKA 2LLNA 4DTGL 1PZMA 4UM7A 1X15A 3X1FA 3UG7A 4OD1H 2EQ5A 1TA9A 1HHJA 2ZIWB 4XB2A 4GYWA 2WIMA 3BN3A 3VR3A 4ERSL 4G8FA 1PJ9A 5G1PA 5HXAA 5JADA 3IRCA 3DL7A 1C4KA 4Q1AA 1NI4B 4F8YA 2W2LD 1IY0A 2VP0A 3ZDRA 1FLTX 5D7BA 3IDXH 3CH4B 4P4KB 1EUDB 5J6HB 3RHZA 2Q21A 2XJKA 5E7FA 2GXAA 4TVPL 2R4RL 4P9MH 3BRWD 3WZ2A 4PPFA 5EMYA 1A3CA 4QGHA 2VXUH 1E66A 3HBLA 2H1XA 5BZXA 3R4VA 4LOHA 2WLTA 3MJTA 2IWEA 1KJMA 3PHBE 5F7FA 3PHLA 4RCZA 1YS9A 3IAM1 1LPSA 2ZJYA 5CX1A 3LTEA 1IV8A 1RULL 1B6GA 3JQBC 4PGJA 4M03A 1LE5B 1HDGO 1IHPA 2V7BA 4ZX5A 4MUFA 4OI2A 1UK8A 1OH8A 1NGZB 5BVGB 5T3ZL 3UTSB 4UDXX 1TCCA 3QH3A 3NJIA 2ZUXA 3P0IA 4CGTA 3GMLA 1VLXA 3REVA 1TMQA 5G53C 2V7TA 4F3NA 3T8YA 1RZIA 1A50B 1R88A 1H3UA 4BZ2L 3QE5A 5I7AA 4C58B 3SHTA 3NH7H 3BO8B 1E3IA 2OCIA 4P5RA 3SX0A 3FUWA 1DTWB 1GA6A 4M7ZC 5G0UA 4IAOA 1OH7A 3TAHA 5D9SB 5C70A 3D3VE 1RAMA 3HCCA 2PW2A 4XWOC 3CK0L 5JIMA 3KM1A 1W75A 2VJMA 3WI7A 3T1NA 2E7LC 5IGXH 4ZTPH 4JXJA 4NZYA 5GONF 4JMNA 3OLZA 1MRCH 4JUCA 5FFOA 5AVZA 1A7BA 2WD0A 4HUUB 4NAQA 3HS0C 2G25A 3QQDB 2OO7A 1TUBB 2XIJA 3LDBC 4LQ1A 2D73A 4Y1RB 3P4MB 4Z0HO 1KFCB 1CDOA 2PNJA 1TDQA 1ORHA 2WXPA 5EJFA 2CXRA 4JM2A 1C9EA 3SLGA 4IU3A 4XEUA 1U3JA 3X13B 4C5BA 1FDTA 4NZFA 1E2LA 3MAGA 3TLGA 2DB3A 3H1BA 1ILUA 3BUBA 5F33A 1JI0A 1SN5A 1CLOH 5G2NA 4JQXC 1A7PH 3ZWBA 5ISZD 3FUHA 3USES 2MFNA 3DV2A 4DR6B 4ZTEA 5ABAA 5GZ6A 2DYSB 1PZHA 3GXPA 3IDJA 1OHHA 3L2OB 3MXTA 4MA7H 3DF9A 5FECB 1EO7A 5CIYA 1KAOA 2Q28A 4F8NA 2OECA 5AWNL 1I31A 5D7EA 3IRVA 3N8DA 5B4UA 3M17A 2VOTA 3A3OA 5EJ9A 4DADA 4E3ZA 5L51A 3G9VA 1H3XA 2EFYA 1J5IA 3RPEA 5F64A 4EKYA 1S7XB 3RM3A 4G8AC 4XIFA 4WJ5B 3CM0A 1K8XB 1YNTA 1L4LA 4K8RB 5EZPA 3RL2B 2WU8A 3DFMA 2WBLC 5JIQA 4K7PX 2QYTA 5LKNA 3KOWA 2YD6A 2FUCA 5BV0A 1JP5A 4TV3A 1HQRA 3F62A 2BCEA 4Q7MB 2VITA 1QUPA 4AX4A 1N6RA 3AM3A 1DJQA 3QPXL 2BSRA 5SWSB 4UC0A 1KPHA 3K4ZA 3UATA 1QRDA 3G7UA 3IDOA 4AKSA 2Y36H 4NO0A 4AUUA 3R24A 5I9BA 4BKTC 4UAHA 2OQIA 1W19A 3FH5A 3Q10A 5KU7A 1B6UA 3B2UD 2I22A 2JGJA 3F8SA 4KJWC 3VBEA 4WCFB 3NSCA 3DO8A 4R4FL 3ORHA 2QORA 2WGXA 1LEIA 2QX7A 1AGCA 4HLNA 4C56D 4LVNA 1WV0A 2V9PA 2JB6A 1YLBB 4OJQA 5HG0A 3EYAA 2A9NL 1KS2A 2PWZA 1WF6A 2D0PB 4B4WA 3KHUA 2GTZA 3PFNA 5A3JA 4LJKA 1RPQA 2RD0A 3CKYA 5DVNA 2C34A 5EFZA 1YHZA 3G9ZA 4EEXA 2F19L 1N32B 3QS2A 3KOXA 1DCKA 1ZXBA 1OARL 2ZSFA 4P3DA 4LDRA 5FCDA 2WBXA 3GLIA 4AKGA 4AL8L 4JM2F 5ETUA 1A7RH 1EE1A 5IEJA 3BMNA 3D8HA 2QTEA 5LD2C 2IS2A 1DWPA 1OI7A 3OZCA 5CG2A 5F9JB 1IJEA 3E8UL 4FWIB 3N85L 1RHFA 4RKEA 3HSSA 4PWHA 3EHEA 1S9KC 3TCKA 3OMNB 4G8GE 3KL0A 1RPJA 3PR1A 4NFDA 5LZ7A 5D71H 1CP3A 3HRZA 1EZZA 3MUFA 3TBYA 5JJLA 4UQ3A 3ABSB 3TF7C 4MS4A 1IQDB 1DO6A 2JFQA 2WQXA 2PT6A 4O2EA 1Z4NA 5BS0E 5IJ0B 1J9TA 2G4LA 4Y6GB 1KNOA 3V4PH 3JQ9A 3LOPA 5T4HA 4RGOH 3QKSB 1OCOB 1K4CB 1RAAA 2DQ6A 1UZ6E 1MLDA 1TIPA 4WXMA 1BWPA 4X0KB 3KTAB 4XE0A 3OOWA 1NVAA 1QFOA 2PZKA 4Q3CA 2Z35B 4M8IA 5E9DE 4YSEA 3CPLA 2UYQA 4JEUA 4PWIA 5CLWA 3SYOA 3H65A 5AW1A 1WZIA 1OHHD 2W38A 2XCIA 4DN3L 2I2WA 2ZK7A 3I0NA 4BUQA 3BK2A 2XW6A 3X1NA 4A7GF 2UWEB 3CRQA 3HPQA 3JWOL 4AEIL 4TXJA 4I8IA 1S7WB 4IOIB 5GRVL 3AVOA 4TVSA 3WKDA 2EDBA 3WMQA 3DOOA 4P2YA 2YAQA 1T7YA 3CD4A 2EW8A 4GOKA 5BWNA 12E8H 5C0OE 3PV6A 1YR3A 2FZWA 5I66B 4U4IA 4FEYA 1YJCA 4UTBL 1C29B 1R5WA 5I6OA 4WAUA 2VUYA 2G09A 2WZDA 5HVGB 3DLQR 1VJ0A 3WN5B 4GPBA 2VSYA 4ZQBA 2IYFA 4X6CA 1ZR2A 4YXLH 4FC3E 1CFNB 2ZTUA 3QIUD 5ITBL 4AMZA 2X4IA 2WJVA 2BZDA 1DRKA 3J81A 1CG9B 1X7XB 3K4QA 4X6EB 5HHNA 3KDAA 4GYJA 3I5MA 4ZMTA 1FDOA 1C9NA 2X8AA 2MR5A 1FNGA 3AIKA 4U6HB 3HI4A 4R2GC 2JLVA 2IUEA 2O8EB 1TOAA 2HYIC 4HIHB 5EMHA 4JFEB 4QRUB 1KK3A 3FCCA 1N6IA 5AKSA 3ZBQA 3FO0H 4LCBA 2GKOA 4E41A 4H7HA 4MDJB 5TVKA 4WBNA 1AX9A 5EF3A 4EDFA 1N4XH 2I3GA 1J48A 2NSMA 1KFBB 2PD6A 4JSTA 3PPVA 2ACWA 5IKPA 3QYPA 1H66A 1RXVA 3BQUD 1ISIA 1CU4L 3BGOS 3KEFA 2BFVH 2EDEA 5FO8B 3X2FA 4WENB 2Y77A 1DO5A 2Z6UA 4AJEA 1YNKL 4MAUH 2F62A 4LOEA 3KJZA 2V55B 5DW0A 2BSTA 4HKJB 3UJHA 1RTKA 1TQ2A 5D3ZA 4CV2A 2OBYA 1JZ4A 4JVUA 4L8DB 1QUFA 3UFXA 1ZJJA 4MS3A 4NTZA 4AQOA 1BFVL 1TENA 2FBOJ 4DP5X 4JB9H 1JG3A 3SE0A 3KYMB 5GS1B 2Q8AH 1ICIA 3DXAE 1FHGA 5C1IA 5BSHA 2Y7SA 4LF3B 2R47A 4YV2A 4K28A 2CJYA 2I1WA 5HQ3A 4GS7B 5DJZA 4ISVB 4LPTA 2RBLA 4MUHA 3NAAH 3RKDD 2DSNA 2AEQL 1HZHH 2WXQA 3LIIA 2VLMD 5TQ0H 4WBXC 3O4RA 3L4VA 4QM6A 3GD7A 4BE9A 2F8TA 1A8QA 5I3ZA 1X9UA 1M8FA 2YMXH 1ZG3A 3T7RA 1TU3A 5E4JA 1TYJA 1DJNA 4J2TA 3Q1SH 3NV7A 4ZOLA 5K6TA 2PZEA 3B9VA 1SVZA 1PS8A 4OAWA 4TQHA 4HXFB 1DBKH 5TDOB 2J1ZA 4GIAA 2XBUA 4XH9B 1DUYB 1BHSA 4CKYA 2YN3A 3GVCA 2GJZB 3EWNA 4HBQA 1E3LA 1GN9A 2E89A 3CX2A 3ARFD 3KPSB 2OMTB 2G75B 1PZSA 2RIPA 4RABA 2MTBA 2X77A 3BKJL 4N0UE 1WNFA 3QY0A 1FEZA 5CJQH 3EA0A 4M6MH 4ENTA 4S2SA 3HDYA 3L0ZA 4HZUA 3U62A 4WI9A 2H63A 2NAPA 5JATA 3W9DB 4M22A 5AVQA 1QONA 1P7CA 2O26U 5ABDE 3DSFH 1JGUL 1XEXB 3JVFC 3AW5A 1DRJA 1LUAA 1RYZA 4ZMNA 3C5WP 1HXMB 3KUCA 3KV1A 4FNAA 2JARA 2YZ8A 2J0VA 4LVCA 5KMGA 4P9ML 3HJTA 4ACPA 3DE4X 3ECAA 2CUHA 2IUUA 4O58H 2A4MA 3HY4A 5ALEA 4M48L 5FJJA 1IXZA 5TF1L 2W0KA 3U19A 1S1MA 3L7KA 3EZ8A 4ZFNA 2UUBB 3TZQA 1QE0A 3UENA 4F80A 2I32A 4KJZA 3WGKA 2QKIB 1QF9A 4PGHA 3MAJA 5KZMB 3S4SB 2Y5TA 3G6WA 1P6XA 4LLVA 3DBOB 2P65A 1LC3A 4TTVA 5IVHA 2P30A 4F2EA 2IF0A 4YC7A 4NZJA 4UFPA 1PD0A 4QBTA 5CHYA 1FPTL 4ZO6A 4FXGC 2J43A 1YDGA 1K68A 5CD5D 1TO2E 4IBUA 3OX8B 3KOYA 1AKJA 4GAAA 4NXKA 1V27A 1OZTG 3ON5A 1OGAB 2BVEA 4X6DA 4XFJA 1SF5A 3NM5A 3F85A 2WLNA 1C8VB 5DGRA 4PSCA 4PGGA 1Y37A 4GQRA 2DS4A 4FLEA 5BW8A 3RRBA 3QPDA 3U36B 4O2RA 4WCVA 4BCBA 3C85A 4HV4A 4EVIA 3MV9D 5GGYA 4QHKI 5ESXA 3MB5A 4ZX3A 5G2OA 1DVXA 1BEZA 4R68A 1CXKA 3L4TA 4AECA 5AJZA 2H1FA 2DQUH 1GMEA 1ODTC 4OV5B 1C3OA 2MMCA 4M4RA 4K9NA 1R75A 1T1JA 4E9WA 5SX4H 1T03L 3K8YA 3ER8A 1Q50A 3FMIA 4AT6B 4PJDF 4AQ1C 1XF4A 3L7LA 3R0XA 4J2HA 3L0DA 1JQ5A 3LN9A 1K2VN 1PQYA 2E8ZA 3WL6A 1PTZA 5ETJA 2WB4A 4H8WL 3L46A 5DEIA 1S2MA 3P4YA 1G8AA 3FT9A 4ZV7A 3ULVH 2N0MA 2LDXA 4U5XA 2YRPA 5DO9A 3V8NA 1G55A 5AI9A 3VKHA 1P4BL 4IHJF 2C4WA 2B69A 4R69A 4BWTA 4P04A 4BV1A 5EJ6A 1SCIA 4MR9B 1C16A 4FAAB 1BJ1J 1DJXA 2LR0A 3KBFA 1FV1B 4FXLA 2C9YA 1ML3A 1HQKA 3KAJA 4TWRA 1KBGL 4L18A 4B83A 3RDJA 1IUNA 4RL4A 3CW9A 5FWYB 1OF1A 5AW9A 3EIWA 1LNUA 4XRCB 2X9WA 1J11A 4BBPA 3ILQD 4YXFA 2OVFA 4TQEL 5I8ZA 4CCYB 5EORH 4W6XB 3GRRA 4IMRA 5H3CA 3A9SA 5AVWA 4ZARA 1GUDA 1QBAA 4HUQA 3GQFA 1KO8A 3O8QB 1OWWA 3ZW3A 4R6WA 5K4HA 3SBPA 2NR6C 1A77A 4IOKA 2G17A 1KAMA 1K4MA 2I9KA 2N1TE 3KDSE 5ICUA 1AXIB 4C8XA 1U8MB 5HP5A 4HX5A 4PN3A 4CW7A 1KTVA 3TPKA 4LTNA 4KHTH 3H42L 1PDOA 1LJUA 1JRHL 2UVFA 4KX3A 4I4TF 3WLTA 2ENJA 3VVMA 3GGGA 4QUEA 4Y4KC 1RMQA 4GG6B 2HW8A 2AS5M 5K6AA 3A7DA 4X1OA 2ICWJ 1ZC3A 3WFZA 4A6YA 5AW8B 5DX0A 2V7NA 4PJDB 3QIUC 2FDCA 4GSDL 5JHLA 3ZZNA 4F38A 2VP6A 5A5DA 1IQUA 2GJ8A 5CJOH 3AVPA 5LQRA 2NSLA 2BW5A 3QHTC 3GEIA 3A5VA 4K0RA 1QIJA 3VXSB 2ATKB 3DTXB 1K2WA 2G0NA 1IM3D 2G60H 4REQB 2EKPA 2NU9B 4QHSA 3MCTA 3RPIB 4DRZA 1P0MA 4TUKL 2ZOLA 2PYZA 2WLJA 1E20A 4C0QC 1E42A 2Y6TE 3GG2A 3W6PA 4DMMA 1RJLB 4A91A 4HLCA 2W2MA 3KKKA 2GSDA 1MNAA 2GXQA 1NC4D 4I9UA 5EHNA 4MYTA 4H6WA 5TFSH 1YEIL 4YJ2F 5DJDB 1AS2A 3D25B 4LJ8A 4OB7A 4MNHB 2AMVA 1QQ5A 3QJHB 3U6XS 3KYBA 3OO1A 2WE7A 3VXMA 1CUIA 3ARQA 3MWEA 2P24A 2IEDA 3BHBB 3RE1A 5IJDC 3S35X 5B8CC 4N4YB 2YXBA 2AJZB 3RBGA 1MF2H 4PE5B 1YZGA 4NKIH 3HEAA 1UC4B 4OZGE 2AKEA 5CM2Z 1QEXA 1OHQA 4LSPL 5D2NC 2NT3A 3INTA 4JJ8A 3TW8A 1VCOA 3RB8A 1W8EA 4G0YA 4KQCA 2D3WA 4FQCL 2V65A 5LCVL 1WXXA 2XA8L 1K97A 2OO3A 3BH6A 3AG6A 3UDWC 1XH2A 4MPTA 2I6QA 4KK9C 2ENUA 4UULA 7MDHA 1V8BA 5EZSA 5FDFA 2FP4B 3E7DA 3AWGA 4AYEC 4N41A 3Q3IA 3WKMH 1FP4A 3GFFA 3L54A 3UWDA 2Y1OA 1M33A 1VPWA 1O97C 3EIUA 4PGBB 1IBCA 2R7EA 3FSWA 4BQNA 4KQ3H 3QJTB 4UHKA 4HGPA 1E9RA 2XOKD 5B2FA 1R5JA 2DWEB 3WJLC 5C5IA 1WUJS 1TJGL 1Z6QA 2AJDA 3UY4A 3VI4A 1G42A 1HH9B 4HC1A 1U11A 2VLJE 2EFJA 2YEQA 3KXFA 2ET6A 5E7BA 4XYEA 5SWZA 1DKUA 1VE3A 1RWQA 3WJ1A 2HHHB 1SKQA 3O0LA 1ZJ4A 2EEZA 2ZYGA 4AG3A 1Q0XL 2WLHA 4EVNB 5LXVA 4YHKL 1XQ4A 3L40A 5EJ4A 1UFUA 3BYZA 4D42A 3ZU4A 1JKMA 3TECE 3U7JA 2OLKA 2AP2A 4XTCS 1E28B 1A2YA 4LHZA 4IFIA 1E1CB 5E6UB 4EKEA 3ET4A 4CIAA 2F54A 2KQMA 1E7MA 3CV5A 4NKDB 2WHXA 1UCFA 3RAJH 4C1NA 3I9LA 4JZOA 2FO4A 2P9BA 3ZQ6A 2Y23A 4JO3H 5A2FA 4IXMA 4YOKA 2R7EB 3U4DA 3E03A 3UBGA 3U1PA 3OJCA 2CB0A 4LL9A 1YF3A 3OMIB 5AVSA 4G8GA 1JCKA 3FT4B 2F3TA 3S28A 1XCMA 2LTAA 1F4XL 4LX0A 1RJWA 4JFEE 1IEAA 4L4TB 1LQ2A 2Q9OA 4N0UA 1KOFA 3NBMA 2YAOA 5B4MC 2IDZA 3Q8AA 1WHSA 5DMHA 3MLTA 3K6DA 5EUMA 3GZNA 3DO5A 3VI3B 1DUIA 5IU6A 5DD3H 1K9VF 5MFPA 1GMIA 1BVUA 4FR5A 2R0KH 1VL2A 1K5DA 4TKUA 3D64A 5HRUA 3SQOL 1KGCD 2WUBH 1GOFA 5EXEA 3T5BA 1ARZA 1FTNA 1U8OB 1AHIA 5JNYA 3KKOA 1Q0YH 2XTJC 4ZFGH 1FP5A 3AVTA 4C2TA 1A4BA 4UXHA 5GIOE 2F53E 1LP9B 1A04A 3K0WA 3UJ9A 4BFYA 2IPLA 2W2QA 1GOGA 3MLUH 4EDHA 4ZAYA 4HWGA 2AK4A 2K4MA 5BUSA 1ORTA 1ZVQA 4WOJA 4O0LA 5DP1A 4FFZA 2GRAA 4K5OA 3N5KA 3G8YA 5IC5A 4J5VA 3FTSA 1X5GA 3GMPB 3GKWH 1JYWA 4JDEB 3FMPB 4YQZA 5HVWA 1JFFB 4EMZA 3CLUC 4IMJB 4KY2A 4QHNB 4M02A 4ONOA 3BA6A 3GMLB 3FWPA 4YJ2A 2Z7WA 5G4KA 4F57H 2UWEA 4WNAB 2O5XH 1MLCA 1XZHA 3QZWG 2FZ4A 3RAEC 4YCBA 3U82B 1EK3A 3JV4A 5I0DA 2IE8A 3D7NA 1M2NA 3ZDXB 1XWIA 4HPHA 1T1IA 1WPCA 4ZAKC 3TONA 1PEKE 2QVMA 4WW1A 4OJMX 4B9JA 5E8EA 1CS6A 2P42B 2F19H 2Y3IA 4DMRA 4FQXA 3VHRA 4CLOB 1BX2A 1JLSA 3Q2LA 1W36C 5IBCA 2D8KA 5IB4B 5HM6A 1TAUA 5D96B 1L6PA 1BBJB 3EAFA 2OXRA 1HYGA 4N0FB 1LQUA 3BWYA 2AK1H 3H16A 5IBUG 2IOYA 3TT1H 1EFHA 3M1CA 2BY0A 1SUBA 2HCTA 2XZPA 4Y16B 5B1EA 4QRQB 4IIEA 3DFFA 4EGJA 4ZW3A 3A9RA 5AVWB 4PM1A 2BBWA 2Y67A 3HYNA 3LVQE 2KPOA 1UMCA 2EKQA 4EA7A 3QORC 3PUIA 1M9SA 1ECPA 2E9WA 1ECGA 3V7AG 3OM8A 1WEKA 2WWIA 4B6QA 2HB6A 3DLPX 4BRVA 3H2QA 4MQEB 1IBDA 2A9MH 3ETSA 4QGTA 4IOMA 3QJSB 2WK1A 1UA6H 1GEGA 3F98A 1M6VA 4EHIA 3AU9A 1T5WB 4FX5A 5DZNA 4PJ8D 4JBXA 4E42B 2YXEA 2WFLB 4C76A 2FQEA 2G9VA 3EXEA 1X1DA 2PSSA 3ZE0F 2R8ZA 2P52A 1DVUA 3FE2A 4CKWA 3D0OA 3IIMA 4K5LA 2OP0A 3RU7A 3WGUA 4UT9L 4JHBA 5FI5A 1DEXA 1H4SA 4ZUWA 4LSTH 4KBGA 5EWJB 3QK0A 4F4IA 3KFVA 4JT9A 1LEIB 4LNAA 4CCYA 1F2DA 3FI9A 1G3RA 7MHTA 1R3DA 2AK1L 3GT6A 4YXWD 2CCWA 2II6A 1W0YT 2XB8A 1M42A 1UUSA 2PYED 4DCPA 4XZUA 3UAXA 5THXA 4GYKA 3P9LA 4PR5A 1DJLA 3Q48A 4WN3A 1MFCH 2PE5A 1WMAA 2ACEA 3C7DB 4TRPH 4OZFH 1LK0A 1KEKA 1KB9K 3EGXA 5EE1A 5IESH 2VITB 1RWPA 1WUHS 2SICE 5AOLA 1YACA 4N2MA 1ORRA 3AU1A 5CS7A 4ZU6X 4EY7A 5CXXA 1WSAA 4W5JA 2RTTA 2ST1A 1T15A 2FT8A 1CY8A 1D5WA 3WAKA 4Y9CA 4QLRA 3QDGD 2PQ0A 5DVZA 1VTKA 4UDTB 4OUDB 3H3XA 4DK6A 3JRXA 5ULLA 4IDFA 5C53B 5DTQA 3DUHA 1MPTA 1D2PA 1HQDA 3T0GA 1YQWA 4WO4D 2OD9A 3TO2B 2WUVA 3JVEA 3RHSA 3SJUA 1NLBH 3L1OL 4LA4A 3CFDB 1TYAE 3NBXX 3ZDDA 1K4DB 4LLWA 4HH9A 1I8UA 5KNCH 3FHOA 1N0LB 2DYKA 3GIVA 4U1GC 5IJKC 5EIBD 2LVEA 4KNWA 4JFYB 5J7CC 3AEUB 2PYEE 5FB8B 2YZNA 4MR7B 5IBQA 5K3AA 2ETXA 2UUDH 4GWLA 4OA8A 4XMKH 4B3GA 4K8RD 1ZYUA 1F58L 1AY1H 3G0GA 1TF2A 2XNAA 3AEUA 3VFVB 43CAA 1GCOA 2GASA 4EJSB 1UXMA 2HA1A 4ZS6C 4IG9A 5B39B 4N3AA 2ATEA 2XLLA 1JHLH 1O96B 5JXEC 1J33A 5ABZA 1H0KA 4IJ3B 1QH1B 4O4LF 1VYTA 4HZUB 4IICA 2QKIA 4WEEA 3E3QE 1T4KB 3BWUF 3IEPA 3S2EA 4JPKH 2IIVA 5ALFA 1ODFA 3OHXA 4MIKA 3MJHA 1K8YB 1NR5A 1FNFA 4QKQA 1N59A 4NT6A 1CK0H 2YXDA 5KHOC 3NC0C 1FG2B 3VZDA 3E0GA 3PE6A 4G5HA 4J90A 1UJCA 3EUWA 2WQVA 4NV3A 1BVLA 3CGWA 1RYNA 4B3HA 3U1BA 1QIFA 2CVHA 1Y8RB 3QP9A 3FU5A 2YXWA 3X1WA 3CPSA 3CMOL 2LD4A 4B09A 5E1BA 2CXTA 5LGJB 3GLDA 4C4YA 2XAAA 4Q02A 3B3GA 3P3UA 4U39A 4IIZA 2E46A 4KQ1A 5AVXB 5MERA 1II9A 4A7TA 3OLWA 1KEML 4GLOA 3BWBA 5DJ0B 2YWRA 1UCBL 2EXYD 1Y7VA 3JD2A 5HYQA 1NCUA 3AXLB 2AA3A 1C0EA 1C3VA 5ACLA 1ILWA 2VTEA 2OK0H 1SLXA 1K3TA 4O2CA 3ESYA 3ZOKA 4M0PA 1P1ZA 2PY6A 2BSCA 4F4JA 1T21B 3MCYA 2A7XA 1INQA 3SD7A 4XN7A 2P62A 4HUVA 3OAAD 5HBGA 2A6IA 4C04A 3AJ9A 4PC1A 5I9MA 1KTDA 1G9NL 1KJ2B 2AS0A 4HS4A 3A7EA 5C2UB 4TNVK 1E2FA 3O4OC 4K5PA 3A37A 5BZWA 4OKVA 1AR1B 1YY9C 5AD0B 5BUCA 2O3SA 1XRRA 4QEKA 1INEL 3EXLA 3SYKA 5CMAB 3V2UA 4WXEA 1KDIA 3KPYA 5I5MA 3ME5A 1CFMA 3K0AA 3RS3A 5I7WA 5IVZA 4L76A 2VZUA 1SZJG 4QRUA 3AFMA 2EDLA 2O4EA 5A6MA 1ZONA 5B4MD 4ZGWA 4CNIB 3Q8BA 1RZGB 1ZISA 2O5YL 3HNVL 4OFZA 1D5CA 1QCDA 5JYDA 3CBRA 1U8EA 3HP1A 4DP8X 4XASA 3VD7A 4PHCA 4C20A 2BE7A 2I0FA 4N5DA 3LHDA 3FYIB 3PS9A 1QSEB 4XKJA 1OW0A 3R5TA 4R0LB 4JQSA 3MS2A 2K6ZA 2ZJ8A 1J8QA 4Q4AA 3DX8A 2D3VA 2F2HA 4JQIA 2I6FA 1FO0H 2DOCA 1Q0PA 4JM4H 5AW3A 1GNQA 4MJID 1BZ7A 4B0OA 3MDJA 2YK1L 3QXUA 4HCRL 2G5UA 2O23A 1FJ2A 2B3TA 1QGUB 1Y18A 4M3JA 4IGBD 4WI5A 3O95A 3JAKA 1CC1S 1OKEA 4DDTA 4PXYA 4FONA 1E1QA 2J2ZA 3D39E 1JNLL 2JLRA 3WFCH 3BE8A 2BXZA 3E1ZA 4G42B 1NT2A 1OZGA 4C29A 4J0JA 4G43B 2PGNA 2H1OA 3DTVB 2XPYA 2VDKL 3NXKA 4Y19B 1JWBB 4PIMA 4DP2X 4MKHA 1RACA 4ZTPL 4OKSA 4TMZA 2CO2A 3ZIAA 3K0YA 4Y8DC 2L7UA 2IAMC 1AQHA 1VL5A 2YXVA 2EXYC 3TLKA 4FP9A 1Q72L 3M7FB 2HMVA 2IPMA 3I12A 1FVCB 3I01A 5AESA 4LIQE 3QEGH 4JC0A 3NVKI 1LO4L 2X10A 3N3EA 3NPAA 4RTPA 1G0NA 3O0RL 4LMPA 4PFKA 1N34B 2D2CC 1A6TA 3FU9A 4M7LT 4RJKA 2BRRH 3QPQD 4FFDA 2QY9A 4OKIA 4FOSA 5DVPA 4UPDA 1G7QA 1YI8A 2HAEA 4OX9B 1Y9DA 3QT2A 5LM3A 4MYHA 3SOBL 1FFXA 5HM8A 5IFHL 3EZ7A 4Y9RA 4CMHA 1BQHG 1U8OA 1HX7A 2ZPKH 2XKNB 5JIIA 1GVIA 4FFLA 2ACKA 2X5KO 1XIWB 1U8JA 4NN6C 1OCRB 4YQYA 3O45B 2DQZA 3CN4A 5IAGA 4HUWB 2VAXA 3INRA 1XU9A 1ZTXL 2FUKA 3ZE0E 2EJCA 1T9AA 3IO3A 2X2YA 3BJZA 1AGPA 5TVGA 2G9ZA 4EOWH 5CEFA 2AJLI 2X0IA 3GIZH 4Q6IB 4FBMA 3GDWA 3SDSA 2HUEA 2HWKA 1J90A 3NAZA 4TUYF 4NQCB 3LF1A 4BV2A 1B8NA 1OB0A 1P4JA 2AT1A 3IDMB 1TEXA 1GCYA 3W5SA 4FSDA 1JEDA 3UG3A 4BKQA 1GNSA 1ZAGA 1RAFA 1AZZC 1JILA 5TEVA 1URZA 3E8XA 4BBJA 1DIAA 2OYLA 4GD3Q 5JXHA 4DLSA 4XCVA 5IMKA 4HB2A 3DOFA 2VABB 3K9NA 1A3QA 4MQFA 3NRBA 1LBHA 4TQEH 2KL6A 3FRPA 3OZKA 1Y1UA 4KGLA 1GTNA 2E5FA 2P2SA 4AV5A 2XOKA 4XNXL 5I9IA 2Q6WB 3DTUB 1TZIA 5ELXA 1K86A 3A0RB 3ISJA 2HO5A 1DRVA 3K1KC 4FS3A 3TCTA 4NQCD 4DB2A 3V4PB 2WV9A 4JM4L 2EACA 2NM0A 4BVKA 4AURA 3NBZC 3STBA 5C9JA 3UAJD 3PUCA 3L43A 5C6PB 3EWIA 3HMWL 1LLDA 2N9UA 4UE3S 5JC1A 2UZXB 2WT8A 3GGJA 3H2BA 4OM8A 4CA4A 5B53A 3NRQA 2E2WA 1YJAA 1T8PA 4Q52A 3FK3A 3FHJA 4S2SB 2NU6A 3DPBA 5DDHA 3MRCB 5JOFB 4HETA 2YD9A 4ASUD 1SVUA 1DCMA 4ZI5A 4KR3A 5KOHB 2DMGA 3HC3H 1Z32X 5L3SB 2FH5B 3BH9A 5CUSH 5FM8A 3DMTA 4NMXB 3DIFB 4BNZA 5T5FH 3BRWA 3DX7A 4CEIB 4N6RB 5DLPA 3WQHA 3C1AA 1Q7GA 3AX6A 1FVEA 4X5XB 1BU5A 4HPOL 1I7ZB 3UYPA 2I3BA 3KPSD 2AUMA 4HDQB 1AHKA 1FXWA 5EC8A 3ZKWA 1L7TH 1KPRA 3WIFB 4Q6WA 1ZXLA 5JR1L 1K7EB 3RU9A 1E9CA 4WUUE 5DRWA 2EATA 3PGMA 3RVRA 2GEQA 3IJHB 4CI0B 4XIGS 5J8OA 4ZPXA 3EFBA 2ZULA 3H4TA 1T2JA 4PYOA 4M4SA 5F9DC 3KYDA 4JX8A 3DT6A 4J49A 1K0FA 2OJ1A 3H0TB 2OFQA 3T4AB 3H99A 4HXBL 5JOPE 3QUXB 4F3TA 3CU5A 3VRJA 4RENA 5EWMA 2CFOA 1ZEMA 2WMPA 5L4SA 3PZBA 4MNHA 1HLGA 5BJTA 4IH9A 2VJMB 4OHPA 3V7MA 2OQRA 1TADA 5HY9B 1HG1A 3TO5A 4FE3A 3WADA 3PEEA 4OJFL 1Q9OB 5JA9A 4LOAA 3BCDA 3CVIL 4RANA 5E9QA 3W90A 4DJAA 3JTTA 3ULUE 3MJ9A 4RDQG 2HVBA 2X8WA 3UXYA 2IOMA 1BFOB 1GGCH 3IRZA 3OZVA 4AICA 3HY6A 3U44A 5E1OA 2EABA 1TKCA 4HLQB 2J85A 3A1SA 3I83A 5ENWB 4HGNA 4H8VA 4A0QA 3IDZA 5GS2H 3SC2A 1OQOA 1NUSA 3IDGA 2JJYA 4ZOAA 2BSXA 2PRYA 3U13A 3HVIA 1ORVA 1A02N 3QFTA 1S3GA 1PHPA 4IS2A 5C8JA 2D74A 2W2NA 2HF9A 3E53A 4MASA 2XHZA 2HF8A 4NCBA 1RXEA 3Q1SL 1GYPA 4YHNB 4TUYA 3RTAA 1XD1A 2BJMH 4LQDA 1NEZB 3N6VA 1J9RA 1LCIA 1O95D 3A6FA 4HGYA 5DD1L 1G17A 2VBGA 2ECOA 2Z1KA 5ALIA 2OHOA 5IUSA 3LRPA 4B84A 4N5LA 1LW7A 3BMCB 2HNBA 3RQ3A 2V5RA 4XI5C 4GUQA 1BVRA 4TXMA 4UIKH 3S4SG 3G88A 1SXJE 4RBNA 4KNUA 3DF7A 4NXMB 1QGAA 4P23B 1T2UA 5J5EA 3BUYA 1T2DA 4DIUA 2HZBA 2CKBA 1CIJA 2DICA 2WUGA 1YYCA 3CXFA 1DVFD 2D2OA 1P4IL 1QFXA 4GP5B 2HFFA 2CLMB 2YNMA 3QEOA 5LZ4A 1JVOA 5GY7A 4KQ2A 5G4MA 4R1QA 5ICFA 1OY3B 4QKXB 4PC2A 4Z78B 2X9NA 3HA2A 1J7JA 3EUDA 3FRUB 1FZOA 4Q1BA 1E9BA 1GPWB 2I80A 2OHJA 4MUNA 2OOKA 1JGVL 4TYQA 4NBYB 2ZSWB 2FLWA 2V2TA 4GAEA 1ZGLA 2Y1KA 5B58T 2CLFB 3QTLA 3DZBA 1XTPA 1VERA 5ADPL 1GO2A 2YC2C 4LESA 3M81A 3ZWOA 1IZZA 4BCXA 2ZR9A 1DE0A 2WB7A 4NWIA 2WUCL 1XTJA 3CGTA 4HK0A 2WC7A 3K20A 2AC4A 1XZ8A 3VR4D 3LPAA 1YPZA 5F2KA 3BKYL 4RJIA 3NASA 5DEFB 4H31A 1KG0A 3LMKA 2OA9A 1Z5UA 2RC6A 2GEVA 1OT2A 3V2AR 5MENB 3LH5A 2UZYA 5TXGA 1OAOC 3WKNA 1G6OA 3ML9A 4X7DC 2H2GA 3W05A 1N6VA 2F8LA 4JU9A 2VK2A 1RRFA 3SKVA 2EZ0D 1HWHB 1G4HA 7PCYA 2Q9CA 4TF4A 4HX1B 2OWEA 1A1SA 3DD5A 4AJVA 4IYRA 3EZGA 3Q0HA 3JATB 3LUJA 1L5GA 1I8LC 2VM3A 3LUKA 2IYZA 1VKOA 3F78A 5L2KA 1JR3D 5C0EA 1U8JB 4P8RA 3B1VA 2QTLA 5I26A 1K63A 4CJXA 2Y25A 5HDBE 5AUMA 5L9DL 1OTUD 4Q9CA 2C00A 3TE7A 1Q9KA 1MQ8A 3EQ9A 1EFQA 4Z7OE 5J11B 1LDYA 4XPFH 5LWHA 1FS5A 3IJSA 5SWQA 1EA9C 3IF1B 1FOEB 3FONB 1NG9A 4LF6B 2NMVA 1Y5LA 5DJXA 3KKEA 4FQ7A 4WFJA 5U1PA 3FTGB 5HPYB 1VIMA 3HKCA 3AU1B 3P54A 1T1GA 1U3VA 4AMYA 2G80A 4GPVA 3RRFA 2VMJA 3LSYA 3COJA 3HCOA 1FVCA 3WHXB 3RWHA 3C4JA 5TJ9A 1FDRA 3BUTA 1V7QA 1Y42X 1GQ2A 3KQUA 2OXHA 1S2OA 4V0KA 4I6EA 3BJLA 3F9IA 2OMZA 5A5VA 4WI3A 3FN3A 4BNXA 3GFSA 3H8WA 2DMBA 1UKZA 3TASA 1OAOA 1AZRA 1G8HA 3GFUA 3MILA 3NJLA 2ZWKA 1IHUA 2EC5A 3GCZA 1Y5RA 3OZBA 4NEQA 5HDQH 1R5BA 1X1EA 4DA6A 3D4PA 1TRHA 3ACDA 3E70C 4F92B 1YUBA 1BE8A 3QWFA 1H4VB 3AONB 4NNOA 5FA8A 3PJNA 1UKCA 4CLDA 4YDKL 4RESA 2Z4SA 1OL0A 3HJCA 3FB7A 1V54B 2W65B 3NTCL 4ICXA 1WXEA 4G82A 3WVNA 3TIEA 4JQVA 1KT2A 3KL2A 4WI0B 1E94E 1JXKA 3V8PA 4ALAC 5JW4N 2EBUA 2ZWSA 2I78A 2QSZA 3W6NA 4KUCF 5AHRA 2GJ4A 3EGVA 3LFTA 1NLZA 4W1RA 5DBIA 2X0FA 1Z62A 3S2SA 2PFGA 4QHMA 2J44A 4C1BA 2NSHA