2VDQB

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 130
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdqB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdqB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdqB03
1YVRA 1BHQ1 4A0QA 2VDOB 1YVPA 1CK4A 4UM9D 4GZ8A 3TW0A 1FE8A 3FCSB 1QC5B 3EFOA 1JEQB 3GXBA 1JV2A 4HQLA 4MMYB 3NVQA 1UEXC 2I91A 4G1EB 1BHO1 1IJKA 1ZOPA 3OL2A 3K6SA 2O7NA 1M1UA 1IDOA 1MHPA 1M2VB 3K72B 1OLZA 3BN3A 1M1XB 1ZOOA 4IXDA 4UM8B 1ATZA 3F74A 3E2MA 5KYXB 2I6QA 1PD1A 4BJ3A 1AOXA 4FX5A 2NVOA 3EOAI 3PPVA 4MMZA 3ZDXB 4IGIA 1L5GB 3BQNB 1U8CA 4G1MA 1PT6A 4HQOA 3K71A 1Q0PA 3ZE2B 1RS0A 5E6UA 3TXAA 4Z7QB 5LN1A 5ES4B 1SQ0A 5E6SB 3N2NA 3PPYA 5E6RA 3ZQKA 2XWBF 5KYWB 1RD4A 4Z7OB 3AFCA 4NENB 4FWWA 3VI4B 1T0PA 2XWJI 4O02A 1IDN1 1MQ9A 2ICAA 3EGXB 3AL8A 4CN9A 1JEYA 2UZYB 1DGQA 1FNSA 3M6FA 4WK0B 5KYYB 2VDPB 5KYUB 3EH2A 1NA5A 4WK4B 3EOBI 4F1KA 1N3YA 3PPWA 2VDKB 1QCYA 1XDDA 2NUPA 3AL9A 1V7PC 2B2XA 1AUQA 4K3JB 3HI6A 1T6BY 5HGJA 1MQ8B 1LFAA 3EGDA 3NIGB 3VI3B 2VDMB 2M32A 4HQKA 3EFOB 1SSLA 2NUTA 3IJEA 1JV2B 3OKWA 1PCXA 1U0NA 2VC2B 1SHTX 2XGGA 4WJKB 4WK2B 2VDQB 1M10A 3TCXB 2QTVA 3EH1A 2P26A 3K6SB 3OL2B 4F1JA 2ODQA 4CN8A 4NEHB 3EG9B 1MJNA 4MMXA 4JX0A 4C2BA 1XDGA 3TVYA 4Z7NB 3ZE1B 1U0OC 4NENA 2WINI 3FCSA 1QC5A 3NIFB 1JEQA 4MMZB 4MMYA 3QA3E 4G1EA 2VDLB 1DZIA 1U8CB 2I6SA 4C2AA 3K71B 5E6UB 3V4VB 5HDBB 4O3TB 1JLMA 2VDRB 3NIDB 5E6RB 1TYEB 2ADFA 5HJ2A 3FCUB 4CNBA 1M2VA 3IBSA 3K72A 1RRKA 1M1XA 1ZONA 4O02B 1JEYB 3AL8B 4PN7A 2ODPA 3V4PB 1OAKA 3T3PB 4IHKA 5KYXA 5KYNA 3BQMB 1AO3A 1RTKA 4C29A 4JDUA 3T3MB 1YUKA 1L5GA 4UM9B 3OKYB 1CQPA 1M2OA 2NUPB 4HQNA 3Q3GE 1XUOA 4HQFA 3ZDYB 3RAGA 2IUEA 3EG9A 5E6SA 3ZDZB 5KYWA 3EGDB 4DMUB 4WFQA 2NUTB 2WW8A 1MQAA 4M76B 5BV8A 1IJBA 1SHYB 3IJEB 3EGXA 4XW2A 3PPXA 3ZE0B 2X5NA 1MF7A 5KYYA 4G1MB 3HXOA 2P28A 3F78A 5KYUA 4O3UB 1PD0A 1SHUX 3HXQA 1N9ZA 2VDNB 4MMXB
chains in the Genus database with same CATH superfamily
4BQOA 2CCGA 4G24A 4E15A 2VJ0A 3KFLA 5B2ZA 3U16A 2CE2X 1MUJA 4L4TE 2VYFA 3INOA 2VDVE 3VKUA 3R06A 5GM1A 1QRND 3QIWA 1F56A 3G9TA 2GTZB 4L73A 4ATNA 1RK0B 5CFAA 1ATZA 5L4LA 4FQ2L 2HHJA 5B1JC 3KO8A 2YY6A 5IB4A 1R7RA 5EINA 3FPSA 4LDCA 3AETA 2A5GA 3T1VA 1ORSA 4OKDA 3KZNA 2UX6A 1QCYA 4POZC 3W5AA 4Z3DA 4X66B 4ALJA 4EUFA 4MNGA 3Q5EA 1PZUB 1E42A 2R8YA 5LWQA 1GCYA 3I1YA 3PXXA 4E12A 2GBLA 4P08A 5JXED 4BWYA 1UMCA 1ZWIA 4V1DB 3LMJL 2WIAA 5LWYL 3OEEA 1R2QA 1E3MA 1ZRHA 1TU3A 4LFHG 1TQ2A 3Q98A 3P0IA 4PC2A 1G2PA 1FO0B 2QTBA 3OZ7A 5IF0A 4YMGA 3LV3A 5SWQA 2H1HA 1X5GA 4R0MA 1XT6A 3T3PB 2JHAA 1R5WB 1BG1A 5AKIA 2EEBA 4HRAA 4R1SA 4YK7A 1OH7A 1E1DA 4XP6H 3KL5A 1QGUA 1MHCB 3VNRA 1H23A 3TIXB 4CCWA 2XJKA 3ZKND 3N2KB 3TOCA 4R8KA 4ZNCD 1F18A 3D6NB 2VYVD 1YZLA 1USKA 1AMNA 4HUXB 4N4AA 5AI8A 1QAWA 4W1SA 2K7PA 4GXQA 2P91A 1XB3A 4D3FA 3P77A 4R1OA 4PMEA 3OLQA 5CEFA 1U4NA 2AQQA 4JP2A 3MCKB 3GJYA 1Z5PA 1R0RE 4FT2A 3O7WA 2QXYA 2QSCH 1H1LA 5K0TA 4KQ6A 1MNUL 5T3XL 1TGVA 3DI2B 3JVGA 2EHJA 1UH2A 1F1JA 1KBVA 3DTVA 4R51A 4AZ0B 3GPSA 1G17A 2ITCB 5C1OA 4E6EA 3OL2B 2VHJA 1TTBA 1WCIA 3HS0C 3K6KA 1LBTA 3UOGA 1GIGH 5ABDE 2JV6A 2WF7A 1AKMA 1PS8A 2I2DA 4BEJA 1A3QA 5K9OA 3L7CA 1A8IA 3VNYA 2DUNA 2I6FA 3NR2A 3EZNA 1W16A 3PXDA 2D0DA 1RZKC 1B74A 5K0ZA 2ZP0T 6CGTA 2JAQA 3AEKB 3AB8A 5D01A 1UBRS 3KWJA 3HC2A 5H80A 3D02A 4QNPF 4NF2A 3BHIA 3QU7A 3NTCH 1Z8DA 4PJIF 3UMGA 5IKXA 1UM5H 2F68X 3D6TB 1GU0A 1E3WB 4P2RB 1X42A 3S36L 4MVJD 1I2DA 2X87A 5B38A 2PTHA 3KXFB 4UQCA 1XCTA 1GEGA 4FVTA 4KXWA 2G60L 4QJ3B 5T41A 1X6VA 3D69A 5IANA 1R4MA 5D7SL 2EDYA 4F7DA 3QIBC 4KB5A 4W9JC 4TROA 5IDVA 2EDMA 5FPHA 3SR3A 2W37A 3TOPA 3C8DA 4PUBH 3BM5A 3WDJA 4OHXA 1U93A 2Y1XA 1GNSA 4KJWC 5D1ZD 5C0IA 4Y1TA 3NWOA 1AXTL 5HGGS 3BCSA 4H7VA 4JUAA 2GRJA 2XVGA 3TSAA 4PLKD 4LQDA 1A1SA 2JIXD 2AZ4A 4YUAA 3T5TA 3Q5YA 5DGCA 5D2LB 2CUIA 5L4JA 2E6PA 1KVQA 1S7GA 1IVYA 2AJ8A 1VDZA 1XF3B 2G17A 4CN8A 1NP6A 3BN3B 4JP8A 2NX5D 5SWSA 3IEKA 1NN0A 4X4ZA 2BM8A 1G9ML 2ZRLA 3EUAA 4EO7A 3C16C 2C3VB 5E0QA 3V8NA 3G02A 3L0OA 3CE9A 3DMMB 1AXGA 4EG6A 1AKWA 1DELA 4PGEA 4HSAC 4M9QA 2UZ0A 2K45A 2VZTA 1RYDA 2WAMA 3Q3EA 1LWHA 3DOIA 1X1EA 1CZ8L 3CN9A 3L1VA 1PG7X 3PPSA 1E3TA 2IQ9H 5HM8A 5ESWA 3EXEB 3ROOB 1PUIA 1OWLA 4B09A 2QRKA 1HCZA 4EB8A 2WAHA 3OKFA 5DNWA 4ZV4A 1BXGA 4MCAA 1H93A 2R7NA 4MWEA 1FIGL 1COWA 5FB8A 3L6UA 4YPVA 4E11A 1JPJA 3CLEL 3CZKA 1RCFA 5AICA 5E8PB 5BN4B 4F96A 1UGNA 5IT2L 3AVOA 3B52X 4FB4A 1EBPA 4OK3A 5F9MA 32C2B 3RI5F 1O97C 1G43A 1HT1E 1WVIA 3MTGA 2Z4QB 3MUGA 4ZTBA 2DEWX 2JQZA 2Z8ZA 4IF6A 4Z18A 3ZVKA 3OZEA 1E58A 5MEQA 3S1AB 5JC1A 1XPOA 1CICD 2B14A 3MJ8A 3M17A 5TPZA 3V3TA 1R3JB 2NU7B 1CUEA 5EIEA 1QA9A 5L2JA 1IARB 1VHPA 2JGDA 4AFNA 3GSNH 5DQJB 3DXAE 3OVMA 1WUJS 2DV6A 3EDEA 1XTUA 3A04A 1YNTA 4WO4D 1A96A 3KPVA 3K9WA 1Y3IA 4BC1A 1Z73A 4A03A 3ZQJA 2X4TA 1BW9B 3PHOB 5L88L 3V7FA 1D2HA 2QAGB 3STHA 3PJRA 3L4TA 2GCYB 5I0ZA 1QKJA 4HEQA 5AAWC 4HYQA 3DIFA 4OF4A 3QNZB 1XH1A 4IKIA 5FYKE 1FQKA 4UHJA 4KTEH 3TUZC 1P4LB 4F15C 1UYWH 4GFXA 4WAUA 5K7SA 1RUAH 5DHMC 4MA3B 1ULUA 1ZH2A 3MK31 5IBLC 5ICXA 3HMXH 1PZ5A 3BAEH 3FYIB 2NU9A 2QMKA 4GPD1 1ACMA 1QP0A 4D4MA 1P1IA 5IC4A 3ACBA 1XBRA 3PENA 2XGSA 1I2ZA 5LQRA 3AIOA 2QE7D 4TUYF 3KGUA 3D0QA 1B90A 4RQQB 1SIUA 5HRUA 3SC2A 3LHAA 2OZ4H 5CIPH 3RVVD 4ESHA 1PEYA 2PT6A 3MXWL 1CFJA 1LJUA 3CISA 1JG6A 3RVSA 1I53A 4BMSA 3EC1A 4C4RA 2FP3A 2CDFA 1R8XA 1J9ZA 4K94L 1JWSB 3OLYA 1GAFH 1IBZA 2G8NA 2ZI5A 2ZQZA 1MABB 5DHQA 3SGDI 2BGMA 1PT6A 4EI0A 2EL9A 4IGEA 5TE4H 4X5WA 1VOTA 4YLYA 4LSPL 3WYGA 3M6FA 5TTRA 1BE1A 3A32A 1GG2A 1ADFA 4YC2B 4APQA 4IUYA 2EH8L 1KCVH 3SDCB 2IXFA 4B32A 4TRRA 1ZVYA 2POCA 3LKQA 4HQQL 4GO6B 3BD3A 1T5TA 2RKBA 821PA 3GFSA 2FPLA 2JK0A 1T66D 4G5XA 2BZCA 2B1OA 2OZEA 5FWYB 3LG2A 1UWLA 2X14A 1D07A 5BSGA 4IX9A 5AVKA 4PCUA 2ZX7A 3AR6A 1U92B 2DQEL 3WKYA 4JZKA 3HZZA 3PI7A 3QUXA 3NQKA 3H3PH 2QM8A 3OT1A 4BUJA 2V7TA 3MRKA 1Q4NX 3A4IA 3LPNA 3HNTH 3FZUC 1CUAA 4AZUA 2C8VA 4C4TA 4TYQA 1ACYL 2NNXA 4XJVA 3O6FA 1CDDA 2P8JA 5HSGA 5C97A 3RTDA 1M8JA 3LT4A 3ZDXE 4XAQA 3B5IA 3MFFA 3W9DB 4JGIA 1RADA 4CLXA 2B5VA 3CAFA 1T7VA 3JYCA 5HYQA 4Q1VA 1XEFA 3A27A 2H0QA 5BWBA 4PICA 1NLDL 2K70A 1X13A 1FFPA 2LGJA 3A70A 2WKOA 4XSVA 4NFCA 1ST2A 1QWUA 1QNLA 4JENA 1DRUA 4LV6A 3LFTA 4YJ2F 4GZLA 4ZPTB 1QVAA 1L4NA 2V2XB 3M46A 4QAWA 1ZZGA 5KN5B 5CHNB 4Y1RA 4WSKA 5PAZA 4WZBE 3G2HA 4PBSA 3LC2O 4L9SA 5ALYA 1HMYA 4X9HA 1HFKA 3CRQA 3MFQA 3HB5X 4RK4A 2CPUA 1XZEA 3FQUA 3D1JA 4GOMD 1Q83A 4XB2A 2FPRA 3AFGA 3CFEB 2WWMD 4KODA 2FZLA 2J3EA 1XYVA 5FLYA 4ZMPA 4N5IX 3UAAA 4EA9A 2AMVA 1KOGA 4TKMA 2C4HA 3CC5A 4U7HA 1TTUA 4HS6A 1S2GA 1JJ7A 5EF0A 4I5BA 4UPVA 4RETA 3QP3A 3K7UA 3QKIA 4M54A 4O2RA 3EYFA 3DBHB 1JMKC 3N8GA 3RIYA 2FPIA 4NH0A 2GYVA 3QFGA 2CIKB 1RIVH 3Q6GL 4EBQH 4OJAA 5KTTA 4OGWA 4B3CA 3CFKB 5C0RH 2MNWA 2VERA 1E2PA 5IOPB 3KALA 4PS1A 5KTEH 4AYFA 1H2YA 3IC5A 4BWTA 4YHKH 2OZLA 1J8SA 4BGVA 3C7CB 1EHNA 1YL6A 2FSVC 4Q9JA 5HDBE 1ZY2A 3UNXA 1WQ1R 2V65A 3SDYH 3D9AL 2PXYC 2CBZA 4YO0A 1RZFH 4YQYA 3KBPA 1X94A 3ROTA 4Z53A 4B96A 3RVTC 2HD4A 3GUTA 2PNFA 2QBYB 3CPEA 1S96A 3MV7A 1G6HA 3O94A 4NHCL 1YEIH 3DVLA 3RT1A 4F33A 3EF7A 3RZWA 3EGOA 3I1JA 1VZ3A 2HL6A 1EERB 3BSZA 2DWTA 3GJ5A 2Z92A 3B9KC 5DYWA 1UKCA 1QBMH 3EQZA 2YBDA 3JQ7A 4JX0A 2O06A 4JO1L 4L9LB 4LZZA 4ISCA 2X53A 3C5VA 4FWIB 4I2XA 1KPIA 3VHXA 3ZIDA 1JXDA 4KWHA 4ZVTA 2OJ1A 2NTVA 1A4JA 2WBJD 2XETA 3DVNA 1E2WA 4JFXA 1F8YA 1RLUA 1WYJA 1GUBA 2VLRB 3FJTA 2PX5A 1V7NL 2NQTA 5IJ0B 3B6JA 1RLBA 3WY3A 1OZUA 3PC4A 3HG1A 2QX9A 5CNJA 3KSBC 4RPHA 4QASA 5LDHA 3ZWDA 2W2TA 2ERJB 4X0EA 4P99A 4ZKDA 3UT5B 1OARL 2R7AA 2WZCA 4JRFA 1IN7A 3KSUA 2PYEB 4I55F 3FRUA 2G3NA 1H5NA 2QDXA 4ETIA 3TURA 3TBKA 1NN3A 3MHTA 4HISA 1Z6XA 4DDUA 1D09A 2F7SA 3OFJA 3I6SA 5IQ7L 2YAFA 4BECA 3MBWA 2IALB 4DZ8B 3NIDE 3K30A 4LRSB 2F67A 1JXAA 2VRBA 2A94A 1K7FB 2DIJA 1VBNA 3TRFA 4DK5A 3OIGA 1I7ZB 2ENQA 4HWZA 3I04A 2J5WA 3OKPA 3FDXA 1JQBA 1CLYH 5C4MA 3I2CH 1XVLA 2FVXA 2YN4A 1UZNA 3G2JA 3FTDA 4IGAA 3A6BH 5KBLA 2OMVB 3KLNA 1GT6A 5B6JA 4EDXA 5JIPA 4A2DA 1IBGH 2FDCA 3VXPA 4L15A 3F47A 4MHHI 3VKGA 4OFZA 3WOVA 3ACDA 3M88A 3TDMA 2P8PA 5IUKC 1X9LA 5LDUA 4LU5H 1ZVKA 1NBVH 1UFQA 1M2VA 4MVJG 2DL2A 3C6LA 4ZVSA 4E7PA 4BU1A 1Q1JL 3CLFH 4JFEE 3HN8A 4DVGA 1YUKA 2ZRIA 1GPYA 1U2SA 3ZGYA 1MEXL 1ECFA 4A39A 4LN1A 5KYGA 1SJEB 2IE8A 4C05A 1KSFX 4RXMA 3K1TA 3ARFC 2P9ZA 1I4FB 4FJ6A 1Q3HA 1T36A 3E9QA 1VL0A 3DBRB 3IP3A 3SJZA 4HKTA 3ENZA 3Q85A 4A37A 4MNQE 5L2KE 2B4TO 4DOHE 2NUAA 1E0DA 1MEJA 4Z7QF 1JIBA 3GN2A 1NDQA 1QFJA 3BH8A 1ZKDA 1U3UA 3I61A 3KZ8A 2TSBA 3QJFB 5I30L 5ARCA 3DGGA 1AOXA 2CDAA 3UTQB 4PR5A 4HZGA 5CFRA 2JGRA 4WWOA 4WNJA 4I9WD 3HFML 4G56A 5A3VA 1SXBA 4XGZB 2ATEA 2C2KA 7GPBA 2VTEA 3H84A 1JIKA 3IMWA 4UNUA 2AOUB 4CKCB 3FL7A 1DB3A 4OCZA 3MREB 1IHDA 3WFDH 2CNNA 1FHNA 4GRMB 3UMRA 3T0ED 3J7HA 2F8TA 4KSYA 1NGPH 4X4YB 2YMLA 1OI4A 4L4UA 4UHBA 4M1TA 4I48B 1L9QA 3N8NA 4BQ8A 1T9GS 4AUJA 3LCYA 2VRWA 2BV3A 4XNUL 3KKZA 5M34A 1BFUA 1C9YA 1XTVA 4NKOB 1N7ML 3V1UA 3BP7B 1RAEA 3L4WA 4OY3A 4ONHA 4J76A 3AVQA 2X4RA 4MMZB 1EHKB 5IJKC 1SN5A 3WHLA 4YJHB 4DO5A 4L8GA 3AT1A 4L37B 3SPIA 3MJ9H 1E32A 4IRMA 1NCWH 3EGWA 3RM3A 1NUQA 5KYNA 3Q8LA 4JBIA 3ULVF 3HU1A 4RVFA 5FOSA 3S2AA 3P2KA 2IPOA 2Y93A 1TADA 4I18C 2B4KA 4B6SA 1ENZA 4YRMA 3LPWA 5GIOE 4DCQA 1XU7A 4H1UA 2GUGA 3K8KA 3E7JA 2IP4A 3PL6B 3X11A 3FQRA 1YR1A 4XPGL 4F8EA 2IVFA 2AJSL 2A73B 4OZFH 1ZIPA 5AKSA 5IVXB 3ZUPA 4AYID 4HJSA 3CY6A 1TZ8A 2B8TA 2X4OA 4D96A 2GLXA 1NCCH 4Y9GA 3C1OA 2EV9A 1FC2D 3TAHA 2CK2A 5DX8A 3IDQA 4CQMD 4IIQA 2QXTA 1FNSA 1ZTMA 1MWAB 2FWOA 2V3WA 3D08A 1AS0A 1EX6A 1UPAA 2F90A 3VCLB 1GXSB 5EZYB 3W9EB 5JTUA 3OXRA 3NHJA 1SD1A 1ISSA 4F20A 4DK3A 1F3OA 3U7GA 1MQSA 4KPUB 4XVSH 4BQSA 3UAFA 2C9SA 4D9RE 2BZ1A 1SUCA 3H8NA 3QORA 5JWHA 5FO1A 3QZPA 1AP2A 3ULVL 4M21A 2Q3AA 4RNDB 5T1LA 4II2A 3LJKA 5KSBB 1FS6A 2HN9A 2EWVA 4QLBA 3OM0A 3PNVA 3PXEA 3PHQA 3JD1A 1FZMB 1H5BC 4OFIA 2W81C 1H2RS 3QUKB 3JWDL 4LRUA 4EG7A 3SKOA 2IFFH 4D0GA 3OWEA 2AL7A 2A86A 1CQJA 5ARDA 3ACCA 2F3RA 2CK3D 4CI9A 1G64A 1AACA 4RFOH 4OCYH 3BMCA 1ZOPA 1C0KA 4JBHA 2NYYC 5JQIB 4IZIA 2OY0A 3SJVB 1EFRD 4GP8B 5CEZH 1KF0A 4JFZH 1CNFA 1W4BA 5IUSA 4EHAA 2B5IB 2KSQA 1X5YA 3C43A 4QRTA 4M1WA 4P36A 3ZUGA 1Z0KA 3H9EO 5LQNA 4J8RB 4JNCA 5ILQA 4U7FA 4B6PA 4QBHA 4Y4HD 3PUKA 4AP6A 1EFVA 5C7OO 1FGVH 4KL8S 1H0RA 1YU9A 3T65B 3T3HA 4LPCA 4QHNB 3RS7A 1KCRL 2CM6A 4I0PB 3VTTA 5KVGH 3GSRB 5I76B 1PW7A 1MNAA 1FI8C 2FEJA 5EU4B 1APBA 3GSQB 5DC9B 3FMGA 4IV8A 4EKEA 3QPDA 1CRWG 5JR1L 3ZZTA 2XBMA 1B2RA 1UBEA 2XTJE 1H9BA 3NACL 4KHXH 2FEAA 3V2AR 2IDMA 3NTUA 3ZE6A 5IFKA 1KQFA 3V0VA 2YCLA 2AUNA 1RYNA 1G3QA 1C12B 1UT6A 4MPRA 2I99A 1GLNA 2ZOLA 1VJDA 2WFAA 2GOYA 4R1LA 2VHCA 4OB5H 3TE7A 4AJHA 3GTNA 4UE2A 3NESA 1I32A 5CAEA 4MARA 1Y6JA 5DHVH 2NZ9D 4UVGA 1JI3A 1QF7A 2QGBA 4UU0A 2QDWA 2V0NA 4BZXA 2JI6A 3HMWH 3HXQA 2V7HB 2QL5A 1XTTA 2V59A 5F1IB 1O95C 1IO4C 3Q5OA 1KCUL 3LQ2A 3RRNA 3UJAA 3LBNA 1BIIA 1T0UA 3KQNA 4Q4IA 4BZQA 3TZVA 1KBGL 5HHXH 5T8KA 2GT9A 4OK6A 2XEXA 2W6MA 3V4PH 5AVUB 4PAMA 4BJ3A 4B9KC 3KL3A 3CKMA 1L5GB 3NDZE 5IUNC 1P45A 1X7YA 3V52L 2J3SA 7REQB 5HGXA 1J8QA 2I3BA 2WOBA 2FGJA 4I4CA 4ALAH 2LRHA 1XIWB 1B0UA 3BSSA 1SCBA 1QEXA 2IYYA 1X70A 2ONYA 1YRHA 3HPRA 4G42B 3DO7A 3NCYS 1ZE3H 4JM2A 1N0VC 1JIUA 1KAHA 3DKKA 4AO6A 4B3GA 1IAIM 5E6IA 5A05A 4FNGA 4YRCA 1WA2X 1DJZA 4M3JA 2W42A 4MJIE 1XD1A 1I7RA 3V6LA 4XOUA 4G2AA 1F97A 1Y18B 2AP2A 2E9GA 4U3HA 4JZYA 3T41A 4E6PA 4H26A 1UQRA 1BVKA 4URFA 3NOIA 5AYUL 3DVSX 1Z66A 2BFEB 2LPMA 1ODUA 1MV5A 3U49A 1KTDB 4E9TA 3UCRA 5LB2A 2AI0H 4Y8VA 4LBWA 2WIIB 4WU5B 1WS6A 3T8MA 3P4MB 3D30A 4KK3A 1JDDA 1W94A 1REQB 4KOAA 4DMUB 3K70B 3PPXA 2TRYA 3K6OA 1SHZA 1DIGA 4BO9A 5HVHC 4DV1B 3EO9L 4P86A 5B37A 4YHPA 1Q15A 2O54A 4HUNB 3GJ0A 2ECQA 1Y8CA 1P4IL 3O93A 3BS4A 4MDEA 2MCMA 2MWMA 1SOAA 3EG5A 2QLBA 1GC1C 1MH5B 4I3SL 3ULUF 3L77A 1DP0A 2VDJA 4UT9L 2K3HA 4MKIA 2O0JA 3RDTC 2R1XB 2ZBEA 2ZWZA 3HYTA 3IDNB 4DL9A 3BIWA 5JDIC 5M5BA 2B6HA 2H2GA 1IHXA 1H3EA 3MRBA 1NJ1A 2FJHA 2WKSA 2ZCKH 4HLCA 4OV5A 4C08A 3QDME 4ODXB 4Y4KC 4EF5A 4RJTA 4R2LA 3UJIH 1ZAGA 2VNHA 5AJYA 4R5XA 3KWMA 4K8RC 1FDIA 4IIUA 4TKUA 3MLPA 1OFVA 2YQ5A 1E3LA 2J7LA 5KKNB 4XMLL 4RD4A 4U9UA 4ZTPH 2BHNA 2ZK7A 1FTGA 4CMAA 4QYAA 1SM3H 4FYYA 4BMZA 2IYAA 5AKKA 3WJMA 2F74A 5KAPA 2VJMB 4OATA 1NT4A 1D5BA 2ACWA 3PWVB 1SRRA 4AKQA 1M1XA 2I2WA 1A4BA 2JBHA 2FP4A 5JBIA 4HLJA 1VFMA 2SKCA 1KPVA 1JHOA 2JBAB 2QJTA 3QEQB 1LLCA 1HZLA 3CQPA 2VUTA 1Q6YA 3M1BA 2AN1A 1S2DA 4BAUA 3IJEB 2J30A 3IIIA 3HXOA 2QTVB 4MTCA 4GQBA 2D5CA 3HVJA 3WGNA 3AILA 2VDOB 3AB0C 3DAHA 3ULUL 3AABA 4ZVPA 2XY4A 4Q4AB 5BS0D 1Z5GA 4BV9A 3FQTA 2HWXA 1ZOLA 3RVPA 4PJXE 3T1WA 1FWXA 2FEWB 1GR7A 2ZQKA 5DVLA 4H0CA 4RH1A 2PUJA 3SG0A 3Q1SH 2DN7A 5EU6A 4C43A 4E5DA 5FCDA 5DFWH 5EO0A 3G6JF 3QJHA 2YC1A 1A6TA 5F9HA 1X38A 2BPBA 2PWGA 5T5NG 5JTWA 1RYZA 1VE1A 3SYCA 2AI2A 1MJ8L 3FNHA 2WSLA 4YI5A 1F3JB 4OQ4A 5G5DA 5BQOA 1K85A 2QTWB 2YD2A 2OQRA 1EAOA 1WBXA 4WK2B 2WMPB 1I9IH 1H6TA 1X7WA 1U11A 3GLDA 4DUXA 1BE8A 5ESRA 4XPTH 3I84A 3TVYA 3S8GB 4WWPA 5BV7C 4GG8B 2Q7OE 4QRIA 2VUOA 3I2KA 1R47A 1KIMA 4HJGA 1LNZA 4AE0A 5IEKB 4U05A 2NYZA 2YZGA 1K8IA 3IA7A 1GZQB 2DFNA 2CPCA 1KXQA 2Y1AA 4MEAA 2F2HA 4Y98A 4U2FA 3C8KA 1FG2B 5AUMB 5FIUA 5JALA 4HO1X 4MW4A 1CFSA 2ACVA 3K6IA 2Q6LA 1KY2A 2QUZA 1UB5B 2A74C 3LU1A 5I1IH 5ELLA 3UJ9A 3ASOB 3Q9PA 3TLGB 2OBNA 1F58H 1I4OA 4GI1A 1KZ9A 3RYTC 3VRJB 1WXFA 3FQNB 3VI4F 1J00A 1P2VA 3QUYC 3CWQA 2H1WA 1YMMD 5F23A 3APCA 5CJQL 2W4MA 3QPQC 3UZUA 5E2VL 5JNTA 4CM8B 2OORC 3SDXB 4M9CA 2B8JA 1BSVA 1XO1A 2VPXA 3IMUA 4E41D 2JELH 4EJ2A 4X7MA 5KS9F 4IIDA 2C5AA 4HN2A 3MS2A 3PICA 3HACA 2K6YA 1FNLA 1NUSA 3GEFA 3DPIA 4Q03A 2QE6A 4LCWE 4XXWA 3MPUA 3QAZB 1NWHA 3JYQA 5J2TA 5B8CA 3IUYA 5AXCA 5BOPA 4Q47A 4JRWA 4AROA 4PEEA 3A2KA 1GCAA 3OMAB 2OO3A 4IIYA 5H7XA 5EUOB 2OAEA 4MW6A 2Y6UA 2QNRA 2H1PH 4OUUA 1FBIH 3HRZC 2DYPA 1V8PA 4YJFA 4ZMSA 1TETH 4ZIRA 2GK3A 3A4TA 4UDNA 4HMEA 3BILA 4UJ5A 4DP6X 2QKIA 1DDOA 3U1TA 1PNVA 3SM3A 4RM2A 3M6VA 1N0XL 8LDHA 5D55A 3BUDA 1N8KA 2EC9U 3UDWA 2JQMA 3TPFA 1ULBA 2IPNA 1EAQA 2A9FA 4BFNA 5F52A 5JNLA 2FZWA 2X05A 5JVDA 2NNCA 1A6VL 5CEZD 1WZMA 4AGPA 5LGJB 1CUCA 1RM5A 4N7MA 2W83A 2WUDA 3K4PA 3VQTA 4A9AA 2GHRA 4MRMB 3AXLB 3NRQA 1RURL 1N70A 4R5TA 4XP9L 3Q7JA 2I7VA 3AWDA 1NUHA 3GCDA 4B4UA 3N41F 4G97A 1RUPL 1E61A 2CK0L 5DRZA 5T6MA 2ZSEA 3MV01 5LA6F 4XVRA 3I75A 1I1AD 1ISHA 2WXGA 1DFIA 1UF9A 3UK2A 4NI5A 4N5EC 2B1IA 3VYPA 4GAGL 1GUAA 1QW8A 2WFLB 4DTGL 2AV7B 1GZPA 2O0MA 1Z38A 1J87A 4IDNA 2AXQA 5HXAA 3GIVA 3RYIB 4I9GA 4X1KA 2Z98A 5C51B 2N7SA 4KO8A 4NQEE 5FFGA 3KRTA 4IJ6A 9MHTA 4OGKA 1TAHA 1PK7A 2JGIA 1BD2D 4RE6A 2AKYA 5DSXA 1EVYA 5JOPE 1E28A 4XM0A 2VTDA 2IYZA 4ZW8A 4MP8A 4JKNA 4RMNA 3UAOA 5LNGA 3GHEH 4C5AA 5C09B 1ZGLB 2Q6KA 3TFKC 2LAAA 1ZXXA 1WD7A 2RONA 3SXUA 4NCDA 3KVVA 2B9BA 4CRWB 2NY0D 4YHZH 4C3VA 2WWOA 1T2QH 4B9PA 3VSQA 2D9CA 4MXVE 4X50A 2EF0A 5DVOA 5DYNA 2ATIA 2WWVD 1YEFH 2P5UA 1OSZA 1IAQA 3V8EA 4F6RB 3MT9A 4TTPA 4E31A 4QRRD 2Z9DA 1P9WA 1J39A 4GRIA 1U1FA 1KJNA 2VLKB 5HGBA 3PEUA 4M36A 1AS6A 2QL7A 2NXWA 3PFFA 4QLAA 2O6HA 1CUUA 1QNIA 4HDIB 4HK0A 2V0AA 1NMAH 3WLKX 4LJ4A 2DM4A 4KZCA 3TA3D 1NFFA 3VYVA 3M3PA 3PQ4A 3AM8C 1UM9B 2XZTA 4CNIA 3LVBA 3RTCA 2DPYA 3HXLA 1D7DA 4ZFQA 4YGYA 1UXKA 1NCDH 1YMUA 3MV9A 5FYLL 2PANA 1Q1AA 2ZRNA 1Y82A 1RZJH 5LXTF 4FZEH 1I9CA 4Y2DA 1B9KA 2JKTM 5IMLA 4FYKA 3R75A 1G6RA 1J49A 3MX0A 3R0NA 4HJ1A 3K0CC 1DO2A 1Q1ZA 43CAA 2CXNA 1IC7H 3GEEA 4O2BB 2BTQA 2ORYA 4QUIA 1T4GA 3C60B 3O9VA 5G1OA 4JT9A 1NUAA 5IKOA 3LQKA 2BR3A 2O48X 2HDHA 1Z1WA 4KE9A 3LX8A 5LBVA 1AQJA 1U8QA 2Z31D 2P5EB 1PY4A 3ESDA 1IUOA 1SGKA 1UZGA 1JYNA 4WKOA 2V3VA 5EIWA 1ETB1 1XA4A 5DRWB 3WMQA 5CW1A 1E4OA 1OHHA 3DVAB 4W9NA 2UYOA 5FAKA 3AYXB 2YBRA 2GCOA 4RDHA 3TJMA 3GY0A 3SODB 4CM7A 1OH8A 2ADIA 1PHRA 3E9ZA 1HINH 5I16A 1I3RA 2DFDA 2YEZA 4G83A 3AR2A 3AY3A 3UBHA 1RYHA 1A6ZB 4PS0A 3WEMA 3T5PA 5F64A 4OO3A 5TPWL 3GT3A 1HNGA 4KHPB 1TZJA 2LR0A 2J0QA 3T4UA 3GTTA 2BE7A 4F12A 3GMIA 1MLBB 1T8TA 1XAHA 4F2MB 5T3ZL 4R2JA 5SY6A 1PT7A 3UBMA 4U2EA 1IJEA 4KQHA 4WJLA 3OLWA 4YHLL 4HZIA 1D2EA 4PYQA 2FN4A 2Z7WA 4Q4HB 1R0YA 3AUSA 1JA9A 1E79D 2CO1A 4Q89A 3VWJC 2DQUL 3GD1C 3HCVB 3KYMA 3DLTA 1QG6A 2O1SA 2R7EA 4ZS6C 4LV5B 1PTJA 5TRTA 5BSHA 1S9KC 2MSLA 4GOND 4ZYXA 3CMOH 1Z06A 5DU2A 2WVGA 3MCVA 5AOKA 3TO2B 4RA9B 4LT7A 15C8L 1U0RA 3HC4L 3KLSA 2FCRA 3K0AA 4Z7NB 2CUZA 5IF9A 4PRPD 4OSEA 2GK7A 1DSFH 3GUFA 1Y1RA 1FLVA 2GIYA 1Q0YL 1H3XA 4RGNB 2I67A 5DUPH 4PWFA 4Y5XB 3A3PA 5ALPA 2IZOA 4L3EE 4EG8A 3NTXA 4PJ9D 2HG5A 5BQPA 2WU4A 5K9KA 1Y7HA 3PNMA 5BNZA 1BBJA 2LCIA 2HUNA 4LARH 2P1RA 5I48A 3YASA 2R85A 1LPNA 1A98A 5BUCA 1CETA 4D0CB 1J70A 3TV8A 2B78A 1MZYA 4EMZA 3RFCA 3WEBA 3WIUA 3BQUB 3F64A 3P4OA 1CZKA 4DF3A 3TEMA 1WT5A 5E4IA 5ER6A 2C97A 1ASPA 2FNAA 2MNJB 3GJ7A 3BRQA 1NGWA 3E1ZA 2O8VA 1ZM7A 3GGJA 5FI1B 5A4MS 4OGXH 3FT0A 4IWYA 4ZJUA 3E23A 4YSCA 1UWCA 4GUOA 3KPQB 4GMSL 3P9IA 4WVLA 1F1DA 1ZGLP 1S2MA 5C0BB 1YNKL 2CNZA 4HLEA 1WISA 4QPZA 3VPHA 1WBYB 2L18A 1E4WL 1VFAA 3GMRA 2H6UA 2NTFB 1P3Y1 2OQ2A 4A68A 3D54D 3RK4A 1DBJH 2N3JA 4JMXA 1P7KB 3TO4A 2VHVA 4MRAA 3VR6D 3ZLJA 4WNSA 2D0HA 5DTIA 3ZHKA 4R2WA 2IQIA 5IGXL 4OSOA 3JWHA 3WUWG 2XWBB 1VACB 4MS8C 3AR9A 4A04A 1GPOL 2YGVA 2CE6A 1UD3A 5CFQA 3ZXAC 4LCCA 5F3DA 4K9NA 4XDGA 1I7DA 1U8CB 5DA0B 1RACA 1YNLH 3PC2A 4LCYA 4GQAA 1JR2A 2FL5B 2OUKA 4LOHA 1CUDA 5LN8A 2XXMB 4PI2A 5D8JL 5AG9A 1RKVA 1R6DA 2XQFA 5JAHA 1OXTA 1SDDB 3OZ9H 2YIHA 5FBLB 1QM5A 3D4BA 2FECL 2VRKA 4XHJD 4G7SB 2OB2A 1ILWA 2DYKA 2N1BA 4FE4A 4GMTL 2QRQA 3ZV5A 3DUUA 4HK4A 1F3LA 1BM3L 2AJUL 2EFDB 3VU2A 1K75A 5FLXA 1PKQE 5KDLA 3I4LA 5EUKB 2DPMA 4G5AA 5JEDA 5HHVH 1R0BA 2Q2QA 3KXKA 5KQRA 3H11B 3MRRA 5J9PA 2EHDA 4QTUB 3EF3A 3HKEB 2XTAA 3RZCB 3B4NA 4PY7B 3FB8A 5BYBA 1JHYA 4KKPA 3NRJA 1W0WB 5KSYA 1KVTA 1YZVA 3DM5A 1UFGA 2J21A 2R0WH 2B1AH 3CT4A 3ABLB 4WBNB 3E9CA 3R09A 1WKVA 4HKJB 4QVIA 3VRIA 3PXLA 1V5JA 2CNDA 2GBGA 4I13B 2H5LA 1P91A 2OO7A 1QRNA 2FW9A 5IAOA 3T08A 3NBKA 2YJNA 3MLUL 3U40A 3FBGA 3QWRD 3DSNB 4MRBA 4J1QA 4IDQA 5I17A 5GZOC 4GDMA 2IWEA 4MVBD 2CZGA 4RELA 4YQXL 4ZQBA 4R26H 4PSUA 4PB9H 1MFCL 2PUGA 4YCCA 4OK5A 1QX4A 3AZUA 4PX3A 3QH3A 1N6IA 4U5QA 3RB7A 3KKPA 3AMVA 2RD2A 3ECCA 3EHBB 4OLWH 5GS0C 2HFGH 1T9HA 3OCUA 1G66A 4QAQA 2EP7A 5CVTA 3WKMH 1PL7A 3BWUF 3GU3A 2XMGA 1N8SA 1MJUH 4EI5D 4PWGA 1FDSA 4Z7OF 2Y3AA 3FH8A 1IBCA 1Q0LA 1PF3A 2ZT5A 3PGKA 1OPGL 1QZUA 1SIBE 5KQPA 3OX2A 5JXEA 2W6NA 2UXBB 3S8MA 4MV6A 1IN6A 3RSSA 2ZBGA 3TBHA 4MWDA 2XKBA 2EDWA 1XAKA 4DJ5X 1I1CA 1XR8A 4OQEA 3ZHBA 5C4IA 3VHQA 4EE2A 2WFZA 3P4LA 1S7RB 5A3QA 4UZUA 4UNVA 2GVNA 3WGIA 3NRCA 5B3JE 1VL1A 1GVHA 3DDOA 4DQVA 2WQ7A 4GRDA 2AJZB 1RZPA 3V4VA 5CTJA 1RC0A 4LYGA 1Z6GA 3CMCO 5BOVA 4HUUA 2VYVA 4LF7B 1CF4A 2GJ6D 1HSAA 3IN0A 5IC6A 3OQ6A 5JJKA 2JKVA 3JWOL 4ZQCB 3SBOA 2YWYA 5WRFA 3RHSA 3BE1H 3U6BA 2VJDA 4Q02A 4N0FA 2VH5H 3D18B 3ZMEA 4OFBA 3LCRA 1GYQA 1O3YA 2INGX 4F8PA 4X3PA 2CLZB 43C9B 2OPCA 3QQ9D 3BD7A 3CZQA 2XUJA 3CPSA 3LH5A 1DLJA 2OTPA 2QJRA 4KJXA 2LP4Y 4BRSA 2EBWA 3N5KA 4EARA 4G0UA 3EJZC 4HBCH 1B3JA 4KQ3L 4GEKA 4JRXE 1Y48E 3GGWB 5FHRA 4X80L 1WB4A 1RUQH 3ARBC 1MFAH 4KQMA 4PCAA 3W4KA 3W5NA 3IJ7A 1TYDE 4GXVL 3VFPA 2WD7B 3TSZA 3ZTYA 4JD5A 2QTAA 4O2FB 1A7PL 4ACTA 4PMFA 1GAEO 1SNYA 5F7XA 2XG4A 2VDLH 2XVAA 2IWFA 1LTHR 3NXKA 3Q5GA 4F37K 4FQXC 5I7HA 1YUHA 4UUJA 3JQAD 2OTUB 4N7RA 3RYCB 5HZKA 1P6FA 4HC1H 2EJ1A 4KTGA 2HSZA 2P1ZA 2P2ZA 4BZZA 1EFAA 6PAZA 3FTZA 2O3RA 4DMCA 2XUOA 1QFHA 2ADMA 2QZPA 1TTPB 3IFLH 3Q44A 4MVJA 3HDHA 4V3CA 4OI7A 1N25A 1XWFA 1IBHA 1ZUIA 4NWUL 2HFJA 1QX1A 5AOMA 2ADFH 4LKCA 5CGYD 1A5BB 4EI6A 3GXPA 2EIZB 3MOAL 3IMEA 3DNMA 3KD4A 5T64A 1R0ZA 5D1ZA 4PJGB 1XZ0B 3T6VA 4UZEA 4U7JA 4V0ME 3O11B 1QZ1A 2CMRL 4WUVA 2JIXA 3M4JA 5AHRA 3LQZB 2D59A 1KCSH 4JDUA 2VQFB 3N55A 4CHTA 1Q17A 1IHYA 1CLZH 2O2XA 3CPUA 1J4AA 3T06B 5DMIH 2ZBPA 4LLDB 4HNAB 1T22B 1KJVA 2J3IA 4WDRA 1U3CA 2CXXA 1U9YA 3AQYA 1OF1A 2XJ9A 4NYJR 4GMFA 4ZMOA 4FMCF 4K55A 4Z3EA 4RKEA 3ZLQC 1RJZB 5CEXA 2GQHA 1RQ7A 5TVGA 3UAYA 1X5FA 3KJXA 3D12B 1TSRA 2P42B 4IHAA 5EOCH 3IE1A 1B0AA 1IRAY 4RCZA 2C4XA 3FFDA 2OESA 1LP9A 4PSVA 1Y34E 1GGNA 4MGXA 2OXIA 1QFWI 2RGNC 4DWOA 3VFUB 4TMPA 2NY4C 4BQ9A 3M8OL 3KKQA 4BLPA 3K73O 2J3LA 3O91A 5CAYB 1T91A 3T1HB 4W9GC 4LLWB 3TX4A 4PVBA 4RAHA 3VXUD 2VCOA 5C07D 4GG6A 1SUHA 1OSNA 1SIWA 1N8ZB 1NMCC 4A15A 3L0SA 4NOKA 3G49A 3B8EA 1JAIA 2TS1A 4AJIA 2M32A 5EJ5A 1V27A 2VF4X 3B6EA 1Y1SA 2ZX9A 1JDUA 5DEJA 5AM2A 2BH2A 1XMEB 1M1NB 2WLKA 5H2BA 2ZT7A 4LXGA 4N8VA 4LHUD 3G9XA 2AYYA 3QBEA 1GPMA 2G76A 1DC4A 4X7RA 4Z4EA 1JJVA 1QS0B 3BSGA 2B7DT 6NULA 2AEOA 3DX3A 2RB4A 1A69A 4TTJA 2YKLH 4U1MA 2L4OA 3G89A 3LL4A 1OB2A 4J0KA 3DDGA 4ENSA 4PP1D 4N9OB 1XZGA 2XZCH 1RZ8A 4WO4A 1J2YA 2H92A 3NAQA 1XTPA 4OLYH 5CYPA 1KN4L 3FDZA 5LGHH 3VXQA 2XNAA 4Z9YA 2AAVA 2F8SA 4J29A 2ODTX 5JAPA 1IATA 2DU8A 4DNOA 1PKXA 5AW4A 4BNHA 4FZ8H 5COQA 3LEXB 5ANMB 3K1DA 3TDNA 1PVHA 3T2OA 1U2RA 3TLKA 1YDHA 2H32B 1G18A 4ESKA 4PVCA 4HDNB 3TZQA 3PBKA 2E3VA 1R0KA 5F96H 2R7LA 1GCFA 2XIJA 4B53A 2JGNA 3BICA 2DLCX 1A7NL 3OHXC 3GCZA 5TQ0H 2J3MA 4DXAA 3JD0A 2QE7A 3X3FH 4FYIA 4LAQH 2HX7A 3D3VB 2J9YB 1VB3A 3RWJA 3MA7B 4HAXA 1UINA 4DP1X 3N53A 5SWZE 1YRWA 5BWMA 3S5ZA 5C7LO 4FYMA 3O8LA 4AJWA 1G0XA 5E56A 3H54A 1P7WA 3HCDA 2H63A 1KTIA 3ALWA 3FWKA 5K0FA 2ZFUA 3APFA 4J3VA 1NOKA 3HE6D 1T4KA 3C3YA 2W9EL 2NXYD 2VWGA 1LPBB 4E1VA 4JQSA 4WWKC 1LQ2A 1OXUA 4MZ3A 4OLEA 4N1EA 3PGCA 5JMOC 2XD4A 2ZU0C 4AJYV 1U8IA 1YIDA 4DMLA 3INGA 1TYZA 1R3LA 1SJVA 3VVLA 4QHLA 3NH7H 4DILA 2VRCD 2R39A 1QG3A 4KTTE 4MQBA 3KGSA 2Q1XA 5D3QA 1PLJA 2ZOSA 4GNRA 1RVFL 2P2SA 1DIRA 4UAJA 1Z4IA 3K2UH 1IAIH 4HG4K 1ZGJA 2Q7YA 3SZUA 1QLHA 2JSFA 3WE7A 4PY8J 2JH8A 4I5DA 4NPCA 1GS6X 4IFTA 1V16B 5ESAB 3TBVB 1M72A 4ND8B 4XXCC 3BESR 2DHQA 4P06A 1M66A 2GMWA 4NC0B 1H3VA 1HKLL 2EFYA 4FG2A 2UUBB 3DYPA 4GGPA 4HVTA 4LDEB 3P2TA 3G08A 1TCAA 1H6UA 4Z7UA 5F88B 1QRUA 3P9MA 3BPOC 1QYXA 3HBLA 1BM7A 4K81B 1EM8A 1BVZA 1V0JA 1HL9A 3HW7A 2EZTA 4D8UA 4QTZA 3FYSA 6REQB 5F1NB 3UPRB 4NC1E 1FRZA 4L2IA 1VGRA 3BVNB 1VPWA 4IFBA 2XWDA 2PKDA 3JRNA 3ESBA 1SKMA 4WA8A 3EYWA 3NFPA 4RACA 5LOVA 5EKDA 3VR1A 2GFBA 4O5LH 3M3DA 4LPVA 4WI0B 1ZS2A 4B75A 1PEAA 2D03L 5CJOH 4NOFA 4KFTA 2RGEA 1UDCA 4P46D 3L1KA 4QJBA 3MJDA 2NU8A 1G3MA 2EDFA 2ZXAA 1T1YA 2JJVA 2BUBA 4FHFA 3SGJA 2FDRA 2W0SA 4F9TA 3MTRA 1USWA 4JPIB 5HK9A 2COKA 4WOJA 3PE9A 1Z35A 2ZPKL 1V3MA 3U9PL 1M7HA 5A5GA 2GUWA 3WGVB 2J6EL 3S0JA 4HS3A 5C0FB 3EQ6A 3FH0A 5KQGA 2PAAA 2UZIR 2X6MA 4PF1A 4GUAA 3NJ8A 1HTTA 1F0KA 1RMFL 3LWBA 2O8FB 1VIVA 3D2LA 4NU8X 3NM4A 2R1WB 3HLAA 4F7TB 4HUTA 3NHMA 4FDWA 5AD1A 4N18A 3T3ME 1KVUA 3VBEA 2JGAA 3WNPA 3MTXA 1DJOA 2QKYA 2Z08A 4Y2JA 3WG9A 1QGZA 1CZNA 1R10A 5D7IF 1N9PA 16PKA 2BFDA 2X1XR 2HC9A 2PQ6A 3QIVA 3CW2A 3QG5A 4BZ1H 4G8GE 1AKUA 1W46A 2OKCA 2PSSA 3OCVA 4H3KB 2D2CC 1EHAA 1KIPB 3HPJB 3EJQA 5D4IA 4UBNA 3FBWA 2X9NA 1MCLA 3QQXA 4FEYA 1ZLWK 3L3IB 2GCEA 1AH1A 5DM0A 2JKYA 5IB3B 4YQZA 4F9GA 3MGCA 3R4DA 1SQ2N 1I0LA 3DKIA 1E1YA 4JLKA 4L0YA 2BLLA 2D3VA 1NWOA 1A9EA 4Y2TA 3W0WB 4XC1L 2V4ZA 2VTVA 1WF6A 2I7CA 5LNK6 4MYHA 2BERA 4YCNA 2EYSB 5TS2A 3FT4B 3O3EA 4B60A 3WWEA 1LK2B 1BFSA 2WBJA 1JF1A 5DE3A 4Q4JB 1V4NA 3ECBA 4YDJA 4MJ7A 2O5EA 2AWNA 1N67A 4FG6C 5CKGA 3OSZA 2D9QB 4H25B 5E6RA 4IQ0A 4WECA 3EBOA 2P2GA 5AVWB 2JWHA 5GOZA 3LXCA 4CSZA 4JUIA 1CRLA 2AI3A 3M49A 1S3GA 1H1DA 3BZWA 3OD5A 3BAWA 5GSVA 3LRLA 3KPMB 3UGQA 5FYKH 2OFXA 1SG0A 1TM5E 2X6TA 1MJ5A 3QO1B 1MXFA 4P38A 3WNZA 3QRBA 5C5IA 1DIBA 3HUEA 3W6PA 4YE0A 5C8VA 2Y2VA 4UBOA 4G2NA 4R1MA 4XCEA 3COZA 3JYBA 4ANUA 3PX3A 3HBQA 1IFHL 5IROC 3QUHA 4BH8B 4AX4A 3GI9L 3PRKE 4N6OA 4WRRA 4GBXB 1ORQA 8PAZA 3K72A 4D9EA 3FUFA 3C41J 1G59A 3VXKA 1MG0A 1NAHA 2YYYA 4KH0A 4EEZA 1JDVA 4DKJA 4AUYA 4KRPC 1P84K 2DQJH 2FFJA 3VR0A 3QUYB 1FH2A 2AOVA 2BJMH 3OMZA 1HHKB 2GPTA 4LKOA 3ES6A 2YPLE 3MI6A 2Q76B 1X8KA 4X0KB 5GONF 1XBDA 5B53A 2Y0DA 3ANLA 3VWKB 4WESA 2XV0A 2CBXA 3B51X 1X2BA 3VU8A 5IMKA 4PJBA 3KXDA 4LOJA 2V8LA 5IKPA 2V7WA 3CD4A 4HV8B 4AM0A 2VDQL 5EBLB 4C78A 2YXEA 4HULB 1AKJB 1R6VA 2OI9B 1YACA 1PNCA 1AZZC 3COJA 3GAZA 5GGRB 3N40F 2ZKHL 4GE3A 3I2IA 3HYRA 1XEDA 1LO5A 4NATA 3RJOA 1UK7A 4HBZA 3FSWA 3GM0A 3E8UH 2VDKB 4FI8A 3LOWA 4OCXH 3FTNA 3U56A 4QFBA 2J4CA 4LNHA 4UQDA 3UCXA 4QXPA 5CWSB 1G8JA 1NC3A 3ZOAA 3M1OA 3H9SB 2WINA 3GSNA 1W36C 3OB0K 2HCJB 4YREA 5CVVA 1HH4A 1T35A 3STBA 2APVA 1DUVG 2IXTA 4WCFA 2LUOA 1TPXC 2IUUA 1IN4A 1ZT1A 1K68A 2R86A 3IERA 1RPKA 1ZXLA 1D9KB 1QKZL 1PW3A 1FP5A 1CZUA 1TZGH 4FNAA 3T0EA 2BMJA 2ALWA 3I9AA 3RVWD 4HCRH 4QRPB 4JHWH 2ZGVA 3H9UA 4XMZA 3LOPA 4O08A 1F4HA 4MVWA 3QJYA 3EZJB 4H08A 1QGOA 3HMXA 5EU3B 1MHHB 5JNYB 5DF1A 1TC2A 4J4HA 2JATA 2ADJB 4GIAA 3L3OB 3U6RA 4BFTA 2O8DA 4ONOA 3KMDA 1QTPA 2DLDA 3GZTB 4ECEA 2EZ0C 3W11D 5HPOA 1BDYA 3NG5A 4IJ5A 3FNRA 1M33A 4CDRA 4RA0C 2ZUVA 2Z93A 2OZ4A 3JD2A 4LHUG 2PTGA 4G70B 3PF9A 3DX8A 2OV8A 4XCFH 5C8JA 1XX9C 3AAZA 1SHJA 3L95A 2ZTSA 3PCTA 1F1AA 2BFMA 4QHKJ 3WN5B 2AQ1A 1DQZA 4PJAA 1PJAA 5E2TH 4HXFB 1JN0A 3S34H 4MUXA 2WQAA 4W9IC 2WHPA 2XRAH 1DUSA 3ZWBA 1U28C 4BTEA 5ICYB 1NQXA 3C9NA 3L6DA 3OJEA 4GT7A 2OFFA 5HE9A 4JZNA 1WV1A 2APJA 5DBFA 2CCLA 4CQMA 1VLLA 5AVSB 1DR9A 3MS7A 3EYQC 1NDTA 2ZTVA 5B1HA 3QEUB 1U2GA 4K7PH 1RR6A 1HKFA 4V3BA 4OZIA 5FYKU 5I4BA 3I01A 2ZJ0A 3HBFA 4JX9A 1YECH 2OYPA 5CLJA 3V6OE 1V3VA 2JIMA 5F7EH 2CV1A 4NZ8A 4HC4A 1DQLL 4G5QA 4OX9B 3NRBA 4LB8A 3CVWA 3Q7EA 1C81A 4Q9BA 4B5EA 2FX3A 3BRWD 1K6JA 2JARA 1QH8B 1J06A 3KQKA 3QKRB 5GS1C 1ZMRA 2HH9A 3OKLA 3VH8G 2QVBA 4U2CA 4UDUA 3I0MA 5J11B 2RAFA 2F08A 1TZKA 5I71C 1IC5H 3N1PC 4PLVA 5ALTA 3GBLA 1VHWA 1GGIH 4BMCA 1OGAE 3MRIA 4LOFA 3N7TA 3AERA 1SCDA 3TIGA 3T5WA 4MPJA 4PBXA 1O4WA 3QDGB 4OBSA 5DURD 3CIOA 4L5FE 2XSKA 5DSTA 3V97A 4J3OG 3H04A 3HGTA 1G8FA 1AMUA 1E9VA 3I8SA 2CK3A 4LESA 2HK9A 5A2LH 3CXDH 1OTUD 2AMFA 2V2TA 1KXVA 3OPVA 1ECYA 1CQYA 1V3TA 3EMBA 1ASOA 1OY3B 3VC2A 1P1HA 1EFRA 1JZHA 4GPIB 5GGVY 4CG0A 4NZPA 4BSVA 2L04A 3MPCA 5BORA 3HYNA 5DXJA 4YHML 4AIIA 4WQMA 2IMMA 2R9HD 2CVQA 5DJ2A 5GJCA 2FT8A 4TNGA 4NGHH 1F2UA 2ROQA 3DMHA 2RH0A 5EOCJ 4BEWA 4YMTA 2D6FA 4HIEB 4N5HX 4EIWA 2LDXA 3LQMA 5MN6A 3FPJA 1NPNA 4ELMB 1WQ3A 1BD3A 2OV0A 4JU9A 4QUAA 2R56H 3U9LA 3FLEA 4KYVA 1H3PL 2MCPH 4R7NB 1PWYE 2EWWA 5E9JA 2IWHA 3KJZA 4NAMA 4F27A 4NAHA 4CLOA 1YUBA 2H51A 2F5BH 1HYSD 1VCOA 3ROQA 2JPDA 4Q58C 5F21A 1N64L 5EBMA 4J12A 5I9MA 9ABPA 3MNFA 4B2LA 4UTAL 5I66B 2AG1A 2XHEA 4MP3A 3C3PA 4XVTL 1TM1E 1Z0JA 2X3YA 2AT1A 3NABL 4S24A 4HOMA 2WY3B 4X8GA 1FP7A 3FQWB 4MQFB 3U61B 3QVGB 4GYWA 4EO9A 1AV6A 3WDHA 4OSUH 3VTKA 4M4PA 1KOFA 3DARA 2RB5A 3ZK9A 3CN2A 3LS4L 4KXBA 1QVWA 3B7YA 1OANA 1ZEAH 2Q7AA 4UQIM 4MI1A 3H3XA 1GNQA 3F4BA 3FCOA 1NC2B 5C81A 3HHRB 4FFYA 3U46A 5ER9A 4H88L 2VP9A 1EWRA 3ILDA 3CX6A 1YTUA 4R9UC 2YA1A 3MLVH 3TBSA 5J59A 4PJDF 2Q3XA 1WDAA 4ZYZA 1ZANH 3W37A 2C5HA 3X43A 3C08H 4ZMVA 2J1ZA 4Y16D 2XJ4A 3HNOA 1A7RL 3T77B 4FLFA 1WHTA 1ZJJA 1L7XA 3LP5A 1F6WA 4G4SP 1RXVA 4LGCA 4Y18A 2C9VA 3GSVA 3ZCVA 5D5HA 5H8DA 5GRUH 3D81A 1E5UI 5A4KA 4BBJA 2YXFA 2F43B 5LB1A 1XRNA 4AJ4A 3ZWWA 4LCUA 2HG0A 3JV0A 3TCXA 2AOTA 4LDZA 2D2VA 4KLRA 1SUWA 3WJ1A 3UJTL 4FBLA 5JDCA 2GI0A 2AOWA 4D6XA 2G09A 1KACB 2RSLA 3U7JA 4NUGL 4RESB 2XTNA 1I3KA 1PBTA 1Y6GA 3DNKA 4Y2YA 1KNOB 3M34A 2GFHA 3DSRA 1L4LA 5EQJB 5FYKD 1E6JL 3VGEA 1E2DA 4AECA 1OTSD 3RD5A 3QBTB 1ISJA 3UGJA 4NQTA 3A1VA 3TRHA 4KH1A 5EWIH 3MRPB 3ZGZA 4HFUL 4PZUA 4L1SA 4NN6C 2NNWB 4LBVA 4A26A 5KOYA 5ACZB 2DJIA 5EJFA 2KZWA 1CU4L 3BMQB 5IJVB 1RZIA 3TW6A 3W2DH 1O0CA 3IFNL 2VJLA 3CX5J 2P26A 5E3IA 1KEWA 2CDEB 1JZJA 5I1LB 4NO5A 4XSHA 1M7DA 2RGYA 2VP4A 4M6NH 2ZIEA 2E5WA 4WNAB 3UJHA 5TY0A 4J07A 5FO0A 3L2OB 4AG3A 3NCXA 2VDRB 4O0MA 4TLMB 1ZJ5A 3GMMA 3R18A 5HFJA 1C16A 1CR2A 1U8MB 4UM8A 4XBPB 3TVDA 2DAVA 1RJGA 4GWLA 1SEVA 4ER7A 1YKGA 2WM8A 2HVBA 4Q9RH 4CIDA 4JLNA 2WI8A 2D4AA 4COOA 3ICEA 2D4FA 1EI9A 2NO5A 4YAJA 4GYJA 2HXAA 4X42A 3O5AA 1I8IB 3DX6B 2R51A 2VPQA 4ADIA 2EVHA 3I5XA 1EK6A 1T0MB 1ZD6A 5CM1A 1OLXA 4LVNC 3BGFB 4S0SD 4FOLA 1ZMOA 3HPLA 3Q87B 3L9EA 3AK4A 3NW9A 4NJEA 1FLAA 4W8GA 2JF0A 1X1QA 4QDUA 2D4HA 1OL0A 3VMPA 3WFBL 1UFRA 4O2AB 4M7LH 3IDXL 3DAOA 1CWUA 3C2AL 3HMQA 4HKXA 2VNAA 3JQRA 3X14A 2WEKA 1BLNB 3OQBA 2WYIA 1YPZE 4PXYA 1J99A 1JCVA 1IQRA 2X70B 1VPDA 3ZH9B 2E5FA 1JVNA 1MHEB 5L3QB 3QO0B 2QR5A 3GJFH 1QHGA 3K9LA 1MCWW 1CGSH 1J05B 3FUKA 4H1VA 3GBVA 5BS0A 1G291 3O3UN 3SBDA 3IGFA 1SUSA 1IEHA 1KBPA 2II6A 1CC1S 2ZBDA 4DVBA 2Z5FA 3PQEA 3JWNE 2VUHB 1N19A 1KJWA 1L8QA 1LS1A 1AS7A 2PUQT 2ZRBA 2Y1ZA 3U44B 5HGDA 5HZHA 1CZOA 2VYND 2G5PA 3MCAA 4A2QA 3SKMA 4M8UA 5T57A 2WT8A 2ASEA 5B36A 1Y5LA 3HZKB 4E9LA 2DBQA 1AUXA 1RYYA 5EPMB 4LMQE 1WEJH 5DOZA 2NP7A 4AYDC 4E9YA 3L6BA 4EGSA 4TRPL 4JJ5B 3G3EA 3DYMA 3ZWKA 3MJ9A 4TUOA 4Q37A 2QVIA 2FVNA 3DFMA 4HNTA 4J43A 1HL3A 1TMOA 2OEPA 2ICEB 2OENG 3JAMA 1G19A 4M3KB 1JEQB 3PC7A 1GY2A 1E2GA 1K2DA 4MKGA 5JQGB 2VNJA 4LEXL 1L7AA 3ESCA 2YPKB 1UQUA 2VL5B 4U8HA 3VC3A 3U7AA 1TJHH 4IXDA 1VLQA 4J1UB 4YRKA 4B6JA 1NKVA 4L8CA 5LR6A 2VZUA 1Y6MR 3NHZA 1K3FA 4L29A 3L0IB 4FYVA 4U3JA 4OZFA 2KDYA 1FDLH 4GUQA 3GLTA 2EQAA 5F6IC 4OIFA 1HR0B 2H4FA 3TNLA 2QX6A 4DUWA 2H2SD 2BIFA 2FSGA 3UUFA 4C30A 2V96A 4S05A 3G5TA 1DC7A 3IVXA 1WDLA 4OUDA 3T99A 5SX4H 4DG9A 4CQLA 3UYRL 4PG8A 5ALJA 2E8YA 2WXQA 4QRSA 3OE5A 2UY6B 4FONA 4AJ0A 1T4MA 2YOCA 5A5DA 4AG4L 1GZ5A 4FKHA 1YMMA 3SE9L 1XGZA 4DGIL 1U7WA 5YASA 1BVLB 5IHWA 4PM4A 2GCNA 2IPAB 5GGTL 1BMZA 1NEZG 2EFJA 2FAXA 1L3IA 4BDTA 5LMUB 5FP0A 4E41A 4EZMA 5HDWA 2G5GX 2JCCE 3H1PA 1V25A 1SGWA 4BY9E 2F59A 3MNVB 4ETQB 3T7IA 2V9TA 2B6NA 3QDJD 1I75A 2VK2A 1RAGA 3ESYA 4MJLA 3H7LA 2KH2B 1AGBA 3KB2A 3KPLA 5FM4A 3DRTA 4PJ7F 2YJZA 3WNCA 3OHMA 4MIKA 4GLRI 3MMEB 4JUBA 3FTFA 2CGYA 2OP4L 4TV3A 4R7TA 2A3RA 1CJYA 1D8AA 3W2EA 5DM2A 1AE6H 3C2QA 5JPDA 3X2QB 1KHHA 2O6EA 1TT7A 2EEDA 1Z3CA 1GOHA 4FYTA 1WFIA 2MOVA 1N6OA 4ZI2A 3FQYA 4YRQA 4Z3FA 2JNZA 2JKWA 3TINA 1A5FL 2Q7DA 1JS4A 4PS4H 1JEOA 3ZI7A 1TTQB 1O03A 4UD6A 3AFNA 3C5SA 1N2CB 3X2SA 5L8JB 1PG7H 1GKUB 1FFYA 5F7KC 4MJ6B 1W1IA 1F51E 3CVIH 2JJ8A 1GADO 3L8MA 5HKBA 4FFMA 5JYDA 4BMVA 4XPHL 3HC7A 3LVFO 3I5YA 1Z39A 2PWZA 4GF5A 1X5XA 5CILH 4F5EA 2V9CA 4RENA 3WIEA 1N8NA 4RSGA 3IMFA 3BJ91 2QADC 6FABL 3BL8A 4KDWA 4W6WB 3GD7A 2DWDB 4WI7A 4O29A 4C0JA 3AF0A 3PTLA 3WMPA 2G7MC 3ZDZF 4MA7L 3DZFA 1N36B 1SU4A 5IX8A 3BDYL 4ZZIA 4MYRA 4O3TB 2LW7A 3P5BA 3UUWA 3GRWL 1FVDA 2NY3C 1FP6A 1QRDA 4FOPA 3ZCRA 4HTFB 2N3ZA 5LNK1 1UENA 1O54A 2J46A 3V8RA 1X92A 4AP5A 3BHBA 5ECGA 5I1DB 3PABA 3OCXA 1WHSB 2EZ4A 1ACCA 3AVYA 2BFOA 4Z4CA 5I6OA 1W8NA 4K05A 5EOQL 1BD2A 1TZ2A 1LLDA 1XK7A 2IXEA 5A5EA 1LEKB 4UVIA 1TAGA 5DHVA 2FW0A 3OE1A 1VEMA 4RV4A 3RWIB 4NJAL 3E9YA 1H15A 4ZT1A 5IR1A 4FZVA 5DK6A 1JD7A 4LLVA 1IM5A 4UHFA 2J73A 4URTB 3NAAL 4PV9B 3DIDA 1E0JA 1BOGB 1NKOA 4G3YH 1DOAA 1BEXA 2F1AA 3QC6X 4QHMA 3V4PA 4QRRA 2DFKB 1ACZA 2DKOA 2VTBA 4QLWA 1EFCA 2Y1LA 1AGPA 1GZ4A 1CDCA 2O2EA 5DV9A 4JUTA 1KEPA 1DL7L 5AI4A 3DO6A 1QABA 3IAUA 5IB5B 3TA3A 2RI1A 1DAFA 3EVFA 4PG9A 3TEUA 3LX5A 2TECE 3NEXA 5JH7B 4HFWA 1TENA 4KLAA 2AK4E 4JJ7A 4CDGA 2HLAA 3U3MA 3Q2IA 4TVPL 4PS3A 4MNQD 2DJMA 3LSYA 5L2KD 4RVSA 2FMUA 4A2MA 4DP7X 1GZDA 1LI4A 3MRFB 1LEGB 2VR1A 2XA2A 3OPYA 1HK7A 4FBGA 2JK5A 2H7VA 1N0WA 3RYHB 1A2YB 3Q3GE 1MELA 5CNHA 1HRKA 3OTTA 1C0PA 3A1DA 1U6KA 3P2MA 3S3TA 3TSCA 3ARDC 2SHKA 4JREB 1UWXK 3MS4A 2B4CL 1VKJA 2G2PA 1MREH 2QT6A 1NI5A 4I1RA 5K6RA 2OAP1 1ZVVA 3GJEB 4DARA 1D04A 4X99B 4CKZA 3KJQA 2Z31A 3FYUA 3RA7H 1YEDB 4B2YA 3C5ZB 2VA8A 2NACA 3I6ZA 2JFWA 1EFDN 2IYEA 2EATA 3CHPA 4QT4A 3I23A 3KLBA 4C07A 3T7EA 1DP4A 1UATA 2Y9RT 1B6TA 3BOSA 3UFXB 1XCJA 2RBLA 3ZKSD 1UM6L 4B6FA 2YPVH 1AB6A 1T0PA 1BGXT 4YSAA 3R7QA 5IM4A 5KVQA 1VAHA 1MO5A 3VJMA 2I7SA 5GXBB 1TLTA 4QHSA 2KM1A 5J58A 2QTMA 5FCUL 1LO4H 4MCJA 1C5CL 2AG6A 3TR0A 1IL1B 4LSMA 2BZGA 2NY5L 2PV7A 3N87A 2P6UA 3NCCB 1K98A 4FCCA 1WUIS 5A7FA 2QRJA 4L8DA 1HNFA 2ZZUT 2Q8AH 1PDVA 3BUPA 2PK3A 4E7OA 4CILA 4V1CA 5C08B 1KXTA 2Q5JA 5ERWA 3EDFA 4HNRA 3SFZA 4RDIA 4JG0L 1FX1A 2HKFH 5IQMA 1J48A 5DTQA 3X1EA 1E79A 1YYCA 4WXRA 3A67L 3FUVA 4GBED 3KW7A 2Z1DA 4L57A 2SEBA 2WZDA 3GMPA 5C0CB 1JZDC 2M6LA 5D5ME 4W5WA 3KH4A 1HIMH 2G63A 2QT0A 2W5UA 3EGXA 1YCFA 2CJYA 2CYCA 2Q8PA 4AEIH 2CKBH 2DJUA 4J1SA 3F9RA 1NMXA 1N9GB 4PP2B 2J4WL 3SLGA 2O5YH 4NFYA 4PRPA 4RAUA 3DA8A 3GLRA 3IHLA 1AGFB 3T1TA 1JI0A 4TTDC 3GFBA 4OCRH 3EA5A 1SN7A 4YE4L 3UL4A 3BYZA 3HG4A 1YEEH 4KQ4L 2VPZA 2KZKA 4ZXBD 3AW9A 3B78A 2DMBA 4PJ9A 1RJWA 3BWSA 3ZZ1A 5GJVC 3V8VA 3W3AH 3W5JA 2E56A 4JJ4A 3WGOA 1I33A 2QQGA 1ODLA 2OL3B 2IGBA 3GBML 2XWSA 1S5IL 2R00A 3HU5A 3G9ZA 4QEZA 3COWA 2R8EA 2OMUA 2Y99A 4Z95H 4XMWA 4BNGA 4MS3A 1WJ3A 2BY0A 3OG9A 4LV8B 4TQ8A 5SX5K 4RK5A 1ZX1A 3N8HA 1QVRA 4GAFB 4X6DF 3R20A 7MDHA 1OPXA 1JHPA 1EZSA 3FT3A 4E9WA 3QZWA 5M3BA 3PWKA 3VU9A 4NK4A 1GGBH 1KMQA 3SC3A 3BEWA 3P2BA 2MMCA 1B0WA 2B1GA 5KVFE 1KTCA 1A0QL 4FWBA 3A25A 3QI7A 2DQKA 4CC1A 3EGEA 4PG4A 2JB6A 2GM3A 1UC8A 2PTVA 3GA7A 3VR6A 5DUJA 1BVHA 2J0EA 3VUFA 4F3TA 5KJEA 4BIIA 2HT3D 2VITB 2Q8BH 5E3JA 3QPXL 1PYWA 1YFJA 3V0FA 3BMNA 3VC1A 3P9LA 2L0XA 3DCYA 3GBPA 3QU2A 3TW8A 1CDEA 4BVBA 4JDZA 3GUYA 1U0JA 4QXAA 5DHYB 2NO9A 3ESRA 2NQCA 2EQDA 3VE0B 1MQ8A 2B2NA 1UIRA 4XIIA 4TSAH 3C3WA 1NVBA 3L7EB 2FEDD 5DWPA 4WWHA 4XH2A 1AGCB 3GG2A 4X7CC 4P48A 1OD7A 1IN1A 3KJGA 3L1FA 4HP8A 3TFBA 2WRZA 3FROA 3OTWA 1SHKA 4B6EA 3IP7A 3LXUX 5TQ2B 2JRLA 2WICA 5DD1H 1FL5A 5LN1A 3BXFA 3RS8A 3KJHA 2XTJD 4JHVA 2NW2B 5K4GA 2BSTB 2ODAA 1F8TL 4F11A 4AZ3B 1E27A 3B1YA 3FG9A 4NX2A 3T09A 4NFHA 3VFVB 3ELBA 3IOYA 3SOTA 3L3JA 1EMTH 4IIXA 4QKTA 5J4KA 4LYYA 1DTUA 1KENH 3T3PF 1NUTA 4XYLA 1L6RA 4X5OA 4ZCQA 3FW6A 1KN2L 5J0BA 3D7MA 5JUWA 4B80A 4XCXA 1JEDA 3RHWK 4QYOB 3NB0A 3EW9A 2G04A 3AL3A 5E1GA 5KYKA 4QOKB 3HA0A 5AB2A 2R4SL 1KTLA 1YBVA 4A63A 4E4RA 2J88H 1Z5NA 5AEAA 3DO8A 4NSKB 2UV3A 3T38A 2GSDA 2H7XA 3UJDA 3K1JA 1K97A 2O7VA 3QWRA 1FCJA 1B6DA 5D6DA 4ZFZB 2MTPA 1AKQA 3KLHD 2GEBA 3PDIA 1KORA 1SXHA 3IVKA 2FB4L 1LLUA 5HJDA 2VW7A 5HYJA 1FZOA 3KVOA 4RHYA 3VFNA 4ZX6A 3MQ4A 5H70A 4XQ0A 5DGHA 3QIWC 3LX9A 1C0IA 5IDYA 2A7BA 3VGGA 4EYQA 1VE7A 2CLLB 2Z4TA 4RFLA 1JNJA 4MO9A 4I9UA 3V8PA 5BJTB 2X4DA 4EI5A 1KP2A 2HLFD 4MJID 1K8YB 1TAQA 3KYBA 3K0YA 1HDXA 4QG7A 3REWB 3RVUD 2QS9A 1U36A 8ADHA 5BCAA 2FDBP 3JYNA 4HMPA 4DG5A 1OCWH 3C09C 2F53B 3BUTA 2I34A 4H1LB 2BWQA 1F0YA 4E5KA 1FO0L 2DWOA 4RAVB 2PVCA 4YZWA 4GR9A 5FA3A 4LMAA 3OKEA 2OK8A 2GBLC 3KLAA 5LC1A 4AJJA 5FOBA 3L0PA 3WNOA 3HCPA 2FMIA 5DD6A 5HYSA 4D0BB 2VXQL 5HUHA 5CGZA 1A7QL 4KRPB 1Z5LB 4MD4B 5BR4A 2DKMA 3QJ5A 3UYPB 1UC6A 3U0PB 4ER5A 4GM4A 4QJ4A 1TZHB 4JWTA 2Z2IA 4ZYKA 3KLMX 4BAZA 2GJ6A 4ZI7B 1W73A 4EJ6A 3I0NA 4MR9B 5E6YA 4TL4A 2QAIA 2WJYA 4BO5A 1PT9A 1TEXA 4AVJA 4AD8A 3R0XA 2JI4A 5E2WH 2WP3T 1TVEA 1BC5A 2KE5A 4BA8A 2HQBA 5KS2A 5DNEA 3D8NA 1A3LL 2VZ0A 3CVXA 3N06B 5LU9A 2DKFA 5F2KA 3RG2A 1N5OX 1K6QL 1RWNA 3PFUA 1XR9A 3IETA 4BZWA 2V7NB 3QDMD 2QGCA 3GRCA 2JFOA 1BHO1 1Q21A 3OHPA 3H3FA 2HBZA 3JVDA 3O9ZA 5JDSB 3TR6A 3SYAA 1R3IL 2F64A 5FL7A 1IC4H 4ODUA 4ATTA 4DKAA 1Y63A 2EDEA 1A66A 4X1IB 1PLGH 1KIQB 2LU5A 5D2LF 3DL2A 4M61A 3EPPA 3ZD8A 4A27A 1L7OA 3JVGC 3DXYA 1GPH1 4HPYH 4TLSA 2IYLD 3FPBA 3FCGA 4HDMA 1DKQA 2I8AA 5K33A 4DPMA 2B4YA 4YXWD 3ISRA 3L0CA 4H16A 3AFIA 3QV2A 2LZ0A 5IM5A 5J9FA 4AJOA 1U3NA 4IO0A 1US8B 2G0TA 4NERA 5DX1A 2AC2A 3E9MA 1QGAA 2NYKA 1DLHB 4YDMA 1E90A 4NM8L 1ZAYA 1DJXA 2EL7A 2WXHA 3JV4A 5JXHA 4QT5A 2HF2A 3JQAA 4AJNA 1JHLL 3A3YB 2P75A 1MY5A 1WC7B 3GHYA 2FGWL 3FZYA 4Y6PA 2XIBA 4UF7C 2G08A 1JWAB 3KYOB 4Z78B 4WTOA 3D6GA 2ET6A 2E27H 4F7EB 4CM4A 1PZFA 3ZEAA 2Q3LA 4F9PA 1T1IA 2NUPB 1U33A 1Z5ZA 1MCJA 2WIMA 5J4VA 4AEFA 4M5TA 1YV9A 2WW8A 5GZ6A 1NGYA 1OX6A 1DFBL 4MX7A 2E87A 3L5JA 3UC5A 2YHUA 3ZTNH 1JFVA 3ZBUA 3QIUD 4HGOA 4AYXA 3L81A 4RGMC 4X4ME 3ENEA 2ZUBA 3QVMA 4YBRA 4XBGA 3D3WA 5GS2H 3HS0B 4N3BA 3MJTA 3GARA 3NRFA 4R6UA 1TCUA 3JZAA 4G84A 2CT8A 1MRCL 3GEIA 1NR7A 4Z7VB 4FP8H 5ALHA 5EEWA 4H7DA 4ZPXA 1H9AA 4I6GA 3N1QC 1N32B 1OOWA 5IVDA 2GEFA 4A6PA 2OXGB 4YPGA 3RGGA 3MJEA 1IIKA 3F00A 2W71A 4RPCA 2OCLA 3ZYZA 5CT4A 5C32A 5FWDA 1LE9B 4TV8F 4KH9A 1AMXA 4CLRB 5EU5A 3H5NA 2VE6B 2QUAA 2BHRA 1A76A 1TO4A 3B2PA 3OAWA 4URHA 1YY9D 1H8SA 2WO4A 2VXSH 2NPIA 3PQ3A 4LGMA 3P54A 2X58A 3U1BA 1KA9H 2CW5A 5LDGA 1TU0A 3K6SB 4ENVA 5TDNB 2OGWA 4LF4B 4X9GA 4Q8BA 1CTQA 4TQHA 2Q4EA 3HZVB 4LSUH 5AD0A 3GMOA 3HADA 3Q9LA 2EDKA 5DK2B 2O0LA 3DMPA 5IVIA 4M9OA 1S5PA 1RZGA 4QWWD 2EFEB 5ICGA 1DEOA 3L1HA 5K9ZA 4QEGA 3DGEC 4C1BA 3QIBB 1TQUA 2QG9A 3VXUA 1Z9PA 2X28A 2YDYA 5A0VA 5C07A 1NEUA 1TU2A 5KVDL 2FX7L 3NOVA 1JK9A 4W9DC 4YVNA 4AH2B 1OBHA 3SHFA 3VH4A 1J9RA 1I1NA 4AM8A 3D05A 4MDRA 4LMBA 2BFBB 3O2VL 4N2MA 5GGXA 1NW9B 1ZHBA 5JO0A 2L19A 4XNMA 3TS1A 3DWFA 3M4XA 4PO3X 4KQXA 4LHUA 1FQOA 1TAUA 4LDRA 3P9SA 3U9UB 3EBHA 5LLDA 3TEJA 2IBBA 3W3AD 5D2CA 4LCWD 1N6PA 1GD1O 3IEAA 1KIRA 2YLKA 3NSCA 2X76A 4L7QA 4JITA 4KPHH 3UMVA 1D4FA 1P9MA 4XGIA 1L9PA 1XVVA 2VUYA 3SO5A 2Z1PA 3NBZC 4TTTS 4DW2H 3BPSA 4FKBA 4K5QA 4D9MA 1JNNH 3K2EA 3S8WA 1E8ZA 1OF0A 3FNKA 5C92A 3RTEA 4YR6A 4OZGE 5EWJA 4EYEA 2H6OA 3O0TA 4F7WA 4UAOC 2RK6A 2X4UA 2VAVA 3TUIC 2GXSA 2H9AA 3PNBA 3JALA 1LUAA 5THKA 1LJLA 3FTXA 5I6MA 5LBSH 1ADQH 1IUNA 5HM6A 1KI3A 2HCZX 2CLKB 3D6VA 1HOEA 3V00A 4TM9A 2C9QA 4ABUA 4WQOA 4TQGA 5M94B 5MN5A 1JF8A 3VH8A 5C0GB 2VLIA 4J27A 3THXA 4LZAA 3B2UD 4MD0A 5IQLA 2HJSA 4FGWA 4UQLA 1NGZB 1QO3B 5I3ZA 3PGLA 3MROB 5ISZE 2O7SA 3PQYE 1T1XA 2Q87A 3ZTEA 4DKFH 1EK3A 3Q7QA 3THRA 3HE6A 5AK5A 1RHHA 3VXNA 2K3TA 3GRUA 1J2RA 1IGCH 4M4RA 4KN9S 4YCSA 3K94A 3ZBMA 1YS1X 4V2UA 5IV2B 4LHWA 1TU4A 4NQED 1ZLUK 3CLHA 4F15B 4IEFA 1X7XB 2ESVB 3EFDH 4JFTA 4IH1A 4EUNA 2ZXQA 1FVCA 3BVVA 3UBGA 2VRCA 4KSBA 3WXMA 1PSKH 5INTA 3DEKA 4OAWA 1O6SB 1B3IA 1G20E 5KC8A 2ORVA 4APQC 1P5FA 1DV2A 4FZJA 1N5RA 4TS4A 4M0CA 5ETJA 1CHDA 1H3WM 1JPSH 3CVBA 4N3AA 1ZKAA 2DWEA 3NASA 4DQDA 4LXXA 2P3QA 3CF0A 1VLHA 1U21A 2XWJA 2KI5A 3G5YB 4JJKA 4A7GF 1D6NA 2N7AA 2WR8A 3CZCA 2WVVB 3NBMA 2AF4C 4N85A 2AJCA 3GNTA 3CUPA 2QMYA 4JOQA 5CT8A 3TBTB 3KXIA 3JYHA 2V1XA 4G9DA 3VPDA 1ZD8A 3W4IA 5ADPH 1FGNH 4GSLA 4YRGA 2I6SA 2UKDA 2XWQA 3U1QA 1BVNT 2ZPUA 1BQ4A 2JFYA 2VT3A 3QUXC 2PR4L 1AJ7H 4KBYA 2P6NA 1JDCA 2HK6A 2NTNA 3KPJA 2ZXFA 4LVEA 1XZFA 2I2AA 4MD5B 3IR5A 4FXTA 4TTIA 3ALXA 1KR2A 1XL1A 4ZREA 4XO8A 2IEZA 3O6FC 2H3NA 2ZVQX 1EUDB 1D9ZA 3E18A 3AQIA 4RLFA 2I78A 3L6CA 1UA6L 4IUBS 1CBJA 2AUTA 3OR7B 1H85A 5DSZA 1CDZA 1Z45A 3GOHA 4N2HA 2H4YA 3JD3A 2NVBA 4B3RB 4F58L 4ZTOL 2J48A 4KV5E 5DA4A 4KI5F 4G71B 4NBVA 3FN4A 1C8PA 4NQXA 1OP4A 2A84A 3VFRA 3D0AA 4GQZA 2FQXA 1SCNE 2QLFA 1DQVA 4CKXA 5BVHB 4FQQA 4MYTA 5BPHA 2A5JA 4MWFB 3KZ1E 4S1SL 3L1OL 2NY6D 3WP0A 1ZSDB 1G21E 4DKXA 2C7GA 3FMIA 1HX7A 3U48A 3IV9A 1G9HA 3L6EA 3ZYJA 4FEEA 5HCIA 1UD2A 2Q3EA 4GI2A 1JHTA 4B27A 4KUCD 4BIMA 2FUQA 3NZEA 5CNKA 5DMJB 1RI5A 2XTLA 1IKFH 4LE2A 3UAXA 5JPMA 5JNUA 4S0HA 3ZQ4A 5DUBA 2J8UE 4MHOA 5A2FA 3X1WA 5FKAA 3BZ4B 1JPVA 1UJBA 1WW3A 2B59B 4QARA 4RKFA 5A62A 1EZVY 1PZSA 2WKWA 3QMVA 2YARA 3UPUA 4B45A 5ABZA 3BT2L 1E8MA 2F8MA 2A4MA 4EVNB 5IIEB 1J7JA 2IF7A 1UH5A 4M0PA 2LTQC 5CRIA 5CEYA 4EENA 2COQA 3L3DA 1BHJA 1ZT7A 3GXOA 4QHYA 2IO5A 3OAZK 4IUCS 3LKSA 4IQHA 3ILXA 2WABA 4MAAA 3BP4A 2CUHA 3WMGA 4YRJA 3HJEA 3FHTA 1NLBL 3O1HB 1TYBE 3N9GH 2AX4A 3KP1A 1UZ8B 4GUDA 1KB5B 5KVEE 2XWZA 3KPRA 1FX0A 4RIRB 3NBYC 5CP8A 5B1AB 3DUFA 3AOGA 3SMQA 4MDIB 2HMWA 2ZJ6A 5DJ5A 1UZMA 4JJGA 4ZXPA 3T7RA 2ICAA 1DE4A 3I02A 4KREA 2XQJA 3DDZX 2Y5EA 2FWRA 5F89A 1C9MA 2XGMA 4CEJA 3G04B 3A1TA 4L3ED 4BP1A 2FJUB 3MGOB 4UASA 4CGUB 3NIFE 1MY7A 3PWJB 2J43A 3MCZA 3ZDEA 4DSAA 1YQGA 4M1OA 2HUHA 5JW4R 4NKIH 4J3OH 4V0LA 3OJOA 3THWB 5LGKA 4KXVA 4DABA 1YEKH 1BMTA 4TUJA 5FPSA 2VP0A 3O2DH 3FFBA 3MOBH 3L08A 4MB1A 2Q10A 2BOCA 5HDOA 2ADFA 2YDXA 3S44A 1MFZA 5LCXA 4F8YA 3SZOA 3VSCA 4AMBA 2PXYB 3WO3B 5CINL 4P5TD 1DDGA 2WJWA 1Y80A 3SF8B 5GS2D 5FUZH 1E1NA 1DRKA 4E46A 3RC1A 2FJGA 1C41A 5LBUA 3EPJA 1O94D 2ZSWB 1NANI 4AOFA 4LVHC 1R50A 3OJMB 3B9KB 3BIXA 2EEXA 2DQFB 1T0JB 3KS9A 4IKJA 3ZQ9A 4YNBA 5L3VA 2FEOA 5I1JL 1PCSA 4NNPL 4HVLA 1XFDA 1GN8A 1MIHA 1X5ZA 5JPNA 3BZDA 3N04A 1J0CA 1GTJ1 4D8PB 1MCBA 3PP3K 1X7ZB 2XRMA 5AKRA 3O8QB 1FNDA 5AJXA 5AJWA 1F1BA 3G7NA 4X91A 3DMRA 1Q7BA 4GEJA 1MVNA 5D1QE 2UX7A 3F2LA 1G16A 1ARZA 2XE8A 1Z0FA 4BNZA 3QEHA 5KNCH 3GKWH 4GLOA 2HCTA 1JLLA 4KRFA 1WTGT 1PQPA 1QQTA 4ANFA 2XTZA 4NCC2 2HY7A 1L7BA 2YD9A 2AYZA 2JKLA 3RS0A 1RUKL 3ZL4L 4DP0X 2ID5A 2BSSA 2PPLA 5EP1A 4MV4A 4DS3A 3WNIA 2OC4A 1OT4A 2DRIA 2CLVA 3C6LC 2QLJA 3OO1A 3L6FB 3OF6D 3LUBA 4R96B 1AURA 5EEHA 4KO3S 4MAZA 4B7CA 1VM6A 2BVPB 3KZCA 1Q9OA 1FLTX 3F85A 3V46A 3RYFA 3ZVMA 2C4TA 1RRFA 4Z2YA 4RGYA 3F97A 4Q18A 5IVXF 1NDGB 1E6WA 3EMKA 2NZ2A 4PJHB 3ATBA 2YV1A 1BHQ1 3DV9A 5K9JH 2WQUA 2DICA 4G9EA