2VDQB

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 130
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdqB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdqB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdqB03
2VDQB 2VDMB 3HXOA 5E6RA 4F1JA 3V4VB 1SHYB 1ZOOA 2X5NA 4MMXA 4C29A 1MJNA 4O3TB 3NVQA 5HDBB 2NUTB 1T0PA 1V7PC 1ZOPA 3M6FA 3AL8B 3NIDB 1U8CB 1IJBA 3K71B 1AO3A 1Q0PA 1U0NA 4C2AA 3BQMB 3NIGB 4WK4B 4HQKA 1M1XB 2VDKB 3GXBA 1BHQ1 4PN7A 1JLMA 2ICAA 4CNBA 4UM9B 4DMUB 2I91A 1M1XA 3ZE0B 1XDGA 2ADFA 3IJEA 1DZIA 4WK2B 3ZE1B 5KYUB 4NENA 4O3UB 1ZONA 1SHTX 1U0OC 3K71A 1LFAA 1PCXA 2I6QA 3OKWA 1PT6A 3PPWA 3ZQKA 1MHPA 3ZDYB 5HJ2A 3TW0A 3AFCA 4MMZB 2VDPB 3N2NA 1YVRA 4WFQA 2NUPB 2P26A 3HI6A 3FCSA 1OAKA 5KYWA 1MQ8B 4GZ8A 3EFOB 2UZYB 5HGJA 3TVYA 4O02A 2M32A 1QC5B 4Z7OB 4IGIA 1JEYA 3VI3B 1SSLA 1N3YA 3PPXA 4MMZA 4HQLA 4CN8A 1FE8A 1RS0A 2VDLB 1AUQA 3F74A 5ES4B 3Q3GE 1JV2A 3BQNB 1RTKA 1T6BY 4HQFA 4C2BA 2VC2B 4UM9D 3AL9A 2I6SA 2XWJI 3EH2A 4FX5A 3RAGA 3TCXB 1IJKA 3T3PB 5KYYB 3HXQA 1BHO1 5KYWB 4IXDA 3EGDA 3IJEB 3ZDXB 4F1KA 4WK0B 2NUPA 3EG9B 1DGQA 3AL8A 1CK4A 1RRKA 1AOXA 4IHKA 2B2XA 1ATZA 3NIFB 3EGXA 1M2VB 1XDDA 5E6UB 4G1EB 5E6SB 3E2MA 1IDN1 4BJ3A 3EG9A 1TYEB 2NVOA 4G1MA 5E6RB 1CQPA 1QC5A 1JEQA 3OL2B 2O7NA 3T3MB 2WINI 5E6SA 5BV8A 2XGGA 3F78A 1OLZA 1M2VA 3EGXB 4JDUA 1YVPA 2P28A 5KYNA 3K6SA 3K6SB 3ZDZB 1IDOA 1PD0A 1M2OA 1QCYA 1NA5A 4HQNA 4Z7NB 1MF7A 2XWBF 4A0QA 2IUEA 3K72B 1JEQB 1MQ9A 3PPYA 4HQOA 4MMYB 3IBSA 3FCUB 4NENB 1FNSA 1XUOA 5E6UA 4UM8B 1L5GA 4K3JB 2NUTA 5KYXA 2ODQA 4Z7QB 1RD4A 4JX0A 4WJKB 5LN1A 1SQ0A 2VDNB 1YUKA 2QTVA 2VDOB 1L5GB 5KYXB 1JEYB 3QA3E 5KYYA 2ODPA 4XW2A 1UEXC 3EFOA 3EOBI 4G1MB 3FCSB 3OKYB 4CN9A 3TXAA 3PPVA 1JV2B 3K72A 1U8CA 3ZE2B 1SHUX 1MQAA 4M76B 1M10A 4G1EA 1N9ZA 3BN3A 3V4PB 1PD1A 2WW8A 4NEHB 4FWWA 4MMXB 3EOAI 3VI4B 1M1UA 4O02B 3EH1A 5KYUA 3EGDB 3OL2A 2VDRB 4MMYA
chains in the Genus database with same CATH superfamily
1O6FA 4FFTA 3WIHA 5ER6A 2I80A 3JWHA 4M7RA 2Y66A 4FKEA 1WU7A 1IU9A 2VSOA 3OKNB 1HNZB 1IG3A 3FFCB 4A7SA 3MTXA 3GT6A 2XN9A 3VNBA 1RYHA 3EDRA 4L4TD 3QH3B 4R1PA 4TN5A 4RZXA 3JQ6A 2ZTVA 1A5FH 4V0ME 3A6OA 2BM1A 4YSPA 3JY6A 2P8MB 3A4TA 3UAYA 4OM1H 3ZV6A 5EP4A 1D6VL 3B3IB 1BP3B 3E8UH 1I3RB 1IM9A 1I8TA 4P5MA 5EJFA 3GOQA 1QYWA 4GKVA 4GLJA 1FHGA 3JYNA 4K5NA 1P9MA 3PRKE 3L7BA 2AJLI 1VHLA 1PI3A 2E7DA 4HS3B 3GBPA 4IP0A 3MXTA 4OAWB 2BFAA 4L95C 3K1TA 5FOBA 5LG1A 1A64A 1E5TA 3WFEH 1JPGB 3AVVA 4LRNH 3GIZH 2BVQA 1ZZEA 5FGSA 3SR0A 1MAVA 4I7EA 2D8AA 4ORZC 4UZGA 4S1NA 2GWHA 2QQGA 4A36A 3QIAA 3UAJA 4UNNA 3WNQA 5DD6A 5IB3A 2C2WA 1DX6A 1D5MA 1GUBA 1R5VA 3PYXA 2H2SC 4HSGA 3ROOA 5C07E 1H8HD 2BT4A 1JG7A 4BZWA 5ALZA 1CVRA 2AABH 3LP6A 3L4YA 1RYEA 1UBGA 3RWIB 4COKA 5IW3A 1KK2A 1NBIA 1MRDH 3TXAA 3TR0A 2WSSA 3X3GH 3GLHA 4TYYA 2EO7A 5DDHA 1XR9A 3BE1L 3E70C 2IWGA 4LVOB 5EFIB 4HKBB 2J7PD 3I1JA 2QDVA 2XG4B 4A2DA 3I9MA 5C09D 4HLJA 1I6LA 2JJWA 3SLRA 3FR8A 2XG5B 5HDBF 1KYIA 2Y92A 3BGMB 3U60B 1RACA 3FCGA 2SHKA 1XK6A 4TN1A 3QUZA 1PF7E 4RA9A 4Y9SA 2FETA 2BP7B 3SDYH 3EJZD 2ZJFA 2BN4A 2W2TA 5IEHB 2FZKA 3OLZA 3C09C 4H1LB 1VA9A 3LZOA 2B4CC 4BBAA 2XXCB 4B6ZA 1ZV2A 3UAEA 3ARBB 2J07A 3NRJA 4JLAA 1QIFA 3MNWB 2A0YA 2DKNA 4G43B 2M1XA 2ZRAA 3LNEA 2A9FA 4JREB 4H4NA 1WCIA 1H2HA 4E51A 1KZ4A 3G8AA 2VPYA 4M0PA 3RC7A 1LPNA 1LNUA 4Y7MA 3RY4A 3C8UA 2FOLA 4E2XA 1U8IB 5TQ0B 4FWBA 1HYGA 1P5UB 4X92A 5FOVA 4LJSA 4HLZH 5T3ZE 1RHFA 2BKXA 4ER6A 4M86A 3LZDA 2AZAA 5HTSA 1QFUH 3NVAA 4NKDB 4ENTA 3HJFA 2MCFA 5KJ1A 2DFNA 1H2WA 4G7YL 2HLFC 3LCJA 4M5ZL 2I7XA 2NZ8A 2ZPUA 3DM5A 3RDPA 4OF3A 3HKCA 4NOJA 3EUAA 2J2ZB 5IMMA 2A1TS 5FS5A 5H4HA 2N1MA 3JPYA 3JQCA 3LZRA 4PTLA 1NVBA 1BRTA 4BLWA 1TJXA 5H9WA 2XZDA 3CEJA 3MRPA 4JM2F 1PAZA 5DXWA 5EE5B 4B60A 5DBFA 1LTXA 1FJ1B 2OBLA 3U83A 2GK0B 5FWNA 3FUNA 5AK4A 2XXJA 2DQDL 1QE3A 4OLUH 2BFWA 4RSHA 2WVGA 4WDIA 2GSIA 2WVHA 2WSLA 2CLRA 4GSKA 2V5SA 4E68A 4YT4A 1TGYA 3AB3A 1PZHA 2X7JA 4NNOA 1ZK9A 4ZUSA 3PP3H 3V6LA 3P5SA 3BKYH 4K9MA 1KJ8A 4MGEA 1F8GA 1ZUHA 4QRPE 5GZNC 2C8LA 2VHCA 3AUYA 3QDJD 1CXFA 3KSUA 4ZTBA 2R8SH 4HZAA 1BBDH 2ZYUX 1RM5A 3O3NB 3SIKA 3I1IA 1UA6H 1ZS8B 1FFPB 5K0EA 5KSVB 2R5FA 3L5XL 4R3SB 1KO4A 4LCEA 1NA5A 5DMYA 5IAJA 4HDIB 3BKJH 3MLRH 1E5CA 2ZLBA 3ANLA 1C8QA 1L9OA 4LLVA 2X9LA 1XK7A 1J1UA 1ZHKA 4G1FA 2Y05A 3SGKA 1F4PA 3HS0B 2EILB 1M8PA 1UQUA 2NXZB 3TIGA 5KYYA 5B58T 3APMA 4PSVA 5AVXA 1SKBA 3GGSA 2WYTA 2BRUC 1VGVA 3WBDA 2BUAA 1XZEA 4GO1A 2XVZA 1XRJA 5IJDC 3GFOA 1EFUA 3KLPX 1HDYA 3QNYB 4U2EA 2ADJA 1HQ4B 3RJMA 3FMPB 4MJ4A 4LDEB 1XTSA 1MREL 3VFNB 3FULA 3S2IA 5LYJB 3R24A 5DEFA 4LIQE 4KRPB 3SDXE 1OF2A 1J2TA 4IDCA 2I6QA 3OKWA 2HLFD 1WB9A 3ZSTA 1U2DA 4LF8B 3GJ5A 4UTAH 1KI6B 3NRCA 2CD7A 4BTLA 4OGYH 4YYEA 4K8OA 2OSLB 1OX5A 2AG5A 4KJZA 2WM9B 1HNNA 1M7IA 3OX1A 4YLCA 2FZ3B 3II3A 4WOJA 4L74A 2YRBA 4G25A 3FWKA 3QHZH 3E7FA 4LZPA 5SV4A 1KH1A 3DX8B 4WO4D 5F3RA 3S2ZA 4Q9RL 1OWOA 4IS2A 1XMPA 2F5AL 2DUUA 3LPFA 1KEGL 3H83A 3AVEA 4PLJC 1W93A 2HXSA 2IDMA 3N50A 1TTGA 2Q99A 3ZMEA 4B9CA 3RFRA 5I7SA 4DRZA 5DQ9B 4ND1A 2C9XA 4LUCA 3QZLA 1GOGA 2TMYA 3FU6A 1U1DA 4DKEL 4JT4A 1EJ8A 3BEWA 4IZIA 4KPHH 3H1FA 3A67L 1PD1A 5G0UA 1W85B 1EVZA 2VWEE 1NYRA 2PGAA 5E1OA 1KPRB 3SIRA 1CCWA 4UAHA 1B0WA 5I8WA 1A6WL 2EATA 1AGCA 2AK1H 2ZICA 1WB6A 4YP7A 4K5MA 2I2FA 3NANA 3NC4A 1QSEA 3FLEA 3BYZA 3KTOA 1OVMA 3RH0A 3DULA 1GG8A 4UB0H 2HLAB 3U46A 1TI7A 5L40A 3X2FA 2WUWE 4OQFA 1EEYA 1SZNA 2VMJA 1A7QH 4J4TA 5AB9A 3SF0A 2J8OA 4O1MA 5IHZA 5JD4A 4DNQA 4Y19E 5H94B 4FMDF 2P26A 4OF5A 3ZTJG 1F86A 3S3JA 3OAZH 4W5NA 5AZ2L 4LDCA 1XVIA 2BRQA 2PZJA 5M94B 3V8RA 5EEGA 2WJYA 4WFFD 2E1RA 4I9GA 2Q86A 1SKYE 2ZIAA 1UJ3B 1SXSA 3DJFA 2E37A 4QAJA 1AVTA 4BZXA 4NM8L 1Z83A 1EBAA 1I3VA 3NEOA 3GDGA 3HHRB 4O2BB 5D87A 1RUMH 3AWIA 4CG2A 1V43A 1W35A 1MFZA 1KSRA 3GLGA 1SPXA 2J5XA 3PWPA 3ADDA 4OKSA 3N85L 2IX3A 5I9BA 1QWUA 3VNQA 4WV1B 3VFGH 2H48A 2W71A 1DL5A 2FEKA 3IP5A 1UM4H 1X5XA 1NUTA 4RSVA 4XZ4A 3RD5A 1R5IB 3ZGVA 4BFEA 1KZ6A 1PZBA 4XFJA 3I9OA 4EUFA 1HUQA 3IKMB 4QQKA 1YL6A 3BIXA 3AU8A 5HF5A 4D0RA 1R6DA 5AJVB 5LBSA 3GEWB 2B61A 2OJZL 2VBIA 4C29A 4HVLA 1MCPL 4GIPD 2VQ4A 5JHLH 1COWA 2WDZA 4N3BA 3DXAA 1MW8X 3COZA 2HD4A 1OZAA 3TCLB 3M9XA 5DM1A 3DFZA 2H1IA 4XHJD 1DRVA 3QQ3A 2J20A 3QJOA 3T2PA 4FR2A 5L7XH 1A3ZA 2A1WH 3U6XA 2YXEA 4Z7UE 5C8DA 4M1GL 2JIXB 3KD2A 3ZQKA 1Q1GA 3QG7H 2C3YA 4AQEA 3DTNA 3M45A 4FEAA 2WA1A 4GUAA 2ID9A 1I30A 3IDOA 1UPFA 1CRPA 2I26N 3WYBA 5JO0A 4XTRC 3FC8A 4HNGA 4P4TA 3U16A 4YALA 4AMVA 4NM4H 2CDCA 4ZOCA 4ATTA 2HDOA 5TQ2L 1BM3L 4WHTA 5J1AB 4PJBB 2MQGA 1A4RA 1GYUA 3L3KB 1L4FA 3RIHA 2A5FA 3VI4F 3TFBA 2IEYA 4RFSA 3HPJA 4OSUL 4IGBA 3JQRA 1M6NA 3VA7A 1U0SY 3JAWA 4FLQA 3EYVB 3BSZH 1IXKA 4XNZB 1FDLH 1G0YR 2HKFL 2XNSA 2JNWA 2A6JA 3VGPA 1MCHA 3QBTA 1I8LA 3RL2A 3BMCA 2B9EA 5B58C 3GHPA 4L5FE 4U0RB 4KDRA 3EOAB 2XMCA 4ND8B 2XMGA 1RU9H 4UIMB 1LBSA 2XOKA 3WQRA 1F2VA 621PA 3WOVA 5FLYA 1U8HA 4AQ8C 5ISZA 3IGUA 2XNDD 3HNSL 4QHUB 3GRWH 3VRJA 2CVZA 3K3PA 4W70A 2O3RA 3OZUA 4CR7A 3H9CA 2VXTL 1WUNT 4LSRL 1WXWA 1L5HB 1MENA 1KTIA 2B7LA 2R6ZA 3H9BA 2QSCL 1G59A 4MDEA 1VB5A 3ZKWB 4MRCA 4D8TA 1YSOA 4HF5L 4AQAB 1G7CA 2NTJA 1TVMA 2Q6KA 3ATDA 2HA5A 2NNWB 4Z7VF 3ZKNC 1RIHH 3RKDD 4UUQA 3MRCB 5FEBA 1XXDC 2C7PA 1UOOA 3RFZB 1OFUX 1EM8A 1KI4A 3E5RA 3TF7C 3L08A 4UE6A 1RJ9B 4K9QA 4MYHA 2ZTBA 3S3DB 1BEYH 4N9OB 4HNRA 2WNIA 4NE9A 4Q9QL 1MN4A 1ADCA 4NKIH 1ZIXA 4GQZA 2PT6A 1TK3A 2H2WA 5CEFA 2W60A 1NMZA 3WKML 1WG8A 3WB2A 2W4IA 2BMEA 1AHKA 1CBVH 2WBLC 4G3YL 821PA 1HE1C 2A86A 1CUCA 3RRQA 5I4IA 1R5WB 3EQ7A 1L5LA 1NDHA 4PWGA 5A71A 1DQLL 4L8SC 1L3IA 3BD9A 2RH0A 3HS0A 2RIKA 5K39B 3A6BL 4Q7LA 4N2MA 4RH1A 3E9YA 3HNSH 2NLOA 1A4JB 5DYFA 3FHEA 1SDDA 2YIHA 1H3NA 1L9QA 4UUNA 2WTAA 4QUKA 1FU7A 1XYYA 3QXJA 5DHRA 1BS1A 1JG2A 5IDQA 1K63A 3B6MA 1CJSA 1SHUX 4RRPA 1UADA 3TCNA 2WUGA 4HWNA 3C4QA 3SHQA 1QV7A 4KTTE 1E6KA 4EATA 2WU1A 1VFUA 2WSBA 4Y2PA 3BYTA 2B21A 5C6WH 3I9PA 2WSSD 1AD0A 3UK7A 1RLTA 3EQ6A 4KAJA 1WHTB 2HMTA 3KK0A 2NP7A 4PJIF 4TNWK 4AH2B 4R26H 4BSWB 3UM9A 4TL6A 1QPZA 9ABPA 3CNQS 1UOKA 5CTJA 3OC6A 4QJ3A 2YWHA 3FB5B 3RC8A 1J1PH 1P1ZB 1VKXA 1N33B 2VA9A 4GU5A 1GYAA 1HU8A 5GGSB 2XB2A 1NMBL 3S2YA 1YEJL 3PL5A 3A6KA 3GRPA 2CL7X 4OBSA 3UPTA 3QG7L 4RPHA 3PTLA 4LDRA 1GQQA 4LXUA 3CXDL 4GKNA 3BSWA 1V71A 2ZG2A 3OEEA 3QPXL 1UKZA 3IHWA 4U1KA 1AGNA 3KR2A 3CLWA 2IXAA 3KC2A 5ADHA 5GRUL 1R33A 1P5VB 5DR5H 5D6DA 1C9SA 4B46A 1YKGA 4Y1RA 2FU5C 5H59A 2UZIH 4YDHB 1XRSB 3K6SA 2FHPA 3DTXA 1X7DA 3ZHCA 2XKAA 1XP5A 1LO0L 2XQYK 5AVQB 3OF2A 4ZEWA 3C3BA 3PQYD 1YZVA 1JIXA 3PQDA 1RPNA 2A9CA 3C08L 4QHNA 5ITBL 4OYLA 1XNQB 4XMLH 2FWRA 3BH7A 2PT5A 1FXWA 1QG3A 4ZMQA 4B7LA 4X6BB 1NSYA 3DPSA 1P9OA 2B78A 5ALEA 1H94A 4M93B 3KTFA 5TJ9A 5I5EA 3ZE1E 1N57A 5BCAA 1LEIA 1DJOA 4YX2H 2OBMA 5K9OB 3DA0A 4GZ5A 4I0PC 5CDTA 2ONYA 1VFBB 1FJ2A 5I66B 4KNWA 5I7WA 1JZGA 3MX0B 3ZYOA 1E30A 2LLGA 5B7PA 3T7EA 3BKML 1QBLL 4MR7B 4ZO6A 3GCWA 3SC6A 4LCUA 2WQZA 4PRID 2ZS7A 1A0OA 5L88L 2FY8A 1CY7A 3DROA 2J5RA 5DK2B 3GI8H 3UJTH 1IC5H 2OXFA 3HDQA 3UWPA 3O6VA 3T7DA 4OH2A 1PJTA 2R62A 5T64A 4CM8A 3JR3A 3NM5A 2MHAA 4U5QA 3OV6A 5KNDA 1CDZA 2PMCA 5LGJA 2YARA 4E88A 2HXAA 1JRLA 3WGQA 5JNYA 3MEQA 3QXXA 5AW4B 2X42A 4V38A 3VFMA 3L2OB 4MJIE 1PDOA 2PYFA 4ANVA 1WQ4A 5P21A 3I6GA 3RVXC 4CKBB 1CUYA 3DLPX 1H93A 3QRWA 4YLBA 3FJ1A 5BVPH 1HEUA 1W5FA 2DQCL 4L1SA 4PNPA 4UM9A 4NX2A 1KTKE 1OI3A 5AK3A 1DKUA 2AKRB 3KUCA 4DA0A 3D3EA 1NOLA 1SA0B 4D8VA 4XVTL 3NHZA 5KSAC 1MO5A 4Z4FA 1D6JA 2QR2A 3MGCA 3L5WB 2Z1MA 3LRHA 2BEWB 4K3EH 2B5IB 5DWUH 4DIFA 3A31A 3GM8A 1E4EB 3C5HA 4ODWB 4J6FA 1TA4A 1P33A 1A88A 3QKUA 4PVMA 3U1SH 4PW4A 3T04D 3C7DB 3RSFA 2XMPA 4NENA 1L0YA 5JWOA 3GWJA 1GQOA 1UWYA 4MWDA 2VK1A 4JR9H 5FV4A 2ZT9C 3FAWA 2UYGA 2IADB 4P3WA 1EKXA 4E0RA 4OIAA 4M5YL 1TUPA 2R96A 3O8XC 2WHVA 1E8YA 2DWDB 3BE4A 2CLZB 2E6QA 1FMJA 1FFXA 2QPUA 3SYOA 2X0VA 2WKSA 3EPKA 1O94D 2N47A 4Z7VB 1CL7L 4TV9F 3BICA 3KGTA 4M1CC 2I2AA 1T7WA 4YDJB 3DFFA 1JG9A 4FQCH 4U02A 2LE9A 5CFQA 5E2AA 5ETJA 1KE1A 2WYWA 2ZKYA 1LWHA 2WZ0A 4MD4B 4P2OB 1TYDE 3RX7A 3WMFA 2IYLD 4Y2HA 1M34E 1NN3A 1EZSA 1XU9A 3PR3A 1KAEA 5J23A 3BX7C 4BFXA 3MRGB 4AEHL 1O6GA 3U9UB 2HX7A 3W6UA 2O2XA 3RT9A 3GEPA 4PIMA 3OT5A 3VFTB 4IQ4A 1RK7A 2ZRGA 4O2EB 1JXDA 4GICA 3WS6C 1ODSA 5LN1A 1SQ0A 3U3JA 4MYTA 3P3TA 2GTZB 2FYYA 3T2QA 2QG6A 3H2GA 3QIWA 5GJSH 3WY4A 4HKJA 3FCSB 3VSUA 1JFTA 2V17H 5DEZA 3AWEA 2IEIA 4XCYA 1PX4A 4WN9B 1B8OA 4LPSA 2K6ZA 3N04A 2R7NA 4XIYA 2HPAA 1YQXA 2NY3D 3G6AA 1CR4A 3B8HA 3C24A 3LBAA 3S27A 5JSQA 3LP8A 4YXWA 4R7LA 5A5DA 1WZKA 3NVQA 2CLIB 3OX3A 1DJWA 1UGNA 1IM8A 2QXTA 1WXDA 5FM4A 3CN0A 1KDZA 4D4LA 2YQBA 5HS4A 1A14H 3RTGA 4HKJB 3ORFA 1YZTA 1JQDA 2HRBA 5G4OA 4H60A 2PCFB 1EWTA 4XNXL 4HPWA 1LZLA 3F7QA 2XYVA 1IKFH 4Z9BA 3HVNA 1KEKA 3I2GA 4OQTL 2CBGA 2XCSB 5I6KA 3NFNA 1T0PB 4IIBA 5KDDA 5KHOC 2CIIB 1KGCD 3GARA 3Q8MA 5H2BB 1JXMA 1USIA 1TXKA 3ZE8A 2R8XA 3PA6A 4ARUA 4XWKA 4XNDA 3PXUA 3MWDA 3RYFA 2E82A 4OQZA 1IG0A 3BGSA 3TYXA 1XF3A 1RYBA 4G70B 3AJ9A 2J9ZB 5C71A 1CQIA 4B6JA 4MS8D 4GAJH 1EFVA 3SXJA 2JKLA 1TOAA 3I04A 4L02A 1Y1KE 1R0XA 3DYMA 2O3TA 2IAND 4ZP1A 1XAJA 2CSPA 1T83C 1BSVA 1DEDA 3I5XA 3GBMH 5J2UF 1G7MA 4I81A 3PXEA 3I5UA 2DY2A 3DHPA 5IYZA 2MYUA 1P6AB 2PSSA 1P7PA 2IBBA 3A6ZA 4YRZA 4MB1A 3HG1D 3UMJA 3VPHA 3AY7A 3BA6A 4GC5A 1K2VN 1Q83A 4RVBA 2ZUUA 2VL7A 4JFRA 3MV9D 2ZQ5A 1HNGA 3LY8A 4W7SA 2BNUB 3BJ91 2G1AA 2O4CA 3FH8A 1GJUA 1RQ5A 2NMSA 2V9ZA 3BVXA 1PR6A 5IAGA 1DC7A 4QWWD 3D25B 2JIXD 4I99A 1FFCA 4JWTA 3DE5X 1EWRA 3BT7A 1BIFA 1S6NA 4FJ6A 3HUFA 2OHJA 1MLCB 3I84A 3ENKA 2BEVA 3H9SE 3HV2A 4XDZA 1GUZA 2XWZA 2F08A 4OP3A 3LRXA 1S7XB 2B1AL 4JI5B 3FFCD 4PG4A 3O2SB 1VRWA 1ZAGA 4P4UA 4GMSL 4EL0A 2FNBA 3B6ZA 2IITA 3CV3A 5TPWA 2RACA 5F7HA 1E3ZA 3FQWA 3L4WA 1H9BA 3RYIA 2YC1A 1NVEA 5JR3A 4MLSA 3RQIA 3B5IA 4J0HA 4KCGA 4NZJA 2OZLA 3GTVA 4E5NA 5GONA 2W2QA 1LX7A 3P2DA 1SYSB 2J8UF 1YOBA 2UZAA 1J0JA 1UJ2A 5CEJA 4N8VB 2IJGX 4ODUB 4WOPA 1H9CA 1MBZA 3OZ7A 1LKZA 4LPCA 4ZGWA 3CFJA 3MB8A 4C0KA 4K71C 2A0WA 3SDAC 4Z7QB 1S0UA 1NFDB 3PL6C 3OIYA 4QTIH 4KQ3H 3KYMB 1TCAA 5ICYB 3AM1A 3ZK8A 2RHGB 5BYAA 1MX9A 2ZCKL 3PSAA 1VFBA 3KD4A 1CR6A 1F11B 1IC5L 3RDTB 2BVEA 4EN3A 1XSKA 4K2AA 3MS2A 4V0LA 3IDXL 3IQFA 3L5HA 3PUUA 3E6HB 4JLOA 1UXGA 2PX0A 1CXHA 3TRDA 4N5EC 4MKZA 1DBKH 1F9EA 2JK5B 2GRAA 2H1LA 1LTQA 3LSYA 4GZMA 4CVNA 2MSNA 3FCXA 4EM6A 3C5CA 1Q94A 5JO5A 1QVOA 5HGDB 1X86B 4ESKA 3S7TA 1VPWA 3GNQA 1YN6A 2WQRA 2CCGA 3GA7A 3F46A 4MXWL 4OJFH 4YCDA 1E3WA 2Q2QA 4QOHA 4HG4J 2J7LA 4AJ2A 3JCZA 2ZEJA 4EL5A 2Z2ZA 3UL4A 3KWVA 3ENWA 4XN2A 1EAPA 4P8QA 2B7CA 3E9MA 4ALAH 2JARA 2N46A 2BSED 5JUWA 4W9RA 4N3AA 1B0PA 2PD3A 5AVYA 1QV9A 3PY9A 4ZCRA 2HT6A 1N2EA 5C1IA 5A4DA 2XAAA 1QYIA 3TO2B 4B31A 3KPMA 4LN1A 3GBEA 2OX5A 3QCTH 4UNRA 4ZW3A 2Q3BA 4I77H 4IIYA 4CU2A 4GSYA 4MARA 2H32B 4BAZA 4XN4A 3OE5A 4CEHA 2BOVA 4BLQA 4NNYA 4C3ZA 4GVXA 5GSRA 4NC9A 4FYYA 4Q7DA 1T6YA 4IRSC 1QOQB 3FWNA 5CEZH 4PSKA 1W0JD 5GGTH 5DM0A 4X8GA 3RG1C 4MS1B 2W2XA 1T1JA 1HHKA 1MUJB 3KPUA 5K4GA 2ZETA 3ZN6A 5GS1A 3BXXA 4EP1A 3FTQA 2DPXA 2GYVA 4N7MA 3VXNA 1XYGA 1Q1JH 1SIOA 1ZA6B 4HEA6 3Q15C 2JCBA 2P4UA 4U4AA 1X87A 4F33B 3TKAA 1ZBQA 2XA1A 5DZOA 2HNKA 4OVVA 4NN6B 5CFAA 2YY5A 2F4NA 2OMKA 1NY6A 2ID5A 3L4UA 3FFWA 1W72A 2ZAGA 1I4TD 2XIIA 4W9NC 2D13A 1E64A 4JY5L 3L7CA 3H6KA 1ZNQO 3OESA 4N5ED 3D4NA 2H29A 3E22A 3F7YA 3E1SA 1WP4A 3QRGH 5C0CE 2M6RA 1CGVA 5BN3A 3OXRA 3EOTH 3T1OA 1ZI6A 2HWWA 2KHAA 2PLNA 1QB8A 1P5UC 1P44A 4PLFA 3FFCE 3IF1A 1U8PA 3U26A 3A6BH 3PXBA 1T9CA 2CDFB 2OMYB 4XC1L 5LN4A 5KZMB 5K8UA 2P9TA 4JREC 4CUJA 3KJ4C 1UURA 4ZN6A 5KQMA 4RA3A 1OYYA 2HLDD 4M36A 1FC2D 5HZGA 3DOSB 1JUFA 3IOCA 3IQIX 1Z5GA 2ZYHA 4JROA 5CFNA 3KXFD 5DUJA 1UENA 4DBZA 2RC6A 4FNUA 4LHXA 2GBLC 3SE8L 1QHNA 3D0AA 3DKVA 4FFVA 2J21A 3A6CH 4JVUA 3KWFA 5L7TA 4WI9A 5KVVA 4MWGA 3KETA 4F3NA 3Q7IA 4P46D 2RALA 1JJIA 2QHXA 1CQJA 1WZAA 4KMQA 4Q39A 2H2PC 5DFVC 3SHSA 4XJXA 3HZ3A 2OQIA 5JW4N 5I1GH 1QFHA 3LPOA 3V6FB 4PRIB 4X7CC 1WPRA 3BM5A 3U4HA 2KBGA 3B6KA 4I5BA 2D5IA 2I22A 2QX9A 2BLLA 5DS1A 3CFYA 4FGMA 5IHUH 1IC7L 3WBKA 1DVYA 2D59A 4I9FA 2QF7A 3L6EA 4Z4CA 3KQSA 1JGDB 5JE8A 2GPTA 4PS0A 3AG5A 4F7PA 5T6MA 4L8YA 1NJ9A 5T3ZD 1DKRA 3PL6A 4MNTA 2YKLH 1F2QA 1YS9A 1HHJB 1ZT1A 1IX2A 2O19A 1Z7JA 3VPFA 4JKNA 1Y6NR 4ODHL 5FUOL 3RVQA 3HI4A 4C56E 4IRZH 1WDAA 4E5XA 2A9OA 2EG9A 5JHGB 5JMOC 1DLHA 2VP6A 3AINA 4J0DA 4YP5A 4S11A 2WYVA 2QRHA 4ZAFA 4H5SA 1SWWA 5HP4A 1S9VB 2PN1A 5EUOE 4OLXL 4GWLA 1GAQA 1T20B 3BLKA 4HT1H 5M04A 4OJTA 2ZX9A 3OI7A 4QRTB 1UZAA 4EITA 4B4VA 3WL5A 1E7SA 5KG9A 4N8CL 4CN1A 2IWEA 1XO8A 4MW5A 3K94A 1KIRA 2ENJA 2HJGA 4FGUA 4XGZB 1N5YH 4KG7A 4AO8A 5GJWC 2HH9A 1ZKMA 2PETA 3U48A 5I16A 1EFRD 3M6FA 2MPVA 4YSTA 3QCVH 1N2JA 4HUQA 4Z49A 4I13B 1X3SA 2H0EA 4MVYA 3ZTDC 3L7IA 3QIBA 1NMAH 2JKSA 4ITUA 3GROA 4MI3A 2V37A 3W39A 3CQPA 5IHUL 2FDRA 2RIPA 5CN2A 4LSPH 3PPSA 4MMZB 2GZAA 4H8WH 1CKEA 1T6ZA 3UENA 1M6VA 4UILL 2R0QC 1BVYF 1ZUD1 2FUNB 5G3ZA 1TU2B 3QDJE 4YWGL 4HJGA 5BRQA 3STHA 5E2TH 2WP0A 3T0EC 4XPIB 3TF5A 3QNXB 4U1SA 1T4KA 3NBFA 1Z1WA 2WD8A 4L1TA 5JSUA 2Q3FA 3AREB 4OCYH 3SDZA 3ZE2E 3RZCC 3FUHA 2WP3T 2W07A 2F1KA 4KDEA 5IN4A 4K8RH 4JPWL 1LC3A 4C07A 3TM4A 4MHHG 5DFAA 3V0DA 3AF2A 2QTZA 3EB9A 1U21A 1EEZB 5AFAA 1YUBA 1S2MA 3DLCA 1FFYA 1KK0A 3FQNA 1FNSA 5IXJA 3D0RA 3HEMA 1U0BB 2I32A 2VNKA 4D0NA 1N8KA 4XNBA 3VYOA 5TARA 3VPSA 4ZX4A 1GRVA 3GZTB 5BY2A 2BHUA 3KPSB 1IEBB 4CN9A 4LZKA 5I17B 4WLUA 5J2UA 2BR4A 2IHKA 1RK0B 3HLYA 3M4ZA 2KMWA 2EXTA 3N1UA 4D46A 3ZWWA 5D84A 3GSUA 4ARZA 3NO4A 4LLVB 4QTIL 3TYGL 4CF4A 2KE5A 3C75A 1J12A 3RGVD 4CU5A 4F2EA 3IR5A 1FCJA 3DDZX 4M1QA 3QTTA 4O4YH 1RXVA 5GGVH 1J8HD 2IOOA 4YDRA 4BUJA 2N42A 1Q7EA 1Y98A 4CKXA 4UUOA 2YQ5A 3T6WA 1Z13A 3IESA 3M6XA 4Y4HC 4NXNB 5DZVA 3WX0A 4S1RL 2AJZB 1MHPH 4JZKA 4K7FB 2GAAA 4E5SA 1U6AL 5L4JA 5DHVA 1TF7A 2W2NA 4YZWA 3KG5A 3QQ9C 3ST7A 4NP9A 5IW6A 4ESOA 4F21A 4P9ML 4R1SA 4MAUL 3FUEA 4HAUA 3KHKA 3AP1A 4ZYKB 3PUIA 4I4WB 4ZOQI 3ZK0A 2Y1YA 1EA9C 2PSEA 5AUQA 2FJFB 3UDWC 4J7AA 4PEEA 2Z3ZA 2XBLA 2NY5C 3KKNA 2HK7A 4LCCB 5ESQB 3H84A 5DW0A 2R69H 5D6CA 1PZEA 1P2FA 4AT1A 5E6ID 4NR0A 5CR8A 1ONQB 1NVGA 4X9FA 4NEGA 3LIZH 4X6CF 2ITEA 1TZ2A 4TWJA 2GCOA 3FSVA 4AS2A 4ONFL 3QG5A 5JLAA 3BGAA 1KFBB 3OPYB 3FUWA 1WIPA 1WDLA 4DSYA 4OYHA 3WBFA 1FZQA 3O9WD 3APNA 2EKSA 1U9KA 1WDKA 2ZT8A 2EUWA 3IFSA 3Q2CA 1HDOA 4OX9Y 2HW8A 4Y8VA 3JD0A 3V4PB 2RB8A 3D0LA 2Z6FA 4XO9A 1NURA 1GNSA 2GBPA 4R9RA 1L9RA 3PHIA 5SZHB 3RVKA 2H4EA 5EBMB 1RZ8A 4JO4H 4Y1AD 5MGNA 3NWEA 2HA0A 4HSQA 1NC4B 2RHOA 2FRDC 3SJBA 1CR0A 3NZHH 4WD3A 5GGRB 3D18B 3MV7D 4K3GA 2Z1PA 2Y72A 4UHKA 2TYSB 2Y0CA 9LDTA 1H85A 1N6IA 3G85A 4U2KA 3ES6B 3PPWA 3G2NA 5DJ2A 1YR6A 3LNTA 3OMAB 1TE2A 1P5HA 4L3ED 3PWZA 1R8YA 1SU8A 4HEA1 3V1UA 1X80A 1N2SA 3EEQA 3STZA 1YCSA 4MWBA 4M5SA 4XKJA 2P77A 1AZZC 4ZYZA 2XTZA 4R7VA 3VGGA 4KKBD 1QOPB 1I9CA 4YAQA 1N4AA 4RLDA 2G1KA 4QSHA 5K59E 4AG4H 2FEXA 4MUIA 4B0OA 3F2IA 1NNLA 2R6FA 4Z3OA 5KNBD 3H05A 4Q4CA 3D6GA 1C1DA 4EDHA 1SOXA 2YPVL 3MRTA 2QL9A 1LUAA 1SOQA 3VNZA 1QGZA 3KJNA 5DZLA 1LPBB 3QOFA 1QS0B 2V6GA 5KOHB 3M1CA 3A6JA 1BWPA 5FBKA 4KWEA 2N7BA 1FNNA 4BGEA 4M4RA 1DUZB 1KN2H 2WWRA 3D6VA 5CDFE 2IAAC 4M9RA 1UWEH 3G3LA 3TPZA 2WKWA 2XIDA 3ROOB 1MT0A 2AJ8A 2GBVA 2EDTA 1JKIA 2IP2A 4BFYA 1A1NB 2V3DA 3F90A 4KWTA 1G84A 3BXOA 2EDHA 3D39A 5JYEA 1E3JA 3TSAA 5E4YA 2PTUA 4LFAB 4NXSA 2CLFB 1QBKC 5LP6A 2WKQA 1U5CA 4W9JC 2HEGA 3CN2A 4W9IC 5JISA 1J8HE 3PGCB 3MMSA 1PZNA 2WIIB 1GZHA 2Q8PA 2Q5CA 4G0UA 1RR6A 4YAIA 3CNLA 5HPMB 2EDLA 4XDGA 1CTOA 1K7EB 4FDAA 3CC5B 4JI8B 1I51A 3AI3A 4GLLA 1PT7A 2OR8A 1N77A 1RC0A 2Y3IA 3ULUF 1H0SA 5A2QA 1ADJA 2VHYA 1L9KA 3ZJVA 2EWMA 4DMGA 4PRBB 4EB0A 1X3DA 1G7JB 3IV6A 3T1NA 2QUAA 5CLHA 5FNVB 4DOHB 2WP3O 1G5QA 5C3UA 3CVHL 1U8AA 3CPLB 3F9RA 3N2IA 3HDTA 4ZK8A 4PAWA 4ALMA 2NDGA 3TUZC 2Z0MA 4IO0A 1XNGA 2WCPA 1QUPA 4BSVA 3DIVA 1JXJA 3IGAB 2P24B 1T5SA 3DQZA 4YPGB 5CWSB 4EQZA 3ULVF 3M4NA 1J2JA 1E5VA 2I6FA 1ABEA 1GGKA 1Q0QA 2IOFA 3WMPA 3PJSB 1ZT7B 3PLAE 3H9HA 3GU3A 5JZMA 3GFTA 4G5QA 3BZUA 2WY2D 3H9QA 4G85A 4AJ4A 1GGMA 1ZVSB 5HDQL 3OEED 4XX1A 3T94A 1SGWA 1M71A 2QBYB 3OAUH 2ZCJA 4W4TA 1MWAA 3MACH 5CVEA 3GLZA 1JA1A 2ILLA 2VSXA 5B36A 3L5OA 4GFTB 4C2TA 3LN9A 4BO1A 4FG6C 3V7AE 4F7EB 2XDYA 1KSJA 3GGPA 4AW4A 1KXVC 3GMDA 3NBAA 3V0HA 2JB6A 3C12A 4L4XA 2XVGA 2C3UA 5TX7A 1W0VB 2CRIA 3ZDCA 5DUMH 1JDVA 1TYAE 1UMDB 3OOYA 2B94A 1E1KA 1SK8A 1OI2A 5JAZA 1VSUA 3PUHA 2DMRA 3K8QA 4WN9A 2A99A 3IGLA 2Z5VA 1WP9A 4Z9FA 1T9HA 4ZG1A 5JHHB 1QVZA 3BP6B 1CUDA 5DASA 4H1VA 1XCOA 3AXHA 4JRYA 3VXMD 3OOEA 1ETZA 2QE7A 4C0JA 5DHYA 3GA5A 1J42A 2E75C 4OHUA 3BKMH 3OE7A 4EYGA 2OBGA 1ISPA 2CRYA 1OSNA 4FGSA 4PAQA 2P3LA 3EGXB 4RFEA 2QVGA 3T4YB 3ZHQA 3B3AA 1DSSG 1F4XL 1UJTA 2XNAB 3T3GA 2N01B 1XL6A 2HYMA 3TTUA 3DRQB 3SFTA 1CUUA 1E9QB 3OHXA 2JLPA 4L6AA 4JX0A 4OY3A 2GO1A 4UU8A 2NQ2C 4L1DA 2JCCF 1IB0A 3DBRA 3QFSA 5E0QA 2C1XA 5AZEL 2QP3A 3EJ6A 1AXSA 5L8VA 3KPTA 2IYVA 2CUIA 4E13A 1LYQA 5F1NA 1E50A 1J39A 2KB0A 2JLWA 4HULB 5L0QB 1TJYA 5CPBA 3SSNA 4EUHA 4HNSA 4A39A 1S8DA 5FPYA 3NJ8A 4PYLA 5BOZG 1ZTMA 1E9EA 5I9QC 3IA7A 3CRVA 1D6EA 3MCTA 2XOTA 3MCYA 3O93A 5CEEA 1ZLEA 2FEJA 2SCUA 5KDLA 3WFIA 2VK2A 1JZFA 3LPMA 4PVDA 4E4YA 4E1AA 4GKAA 5CBAB 3QUGA 3PUYA 1B90A 3DHUA 4F8EA 5CG1A 2AI0H 1FZMB 2CBMA 4ZHSA 1U0TA 3M6MD 2HKAA 3ZWXA 1J9CT 2ZAOA 2RGUA 2R25B 1A1SA 4PJAE 3FWZA 2PRSA 1LP9A 3QRFM 1BJ8A 5EA0L 1G20E 3QWBA 1D5BB 3DTVB 1M9WA 3WFDH 1JMZA 2C4UA 4ATNA 1E3TA 4MAUH 2XWQA 3G2JA 3IMGA 4ZIRB 1G9EA 3JTTA 4FXKB 2VVTA 2AP2A 3C5VA 2QX7A 1MY7A 5JLZB 2P6UA 1DQZA 4DIEA 5D9SA 1WCWA 3ASOB 4DCQB 1LQ2A 3ZV4A 1UWCA 1QUNB 4G1MB 2VYND 4PZPA 4LZAA 4CDMA 4A2GA 4JXXA 2Q5IA 5DWPA 1QZ1A 4V0OA 2H7WA 5LNEA 5CCHE 1DQNA 3UMNA 2PX8A 1NBWB 1PQPA 3GSOA 2JD1A 4LRQA 1GHFL 2GUGA 2WVSA 3CVBA 2Q7YA 4N3CA 2FN7A 2NPOA 4IFBA 4LNRA 1VI6A 4ZYKA 5EORH 1TEFA 3LLUA 4BNWA 3T65B 3ZD9A 3VWJC 5SYMA 2OLJA 4KIJA 1MCWW 3KLLA 5JYCA 1S7TA 2INGX 2FX9H 4PPFA 2WNXA 3P7MA 1JZEA 5K3OA 4N86A 4HIEB 4EI0A 3VXUE 4E33A 3D6NB 4CKQA 3UYRH 4PY7B 2PP9A 2YBDA 3DSNA 2AVGA 3QEMB 1LP9F 1XJ5A 2XV0A 2AZ4A 3X1KA 1P4UA 4K8RL 2YJ5A 1USVA 4JXKA 2YDXA 3ULSA 1NG9A 1FK8A 2NY5H 2Y5EA 3ETSA 1T8YA 1EFLA 3OWHA 2ADMA 1FC0A 5HHVL 3UBXG 1LF0A 5K05A 2I60L 3RGHA 1J5HA 4FQXD 3LIIA 3NA4A 1LWRA 3M9WA 3TW6A 3TV8A 4L0YA 2AAVA 2NU8A 2V5UA 2C1ZA 3FRPA 1DSWA 2RAPA 1ZVSA 4D3FA 4PYIA 4L5CA 1E0DA 1TNDA 5C0EA 3DXYA 4E0BA 4F2DA 1QTQA 3HPLA 4WFGD 2EE2A 3C41J 1LP9E 1ZVNA 1QSFB 5BV7A 5FYLH 4JN2A 2VH1A 5D1ZI 2WT9A 2ZRFA 4QODA 2YEVB 4PHZA 2QJRA 2WUDA 5JTUA 1AP2B 4FFYL 3KJGA 2WW8A 5EPMB 2JFQA 2ZTHA 1KJJA 3AI2A 3KKKA 4NGHL 2PT9A 1TQ8A 1CNMA 4BM7A 3GLAA 1GTG1 2P41A 5F2KA 3JQDA 3FUMA 4AQZA 2RIRA 5T8KC 5DLDA 3D81A 5INDA 4FA7B 1S7RA 2VDKB 3P4XA 4GPEA 3N42F 2P91A 1FU8A 1WKVA 3UMYA 3RTBA 5LP6C 1OA1A 1R6BX 1Z7EA 1ZSHA 3OT4A 2J6EH 3P73B 3DF7A 4QRRA 2PA3A 4LSTL 1T1ZA 3ZIMA 1KWKA 3TKYA 2YPLD 5LWYH 1CGSL 3F6EX 4MVJF 3PFQA 1I01A 5CFZA 5LZ7A 4B73A 1R27A 4R0LA 4Y4KA 5DM4A 1P4IH 1WABA 1SJHB 2NMVA 4F7TA 4A2HA 1XGTB 2NY3C 2FMTA 4RGOH 3IUNA 3MOQA 3WP0A 3VYTB 4X90A 3CZ5A 3G6JF 1WBYA 4K8RD 1XMXA 1SYVA 4F3CA 4B9KC 4A92A 1EXGA 3UJ7A 2ZQZA 4TSKA 4LYFA 1YHNA 2A1WL 4XIGS 4UDTB 1KO5A 4YJHA 1FUEA 1CDDA 4EO7A 4K7PL 4LSGA 3CVIL 5EO0A 3SQOH 4QPEA 1O95A 5FHBL 1MCPH 2PV0A 3FU3A 3C6LC 2PXYB 3B2UD 3QO1A 1DLHB 4FE3A 1C1DB 5JYLA 4GKSA 3VG0H 1QDEA 5SX4H 2JJSA 2O8EA 2VHZA 4L9RA 5IMOA 1E8ZA 3BJLA 3E1KA 3ONEA 1ZLXA 4E5UA 3KS0J 1Q15A 3K8YA 1NUAA 3SC2A 2R9HC 1KZ1A 2NW3B 2FHSA 3FQRA 5GGQH 4PLPA 1QEWB 1U2DC 2K9UA 3DD1A 1FSFA 4A67A 4IS6A 2R1XA 4OFDA 2UUAB 2C8NA 1R0SA 3UAZA 3U3OA 3L93A 4LEOB 4W63A 2GTWB 4NM8H 2GM5A 4JLRA 3NWJA 5KUKA 4AJNA 4WINA 3IB4A 3FKUS 3UMTA 2FJGB 4QRBA 1FLDA 1JHQA 5D96C 3M6UA 1DVFD 3MR9B 3UEOA 2W65A 4DSNA 5FGRA 2Z4TA 3RVVD 1NTRA 2P27A 3NM4A 1XD2A 4JPVH 5JW5B 1U95A 1F56A 4UMSA 5EC2B 3ZQJA 1UFVA 3HFGA 1WT5C 4BKLB 2A92A 4UV7L 2R1XB 2H08A 4OLYL 3FE2A 4U3CA 4PJ5D 2VISB 4D4HA 4RMQA 1T6XA 3COJA 1LC0A 5J11B 4ARVA 4QDXA 1G0XA 3IQXA 5JANA 1A7PL 2ZI6A 1ZVJA 4MFHA 3I6KA 4IS6B 3GLRA 2V0CA 2AN4A 1EZ1A 1I7ZA 3TRKA 4RMJA 1U3HC 5EZIH 3SYMA 3QA3E 3MLUL 5ALXA 3DVNA 2IPXA 4NF2A 2NAFA 5ICCA 2G6TA 5AAMC 1TYCA 3I01M 3US1A 2IUSA 2QPFA 2G0AA 2C97A 3C3DA 1BYOA 2G9UA 5L9DL 3CZCA 4XCFL 4PX5A 5IT4A 1NC4D 2Q6OA 3PDOA 4YGYA 3H1BA 3AHDA 2IV9A 3EO0A 2XVBA 1SB9A 5ESVA 1H1LA 2D7QA 2YHGA 1T5XA 1BZ9B 4O2RA 1GG9A 5K0JA 4XPAL 1TZOA 3RWHA 2IOHA 3TVMC 4PJ5E 4H18A 4PGEA 2IOQA 1UM8A 1A7AA 2ZP8A 5E7BA 1RBYA 4QRFA 4FDUA 4Q9RH 3BZWA 1CICD 1VGKA 3UO1H 3NHJA 4LOEA 1TLMA 2R2HB 3UH1A 5E1QA 4CNQA 1UMCA 4P36A 1CD1A 4LVNC 3EEBA 3MUFA 1SWVA 5EGSA 3VJLA 1KJ9A 3NCHA 4ZI2A 2I1WA 4WBNB 5FEUA 2XV6B 1ADWA 1WDWB 1IAVA 1MVUA 5EO9A 2FKAA 2HJKA 2GOYA 3U2QA 1KLFA 3CGGA 4JL6A 3KZNA 3W6OA 1UBMS 4A68A 5CHNB 1SVNA 1NVUQ 4DT1B 5BV0A 3TYFB 3TBYA 3N43B 2GFBA 1MA3A 1IDOA 4ZVUA 3DUHA 2LE0A 2I5YH 3BK2A 2H5JA 3NJ4A 2ESVB 4UINH 5GQBA 4KHPB 4OJFL 4C2UA 4IX1A 5DLQC 5C07D 5KYXA 4ACBA 1DMRA 1KB5B 4DERA 3MROA 1S7RB 2XTJE 5EWIL 3FSZA 1SM3H 3OT1A 4FD3A 1H5BB 4FR5A 3NEEA 3N70A 2DW5A 1OLSA 4QXUL 3CU1A 1E2QA 3LUPA 5GWXA 2VDOH 3WVNA 1BXKA 4DE5A 1WDMA 4EI5D 3KJEA 3AREA 5E5UB 3ASWA 1ZOIA 2NXYB 1WBZA 4HWEH 3KHUA 4KGZA 3NYWA 2D3JA 3N40F 1X74A 2OM2A 2V8LA 5AW5B 3TBYB 5A3VA 2IJ0C 3MNFA 4CKCA 1NG1A 2HVJB 3AVOA 1N7ML 1J56A 1ZGAA 2OHVA 2I3ZA 1F6BA 2DFDA 4F8JA 3WKCA 1MCIA 4Y8DC 5CT6A 5BXQC 2CHNA 2YNMC 2GHTA 1FMCA 3WHIA 4CV2A 4FNPA 1JEYA 4Y4FB 2ISQA 4HQLA 2K7QA 2NU7B 1ZQ1A 2X9GA 4R9HA 2OG1A 4GEGA 3H2WA 2Y5TB 1Z29A 4K7JA 2EDEA 3PB3A 4DILA 4KO9A 4ZT2A 3ZR5A 3NAQA 2CO1A 3FS9A 5JCXA 4JRXE 3DX8A 2AQ1A 4KOBA 1HYSC 3F65A 4LTDA 5GAJA 3OB0K 2I5PO 4R8KA 1I7UB 3Q2NA 4ZAWA 2IY8A 4PH8A 4NFCA 3BRSA 3O84A 4CEJB 4N5LA 1MR3F 3S5JA 3GSQA 3UPCA 1MVLA 3ECBA 1V5FA 2L19A 3OQHA 4CMAA 2BVNA 3GJYA 2X5PA 4F3FA 3RAPR 1E2WA 3GJ3A 1JE1A 4P4SA 3QAZC 4JPIB 2FMUA 1GU7A 5ELIA 3B2UC 2VWQA 3JV0A 521PA 4GXVH 1BDIA 1XSJA 1ICIA 2G4CA 1N19A 2OCLA 3ZUNC 2QYTA 3KSZO 1K8YB 3FCBA 4HAZA 3C5JA 3DUWA 5EHIA 3DBVO 3EIUA 1BOOA 4NJOA 3PHLA 4NARA 3ET5A 2Q3JA 2MSLA 3A1TA 1KJQA 4EJFA 4KYVA 3SBWA 5GGTA 5KAQG 4GP9A 4QVKA 1QQTA 3BEVB 3CBRA 1D0VA 4F8LA 3A6GA 5C3TA 4MB5A 1RWBA 1P1HA 3ZDRA 1SUSA 3ZZTA 4MSWA 2Y4OA 4F3RA 2GYYA 1NE2A 4ONEA 1KY6A 1QPKA 2D31A 2P5ED 2EL9A 2PKCA 3LGSA 2YOGA 3W9YA 1U6IA 4L9AA 1QZ3A 4MQ5A 3CVXA 1KZHA 1PW3A 3KYKL 1MPXA 2G1UA 4I1VA 2VJ0A 3I9FA 4QTFA 3WAGA 1JB1A 1DQQB 4PRNA 3S4SB 3B2EA 4PR0A 2X70B 2QIOA 1BAGA 2VXUH 3GN1A 1M1YA 4AQ7A 5BUAA 4P4RA 4APQA 2JGKA 2VI5A 3LUHA 3FPJA 1WFMA 2B1HL 4ABYA 4F3TA 5DFVD 2FSEA 3FG9A 2WQAA 4UOJA 3ZY5A 2YDYA 3PC8C 4PWJA 2IPTH 4ZVPA 2HNAA 4MD0A 2H17A 1W94A 4EBQH 4J0KA 4OFQA 3R1GH 4K7PX 4HDOB 5FKPA 4PJFA 1I3NA 1A8SA 1T2QL 4HWSA 2WYUA 2HBZA 4XIIA 3UFBA 2FSIA 3QI9C 3W3AA 1ZS9A 5LOVA 5BQ5A 4P7BA 1XSIA 2A0UA 2RH4A 3GO4A 3E9RA 5DV9A 4EHLA 1TJ5A 4J7CA 3A4YA 4FHZA 4QWMA 3KKPA 3SDAA 3EQZA 2ODEA 3V8OA 2W38A 4KGDA 3F2LA 3LXCA 3UMCA 1S8OA 1MJHA 3IRCA 5IOPB 2KDGA 3B9KA 4ZVRA 3BX1A 1HL3A 1P6QA 2VMEA 1WBYB 4WI8A 1WHSA 2EUXA 2CUKA 1RJWA 5HGXA 3FTCA 4PANA 3MLYL 4CAGA 1CF1A 1S2IA 4FKMA 4FYMA 1TMGE 3KJZA 1BHGA 2HADA 3OKPA 1M05B 3C09B 2VP2A 1SXZA 3LHSA 4OUDB 4TVPL 1T03H 2J71A 2AAAA 4WJG3 4FIDA 1BQ5A 4YJZL 4B4DA 4XPTH 3U2SA 1VGEL 3LY7A 4OM1L 3CFEB 4DP4X 4WSGA 2W2LD 1G6RA 3CVOA 5AW0A 3GWZA 3IVCA 3HTXA 4QEDA 4YFLI 2DKOA 4O63O 4U0KA 3EDFA 3C3YA 1Z0AA 3C8KB 1EUDA 3E2IA 1E79D 1YRWA 5D1ZC 1G5AA 3QDGA 3FUUA 4QRUB 4S04A 2AJ3B 2PAFA 2BSAA 2FQQA 1Q0EA 3A11A 3ZWYA 2CE7A 2IYPA 3E1GA 2C7UB 4DNLA 2LU4A 1Y3FE 4YRIA 3IDAA 4MWOA 1AGBA 3E9UA 3OURA 3PXJA 7YASA 3PWNA 3BAEH 3VNAA 4ENVA 3NTUA 5CD3B 2QT6A 1N9PA 1EFCA 5CURA 5L3ZA 1MAKA 1F3LA 2WA2A 3QXWA 2GSDA 2OMVB 4P99A 1JYXA 4DKJA 1NVTA 1DB3A 3VYVA 5AM1A 4NERA 4LASL 4KFUA 1X70A 3U4DA 1NQBA 5D1QB 4ZYLA 4ZPTA 2UZYA 4TSBH 1IEVA 4I8XA 2NU9B 3AFCA 4EG5A 1YVRA 1UEYA 1LQTA 3IXTB 1JZSA 2AW3A 2C9DA 4ABWA 5LQRA 5GGYA 4UHBA 2QMOA 3C5XA 4YP1A 4URTB 3B1ZA 4FZ5A 5CDYA 3RUEA 4JZJA 3ZOAA 4QYXA 2Y07H 3DZBA 1G6VK 1MOSA 3W38A 3I02B 1XGPB 3RJZA 3DRTA 2L2QA 1H8LA 4Y2DB 4M1TA 1PR4A 2ZS9A 2MKLC 1QCYA 1U80A 4UNQA 4WHYG 4UNPA 4YRCA 4EUKA 4N5DA 1R5BA 3BE1H 1N2OA 5DMJB 1SZDA 1WC7A 4ON9A 5KNCA 3SS8A 1IAKA 1Z7WA 2DLEA 3P77A 5F8QC 4AP9A 1CDJA 4IFIA 2ODAA 5LPNA 2AJXL 2AHRA 4F58L 3MXWL 3CQQA 5EU5A 2CXOA 5IVXA 3KPPB 1PQYA 3FQXB 3NOXA 4FEIA 2J09A 4PJ7B 2EHJA 4MS3B 1TU0A 4CSPA 1JEDA 1ZEAL 3POCA 1HG0A 3THWB 4M7JH 3K4QA 2XWEA 2FEWB 3Q2IA 1I5EA 3QO0A 4PN7A 2QXYA 1V7ZA 3P30H 4L07A 2VCOA 3K09A 3R0XA 5BOSA 3COYA 3HR7A 1ZLDA 3QA3B 5ITBH 4L5FL 2PQ2A 1NFFA 1GZUA 3HRKA 3CLTC 4W68A 5JIPA 4Z7WF 4CKYA 2HOQA 3O8XB 1YUKB 3PDGA 2A4ZA 4MYWB 3DGGB 1KY5A 3G59A 4NCC1 1F2UB 3WLFA 1N5KA 1NZFA 4U3SB 1DPGA 2J45A 3LQ2A 2OJEA 2WOBA 3KEOA 1S7VA 4NJAH 2LDBA 5EOCL 2OBBA 4XO5A 2C9ZA 5EYPB 4DSTA 2OL4A 2HEIA 1S3KL 2D73A 2NNXA 3QULA 1INEL 3ESDA 4X1IB 2I9LA 1E2NA 1AQ8A 3D9QX 2IKSA 4YCLA 1ZGBA 4IRJC 1ATIA 3EH5B 4YHZH 4RAVB 5DCCA 2C84A 3ZK9A 4I5EA 2PM8A 4OHPA 1SF3A 2PUWA 1OU4A 4ZSOA 1N4DA 3TXXA 3SDXB 5KMGA 4YY3B 1NDMA 4TXMA 3V0GA 2Y0SA 3AGWA 3AR8A 1CR9L 5EU6A 1PBYA 4L8CA 1ISMA 3PENA 2EO1A 2GKGA 2VDMH 2DE0X 5FW7A 4J9UE 4Y18A 4XVSL 1WA0X 2ORED 5EFOA 3TA3C 4DR1B 3MQ2A 1QFWM 3ZQXA 1L7XA 1ZIDA 4A66A 1OCEA 1GDTA 1BPVA 2TMKA 1DBPA 3T95A 3CVHA 1NGZB 1HT6A 2FL5A 4R31A 4GBXB 3FQXA 5L3SB 4KO3S 2ATKB 1O08A 3ETTA 3H86A 3H87A 1L5RA 5F7EL 3NSJA 4D0LB 3TMKA 1I7UA 1KC3A 3O6KL 1ACYL 3AL9A 3OJOA 4WVFA 4AH2A 5T3ZH 3U0BA 4ETMA 4A8JB 2WSPA 5J2TB 4NBUA 3S3SA 4AWAA 1NANI 1GOHA 4PSUA 1XMIA 1PL3A 3V0WL 1UPTA 4P58A 2W6QA 2IVFC 3M8OL 3RLIA 5B1KA 3HDHA 4P8RA 1PDKA 5I1LA 3AYXB 1T9BA 4HZIA 3ZGLA 2YW9A 3QJUB 3W90A 2P4EA 1EDDA 3F5MA 1Z56C 4ZS7H 4AL8C 2VXYA 4KMLB 1SMDA 3G6KA 1U63A 2ZJ7A 4G9DB 1OJLA 2ZXAA 2ONZA 2VXQH 4QU9A 1U8JB 2JKRM 1X6LA 3EA0A 1CRQA 1WSDA 2L17A 3OZFA 2L0XA 4F2WA 2EKQA 4N18A 1Y3IA 5BSFA 2I65A 4URKA 4JJ7A 3OOSA 1JPFB 4RA6B 4B7XA 4Y67A 3KG2A 3AFMA 4WI1A 4XTCS 4E6PA 4N39A 1AGFA 4OY9A 2CNWD 2H2FA 2I54A 2H0AA 2P2YA 3W7VA 1GZ7A 2GTQA 4PLJD 4QFCA 5CWSA 1LPPA 3BQUC 2DHCA 2C1PA 4OQTA 4URZR 3D1JA 4ZT5A 1L8OA 4WFQA 1TQ6A 3IHTA 4W1SA 4QBGB 1KCUL 2IMNA 1N3YA 4HVAA 3JQ9C 2QGDA 1BEZA 3PGA1 4CETA 3GFUA 1N7GA 1Z3CA 2YWXA 3BTVA 2OAGA 4AY6A 1XAUA 3PWJB 3TA3D 5BQ7A 4HHAB 3IKJA 3G79A 2XDHA 1CEQA 1FL6A 2OJEB 4WUTA 3WNLA 3BILA 3WWPA 4CVUA 1OU0A 4PGCB 2E9JA 4WZAA 1CU1A 3K30A 4HUQB 3SZUA 1FFOA 2AVDA 2WU4A 3MJFA 5BMVA 1M7DA 1JILA 4B4KA 2P9CA 5LBSH 1YZ3A 2IXGA 2O3SA 3RRJA 3OR6B 3R0VA 3QR0A 2PQ6A 3V7NA 4EI5B 3V6MA 3L4JA 3X1MA 3IAS1 4L2IA 1YUHB 1ILSA 1YYCA 3RVWC 1YNLH 2PKRA 2VLRD 4F71A 4OMDA 3BWCA 4D9QE 3QPVA 3S6CA 4P35A 2QOEA 4MQFA 4DAOA 5J1AA 1I3MA 5SWSA 2ZYSA 3ZWKA 3QZPA 1GAFH 2ED7A 5CBPB 3RWBA 3LC0A 2WCGA 3MUEA 5AB0A 3T8MA 4PLTA 5A3RA 4GZ3A 4MAYB 3DVGB 4P08A 3UXFA 4AY5A 2GM9A 5GGVY 3D8MA 3G88A 3CG0A 2CHUA 2VATA 3QNUA 2W98A 2IYQA 5K0CA 1YO6A 2E7BA 4S35A 4FI3F 3HGTA 4RMWA 1NIJA 3ZDYE 4TLTA 4EY7A 3OQIA 4BP1A 4K23H 2CXKA 4LK4A 2J3DA 4YBQC 4IDAA 3PE3A 5BS0D 3IV7A 5IFKA 1V7CA 4UVIA 1INDH 3CLTD 1FIGL 4IRJB 1T3ZA 1KEVA 2PO5A 3SOBL 3KQYA 3GXPA 3LI2A 2CNKA 1NRXA 5A7HA 1Q14A 4D0GA 3WY2A 4KLZA 4C56D 1VL0A 1PEWA 3D18A 4L15A 2Q3MA 3K5RA 3M7OA 1RIVL 5AHOA 2XWBF 5JW5A 1YEFH 4E2FA 1QONA 5B8CA 4RGVA 3FUTA 4FEGA 5KSZA 5CM2Z 3ZV3A 1DAKA 2AI2A 1MB0A 4BV8A 4WBNF 2QAJA 5GGRA 2O26U 3GEGA 1TPZA 4JG9A 3CVUA 3FRJA 4XD2A 1MQAA 4O25A 3ZHRA 3KDMA 5E1BA 2QSQA 2F6AA 4X6DB 4LJ9A 1J10A 3V4VH 2IP1A 4LP5A 3WFCH 3S34H 1N5IA 1JDCA 1HOCB 1B14A 3TLMA 2MQCA 3G5XA 6FABH 1VJDA 2PVSA 3WNJA 1I4FB 3ELQA 1AGBB 4JDEB 4IMIB 3TLXA 4IEIA 5HGBB 4KKNA 4G71B 1J5DA 5D7SH 3NCFB 2FFRA 5EVCA 3KBHE 4M8SA 4WSJA 3DUSA 4DKEH 4DPRA 2ZTMA 2ZU6A 1IBMB 2RB4A 5I2IA 5TE4H 5H94A 1HH4A 3W1VA 1JWBB 5EU6E 1MW1A 5IG2A 1C16A 2YMXH 1IAMA 2JQAA 4J27A 4L3EE 4I4WA 5DHVB 4YB8A 3HVUA 3CFEA 3PF9A 2JRCA 3L9BA 4JCOA 1J24A 1J5OH 4BKRA 4MCHA 1AD0B 3EC2A 1T2UA 3OJCA 1RIUH 4PGAA 1VZ2A 1YDGA 4H13C 5LZ4A 3E35A 3OBBA 2W5PA 5FNVF 3ND9A 2AEPH 1DVQA 3LPWA 4JM2D 3HVKA 2HA7A 4RVDA 3MTIA 2YVQA 4U6XB 4NK5A 1GGIL 4X7PA 2WO3B 1RFGE 1L5FA 4V0RA 1QRNE 1V6AA 5C07B 4CQLA 2DYPD 3TL6A 3E9DA 2A6IB 1LTKA 3RO7A 1PX2A 2ZUQC 2O61A 4INOA 3KPSA 2HKHL 3GXDA 2H32A 12E8H 1OD7A 3WNVA 1JA0A 2Q1SA 4Q18A 4MVCA 3VGAC 2EG5A 4NYIR 2GN0A 2J9FB 1G4AE 4X8MA 4DEPB 5B30A 5IHWA 2HWXA 1HEIA 3TZEA 5HUQA 1NFIB 1EQAA 2X4RB 4MYSA 1P3JA 3LYHA 3HBAA 2I3DA 1XYVA 5LLDA 2QT0A 2YLKA 2CGEA 1T4KB 1ZD3A 1TEYA 5AO9A 3GEBA 2VM4A 5TF1H 2DAPA 3ZCTA 3R8XA 1QZXA 3DF9A 4XCXA 4EAAA 4LRIA 2DTEA 5LBIA 4JNCA 2SBTA 1JJVA 5CU5A 3GD1C 3CSUA 4XXWA 4Y4FD 1A9VA 1BQLL 3UTZB 3E9ZA 2HPZA 1WUYA 1NVAA 2FEDD 2Y7SA 4ECEA 1UZUA 3NV7A 1Y5NA 3CFKB 2NACA 4QCIA 1IE4A 1XB6A 1JNYA 1YS4A 2UYLA 3W5AA 3DMNA 1SVOA 3HMXA 1QFOA 3S8GB 3GO1L 3GBDA 2IGLA 1MW2A 4GL4A 4O5LL 4ZXBD 1GTFA 1EK1A 3KGSA 3ARFC 2QLTA 1Q0HA 3OCVA 3EQ9A 4Y9CA 4PWIA 3QI9D 2XUKA 2IYSA 3NPSC 4TSRA 4Q34A 3JRXA 4AW9A 5EXTA 3F71A 4ADJA 5IW1A 1NYTA 4RGQA 1DJHA 3BIBX 3UTPD 1OTSC 3IDQA 3V7FA 4M48L 1LQUA 3AI1A 1FDVA 2OTUB 4JODA 1NIPA 1TX4B 1ZMTA 4R8SA 2ATPA 3D0VB 1OZUA 2C2GA 1YNKL 4ZFOB 3CFJB 1SYSA 1IVTA 3S8YA 1NEZG 3LD8B 3JARA 1Y6KR 1WD7A 5TQ2B 3LX5A 2EYSB 3ZNOA 4ELMF 1CB4A 3LNCA 3W5BA 4EHFA 3V7MA 3U4IA 1E6OH 3EAKA 5I5RA 4AV0A 1RSFA 4RFNC 3MJVA 3BF8A 4EW1A 3PNLA 5CSZB 1YJXA 1JYSA 1RPJA 3HCOA 3WBBA 5CN3A 3UTDA 3ORRA 2RHDA 2NZIA 3M2PA 2AV6A 3JQ7B 1T4CB 3I9JA 4J0FA 2QTCA 3HGMA 5CP3A 2RBEA 2WJAA 3IXMA 1O87A 1OCCB 2DIBA 3DLQR 1WAAF 3VZRA 1YAZA 2Q7NA 5GZ3A 2WTNA 4N82A 5LQCA 1V8DA 2ZSAA 3UTQB 3PXHA 3DONA 1HCZA 1DCKA 2CGYA 3BB1A 2XTLA 4ZO7A 3GRCA 5LU9A 4RKYA 2G9VA 5EQJB 1ECGA 4XYGA 5K9KA 2VC2H 4TKVA 1CF9A 4OLVL 5I7EA 1QACA 1OAOA 1OYVA 2BFFA 1F17A 4FC7A 4R97B 3PA8A 1Y1QA 3WMRA 4J75A 4HFRA 3LXBA 1KVQA 5DK0B 2ATXA 3R5FA 1BA2A 4XOIA 2JHGA 4PJIE 5E00A 2OL3A 4ZVVA 1K89A 1TT7A 4CU6A 3B9AA 1CYEA 3ZLTA 1Q0RA 4UARA 1I2AA 3VFRA 3EFEA 1QP4A 3FGOA 3NH7L 1QQAA 2WLLA 3LBNA 3VX4A 4FDVA 4YVFA 4AWXA 2X7XA 4TKLA 3QSKB 1YBAA 1I8IA 1MJ8H 3BP4A 5KN5A 3HM2A 4CUCA 4N12A 1OHZA 1JMKC 2FFAA 2JVJA 4Q4AB 3DGFC 2C82A 2BZ0A 1W2WB 5CLQA 5EBLB 1IOLA 4G8JA 1UPAA 3WK4A 1MIEL 4IUBS 1HSBB 4HJUA 4A1OA 4JUFA 3ROPA 4ERNA 3B7PA 4JT9A 4A5SA 2WLKA 1NF3A 4WW1B 5F77A 1WS7A 1E43A 1HRKA 5DO9A 4F5ZA 2VLKB 2WUFA 4D7AA 4YV0A 2EWVA 4HWBL 1K3FA 4OQLA 4QU8A 2ORBH 4D4KA 1X1AA 4XCEB 2P2ZA 1UKTA 2JB5H 4OGZA 2J7KA 5K9JH 4U7JA 4YONB 1RPKA 1S9WA 2F1HA 5DO2C 1V8ZA 1OGSA 2XD9A 3T65A 2B2NA 4HB3A 3ZY6A 1GNRA 1ZHBB 3BO8A 4G8IB 4WLEA 5DA4A 2JIOA 5DRZB 1D1SA 2W11A 2LVBA 4XSHA 2R56H 5B3SB 3G5VB 2BNQD 1RZRA 4QI3A 4DDVA 2OX5B 1T89C 4TSAH 4M7OA 4QO1A 3BUIA 3IEAA 2DDQL 4R3UC 4WENB 4EG4A 4IGEA 3Q9UA 1T8SA 1Q9OB 4G7RB 2I2XB 1XQ1A 3G1TA 3VXSD 3DJ9A 1BXUA 5C8ZA 2V7VA 3L8YA 4G83A 1YI0A 1SXGA 1LV7A 3IPBA 2DWPA 5E4EB 3OM3B 1NBAA 1XTUA 1IBBA 1TAGA 3EAQA 1WFIA 4MCMA 1BD3A 4J91A 2Y2YA 2QKSA 3HZRA 1PQZA 1B93A 2YL2A 1MHCB 1NBVL 4D9BA 4Y0NA 2P24A 1HKHA 4CGUB 4KMOA 2NR6A 5C7LO 1C7JA 2VLJD 5AVOA 2NT3A 1UBOS 1R3JA 1JF6A 4P80A 3VWJD 1PHPA 4MITA 1EFXD 5FBZA 5JXWA 3F6CA 3KL0A 3D1VA 1H0KA 4P86A 1VEPA 3P9QA 3QF4B 5C2BH 4G1BA 5DNUA 4W9LC 3DXAD 5BWOA 3ZDBA 1USGA 4DC1A 1C3OA 5FWRA 4RABA 2GB2A 4Z7WE 3K1ZA 1NI4A 2DYKA 4OAQA 5AYUH 3IDJB 4AKGA 4PRHD 4CMIB 3GRZA 1NM4A 3LKNB 3IA2A 3JUYA 4E31A 1DWPA 4DGIL 4J43A 3D5OF 1WMAA 3EZNA 1BDHA 3PGCA 5JNRA 3RSHA 2VQSA 1GLVA 1SUEA 4TQEL 1B0UA 3FBWA 3ZS9A 3TQOA 4O4LB 5E1AA 2SEBB 1ESMA 3H5OA 1RE0A 2ZS8A 3QKTA 1YJQA 1WA5A 2OBXA 4OQ1A 2XUAA 1ID2A 1RURL 1MSPA 4B47A 5DFWH 4RHTA 5JJCA 3FW1A 4MXVE 1RLIA 4LKOA 5EO0B 2J1KA 4Y6QA 5EU5B 3T9DA 2VAAA 2E4AA 2PUVA 1KU0A 1I24A 4PLYA 4A6YH 1O5OA 1LI4A 3F2VA 2XCQA 4MXQC 3QX3A 2AKAB 1XZHA 1IL0A 2C4HA 4RD6A 1LP9B 3WGLA 3JT0A 2WUBH 3VR5A 2VTFA 3TJRA 2PN5A 1Z6XA 1G9TA 4U0RC 1ZGLA 3U7IA 1VFMA 1CR2A 4TTRA 1ZOSA 5GJTH 5TMPA 2M2DA 1BAFH 3DW3X 2EIZB 1RWWA 3IMFA 2VJQA 3O0RL 5DGTA 3E1ZA 1LEIB 5I18H 3W3AH 1GM5A 3A58B 4LCYB 4GRWF 4UOW1 1DPFA 1JPUA 3D69B 2VUUA 2C1PB 2ZSFA 2YPLA 2WXMA 2W42A 3HC3H 1SKUA 3AT0A 1R3JB 4XSGA 3WGJA 1DDIA 2O0KA 3ESBA 4CTNA 3GAAA 5F64A 3H3KA 3QZBA 4RVOA 5CP7A 4I1OA 3IWUA 4JMXA 3OSKA 4RAUA 5GHWL 2JKYA 2GY5A 4LXQA 3A0RB 4EGJA 1QEXA 4NBZB 4AMUA 3B5HA 4X6FA 5MERA 4YHOH 3LUBA 3NBUA 3H13A 1YTLA 1T3FB 4HK3N 4YJGB 3HWX1 5HSGA 2I8AA 5DT9A 4L8WB 2IH1A 1T6BY 4LOAA 4LCWA 1QIEA 1QMGA 3FHJA 3CUPB 5GONF 3K1KC 2E7LC 4GP8B 2R751 4FWTA 4G0WA 3EGXA 1YZNA 5ADOL 4PTTA 1MFBH 4M9SA 3DX3A 5LZ9A 3OTQA 1CBUA 4JRWA 1F5WA 4PG5A 3SEFA 3U3XA 3U7JA 3BC9A 2PW2A 1KIMA 3U6RA 2EARA 4QRSA 1IN4A 1WHTA 4BWGA 4TPRL 4C3OB 3C3EA 2K8MA 3I42A 1XZCA 1Y7LA 5IW6B 4KIWA 1EVYA 3WFZA 5CR9A 5ALNA 3LW7A 3H7BA 2J4WH 2GEEA 3FPBA 1CL7I 3P2TA 3A06A 4M3KB 3ZL4L 1K8XB 3U7HB 3GVCA 1QJCA 1V8OA 3R75A 1FA9A 5BO1H 1M05A 4TLEA 4K9LA 2C9YA 2ZUFA 3L1KA 3GC3A 4OZHF 2OMEA 2VN7A 5AI9A 4G8BA 1PZFA 1ZOPA 2X4OB 4HIXL 4RTJA 3QQ5A 3UK1A 3B5JA 1NSTA 2YJZA 1AA6A 3OZBA 3EY9A 4PWYA 3I85A 2X4QA 3FFXA 2ZRMA 1MWAB 2PO6D 1R5JA 4DCSA 3ADCA 3L4SO 4NICA 4KAXA 1JLSA 5COBA 2IPLA 5D1ZD 3O3DA 2BHYA 1J8FA 4YDJA 4KI5D 4LF3A 2YICA 2WF5A 4KXCA 1Q7TA 4P2OA 3REFA 4ZYXA 4IJ3C 3OKNA 2CK3A 4NCBA 3VZPA 4L8CB 3AK4A 3HB3C 2DX7A 4J1QA 3D8TA 4MDJA 1IWOA 5TEVA 4LJRA 3VNVA 3HFRA 2NQCA 3WJ7A 4M88A 4C7VA 5MN5A 3GN2A 1M2OA 3MKGA 2VLLB 1OV4A 1CFVH 1TMOA 1XZAA 3DKHA 1OARL 4IVNA 5AKEA 3LY9A 2H0JA 5G40A 3IHKA 3X3FL 1J90A 4LJ4A 3EZ8A 1VL8A 4G0ZA 3HR4A 1PSKL 5K3EA 4INAA 2UVFA 2FPMA 3UQYS 4MUXA 2OG2A 1OC2A 3KS9A 1OKEA 4RE6A 1DBJL 3NSCA 2E4XA 4CBZA 7PAZA 4OL9A 4IDHA 4B44A 4DIOA 5DNVA 4B96A 2O07A 4UHJA 3TR6A 4KFSA 3SGJA 3HUEA 1NCBH 5JHLA 1O54A 5F1NB 5HXAA 3EYVA 1PVVA 1HG1A 1XZNA 5CLIA 4GPZA 2R1VB 4LGCA 4YSSA 4MDIA 3VRLE 4KXYA 2Q29A 3PUXA 1DLJA 2BFOA 3PGLA 3AWFA 1YF3A 4HUWB 4KTGA 1E5XA 3W9DB 5J6HA 4WUUB 2DSNA 3PJEA 4A63A 1KARA 4G9EA 4F3FB 3NHFA 3MU3A 2EW8A 5E7JA 4EB8A 5JS8A 3O6LH 4HO1X 4E5XB 1I8UA 1AZNA 5DK2A 5CNIA 5E4JA 3TSCA 2E9SA 2J1WA 5EHGA 1A7OH 2ESVE 1GRQA 3SJUA 5JY1A 1G6OA 3DCIA 2PG3A 3W2GA 3GLEA 1O94C 4NVRA 1FORH 5IIEA 3N2YA 2YVAA 4O08A 2YJTD 4JO3L 5T4FA 1OANA 5HHQA 3RIXA 4PS1A 3BUPA 1N59B 2EDXA 3UBXI 4JRXD 1JNXX 2G28A 5EGNA 4L3EB 1HVXA 1Z15A 4YJFB 4YRTA 3BKWA 4AYXA 4R4FL 1LLCA 3DO8A 3PGDB 5BUQA 3ATAA 1Q22A 4JU8A 1F6AA 4OM8A 3ZJTA 4QUAA 3PP8A 4BFJA 1RURH 4U1NB 2JK0A 3OMZA 4I9NA 3D31A 3CR3C 3P0JA 1UZLA 4XYEA 5MDHA 1JHOA 3HYTA 2GXAA 2HWZL 2CMRH 1CR1A 1I94B 2C2MA 5TQJA 2X6RA 4XYMA 2X4TB 4X4YB 1QBML 3JVGC 5AQ1A 4DABA 1D5IH 3L8ZA 3N3AC 3PWPB 4G6MH 4NBWA 5KWIA 5JAMA 3KAQA 1MG5A 3KL5A 1V26A 4CIDA 2IBGA 2FQDA 4J3OC 3CKMA 1UBTS 3TIXB 4L3FA 2FWMX 1OBVA 4F7KA 4LJ5A 1J06A 2R84A 1DL7L 2GI7A 3LDFA 5HI4C 4RZKA 5I8KL 4I48A 3EFOB 4ABQA 2CLVB 3G2QA 3ZT7A 4CL2A 3PXAA 4E70A 2F58L 5A6VA 5ESDA 5C8YB 2ZSJA 5F9JA 3WFHA 4D0DB 5AL8A 2MTBA 5CLYA 3ILQD 3D4YA 4RAHA 1EJ2A 4IY1A 3GOHA 4AIZA 4FXKC 5BN3B 4K3UA 1RQXA 2PMFA 3TPFA 3B5TA 2O8DA 1XD8A 4DLYA 2J43A 4F5DA 1GZPA 5D1XD 2AITA 1E77A 5AKTA 3GAMA 5B1JC 2DN7A 5JSZA 3PJLA 3MODL 4UUPA 4J23A 5KQSA 4PFQA 1AHPA 5ERWB 4IIFA 4K3VA 3KW8A 5JJIA 2A9VA 2UZ4A 3WSQL 2Y1DA 2Z6UA 4TWAA 4RMSA 2PMBA 1OILA 3S35H 3QWNA 3FIUA 2ERXA 5H37H 4FQ1H 1NAMB 2PLTA 3BC1A 1A1MB 2PEZA 4OUKX 4ILKA 3MYYA 1AK9A 2P30A 3KVNA 1MJNA 2QY6A 2UY6B 4G5HA 3HNVL 1N8TA 2V7HB 4YDIL 4HAFA 4M1ZA 3RVUC 4UZEA 1M5RA 2WWXA 5I9LA 3DDUA 2WAHA 1SDDB 3QUMB 2LR0A 2X89D 1ZHOA 4HAYA 4MNGE 3R4RA 2X53A 1OAUL 1VGKB 2R1ZA 4KGJA 3WNKA 3S2CA 3LSTA 1FVDB 2ZUYA 5EZYB 4QKTA 4JBIA 1IEBA 4FCAA 5C0GA 3X13B 5SY4A 5I30H 4N40A 1E1CB 2VDUE 3D39D 4M7KL 1I3UA 4ANKA 3EZLA 1UBRS 1LVEA 4R54A 5MHTA 4HS8H 3ZLVA 4KTDH 2CB9A 2W00A 4CQMB 2DEXX 4PPGA 4LVHB 5IB5B 3QHQA 4KX9A 4OBRA 3VFSB 1MCFA 2V4MA 3DVNB 4JFPA 2QFPA 5I1IH 3LX4A 4GMDA 4DJDC 3BD8A 1ZE3H 1VXOA 2PGLA 1MIEH 2FRVA 5TE6H 1MN6A 2XWPA 3JZAA 2HIHA 4EIBA 4JANB 4UVEA 3ARDD 5A3IC 3QUKA 3AHEA 1ETJA 1T4WA 3ZJ5A 2EKZA 3DE0X 2VDPL 2R60A 1B4JL 1E3WB 2JLBA 2GAFA 4BCZA 2WWGA 4JZOA 4AMKH 3P9WB 4GNKB 3UIZA 3EUUA 3DD5A 2FJGA 1VMAA 1ACZA 5CM1A 2HRGA 5I1IL 4W81A 1F7VA 5KEIA 4KX8A 1ZHNA 4WIQA 1O0BA 5BN5A 1S2OA 1D8AA 3QBTB 3IAGC 1Y3DE 4S0HA 1E7WA 3JWJA 4BKTC 3P2MA 2XQGA 1XE3A 2XHEA 4EOWL 4P4NA 2JKZA 3WXWL 3FYTA 1OAXL 3MV7A 1A6AB 2GH1A 4DPMA 4RZHA 4HRVA 1KR2A 4QYAA 1W72L 5T3XE 5I7AA 3EC7A 1A9BA 3E3OA 2G3YA 1Z5NA 3FQRB 1C0KA 3QVJA 1N8SA 1UFOA 3QJRB 1D4FA 4H7PA 1B8UA 1UUNA 2CLEB 1QWOA 4KO7A 4HJSA 1W5AA 3H0KA 3DOUA 4PPTA 3QVAA 1Z88A 1KSFX 3L92A 4D9GA 3CUUA 4CJXA 3NFSL 3LSOB 5JD3A 3OFKA 3N41B 4S0ZA 1K8IA 3JAKA 3DL4A 1NAHA 4HLUC 5CA0B 3RVVC 2HJRA 2C61A 4J3VA 4NHCL 1D4AA 4R2LA 4CQNA 2WLTA 2YFQA 1E59A 4HFNA 1U7OA 6AT1A 1Q9KA 1CICB 1T89A 3MJHA 2JIXA 4HSEA 4E1BA 2BNRD 1U3ZA 1MOEA 4F6RB 4ES9A 4I55B 3ZW3A 3DEZA 1VJTA 2XA2A 2V6BA 3SICE 3HVDA 2QRPA 4OJEH 5H5JA 4GMHA 1G4RA 1PS3A 4JDTH 1NV9A 1HYQA 3ZE2B 2R9VA 4LS3A 3O2DH 5IMMB 3MRKA 3VXNB 4LY6A 4AKHA 4PONA 3WY3A 4M0UA 2O5ZH 5BNIA 5K0BA 5ISZE 4P23D 3H2BA 4NPJA 1E2VA 2EBWA 4QLOA 1CQJB 1L7VC 5IZ4A 1RZFL 3CZMA 2DJMA 1DC8A 3J81A 1UWXK 4CMHC 3NONA 3BMNB 4ERSH 1IRXA 4L0PB 3CX8A 3E7PA 1EO8H 1T1ZB 1LVUA 2XTJA 1T22B 1U8OA 4AJWA 2O6CA 4ITRC 5I24A 4NKDA 2OT3B 1KXQA 5C0AE 1P91A 4GXUN 5DW3A 1AMUA 5TMDA 5HZHA 1U41A 1K5DA 2JF0A 3VX0A 2WZBA 6ADHA 3WS3B 4JGBA 3LKRA 3LQ1A 4R8MA 5DHTA 4LAQH 1WNTA 3Q3CA 4PBTA 3KQLA 4O6VA 1ULUA 3S37H 2XCTB 4F1KA 1YDMA 5HYJA 3OD1A 1KBOA 3C8MA 2YCLA 5IEJA 2Q8BL 3I3BA 3QQNA 4PJHF 3G0OA 1NUNB 4WTZG 4PSAA 1U5AA 1R3LB 4JPKH 1EFVB 4BNMA 4GX0A 4QPJC 3TLJA 2XA8L 1GZSA 1L5VA 4H9GA 1G291 3KWUA 5LJIA 2ARKA 4PJAB 5CVTA 1GWNA 5K69A 2HWYA 4OTXL 1PFOA 5E8DH 3SQMA 4XN9A 1UBJS 2RMNA 2W22A 2IZOA 3EOBI 1SMAA 3ZE0E 1WD5A 1T24A 2O1AA 4RADA 3CBJB 2QW8A 4MGHA 3HMKA 3N75A 3CLRD 1OAZH 4O4HA 4R81A 2IPMA 2W9XA 5KTKA 2FN3A 4UT6A 2JLUA 4P3KA 3CX4A 1QDLB 3CH7A 4N28A 4RD1A 4DGSA 3DUUB 3R44A 2Y36H 2ENSA 4H3HB 4KSCA 3MILA 1KENH 4MINA 2CXTA 1OAUH 5IAAA 2OC4A 5KBYA 2HKHH 1Q95A 4JDVA 3FRHA 4NB7A 4DR7B 3OHMA 2FYTA 1P5RA 3UZEC 1U2HA 4RX1A 5EOTA 2RR3A 2V3FA 3ZWBA 1N78A 3F7RA 3PRJA 4QGHA 2WKGA 1J8DA 1VJSA 1PO7A 1VCHA 2F0CA 1VPLA 3VXRD 2Q2VA 1TUGA 1RJFA 4JLMA 3DUSB 1UMKA 2IYXA 1VI5A 4M1MA 1N2ZA 4H4EA 4EO9A 3RRXA 1XKXA 4FKKA 3VGEA 4GOND 3ICQB 3RT7A 1RIUL 1T1RA 3T7RA 1VLHA 1UVQB 1PD0A 4TQHA 4Z7NB 2CEKA 2OXIA 5FV2A 2X9YA 3OAAD 3BPNC 1NBME 2CO2A 3D6JA 4I1UA 2JRLA 3MSXA 4PR5A 3BD4A 3N1GC 4XT1C 3LQQA 2QP4A 2PWBA 3LIPA 2F8TA 4HJIA 1B0GA 3F73A 3O4LA 3T3OA 4JO2H 3VI4E 1ODLA 4YIQA 5JBIA 1XAGA 2YD4A 2VYCA 2BZ7A 2UKDA 4G67A 4N5UA 1P4LA 3LN4B 1LWOA 3SQDA 1WZUA 2HF9A 1KT2A 3M17A 1Q94B 1U5BA 2GQHA 7MDHA 1RLWA 1OAOC 3B1FA 2HMSA 5J47A 4TUUA 2HA3A 2XZAH 3MB5A 4B3SB 5D7KE 4UHFA 1PRYA 3IU4H 5AW9B 2XGOA 3CWZA 4DMUB 1NLBH 4CSZA 1C9NA 3Q1EA 1VM6A 2AXPA 1R75A 2FZ5A 1G1YA 3WE6A 1D5WA 1OE0A 1A5AB 3HA5A 5FBVB 3AVXA 1MVYA 2ABWA 1QZUA