2VDQB

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 130
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdqB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdqB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdqB03
1MQ8B 4DMUB 1U8CA 1QCYA 1T0PA 3GXBA 4MMYB 3BQMB 2WINI 3PPXA 3TVYA 1PCXA 4PN7A 1FE8A 1JEYB 2QTVA 5E6RA 4O3TB 3IJEA 3EG9A 3NIGB 3AL8B 2I6QA 2VDKB 1Q0PA 3EOBI 2NUTB 3HI6A 4NEHB 2ODQA 4HQKA 1SSLA 4JDUA 1JEQB 1RTKA 3FCSA 1M2VA 3EGDA 3EOAI 1L5GA 1RS0A 5E6UB 5LN1A 3PPYA 2UZYB 1U0OC 3BN3A 4HQOA 4C2BA 1ZOOA 3PPVA 1YVPA 1YUKA 4JX0A 4IHKA 4G1EB 4NENA 1JLMA 1XDDA 2IUEA 3QA3E 4M76B 4WK4B 3NIDB 4HQNA 1V7PC 1U0NA 1YVRA 1U8CB 1JV2A 5E6SB 3OKWA 1N9ZA 2NVOA 4A0QA 4MMZB 3HXOA 1QC5B 3NIFB 5KYWA 4K3JB 2ODPA 3TXAA 1MF7A 3IJEB 1AOXA 1OAKA 3ZDYB 1M1XB 1MQAA 2P28A 3F74A 3RAGA 5BV8A 5KYYB 2VDQB 1M2OA 1UEXC 3K71B 1M2VB 3EGDB 3ZDXB 4Z7OB 3K6SA 3OL2A 4MMXA 2ICAA 4CN9A 5KYUA 4UM8B 1RD4A 2NUTA 2NUPA 4O02A 3PPWA 4CNBA 1BHO1 5KYNA 4WJKB 2B2XA 1BHQ1 3EFOA 3IBSA 4BJ3A 4F1JA 4WK2B 3EH2A 4FX5A 4WK0B 3VI3B 1IJBA 1SHUX 5E6RB 1PD1A 1JEYA 1IJKA 1SHTX 3OKYB 2VDNB 4MMYA 3E2MA 4XW2A 3AL8A 4IXDA 2X5NA 1TYEB 2P26A 1MHPA 3NVQA 2VDPB 5KYYA 3V4VB 3K72B 1DZIA 3ZDZB 3ZQKA 3N2NA 4MMZA 1AUQA 2VDOB 2M32A 2ADFA 5KYXB 1N3YA 4O3UB 4FWWA 4Z7NB 1ATZA 1ZOPA 2XGGA 3F78A 1XUOA 5E6UA 4G1EA 4NENB 1SHYB 1JEQA 2XWJI 1MQ9A 3VI4B 3K71A 1MJNA 4HQFA 3T3MB 4G1MB 2VDMB 3EGXA 3TW0A 3EG9B 2VDRB 1LFAA 4UM9D 4MMXB 3ZE2B 1DGQA 5HJ2A 4Z7QB 4F1KA 5HDBB 3AFCA 3AL9A 3ZE0B 1M10A 1OLZA 5ES4B 3HXQA 1M1UA 1XDGA 3ZE1B 4UM9B 1SQ0A 1IDN1 1NA5A 1L5GB 2I6SA 4CN8A 1M1XA 1PD0A 1PT6A 3K72A 5KYUB 4WFQA 1QC5A 5KYWB 3T3PB 4O02B 3K6SB 3OL2B 3EH1A 3FCSB 3BQNB 5KYXA 3FCUB 4IGIA 4C29A 4C2AA 3V4PB 2VC2B 1T6BY 2O7NA 1JV2B 1CK4A 1IDOA 2WW8A 4HQLA 4GZ8A 1FNSA 3EFOB 5E6SA 2I91A 1AO3A 1RRKA 1ZONA 3Q3GE 3TCXB 1CQPA 2NUPB 4G1MA 3EGXB 2XWBF 3M6FA 2VDLB 5HGJA
chains in the Genus database with same CATH superfamily
1SA0A 5HJBA 3LXAA 1JSCA 3VO9A 2QZQA 1IOVA 2B5VA 1FTYA 1SCNE 2WJWA 2OXHA 3GMSA 3HJAA 2LV4A 4B75A 4D9CA 1N36B 2IQ5A 3QNZA 5I6XC 5A9SB 1BJTA 3DBRA 5IJXA 2OCLA 4DDWA 1E9AA 2P75A 1EFVA 5I0XA 3VNYA 4YXLH 4U3SB 1D1QA 3FQYA 1WICA 3MV11 3KJEA 2A6IB 2WTOA 2MINA 3K5WA 3N07A 3L3IA 1T0NB 3DP9A 5E03A 3QKSB 4JPVH 4ZMVA 2C82A 3P9MA 3WTYA 4G1UC 2VK4A 4EW6A 3I4FA 1HDEA 2LNDA 4JBHA 3AM3A 4OUKX 5CFAA 4XNMA 3M4JA 5EBWB 5FM5O 1YAHA 4HIIB 3DUSA 4CM4A 3RDTC 4K5MA 4QR7A 3VH2A 4JANB 2PTVA 5JADA 3X44A 3PHSA 3B1UA 1HGXA 3EH3B 1W35A 3KXKA 3RU8H 1G3QA 2HMYB 1BD3A 4W68A 5KQMA 4CKYA 1NBIA 2FH5B 3NAQA 3S81A 1UDRA 3RRMA 2I6TA 1AI1H 1UC5B 5HI5D 2GZHA 2Y1VA 3MTAA 3EJQA 3E48A 2WUWE 4WV3A 1XT6A 2X15A 1SQ0A 1NNSA 2X4UA 2A78A 2DMRA 2PTUA 2RHLA 1QRDA 2D1TA 3FLMA 3BT2L 4DBLE 3GF8A 4G8BA 4MARA 3NANA 4HS3A 3MBEB 3RZCD 5FO9A 3OSZA 1Z9NA 3CZMA 4EQ6B 5ID1B 2J0SA 3H6AA 3V5DA 5D2LF 2WZPA 1H0HA 4GW4B 4A0HA 1KBGH 3CDCA 2A2ZA 1WC7B 4ZNEA 2V59A 1QTYT 1BCSA 2WHEA 3M4ZA 4NRXB 3ACBA 4RGNE 3E2HC 2XQVA 2IYFA 4MVXA 4PLOB 3QDJA 2N7AA 2FW0A 1BDHA 1I9GA 3HXMA 1LDNA 3ZY3A 4G83A 4URVR 2NX5B 4OZGA 3UP6A 5D2NE 1QYXA 3JBG7 2QPLA 4EDHA 3LSOA 2R8YA 1PLCA 2WHVA 4AX3A 5T8IA 3A3OA 3DA0A 2DF3A 5T1DH 5ALHA 3C16C 2ZCVA 3DL2A 2JFBA 3FPCA 3SD2A 1T9CA 5ITSA 2H4YA 1BFOA 4TRPH 1HE3A 4ND5A 4IWXA 4XMXA 2QELA 2B7LA 1ZWKA 1HH6B 2J09A 1NPDA 3CZPA 3ENKA 1E8DA 3NGBC 3ZJVA 3LC1O 3EXEB 2R5NA 2ZSHA 1UAAA 1VECA 2N1MA 1J09A 2OK0H 5AVWB 4IZOA 5A9RA 4L8DB 1ZAYA 3DPDA 1Z7EA 5EXEA 4ZU1X 2NY2C 3FOMA 4WLEA 4LASL 5JSZB 5J06A 5J5EA 2CZNA 3SF8A 1U0RA 1UDWA 5D93C 2M6RA 3PFBA 1GPUA 3N75A 4C47A 1E1RA 3FTDA 2IE0A 1QP4A 4O58H 2KKQA 3M6FA 4MCYB 1IGYB 2ABWA 4J23A 2GDZA 4YV7A 2BSRA 5CP3A 2WINB 4I0KA 2L7QA 3NIGB 2VWHA 4HWGA 2XC8A 1ECGA 4NARA 4I3GA 3FCOA 3RVMA 4AAYA 4U6YB 4ZZ3A 1UADC 4EPTA 4P3CL 1Z5HA 1KHHA 4WN9B 1P29A 4LBZA 4DA0A 5D6CB 3PHBE 2GZMA 4N47A 5KX5B 4MP6A 4QOGA 4BB5A 4PONA 2AW3A 5TF0A 4NC9A 1JLLA 1YZHA 1I9IL 2QXYA 2ZCKL 3YASA 3HV2A 2QQQA 4JKKA 1AKJD 2OMYB 1UBJS 1PG7X 4OGQC 4PANA 1VLJA 3LL4A 4KJYA 5J23A 3B9KB 3Q6IA 1SXSA 4N5HX 3VH1A 4YOKA 4LK3A 2CKBH 2JJMA 2XV6B 5LQSA 3DO4A 3PGMA 5LLIC 2ZXFA 2DHCA 2I1QA 4LU5L 1NW3A 2I33A 4MB2A 4U1IB 4BASA 1CP3A 2DX7A 2XUFA 5K6TA 2R2GA 4LGMA 4HEHA 3NWEA 3VGAB 3AK4A 1TC2A 3PD1A 5IVKA 1Z5YD 4I8IA 3AT0A 2ZRFA 3N5KA 1KBVA 4LSWA 4L22A 3PGDA 3NACL 5I9NA 4HLNA 4EABA 1C5BL 3U37A 1GCOA 3R0IA 3RX8A 1TKAA 2XD4A 3KXFA 4C1NA 1N59B 3PPEA 5C8XA 5PNTA 1E2IA 1TK3A 3BFJA 1FH2A 5A6IA 3CDZA 4IDGA 3SIKA 4PJCF 3IHKA 3QA3E 1QZ3A 2I25N 1KBKA 2AJXL 1U0EA 2VZ1A 2NY0D 2OO7A 2HYIC 1N18A 3NIWA 4Z8XA 4JL8A 2B1HH 2ATXA 1Q0QA 3LUAA 5C9JB 2FPIA 3EA5A 5ER6A 2IF0A 3BWZA 4AM0B 2WU4A 1GXEA 4YAOA 5F0PB 1CD8A 1GW6A 5CEZD 2EWWA 3ZI7A 3C5ZB 2H8PA 2JKVA 5KVGH 3D1LA 2ETWA 5DHFA 1CLCA 4TNWF 2TMKA 4MRVA 4H8HA 5MN5A 1EU1A 3ENZA 4XM2A 2J5RA 3IDNB 4I77H 5CUSH 3SEFA 1QV6A 5AWNH 4ZPJA 5AW3A 5HFNA 1L5VA 3D6VA 1CVRA 4R84A 3DHNA 3OIFA 1Z0SA 4ZZ0A 2DM6A 4H20H 3THSA 2V6BA 3FOEC 2LE9A 1A6PA 4BNGA 4V0LA 5AVRA 1NHWA 2IBMA 4WU5A 1XCQB 1OR8A 3CXRA 1SXQA 4J6EA 4MHHI 1KTVA 3FUKA 4U9UA 5BO0D 4L4JA 1GV1A 2Q62A 4CJ1A 3MTEA 2GUOA 1W36C 1FH5L 1WVMA 3WLPA 3UG3A 5AKVA 1EX9A 2EUXA 4U6SA 1NFDF 1OAXL 4I6GA 3IR5A 1IHYA 4JFRA 3GRUA 1M7GA 5DQDL 4IHJA 2JJSC 2F54E 5BV2P 3RG2A 4OD3H 2G60L 2W0PA 3F6YA 1CY4A 5DHTA 2YJ3A 3HMQA 1DBWA 3MV7A 3WQRA 4PH8A 4OKVA 4CGTA 4WZZA 3EJSA 1S6YA 2WKWA 1W5AA 3SC2A 3K3QA 4CKEB 1Q57A 2CUHA 1PEZA 5CNKA 2D62A 5I2IA 4TMFA 2QT9A 4CV0A 1CJCA 2YRBA 3IPFA 3QEUA 5BWBA 4O00A 3GHEL 4JGMA 4LG1A 1RI4A 3K8ZA 4ONFL 1VBMA 2R8PA 1AZZC 2VW6A 4HIEB 3DX0A 5A2FA 4IR7A 1D5XB 4X20B 2AAVA 2MHAA 5E23A 4BTEA 4P83A 1W16A 5BV7B 4XMLL 3SQOL 4PJ8D 5GGSA 2OGZA 2X3FA 1F4XL 3IJYA 1SHSA 1SMDA 1J49A 4OJCA 3M1YA 4JM2C 1OM3H 4D3ZA 3M1IA 3TD9A 2ZGVA 4TUUA 1XKXA 3HXPA 3VWKC 4BFFA 3GA7A 2HBYA 4RF2A 2BSSA 3RL1B 1VYTA 3HN8A 4XUEA 1YY9D 1P7WA 1B6GA 1DBPA 4YMHA 5DSXA 1BAWA 1CLYH 1JKFA 2W8BB 3JT0A 7YASA 4AYFB 1KBPA 3EOTH 1W5EA 3QKSA 4HEQA 2LGNA 3PJSB 2X5KO 2VDPH 2C04A 3GLSA 2IBGA 2NX2A 3FDXA 4H8PA 3Q0HA 4NPJA 3V8CA 1CB4A 3A6EA 5CJ8A 5EHZA 3DE1X 3MNZB 3RI3A 4L29B 4AG4H 2G67A 3CVHB 3NC0C 2Q8NA 4V3CA 1A3RH 4I1IA 5BW5A 2MSEB 5A5EA 5C0BD 1DZ3A 3A9RA 2Q2EB 2BFDB 1VMEA 4TTTS 4BWFB 2OHVA 4KKCD 3HRPA 1QHYA 1A47A 3FB5B 2IZ1A 1GA1A 2ESVD 5FYLL 2P9GA 5T5FA 4IDCA 1B2WL 4IZ6A 1J8DA 1ASPA 4RZ3A 5DK2B 2ZPKH 3S88L 3MRDA 2ADIB 1TTAA 4L0PB 4W9ZA 3PJSA 2QQNL 2FX2A 3A6JA 4K07A 3E53A 5BXFB 3T4AC 2ZPKL 1PT5A 3D4IA 3K0HA 3HE7C 1PZ2A 4QFMA 1EJOL 3JQ9C 4QBHA 3I4CA 3DIFA 1NA8A 5MEOB 2ESVE 4WHTB 5DYFA 5EU4B 1O1YA 2JKIS 5GS0C 2V9UA 4JRFA 4RZ2A 1E6WA 1IPHA 2Z93B 4MEBA 1QBLH 3RB7A 1HYGA 4YGXB 2D54A 1ZVJA 3OU6A 1TT5B 3CKKA 4Z0BH 3V7WA 3N8IA 4EG7A 2EGUA 4XQCA 2D2CC 3MC1A 1VEMA 1YA6A 3QJHA 4FOMA 3KYNB 3O4OC 1GAWA 4IKKA 1PFQA 2PL3A 3WL9B 5IAEA 4BN5A 4JCCA 5FW7A 4TTAA 3CF4G 2V8BA 1L9RA 2YK1L 1J9EA 3K6FA 4HUVA 1I8AA 5HIAA 1TZ2A 2QW8A 4OIMA 5L4MA 1UFKA 2DRUA 4A6DA 4E9LA 3R3JA 1PFOA 2FJFB 1E1RD 4P33A 4C29A 4IILA 1V25A 4MLZA 4NQCA 5AFAA 2HX9A 3ASNB 4ZYVA 1M8FA 2Z2YA 4MQSB 1PIWA 3QEMB 4FE9A 2QS9A 4GU5A 4PVNA 4ZXBD 2GM3A 2P65A 5CHNA 4B35A 1MOEA 4PU2A 1SO8A 5DUJA 2J0UA 1JVBA 3BWSA 1UK9A 4BNWA 3H1FA 4URFA 2OMVB 5DNDA 4K0KB 1S1CA 2CCKA 4MA3A 5B2EA 4L08A 4NR0A 3UJNA 3F5DA 3BF8A 1YNLL 1MIEL 1JDPA 1F0KA 1TM7E 3EY4A 1KF0A 3ESXA 2DM2A 3AB7A 2DETA 3PXCX 2ZG6A 1ZICA 3I9MA 3TWOA 4ARSA 3L3JB 3FFWA 3L5HA 5E4AA 5KSAC 3W3AA 2ONCA 1AE1A 3X0DA 4O4HB 1CUDA 3ML9A 5GJCA 3V8MA 3ZHNA 5IMMA 4Q19A 3VU9A 4GXQA 5I18L 4BH8A 5E9DE 1TZIB 2VDPB 5FO8B 4OP1A 3TZLA 4ERNA 3HFGA 3I9V6 2QNRA 1ESMA 4D79A 1RXSA 4AYSA 4P4TA 1P7QD 2B5IC 3MO1B 1FFRA 4DR5B 4NAMA 1ACYH 3SZ3A 4YCDA 3ABKB 4URWR 1X7WA 3HM2A 2I9LB 2YPLA 5E9QA 4L1BA 1N2EA 4PGHA 2P9YA 1SOSA 1F8TH 1CJBA 4O9HH 2X1HA 4JI0B 4DN3H 1JDCA 2HBZA 2G4GA 4BOYA 2FZEA 5LQAA 4RLQA 4QMEA 4WZ9A 4KYUA 1LD3A 1R5IB 3G5UA 2X5PA 4AN1A 1U6AL 2XWDA 1JG7A 3HG1E 4M6OH 4YXFA 4INOA 4U6XB 4XMVA 1OTUD 4LGPB 5D85A 4PV9B 1TD1A 4ZAYA 2GQHA 1ZUIA 3NCCB 2KERA 3K4QA 4TS6A 4YSQA 4FABL 1P1IA 2O0HA 2CK2A 5IC5A 4KI5E 2OXEA 1XMXA 15C8H 1U8HB 4KH1A 3VX3A 3U48A 1OAUL 2RI1A 2VBFA 3LXXA 4KPGA 3VQMA 5JLZA 5AW2B 1OANA 2QYOA 3ZUPA 3E22A 5G5DA 3NJJA 3SOBL 2VDKL 3EHBD 4AJPA 4I0PB 1GEEA 2GTZA 1LE9B 1KN4L 1XLTA 4XARA 4BJ3A 4G0XA 2WAYA 2DH3A 1XTMA 4YDKH 4HEPA 1DCFA 1UWVA 1NFFA 1RZRA 3LNEA 4WV1B 1RM3A 4HUQB 1O75A 2YRLA 3BP7B 2EZ0D 3SCMC 5I15H 1MHEB 3SE9L 3O81A 1VEOA 3DTVD 4BMCA 4HRXA 3VR4H 1YO4A 2HIGA 1G5IA 1DJMA 4MTMA 3R75A 2NTFB 4WASA 4MA8H 4LXXA 5HKBA 3AL9A 5F1IB 1XGTA 2QVLA 2ZIGA 2OYMA 3OE7D 3IMFA 4UPVA 2FJGB 2WQXA 2NVUA 1L0QA 3ZZQA 3GVPA 2N47A 3V95A 2E7LA 3K73O 2XYBA 3VZQA 3K30A 2JKZA 1LP9E 4R3WA 1HE4A 4OM0L 3ROZA 2OMWA 1JT9A 3HZVB 4P5RA 1XALA 3COZA 5IB1B 1CRWG 1JK9A 2F2TA 1J12A 1I1YA 3KJQA 4LDRA 4DO5A 4KWUA 3AZUA 1AGFA 1JSRA 1HK7A 2JLUA 4IOFD 3REWB 1BQHG 5KHLB 4QKXB 4L2IA 3BWAA 4M1DH 4WFKA 3W5HA 3HOGA 4AUUA 2AZMA 4O1HA 1BQKA 4X6YA 3KR9A 1EJ8A 4BE9A 2HZ7A 3DJRA 4H0CA 1SCDA 3SY6A 5I01A 4L6CA 1HWHB 2I9TA 1SY6A 1HDZA 2JWYA 1XD9A 4KXYA 4K6HA 5A2GA 1U8KB 2W88A 2OJ1A 4OJAA 3EVBA 1RLWA 2R96A 4BVGA 2ZJ1A 1A4AA 1HE2A 5H02A 4Q4AA 5KTTA 5IOPB 1LWOA 1DAPA 4ZCPA 2H4FA 5HHVL 1N7JA 3MRJB 4YGVA 2BP8A 5CD5C 4OI9A 5K9QG 2VO8A 4M48L 3DHEA 2AGJL 1WFTA 4Q74A 5IAAA 3A0UA 4DZ8A 4NO0B 2I2BA 1CZRA 5DD3H 3WTTA 2R5FA 4KMTH 1CFVL 2FEJA 4FYVA 2WQ7A 3DOEA 2XZTA 4QAQA 1GPLA 1J00A 2AJVH 1Q9KA 2P79A 3V3KA 1JN0A 3D0OA 2ZWYA 2UZIH 4YGYA 3UKJA 3FMFA 1FGNH 1REQA 1ODJA 1IM9B 4L9AA 3CVIH 1NMBH 2IFGA 1IBYA 3ZRSA 1C0KA 1XAKA 7REQB 5JW3H 5DEGB 1WB9A 3ZHKA 1QJ4A 1XTQA 4QHUB 3QZPA 2ITDA 3UUWA 4N0UA 3GZKA 2O5RA 4V2IA 4ZV9A 1SJEB 2E9IA 4ONGH 3CLWA 3LNCA 1T3FB 1UCBL 2CHNA 4JE4B 3FQRB 2XMPA 4N20A 1FVHA 2BFDA 2AJ3A 2V96A 1WCIA 2XX3A 2ZUQC 4MUEA 2IPKB 1KEKA 4UD6A 3LB6D 2FFJA 4NZTH 3K1YA 2FF5A 2B78A 2AF3C 3HJ0A 5ELIA 5AB2A 3SGJC 3FTEA 4P34A 5AENA 2IF7A 1ZD5A 1H15A 1UBCA 3TRJA 1XTVA 3EVCA 2ZJ5A 1QV7A 3O8OB 5M2QA 2CLZB 2HG5A 5KSAD 3HB3D 3IVXA 2JK5A 1VEPA 2ZIWB 4PC1A 3SZMA 3BTVA 2Z91B 4LPWA 4LZPA 1KYWA 1ZY2A 1V5IA 3G04A 4YHPB 2B9EA 2EE2A 2UYCA 1FHGA 4D0DB 4UE6A 2DB3A 2QSVA 3KRTA 4P9HH 1JU4A 4GIBA 4LV5B 2UVFA 4JRYA 4IFEA 1LSSA 5BS0D 2WT9A 2XX0A 3L4SO 3TB6A 2FKAA 2R6ZA 2H2GA 1LQ2A 4BNIA 1W8OA 1JHPA 1UOPA 3CCHA 2B8TA 1ITZA 3PE6A 4E07A 1YB7A 3C4JA 2RFXB 2CLLB 1KAOA 1H69A 2G4EA 1QONA 3VFGH 3E7WA 1QR4A 3Q3GA 1X5GA 2QZSA 2BCKB 1C14A 2PT9A 1A69A 3E0QA 2P2NA 3GPDG 4FG2A 1X74A 4X3PA 5AOZA 3IMGA 4FHZA 5EU3B 4RK6A 5HFJA 4WO4C 1JH9A 4W5WA 1M5RA 4MVJI 3OVUB 1J23A 1UT9A 4EBFA 2QM0A 3BGDA 3QIBB 3B6KA 4O2BA 3PJGA 3TB4A 1H23A 4P08A 1JYFA 1VPWA 2W91A 1J5IA 2AK4B 3NRFA 3H16A 2DBZA 5IQ9B 2XPZA 3BERA 2YNMA 2FK7A 3I64A 5DN6A 4RDQG 4KTEH 3G8BA 5CXXA 4U8HA 5CB6A 3SJUA 3BWDD 4M1DL 2WM2A 3G59A 3U3KA 4E9QA 4NUPA 8ADHA 3IKCA 3FONA 2NQ8A 2QYSA 5F44A 2NY6C 4Q14A 4GKAA 4WI3A 4N2LA 1KEMH 5EJ4A 1YQUA 3DBSA 4E46A 1OT2A 4LQ1A 4QXTA 4IRZH 3JVIA 4OLYH 5B58C 2A1WL 3HA2A 2VBCA 2J33A 1LEKB 4GGOA 3ET4A 1PNCA 4FEMA 3FDIA 5GZND 1KTLA 4R7VA 4EAEA 3MC0A 1JVNA 3GDBA 3RCBA 1X5YA 2BFEB 4M1MA 5LLTA 4K46A 1L8LA 4PG9A 5IHWA 2DBYA 5AK0A 3WB0A 3SN6N 5ID0A 1CVSC 3G9XA 2C9PA 2HA2A 3KYMB 3A2LA 3CK0H 2VCHA 3KGTA 5CN1A 1C7JA 2VLJD 5JPNC 4EUEA 1EO5A 4Y8AA 4LX0A 1V3JA 3KE0A 5AD0A 5I1JH 1N10A 3IP5A 1A8QA 1J1XH 5A16B 5LAXA 3EF0A 4WKNA 4LXTA 2CUTA 1F17A 4YPJA 2DWEA 2Z8XA 1TVKA 1EM8B 5LKAA 4QHPA 3JWNG 2ANBA 4K2UL 3FNEA 3MZGB 2NU6A 4E68A 3W5AA 4UM7A 2F9LA 4P2RA 3TJPA 4F7EA 6FABL 3R06A 3VO0A 1XXLA 3VR3A 3P02A 4X7DC 3W90A 3JV4A 4IMKA 1WHTA 2WB1A 3ZH2A 4HT3B 5HP5A 4B2IA 1XZAA 4L37A 1NLUA 2BTOA 1A14L 2D5AA 5AQ1A 4H6VA 3U44B 3MLYH 1T5WA 2J20A 3FWYA 2UUCB 4OFVA 1PLBA 1UGKA 2FN3A 1H5QA 4KHZA 4NRDA 4Z7QB 4HNAA 4AMZA 4C4BA 1RTTA 3MRIB 4JB3A 3SY8A 1G5AA 1U2CA 4LOAA 3DT6A 3GPCA 4P3YA 3S5ZA 4K3VA 4F9LA 1TX4B 2NYZA 1RL1A 2RGUA 3D33A 3DIVA 3AITA 3MGGA 4PTUA 2E0PA 5K3AA 3RW9A 3WA7A 3QLJA 4HFRA 1XJQA 2VH1A 1U2YA 1JTPA 5FLEX 2WTUA 4GKSB 4OA5A 4UUNA 1I53A 1M9SA 4GIOA 3JXAA 2AZTA 3JVGA 4H7IA 4P3CH 4XCEA 1YUMA 3CEJA 4D0CB 2WMPB 2GUWA 5AHXA 2WVJA 2XKJE 1UWGH 4RPGA 3HMXL 4LKXB 4XN7A 2WP0A 1HNZB 4OLWL 2WAHA 4KZCA 3F7YB 5E0FA 1HEUA 4KH9A 1K8RA 2C9RA 1E4XL 2WC7A 5I19L 1YN6B 4FXGB 3PV7A 3SDCC 4KOAA 2WLYA 4NU0A 4JDZB 1CB0A 2P5UA 1SK8A 5MEQA 2IPUG 1E2NA 5I75C 5HSFA 2QD3A 4R26L 3N8HA 4MZ3A 4LF5B 3F04A 4LSVL 1SUWA 4OIFA 1CDGA 3QZNA 4EUPA 3CR7A 1QKZL 4N8EA 5BVGB 1Z6TA 4K5QA 5E4JA 1IRIA 4PBTA 3WN5B 2PWEA 3A9VA 5TARA 3X3FH 1KXTA 2QJFA 3R3WA 5I1AA 3VVCA 2X0WA 4WF7A 2F43A 4Q6IB 1JHVA 5HYJE 3I9JA 2PSJA 1VCOA 4JELA 3Q3GB 4UC0A 3VV3A 1N5KA 3M82A 2Y7NA 2O8DA 2QN8A 3NCJH 3D2CA 4FNRA 2VWEC 3V7MA 5FOSA 2GCIA 4WJG3 5MEQB 3WFJA 4UPDA 4IGBD 4LCVA 5FWRA 2ZT9C 1FNSA 5HDLA 2YQZA 3MGTA 4PWGA 3HE6C 5C08E 2XBMA 2CVQA 1CBVH 1DLJA 1SXBA 2EJCA 3WHXA 2OLKA 2J9GA 1KZHA 4CLDA 3IB3A 5IZCA 2R1XA 4PVDA 3NP7A 4JUSA 2RHMA 4RNRA 4FUQA 3EZ2A 4FFDA 5I51A 3OF2A 1RS0A 3STZA 4MJIE 4NPYA 2ZIUB 2DQFA 4KLRA 2ADYA 4IBQA 2WN3A 4WENB 4E1AA 3AI2A 1PZ5A 1EVJA 4CE6A 4HS6A 2Z7WA 2L19A 1KZ7B 4XFDA 3K8QA 2KMWA 2FR0A 2PS9A 4K7JA 3HRKA 2BMEA 2BFGA 1NUQA 4MMXA 1NEZG 3H3BC 1IHOA 4RVBA 3CW2A 3GSXA 1IY2A 3WWZA 5ICEA 4NBNA 3BFXA 2OUIA 2DB8A 3BUQA 2YXVA 4CDNA 2L8AA 1R0CA 2YCBA 4D9LH 4P6VF 1GR7A 4G9GA 3DL4A 1VRSA 1ZA1A 1EERB 3QI9A 4C7OA 4QBKA 4XJTA 1BC5A 5TMPA 1ZV2A 5T1DL 4QHUA 2RIRA 1NVBA 3HU1A 4PHXA 4C8XA 3GI1A 3S5YA 2HSZA 1XEDA 3WIIL 4LJYA 3ZD6A 1BFSA 1HIML 4YK4C 1E64A 2VLKA 2Q6WB 3PNKA 4I14A 1X5AA 4B2PA 4E9XA 4GW1B 1TCAA 1GDDA 4EZBA 4MQXC 3SQNA 5FWXA 5K6RA 2YMPA 1DQIA 2FGWH 1VIVA 2C2BA 1L4HA 5K0CA 2LFGA 2R1TB 4WUUD 1KTKE 2Q10A 1FYDA 5I1HH 4DMUB 2OV8A 3SGKC 1M33A 3MLZH 4PP1D 3IDNA 1CGWA 4FYSA 5DTFA 3IPYA 2ONYA 3EOBI 5CFNA 1E43A 3HW7A 4HWEH 4GG6F 5FK9B 4FA8A 3W9EB 5EWLB 5IESH 2VRQA 4OF0A 2GJKA 4R7NB 5KVDH 3ROPA 3HHMA 3WLTA 4L5JA 3OLVA 3I34X 5BUAA 3WQHA 1EK2A 2P2ZA 2QLNA 3RYHB 4BKLA 5D7IF 1RZFH 3RTEA 3AG5A 3GIVA 1LV7A 1H6TA 2C4UA 2G9QA 1PYOA 2VYNA 3ETNA 3QE9Y 3OHPA 3AJRA 2EYTB 1JSYA 3QUML 1WAAA 3V32A 4UNIA 3BKYH 3SDXE 4OCXL 3ISVA 2XEXA 3BCHA 5AKJA 4ARUA 1BYOA 3AHCA 5JZVA 4TSCH 4CL8A 3RU8L 4J0CA 4R90L 4NBVA 1WC7A 3PD0A 1OP3K 3NSCA 2Y1ZA 4DP0X 3CTMA 4BX2A 2IS4A 1W36B 2W6PA 3OTTA 3PGFL 3D5TA 1JQKA 4BKTC 5GADl 1HXKA 5D7SL 2VPTA 4KGZA 3H8NA 1O6BA 1A5FL 3HVRA 4FQCL 2H32B 2QXTA 1N5OX 1E0AA 3SPCA 3W1EA 2VKQA 3OF6D 3T3HA 3WE1A 3HKBB 4KI0A 4WDIA 1YLBB 3VFTB 4TYPA 4ZOCA 3HO8A 2A0WA 2LWIA 2FZGA 1A9QA 2QV2A 4MYHA 5MFPA 4QU0A 4XVTL 2ICCA 1BECA 4LJ7A 4L74A 3KCPA 3IETA 2QP4A 4B3HA 4JU8A 1QABA 4HGWA 1IBFA 1QGZA 3TVYA 5I1LA 5F7FA 3F7TA 2CLRB 1VLQA 1TOXA 2PZBA 3L3IB 1YI1A 2UYHA 3AERA 4ER5A 5SWQA 2OMZB 2DUJA 5KDDA 3PWNB 3X2SA 3L01A 3I53A 4PGZA 3AG2B 1STOA 5EOQH 4GPBA 3MBED 3ZVKA 1QA9B 2J56A 1LNSA 4YRIA 3TLAA 2PXAA 4U6VH 4KH0A 4DV3B 3KPSE 4MD4B 3DD1A 1LBTA 2ZRLA 1K6JA 4EB3A 3EXG2 1ZRUA 3QJQB 3L5XL 4XXDB 1VHQA 4KNSA 2Z08A 3NQIA 4JM2D 1XB8A 5TQ0H 4UUAA 1NVGA 1GRWA 2BSBA 1OI3A 1UZ8A 3QJ5A 4EHLA 1Y3HA 3H6JA 3O6FA 3TW8B 2H65A 4JV5B 1TO6A 2AS0A 1QPZA 2PABA 2YBGA 1S6NA 4K94C 4M88A 5JO9A 3UMTA 3T3MF 2X1XR 2OCPA 4WNIA 1SKMA 3RS8A 4J0KA 1X4XA 4BLQA 4RJ2A 3EMVA 4FFYA 5DT2A 4KI7A 1GHFH 1PX8A 5JW5B 2B1AH 3WIDA 3AMVA 3HDGA 3C09C 1FAIH 4RDHA 1CK4A 2ARWA 3HJTA 3T4UA 5AVWA 1B0UA 5CKAA 3ZYJA 4YC7A 3KUXA 3U1BA 3EYOB 4FLQA 1J8KA 3EGCA 3WYNA 1FNLA 1LNUA 1WK0A 3OHXB 2V6IA 4FFRA 1JVSA 5IW1A 3NRCA 4LRUA 1GKUB 4WI9A 3FFTA 4R2WA 2Z92A 4PJ9D 4L57A 1I6KA 4OCWH 4JB9L 1JZEA 4WJ5A 1HZJA 4MA1C 3NH6A 3K70B 4KJYB 2EBHX 3ZGVA 3AEQA 5K3SA 1E2BA 2NNAA 1CRZA 1FNEA 1M54A 1IJ9A 4QOKE 4UNTA 4TN1A 3ZU5A 3IDJA 3SCMD 2Y3AA 4HUXA 4FGWA 3AR3A 4OQ4A 3ICWA 1GOFA 5HR5A 4C5CA 2H9YA 4BFGA 4NS4A 3LLSA 5EGSA 4HDRA 3EH2A 3C7KA 2GJ9A 4Y9CA 1PD1A 2P5EA 3IJ8A 1T5HX 1MGOA 1BKYA 2JI9A 3P2MA 4CODB 3K9NA 5C34B 1MHTA 1HLPA 2WBLC 3IAS6 5D3MA 4H7HA 3FROA 2ZSWA 1H5BA 4JRXE 5BV7C 4NN5C 2VP6A 2M98A 3FQ2A 3ZIAD 3GRRA 5IT5A 3NJ4A 2FH8A 1A1VA 1TQHA 2VLME 4XCCL 1ZC4A 1ETA1 1U8OB 1ZMYA 3U6XS 1QTSA 4Z4IA 3GZJA 1O95D 2GI4A 4GKJB 1Y1UA 3KSDO 2AG6A 4PPNA 3HR4A 4I4NA 3K9BA 4E22A 1VL8A 1XV5A 5DEFA 4MHHG 4KU4A 1J1OH 3QAZB 5CDTA 3AMLA 2QSYA 1GTNA 2XG5A 2LFEA 4D9QD 3QXCA 4YE4L 3EO0A 4IDEA 3SNHA 1GGVA 2PWPA 1H5BB 3EOAB 1LDPH 4W1RA 3B36A 5CFRA 2HA7A 4CDRA 2D0GA 4PVBA 3VH8G 1P8JA 3ABGA 3I3EA 2DYPD 5FM5M 4H8WC 1K66A 1PFYA 1KGJA 3H9BA 2JFVA 3JAWA 3VTKA 1NJ9B 4MLPA 3VC2A 5KQGA 4V0QA 2OBLA 1TAUA 3NS7A 3MA7B 3DVNB 1FPTL 1XGRA 3E61A 1URLA 3ASVA 2DIBA 4XAKE 1W1WA 2Z0UA 2BOVA 3LP6A 1GAQA 3LUJA 3RGVB 4O02A 4YAUA 3GMOA 2O8CA 1TIKA 3NTXA 1E1KA 1G4MA 4LXYA 3SQBB 2HTEA 5IULC 5GRVL 2EIXA 3ESMA 3PS6A 2F55A 2NSYA 3BSZH 4Q7LA 4L51A 4DVRL 4R8MA 1J9TA 2ZRBA 5I74B 1YD7A 5HILA 4DWHA 4C0XA 4DOHB 3HNVL 4HJJL 2WEKA 2BVPA 5HHMD 1OARL 5CITA 2BKEA 4OD0A 4K8RB 2OSBA 3OX3A 1MVUB 1Z2CA 4YSTA 3E70C 2OTWA 1XTRA 3CKLA 3FCSB 4WEOA 4D8PA 4MGEA 3VPCA 4Z7AA 2R7AA 4RVFA 2JWHA 4RESA 2J30A 1GS8A 4JFYB 4R6WA 1E5QA 5FA8A 3L4UA 4S24A 2WKQA 1PG7H 2NT0A 3UM9A 3L9BA 4JYPA 1YONA 4V1DD 2WXLA 4IDNA 2H2IA 2EYSB 3B5HA 1YYCA 3ATBA 4EI9A 2R27A 3FY4A 3WFCL 2Y6VA 2NT3A 2D3LA 1P2CA 4P9MH 4QXTB 2FH6A 1US8A 4JUIA 4F93B 1GT6A 5K8CA 3M5DA 4UAOB 5K1VA 2WXNA 2Q3EA 4RA9A 2W2KB 5KHAA 1P9LA 1P6WA 3FBGA 1RK0B 3DJFA 3AHJA 4AJWA 2HFKA 5KQLA 1OAKL 4HPJB 3OFVA 4FXTA 3NA9H 4FFNA 4N3AA 1DJYA 5JAOA 1PKQE 2NY0B 1L4NA 1FJXA 4GBED 1M4KA 1CY1A 2O14A 5EZPA 2AB0A 4PGDB 1HHKA 3HC7A 1YZNA 2OO5C 3MILA 4K3HA 4UEQA 2IBSA 4DIBA 2VH2A 3EXHA 3HCPA 4BQEA 3S44A 1K85A 2P80A 1GPDG 1YJDL 1KK0A 4E5XA 3RV4A 1XCJA 2EFEB 3IPLA 3OWHA 2HCTA 4N8SA 2I6SA 2AANA 2UZXB 2FX8L 4P3WA 3NGLA 5K3DA 2WU8A 2FEWB 1F90L 4JLRA 1A2YB 4IW3B 3EFDH 5F9DC 3FXIC 4GDMA 4XMPL 3DSFH 4H3VA 3O2WH 2O48X 5GRZA 3VC1A 1A3QA 3T77A 1WE5A 2LABA 5I1GL 3OM0A 3RVOA 3NEAA 2D1QA 3BMOA 5EN2B 1IXKA 3NCHA 5AW2A 1NBVL 3C74A 2FATH 3IUSA 3OT1B 1A2OA 2AI3A 3W9YA 2OW7A 4YDJA 1V11B 5K9KA 4D9EA 3JU3A 4BNZA 4P2OC 1SBQA 1OXTA 2ZSKA 4KVFA 3EYFA 1FF9A 4BKQA 3UH1A 2H4EA 2DI8A 3C1TA 3LCJA 1DN2A 3WXWH 4D97A 4WNYA 1SBTA 4JLRB 5BNXD 1EQWA 5IXYA 3V7YA 1A8ZA 2E5EA 4M6ML 5F7LB 3H97A 2G70A 4MW5A 1WTAA 1R0YA 5E8EA 4AMBA 3PXEA 4LLUB 4EHBA 4PIVA 2VKWA 1LWHA 1CU4H 2OQJB 4B3TB 3A1DA 1VE9A 1BLNB 1JXOA 1KB5H 2DQHL 5HM8A 3WFBH 4R2JA 5EU4A 1ZHHA 5IJKA 1MCDA 3MLEA 4Q9CA 3CH4B 1K8QA 1USIA 1DE0A 1K4KA 2XRMA 4N6GA 4DLXA 4II7A 5FCUH 3UZVA 5HS4A 3LX5A 5LR6A 5K1JA 2PKYX 1NCBL 2BVYA 2C8LA 4L73A 2OULB 3CV5A 2EEXA 4U6HB 3LWDA 4PXAA 4M02A 4Q66C 4MQXD 2JB5L 1W8IA 1Z83A 2M6LA 5FYKU 4KMLB 2XNDD 2GYSA 2JIZD 3OXRB 1PSDA 4Y1RA 3NPSB 1F48A 2G0LA 3WLQA 3QLUA 4Z9XA 1E9RA 5ARBA 1Q91A 2Y9PB 3GWGA 3SC3A 1UXIA 3NJVA 1ZLUK 3SG0A 1TZHB 1LJUA 3PXXA 1I3VA 5IEHA 3D0LB 5GSVA 4P2AA 2YRFA 5KSBA 2BZGA 2YR0A 3UPTA 2B3DA 4ZXBB 5LNGA 5DX1A 3K2KA 3TTYA 2WHYA 3STVA 3VDMA 2VSKB 4JK0D 2X5JO 4CKCA 3A1UA 5TE6L 1EXNA 1HR0B 2OTWB 3SICE 2NO5A 2FEOA 2DT8A 4BNKA 5EA2A 3FTGA 4DNFA 3ZI4A 4KQ4H 3HKDB 1KXQA 3U4EB 3AHGA 1KYYA 1YRHA 2P42B 3D6TB 4GUQA 2G6TA 4QCIB 4YCBA 4HPOL 1HOXA 1P2DA 3KUKA 2PUTA 3E5RA 2RGRA 2F19H 4RFEB 3R7QA 4FHJA 5FH9A 4Y0VA 2LD4A 2ZZKA 1RE0A 2N1BA 3WIBA 3DLHA 4OZFH 1K2DA 4BO0A 1AV7A 3AF3A 2NV2B 4IMKC 5JIKA 4TKUB 3MGCA 1WZEA 5I7SA 2F61A 2PW2A 3MYJB 3DI2B 3R5JA 3H4MA 3B2NA 3OIVA 4AJLA 4XDHA 1C7QA 4F3KA 2MYPA 4ENUA 3LUGA 5F7UA 1U2ZA 5EDSA 5F51A 4BFSA 1S5IL 3MS4A 2HSWA 2XVKA 3F96A 1T5XA 4MJIA 4B8YA 3FQRA 1Q7RA 1JYVA 2MTBA 1OI7A 3FF4A 4X9BA 1XJCA 3O4HA 1XNGA 2PLRA 3WQQA 3RSOA 3GNML 3EVAA 1KCLA 1BN7A 1R6AA 1L1RA 3IAGC 1U5AA 3K5RA 5IABA 4KX7A 3NDZE 2QT0A 3IM1A 3D3VA 1QFUH 4N5NA 1P4JA 4AIZA 4BFEA 2GBVA 2J8OA 4UAVA 3EASA 1R0LA 3QSKB 2YOHA 4QLAA 3W2DL 2C5SA 1PW5A 4RXUA 1DEKA 1G9NC 2YRWA 3LQKA 3RRFA 2AEJA 3C60D 2DHEA 3V9AA 3HCRA 1ZUNA 4K71B 2A5JA 2NPFA 4BSWB 4E32A 2G5BA 3BDYL 1MTOA 4BGLA 4MRNA 5D93B 1Z36A 4PR5A 2FR4A 4LE1A 3I1IA 1TCBA 3FZGA 2JGLA 4H7VA 1MABA 1BZYA 3V0WL 4OAPA 5B7PA 1ZAGA 3IDJB 2FFBA 1DUYA 3REVB 2QX4A 4IGIA 2X9LA 3TN0A 1X77A 1A22B 1A9PA 4HIXL 3NLLA 1UJ5A 4ZVQA 2BF4A 2GTIA 6REQB 4Y19B 2BRUA 2P5EB 5M7EA 1XZFA 1WCWA 2CUIA 4BCYA 1NOKA 4J7CA 3GNQA 4YSEA 5CINH 3WD5L 2N7SA 5KTRA 1GCAA 1RXVA 5F33A 4ECNA 4QRQA 5F2OA 2I2DA 2PUHA 3HHSB 3FLEA 1MIEH 1X13A 1ZNYA 4N6RA 3VVMA 3U9PL 5CD5D 1LLDA 2FQ1A 2QLTA 1QHOA 4DSNA 2W2LD 2BW4A 3RB5A 1GGTA 4XNBA 5IVZB 5DU7A 3WZ2A 1FNMA 3C3CA 4JOSA 3KFVA 4GW5A 2IH2A 1YZQA 2JAOA 4DZBA 3QYPA 2ZCKH 2VTEA 5AALA 5G0UA 2ZIVB 3VGHA 3PEVA 1OD7A 1YJAA 3ND8A 2ARJB 1RZKC 5HBRA 5CF3A 3NFPB 3PP8A 2GXAA 4UCQA 3TR0A 1IQDA 4L2YA 3RADC 3Q1SL 1JU9A 4FOTA 4F3RA 5GHWH 2VDOH 2HMIC 1SHMA 4FWWA 2DMGA 2Y7QB 3V4OA 2W5UA 1SXJA 1YFJA 2DBLH 2NY5H 3A10A 4FYHA 4YLCA 3H2ZA 1MF2L 4MMXC 1MOSA 3FUJA 4KC3B 4X4YB 2H08A 4RVCA 2A88A 2WKLA 4YAEA 3JZDA 4DA8A 3RM3A 1NGQH 4X64B 3USZA 4FQLH 2MINB 4OM7A 1XK6A 2JE8A 1GPOL 2KLSA 1CYDA 1X1AA 3O75A 3U4GA 1JJUA 2EGHA 3WIFB 4WL0A 1B4DA 1BDJA 5KG9B 5EBLB 3K0BA 3KYCA 1RI3A 4A73A 4H26B 1Z9MA 5DS8B 5T33L 2YNMC 4QDOA 3PPYA 1RRCA 4OJKA 1CZOA 4UDUB 4ZN6A 4M4PA 1C5DA 4NRYB 3MJ6A 4G1EB 3WN5C 4IBZA 5JZOA 2RBEA 4ELME 3PP4L 3R5XA 2C9AA 4HUWB 4GZLA 3A3YA 4UYPA 4HK0A 1NUNB 3IKJA 1NNEA 3E6AA 1Q0XH 2PDAA 2YJGA 5K0JA 1WEKA 3LT4A 2AG5A 5GJSL 3GP8A 4EYQA 1KH2A 3PSHA 1H6UA 4OSUL 4RESB 4UOQA 2BGRA 4FX5A 5GJBA 1WD5A 1T6ZA 1TTFA 3BIAX 1RKQA 2WVGA 2H07A 4PZLA 2AF2A 1WT5A 2CLVA 2XN9D 1AK2A 3DAFA 3KUDA 4WUUB 1MIOA 3MHPA 3FVQA 3M33A 1VDGA 2BNRA 3WKNA 4LNRB 2IYWA 1MPXA 2XZCH 1QMUA 4M93B 2QRLA 1Q9WA 4YHZH 5C46F 3SKNB 5IEKA 1RYNA 3QISA 2YD8A 3QFRA 5J4MA 4RVDA 1FDWA 1DL7L 3JD4A 2E8YA 4JEHA 1DVSA 5HUHA 3H13A 2CHUA 3OEWA 4RMRA 2IKSA 2A3NA 3PC8C 4JO3L 1QV9A 1M0EA 1AQYA 3SDYH 4MVJE 1F4LA 3DV2A 3UBHA 4LZJA 1ACZA 4FK8A 5DLML 1TTCA 1WS6A 5T5QA 4B41A 2BI4A 3FF7A 4J3NA 1E4VA 4YPGA 3S7GA 2NZ8A 121PA 1V8FA 2UAGA 3MQ2A 2BE7A 2PSSA 4ODVH 1JJFA 2QRVA 3OF6A 4LCCC 4BDSA 3B7YA 4D0DA 3L7NA 3F7RA 5SWZB 2ECFA 2JFWA 2A77H 2PXYC 1MLCA 2QBYB 2VT0A 1FW8A 1W4LA 2H0EA 4H2AA 4XPHL 3IEXA 3BWYA 4LLVA 3L7LA 2B25A 1I2CA 3O6MH 3X14B 2XYGA 3NV9A 2AC4A 4UM9A 4GMSH 4HHAB 4QJBA 1H15B 2J4WH 4JJFA 5KZMB 1B23P 1QK3A 4MNGB 2NT1A 3WXVL 2JRCA 4F8YA 1M7DA 1ZDSA 1RCUA 2OYCA 5IHXA 2R87A 2NAPA 3EXG1 5DJZA 1TQVA 3GQVA 4HKBB 3F7PC 4DLPA 4N18A 5FGBA 3O6ML 2X5NA 5ECJE 3ZX5A 4UVHA 5BSVA 5D5ME 2GN0A 3I72A 5E99L 2FVNA 3MV9A 1NC2D 1F2TA 2PD3A 3CPLA 1D5CA 1VSTA 3SU8A 4N8DA 5K33A 4ETWA 4HC1H 3HFJA 1KG0B 1LK3L 1X8JA 1Z6ZA 2KQMA 1JFRA 3KPNA 3GSUA 4YQZA 1G6RH 1CBJA 2ZXEA 3VD3A 4FDLA 3TBTA 3X1FA 3K8LA 4B5EA 3V4ZA 4CWAA 4XWWA 5JAHA 3TLYA 4DDTA 5I0WA 4RZSA 3SQLA 1ZH6A 3ML8A 4PD4K 2OHFA 3HH8A 5C5EA 1L5YA 3FO0L 4P46A 4HDAA 3VTAA 1PK7A 3N91A 1DIOB 2FPUA 2WQSA 2G5UA 5AW9B 3T2NL 5H68A 4LSRL 1NOIA 5IB3A 4RFEA 3P9ZA 1RYMA 4YWJA 2X58A 3IXMA 3C60C 4QUKA 1F4WH 2VRNA 3S40A 1AGNA 2XRAL 1XDDA 4FHCA 3VYTB 3BIWA 2J6WA 2ZT7A 4I1PA 3DKPA 2R47A 2GYYA 4Z7VF 2DQCH 5E4EB 1PJRA 5AK3A 4WFFD 1Z6XA 2IZZA 3IO3A 3VR4A 1NNUA 2G4CA 1QCCA 4W1TA 4AO7A 4ARZB 3OF5A 3QWNA 4W6WB 1EDEA 5CA1A 1VCIA 4RNRB 3GZPA 3Q2OA 3A6BL 3HUJA 5GRUH 3K8MA 4CKWB 2PGLA 4C2UA 3O4OB 2PSEA 4BFCA 2PH5A 2YA1A 1KAQA 5K1NA 2MYUA 3K2MC 3O2DA 4N8UA 4PGCB 5J1TC 4RWZA 5C51B 1CQKA 4AKOA 1GZPB 1IEAB 1E60A 4G24A 4G6KL 4U4BA 1U8HA 5J6HA 2VDOB 3C1AA 4WTOA 3V9PA 3U40A 5T6MA 4YHBA 3NJGA 2EDRA 3OJFA 1CK0L 1QFXA 1ORIA 4JIGA 5BQDA 4BVKA 2AXPA 3N7TA 4NMWA 1UXSB 5FWDA 4ELKB 1D0SA 3OCJA 4I7EA 3PNYA 3D6HA 4W9HC 3AY4A 3Q1LA 2VH5R 2ZE5A 2CHGA 1QFHA 2F0CA 2MNUA 2YZ7A 1OZFA 4EKIA 4MWCA 2PPEA 1EWKA 1FSGA 3G6AB 1NAHA 4S1SH 1SZNA 1XF4A 2C8JA 4E94A 3EYUL 4PIRF 4O0MA 3TVDA 5KSAA 5C0BB 1ISJA 1E2QA 4DTGH 3AFIA 5CX1B 1MCNA 2PPCA 1JXQA 3UAOA 5JD3A 2Y9MB 3IDYB 3UBXI 3V4VA 4RISL 1MHEA 2VOEA 3STYA 1KGCE 1BREA 2VAWA 3FOZA 4QKTA 1OFIA 4ZTZB 3BXGA 4RDCA 4YZFF 1MRZA 3GEMA 1P6UA 3M6IA 2RA1A 6ABPA 4B6QA 4OIIH 3V5KB 3QI9C 3WHIA 3H9CA 5EFZA 2AJSH 3CEAA 3O74A 4X50A 3PQ5A 4EVNB 4P2QE 2EVGA 4TTPA 3OIWA 4G2NA 1ZLVH 3SZOA 1ARZA 4JKWA 1C2YA 4JSYA 3RIHA 4BZPA 3B2VL 1I36A 4AVJA 5AZ2H 4F37F 1UFRA 3AG3B 3OD3A 2RJNA 3G6DH 5KVMC 4WFIA 7PCYA 1EFUA 1JEYA 4PFJA 2NNXA 3RJ5A 1VADA 1AKVA 3ZIDA 4HPWA 4U6TA 3MGTB 4BEIA 5IAOA 1ACXA 1FXWF 1NW5A 3GHHA 5BQXA 4P35A 1FZMB 1HN1A 1BNCA 3I8SA 4A8TA 3EIHA 5HPMB 4DR2B 3F5WA 1XF2B 1I7UB 1B3JA 4OY9A 2JB6A 1ZGLM 2X76A 3MUZ1 5KX5A 2ID7A 5T4BA 5J63A 1XTUA 3R7SA 4X9FA 2IK8A 2B94A 2AQNA 3PL6A 4L37B 3TNJA 3TSWA 4KVPA 1G7TA 1NCTA 3LVFO 5JHLH 2PX5A 4JT4A 5EQTA 1X6NA 2GQ0A 2R0LH 3E3QE 3KD2A 1IC0A 1AACA 3ESYA 5LJLA 5A7GA 1GXSB 4JBNA 2B16A 4N12A 1ZJZA 4TZ0A 1D6NA 1OFUA 2E8ZA 4HMQA 4KK3A 4XC3L 3O9WD 5B4UA 3RC8A 4MYRA 1BVNP 1WDWB 4YXWD 4CQMD 5HD8C 5IK3A 1QQ6A 3L3DB 3BIJA 1FQOA 2FUEA 1HZHH 2CCLA 1L6IA 4OHRA 4Z0XB 1CR2A 3RFRA 2HUHA 2AJTA 3NALA 3PFCA 1H6FA 3IERA 3MLTB 1PNDA 4XB3A 1SRQA 2QQKL 1ZVYA 5E00B 2R0WH 5AB1A 2CDFB 3FUVA 5AMXA 3C5ZD 3M89A 1LEKA 1CDCA 2KLRA 1P2CB 4OHBA 4YT2A 2H3XC 4AYWA 3QP3A 4DETA 4U7SA 5CD9A 3IWVA 3ABSB 4UBLA 3VZSA 1Z5UA 4C9BA 3I74A 3ECAA 4IVNA 1QNLA 1OH6A 3AT1A 5HIJA 3U30C 2R84A 3LDGA 1OTXA 1C9EA 4OUDA 2W60A 1ORSB 3ZGIA 3A4TA 3IKCB 3EZGA 1MVNA 4NF2A 4P9HC 1M2JA 4FMDB 4FS3A 1V5FA 3CZRA 1PZBA 2C7BA 1WXDA 1T6YA 1WMSA 3U79A 2QLVB 2EZ8A 2ACVA 3QORB 3G2QA 1U8MA 4AGQA 5LA6B 1CICC 5ITZA 4J28A 3ILEA 4NWUL 3KPRA 5AJXA 3GJ4A 5BUZA 1ZLWK 3N6RA 4K9NA 3BLPX 2OPBA 1JD7A 2F5BH 3CSPA 1JRHL 1WT5C 5K3EA 1DINA 4PS1A 1NCOA 1E9DA 4J2TA 3ZU2A 1ACJA 4MNQA 5KDOA 3O6KH 2RIPA 4S1DC 2FY8A 3PUCA 3K1AA 3D3WA 4MCZA 4HIQA 2BELA 2JZCA 3B1JA 1DVTA 3QQ3A 3HO1A 4YUVA 4CM8B 3TMKA 3OJWA 3KPSB 5FB8B 1LE5B 3G6AA 3UWKA 1WPRA 3VYPA 4BFIB 2QR5A 4ERSH 3U6BA 4EUKA 2MR5A 3PC8A 4IF6A 2LW7A 3I02B 1F9AA 3F78A 1AS3A 3K7EA 4GMFA 1S7SB 1AGRA 3QUMA 3U0PB 3AYZB 2V7UA 5TE6H 1USUA 4HCIA 3CURA 3DULA 5JTTA 5ITWA 5C0CA 2PA0A 5C1PA 5F9WC 4YXKH 2FOIA 2DAPA 1KDPA 4ITUA 4KREA 4X1IA 5C53B 4B2YA 4ISCA 3NIFE 4D41A 3WUWA 5FDFA 2CO7B 4D6PA 1KCUL 2WZBA 3ZXXA 3V2AR 2YYSA 3BJMA 4WUKH 4Z77B 1U98A 3IRUA 1TPYA 5EMKA 4JXJA 1JZIA 4I1NB 4KQMA 3WGTA 4OGZA 4R0LA 4MQUA 1KFJB 2GD1O 1H2FA 3WFEH 3N9GL 4TVUA 3N5AA 3GCWA 4TXHA 3PWKA 4HUQA 4L0MA 1CTQA 3AOGA 4KPHL 5BVGA 3OGOE 4M9ZA 1ZS9A 1X1CA 4IWNA 1MWAL 4D25A 2Z2XA 3LEYH 1G9TA 3SJVB 4TQUS 1UINA 1QIKA 1QHNA 4MMZB 3UBXG 3V52L 1NFDA 3B82A 4PAGA 4N5ED 1WY7A 1CKEA 4IIEA 4UFOA 4I1UA 2X2FA 1D5MB 3UTDA 2YQ4A 3WE7A 4AL8H 2ZWLT 3W0WA 2FB4L 4MUJA 1H4SA 3CVVA 5F23A 4G6MH 3ZGLA 1BFDA 5CGBA 4L6AA 1QYWA 4X91A 2IVFA 3N28A 1S7RB 3Q85A 2A0UA 2CMRH 3F5MA 3PUVA 2ZQ5A 1A9OA 3MRKB 4R3SB 1ONPA 4PTUB 4KIJA 4LSPH 5H37G 2J8UA 4N5DA 3NUQA 3TLKA 1HLFA 1RJYB 1EVKA 3V4UL 3KCWA 4EFNA 2BMKB 4IIQA 2WJ5A 4PS4H 3C3EA 2WTMA 2XRAH 4KI5C 5BP7A 3FMIA 3S2EA 4NZZA 4G0QA 3W0WB 1SNRA 1JW9B 1LFDB 3AETA 5D00A 3D2BA 3PHGA 4Z78B 3LKBA 1L8OA 3OOEA 5EEUA 1N33B 5BN3B 3ARED 4IIHA 4ZV4A 2FX9L 2LAAA 3O4LA 3CFJB 5ADHA 3LTNC 5ETUB 4MHTA 4HKBA 4RHUA 4EI5A 1IN4A 3O4RA 3LIZA 2DBJA 1D1SA 1X1DA 1HO3A 2I6QA 2FDCA 1KS9A 3QDMD 4JKMA 2ATCA 4Q21A 1MCKA 1LNZA 2QGBA 4EZLA 2CGZA 3K53A 4FFMA 5GZOA 2VAPA 4LW8A 1AHHA 3QVGA 4LESA 1MZVA 2A0XA 3MOIA 2ZPAA 4F3FB 1ML3A 1NINA 1U8NB 4OCSH 4ENZA 1XTJA 3D9AL 5KVDL 4JJGA 3IJEB 2P78A 1PU0A 4N9QA 2OCAA 4YJ3F 4Z76A 1LVGA 1QVAA 5IJ0B 3LZFH 2A74C 4DLTA 4FC3E 3VBCA 3JALB 4ISVB 2WO3B 5KO2A 1JWBB 4QPNA 3SQMA 3FTFA 1Q11A 4IOMA 4PGBB 3B7GA 3CLTD 2DL2A 2MPAL 3H5TA 1UOOA 1RIVH 3LIZH 2FPKA 3UXYA 3PYCA 4WW1A 2GPNA 3ROLA 4DK5A 3BAZA 3IAXA 2ZJZA 3EHBC 1N0XH 4INZA 1GDHA 1N5AB 5DWQA 2R1YB 2DDQL 5JQHC 4FOSA 3UQZA 3BKML 1XK7A 4HSQA 4O4JB 2G3NA 3QWOA 2IT1A 4N6RB 1Q1AA 2KLTA 4FI3C 3PAZA 3BZ4B 2F62A 1N1GA 4TUYF 3TJMA 2GDJA 5JRDS 1L5OA 1FEZA 1W88B 5FORA 5K3FA 1RPQA 4KXAA 1RAHA 2X7LB 1BM7A 4RZHA 5JPNB 4NE7A 4JUAA 5B37A 4L3OA 3QJSB 1CRPA 2I9TB 1XXHE 5CLTA 3FZUD 4L3EE 3B7UX 4EN3D 1W4RA 5B4VA 3VD7A 1W72H 3DXZA 1DRWA 1X7GA 4AJ4A 4E4TA 4Z18A 2MQ0A 2PBZA 1KYZA 2WSIA 4B3BA 4PPGA 2V3CC 5DLDA 3IDMA 4M0KA 2I2FA 2P4QA 2Y1OA 4R31A 1YR2A 1DBMH 3SHFA 3GO1L 3PIDA 1TLFA 3G2PA 1IEQA 4REMA 5IJVA 4I8XA 1RHHB 1L7QA 2C9UA 5C3MA 2XMRA 5TE4H 3B3JA 2Y7LA 2W2QA 5DMHA 4C6HA 3ADBA 2HCFA 4KQKA 4DFHA 2JCCA 2HHCA 1CR4A 2OPHA 4LRXA 1VHLA 4ZI3A 5I5EA 2J9ZB 3FNQA 3N8DA 4LCWB 1UURA 4AGPA 1ZT7A 5FDWA 2D31A 1IV8A 4AEHL 1UZ6E 4NM4H 1FVCA 5CW2A 2Z8SA 2JS7A 4J3JA 2YHSA 2PT5A 4CI9A 5AVOA 2PWFA 5FOBB 1QGUB 3ICOA 2X0NA 1C0IA 4TGLA 4L0YA 2F1RA 3HN5A 1PS8A 8MHTA 3O11B 4W9EC 2VTFA 1A1MA 4JVPA 4W5NA 4HOWA 3HVUA 3HPLB 1UCTA 1NQOA 1TPZA 4NZFA 4FQLL 5IK2D 3OJVC 3VXSE 3IETB 4O9HL 2P8JA 3CDGA 3BJIC 4QT0A 2O30A 5IMBA 4A91A 1CQZA 2WY3B 5HUJA 4E5YA 3LUKA 5DMJB 3T9EA 4ZOEA 3MJ7A 1AQKH 2ID8A 1NWPA 1V5GA 2DDQH 1AQJA 3C12A 4IIQB 1M6VB 5BZWA 1VAHA 4M62L 2NXYC 4ETQB 2FJGA 3GSQB 3DPBA 1OH5A 1AQNA 3TZ6A 1TAHA 2JJSA 4EJ6A 1NG9A 5HSGA 1RP7A 3G23A 1C9NA 3KPRB 4ZK6A 1P7HL 5J11C 2HMAA 3P26A 3FT2B 5HXMA 1FDVA 5A40E 1AUQA 5EINA 2F1AA 3ZSSA 3B1ZA 1CT8B 5C6WH 5KSUA 3R41A 1R3UA 4BFBD 4WEBH 4BQBA 4HY3A 3ZZTA 5EZYA 3HGMA 1V5WA 3NHRA 2ZUEA 3BN9C 3NIDE 4NPCA 1J9CT 5LLSA 3GOQA 1QZZA 4U05A 3OZTA 1GH7A 1XRQA 4JLMA 4S0XA 2YHGA 5BSFA 4BNHA 1OWWA 2H0QA 3SJBA 4Z7NE 4K7FB 2ZYUX 1NQWA 4JI6B 3PT5A 1A3LL 3UW1A 1M2VA 4XYMA 2OPCA 2DW5A 2A99A 3BKCH 4MRAA 1XTTA 4BSVA 4I3FA 1GKYA 2Q6LA 4CN1A 4Y7OC 4AQAB 4G36A 2G9ZA 4U6HA 3LXCA 2FSDA 1XRJA 5IHHA 5E6SB 1L4GA 1KG0A 2WYUA 4QRPA 2XLBA 2E4AA 4J7AA 2RGDA 2HT4C 1ZUNB 3VZBA 1KELL 1N8ZA 1QLFB 5BORA 3MV9B 2ZCLH 1WUIS 3HNTH 3RD5A 3RIAF 2FIKB 1GUDA 4F91B 2WYTA 3AY3A 4F7PA 2XNKA 4QODA 2ZCLL 2I7VA 4TMTA 4PRHA 3DMFA 1U28C 4XX1A 4CFYA 3LPLA 2BEJA 4GI3A 1JDJA 1IY1A 3CVBA 1NI4A 2ECOA 3KHTA 4PW4A 2HBQA 2O93L 4HWSA 2CG9X 2VJNA 3VAEA 1TM2A 1JR3D 1TUEA 1FYHB 5MN4A 2C2KA 5DM60 3S3TA 4NBUA 3PI6A 2XTSA 3DLBA 4HLZG 3PA6A 2JJ8A 4QFDA 4IRMA 3HXKA 2VHXA 1FFHA 4WEMB 3AL2A 1OK0A 2BDEA 1GGHA 3H05A 2O2EA 2QN9A 2VR3A 2AJDA 2FD6H 4HJ0C 4XWGA 4XX0B 4OIIL 4MXVF 2ADMA 5LZ4A 1FL6A 4CM8A 2B3IA 2QTZA 3BP7A 4NZUH 1G7JA 3RTLA 4E5MA 1OGTB 1PGRB 5DD3L 3HZKA 4BO6A 1QRTA 1B7GO 4WKXA 3OMNB 4Q4EA 5IRCD 4XEHA 4LYYA 3ORHA 1G17A 1TEYA 4IIFA 1ZWIA 2O6EA 4CMGA 4JJ7A 5ENWB 1OF0A 4ZNCD 4Y6OA 4DK3A 2GXSA 1MB4A 1R00A 3NTLA 3S99A 2V6HA 4XR4A 1FJGB 4S1NA 1BHO1 3OX4A 2H9GA 2YQGA 3EJCA 3HL0A 4K86A 2JFZA 2PCFB 3DOUA 4MXDA 2PKRA 5KYVA 5GGRA 4PLJD 3L8GA 2V5YA 2CJ3A 1PDKB 3VHQA 2FA9A 4CKCB 4YDLC 4HH4A 3ZDXE 3EGSB 1NT2A 1BVRA 1DJOA 1HHIB 3F3KA 3KLAB 5D5MF 2Z31A 4KX9A 4MRCA 3LY8A 1Z13A 3DMDA 4FFYH 1JZDC 1JPNA 5LMCA 3JQAD 4IOIA 4GQBA 4HN9A 1SN2A 3WSQL 2ROQA 3T9AA 4OF3A 4CSZA 4P58A 3LZCA 3F9RA 4BVBA 1CQJA 5JJ5A 1CYGA 3LKOA 1BKDR 2Q45A 2QYTA 4GOJA 3CFNA 3RTQD 5DO8A 3B9KD 1TZKA 4UBKA 2YWJA 1R10A 3S0PA 3EK2A 5HOEA 1AZUA 5CSGA 2K45A 4JITA 3HNTL 2YVQA 2DBVO 3UZVB 1URIA 4RAHA 1R12A 3Q48A 1OB1A 1CYEA 3T4PA 4Y6SA 4Q3OA 1H4VB 2Z31B 2FK8A 4Z6KA 3H3FA 3EJYC 3CSTA 2X3BA 4G5AA 1V8ZA 4RPLA 4OHUA 2BGUA 3SDCD 3KFLA 4ZZKA 3L4BA 2GK3A 4FL4C 1NXWA 1HIMH 4DESA 4D3XA 3B43A 1LW7A 4UUJB 1F4YH 3B6JA 3OY7A 3FN4A 2IY8A 1A4CA 4LJSA 4GSRA 3QUKA 1H1LB 5HYSG 2WG1A 1O7DC 1I4DD 4LMAA 3I50H 1P7KA 3QYCA 1CZ8L 1QMGA 2VUTA 2KH2B 4JVOA 1IVYA 4HQQL 1R19A 2QTMA 5CXPA 3ZWYA 5CEXA 3R1GL 5IB3B 4ZJZA 1D4ZA 4NV1A 3NVQA 3WY3A 5F3RA 5DGIA 1SJMA 5DNYB 3B2PA 4O4IB 2BP0B 5AOIA 4KTGA 3TRDA 1Z6JT 1JQ3A 2ZOOA 1RYBA 3DVAB 3MYJA 4HIHA 5GV8A 3GAFA 3LV3A 4IGBA 1BROA 3U6RB 3TYFA 4A39A 1T20B 4UBDC 1EBUA 1Q92A 3D3WB 3MCLH 2G9VA 1AKNA 1RUKH 4HC1A 4DCQB 1LXCA 4PW0A 1GNRA 4C4KO 1DO8A 4HETA 4HS6B 1U04A 2DFTA 3E3LA 3NC1C 3KWWB 1JYEA 4UARA 1UAYA 1CGSH 4F12A 4MUHA 2YGPA 1E2ZA 2IYOA 4WNSA 3NEOA 2CK3D 2UZXA 4JQVC 1Q20A 4D9IA 4ZPVA 3S68A 5J47A 4CF4A 5HPOA 4YAKA 1JIXA 3WEAA 3KEOA 3UIEA 3VXNA 1WMFA 3T2LA 1VSQA 2W6ZA 3KNBA 1ED3A 4F9FA 1U0NA 4HF5H 2GNAA 2PO6A 3JASA 4CAGA 1SIOA 1WLSA 4GZMA 4KVCL 4Y2XA 4CADB 3BJRA 3OVMA 5A3RA 3GGJA 4Y4FD 2G5BB 4IFIA 2GTHA 3EZFA 1CVIA 3RC9A 3U6KA 2ZFUA 3FHCB 1DPGA 1ZA6A 3A22A 5F7DB 4A2EA 4WZBB 4L5FE 4Z49A 4MCYA 2Q99A 4V39A 2UY6B 2NO6A 3O8DA 3AS2A 2R15A 2IPMA 3V4VB 1I3KA 3RI5K 4H77A 3DMTA 4HR7A 2C0PA 4PYOA 4NYJQ 1A77A 2DAVA 4MWSA 5SY6A 1CXKA 2NXJA 1TZAA 2ZIEA 4XVUD 4CKQA 2C1EA 2IS2A 3O3CA 5LOVB 1NTOA 1JHTA 2CR0A 3A6KA 5ISZB 3RTQA 4DT1B 4PJBF 1X3DA 4URTB 1OWNA 4OM8A 3M4NA 5FGSA 4YHHB 1T2CA 4JBYA 5EMYA 1ZR2A 1XDBA 4D02A 1U3ZA 1UASA 2MOVA 3CBJB 5F3FA 4X20A 1SBYA 2Z7UA 2JCCE 2EFDB 2F8OA 5E0QA 2V5SA 3NJHA 1X1BA 2QSCH 5FTKA 2WIGA 1NBYB 1Q0HA 3Q6NA 4LA4A 2NTEA 3HU3A 4AYXA 4DCSA 2ZI7A 2BJMH 5HGXA 5EMNA 5CPFA 2JCYA 1BGXH 2H85A 4HX9A 2J9RA 3ZTJH 4PZEA 3PJEA 4TQHA 2EO9A 5DS2A 1PZEA 5T33H 1Q7TA 2HGSA 3FRHA 2A0FA 3ZWWA 5F9AC 3UV3A 5E8OB 2YD5A 1F51E 5E8PB 1T04A 4U1JB 4K8RD 4GOND 4AMUA 2BLNA 4IFBA 4A7PA 3SYKA 2D9QB 2OAEA 4CW1B 5IX8A 5BWLA 3T3NA 1DXOA 2R23B 4X42A 2NTNA 3PG5A 1Z12A 3KW8A 1EFRD 1OTSC 3G04B 1OIOA 2QTGA 4C57C 2LT9A 3P2OA 5DGHA 3UJTH 5AW9A 5B8CA 1RPTA 4MA7H 2G9RA 4TMVA 1T2JA 4B4DA 1PZDA 3QUZA 4RH1A 1SVCP 1KBWA 4HGKC 4LVNB 4D9KA 5B3NA 3MA7A 2IZ0A 1MHPA 4FHDA 2J6EH 2XXCB 3GGWB 2DWOA 5REQA 1LPNA 3FTXA 4I4WB 2VNCA 4PWYA 2R6AA 1XO1A 4CLXA 3VACA 2Q3CA 3CFKA 1XELA 1LK2A 2OSVA 3GXPA 2DF8A 2PXYD 1NVAA 5A2CA 3C7DB 1KSRA 1UD3A 4MB4A 3TD6A 1IAIH 1E2KA 4N76A 5FLVA 5FKPB 1F8UA 3NI2A 3Q8MA 2O3SA 1LY1A 4X98A 4YUAA 4PNEA 1B2RA 3WSVA 1QEXA 1W96A 3HG0A 1J48A 4MB3A 4NNYA 4ZSOE 2RC5A 3DXYA 3TIDB 1A6ZB 2Y2TA 5K9JL 1AQ8A 2R85A 4MNGA 2XUOA 3TS1A 2ZIDA 3DYOA 3WD5H 1N5MA 1L5GA 3USCS 3QRWA 2EP6A 3JTEA 5DZPA 5C09B 2J44A 2YVLA 1DMSA 3KT0A 4B17A 4U9IS 3NJXA 1GZ3A 4PJGB 3QV1A 4RACA 5FPYA 1RAIA 5ALNA 4F7CA 1NBHA 4OJYA 5C3IA 4ENQA 2NLJB 3KBPA 5F9HA 1C0PA 3RFFA 3F8TA 3KDAA 4GQQA 3N6YA 1LEIA 4TSFD 4OAQA 3BFKA 2G25A 3P9WB 3SVZA 2WHQA 5EH1A 1P1JA 1N2RB 3ICEA 4BVEA 1C1HA 5EN3A 1QNIA 3O82A 2EINB 1DWOA 2CBMA 4DMHA 4FQHA 2XZQH 1YC5A 3B9BA 3V9EA 5D1ZA 4YP9A 3ZCTA 4C04A 2G60H 2R83A 4PW9A 3LEXB 4S2UA 2I62A 5FOVA 4QSHA 4EGAA 2VN3A 1X1QA 3OMXA 4J5VA 4JYMA 3FPKA 4X45A 2CLVB 4X1KB 4F84A 3WEBA 4GC5A 1MCOH 2H5JA 4D8YA 3RWIA 1B00A 1J2RA 1PE0A 1KY2A 2Z6AA 4KZKA 3TXXA 3HDJA 1B1CA 1P69B 4GSDH 3IN2A 2WZPD 3EUFA 1XVVA 1T03L 4MWFB 1HL5A 4EG5A 4H4NA 5K7SA 2QX8A 4OGAD 5IJ9B 4C05A 5CCKL 3I2KA 3D7MA 4ER3A 2EEAA 2EX0A 3ABRB 3AY0A 3EF7A 4B84A 4DLYA 4EKNB 3IFOB 3CH1A 2Z8ZA 1DEEA 3QT2A 3II3A 3T65A 3U0WL 3M5CA 5TJHA 3N7AA 1IVSA 4O02H 1EUCB 4F2GA 4TZKA 1O77A 4M61A 1TQDA 5L7TA 2H1PL 2PANA 1RKVA 2R79A 4Y4FA 3FBTA 1BS9A 2CO7A 1Q9OA 3O8XA 1CE6B 1NI5A 4NI5A 2WMOB 2E2WA 1HSOA 4G9FD 1RIFA 5C18A 4F5ZA 1QZ1A 1RKUA 4ZV7A 2CJUH 4YT8A 2KS0A 2V6GA 2OW6A 2ECPA 3ZMRA 2CFCA 2ZJAA 2VZEA 3VFMA 1Q21A 4BJHB 3HE6B 3CX5J 4XWTA 2X0JA 5ALBH 1V41E 1H3PH 5EZOH 4RJJA 4C6SA 3F7QA 3H5AA 1G7SA 2DEXX 3D6JA 4R96B 2UYQA 1DAGA 1UOQA 4UM8A 3AFOA 1Y7LA 3OM9A 1M7DB 1OT1A 1WBZA 5FYKH 4KQ2A 4G1VA 1JS4A 2BZSA 1FP6A 1XZEA 3ILQD 1NCUA 2BIOA 3O6KL 1K7FB 5FEBA 1YEIL 5F9FA 5E6IC 2OOKA 4C4OA 4ONHB 1SXJC 3RO7A 5L3RA 3RREA 1D3CA 3FHEA 2J1XA 3UH8A 4R1LA 2HMUA 5I9MA 4JBLA 3V79C 4E5PA 5EJ9A 5GIOE 1XIWD 2NXNA 1RC1A 4YC2B 3TC9A 2PLFA 5EHXA 1PUJA 1HTBA 3EADA 1N8TA 2XVZA 3B2DC 3KYNA 4IGBB 4MYUA 1DBQA 1O8CA 2BC9A 4F9LC 3O47A 3MRFB 5GGYA 4W9MC 2CKBL 3RWHB 3IU3B 1HG0A 2Z8YM 4KODA 5CFHA 3L4VA 5TPWH 3MWJA 1VDZA 2XB4A 43CAB 1P5ZB 3IRZA 4ONEA 1G7CA 3UCRA 4HDKB 2IV2X 3TH4T 4RGBA 3UPDA 3STHA 2GTQA 4MUNA 3IKKA 2G5CA 1MAWA 4ZYUA 1DJIA 4YP1A 1BDBA 5GS0H 1DFBL 3F6JA 5K2OA 1Z4PX 2FFAA 1UADA 1B88A 4KTDH 4GZ3A 3H5RA 4FOLA 1LO4L 3GAZA 2VDNB 4NZRH 5B58T 2IQAA 2VXVL 1S8NA 2KM1A 1TZJA 3F6CA 3BWEA 2ONKA 3BRFA 1KVSA 4PWZA 1JI2A 3BCUA 4RADA 4UQOA 2JFYA 1ZVKA 2DMKA 4K3UA 2JLZA 1FDOA 1ZI6A 2J1YA 2VHJA 4OF6A 3W2DH 4LY9A 5CFMA 3T9BA 3NHUA 4TXJA 3ETDA 2Y23A 4DVRH 2EH8H 3OKLA 3DZFA 1IBCA 5FDYA 2W2MA 2XYHA 4WGGA 3TJHD 4N9WA 4ZG1A 3ERCA 4B9GA 2R3SA 4DIXA 2IF2A 1J8HA 5JOPD 4RIHA 5GS2H 5E8EB 3UK2A 2AD1A 3Q44A 3UBMA 2D3WA 1WHSA 4Y2LA 3AXIA 3T71A 1IRXA 1REIA 3LL7A 2FYYB 1UQRA 4FQ2L 1Y4SA 3T4AB 1WMEA 4OKDA 2BVEA 2MCAA 3UX9B 1KJIA 2RAFA 2DTML 3OE1A 4B96A 4DDKA 3KS0H 4Y6PA 2FWBA 3ZTWA 5DX0A 2QJDA 1JUDA 1V7NH 2E37A 3T52A 2WWXA 4U9HS 5A5DA 1IFXA 2WSPA 3CN1A 1SLUA 1HDCA 1J0JA 5IBLC 2FO8A 5I45A 4J9VA 3V7AG 3GBEA 5F98A 3IDUA 4YBQD 1E5CA 3ZWMA 2PYDA 1RJ9A 4KTYA 5BNIA 3VB8A 3C5CA 3FUWA 1A4XA 1YO6A 3WP0A 3WR5A 1KV7A 2DJIA 2IMMA 4Y9TA 3OJEA 4D0LB 5CEZH 4Z4QA 3HZKB 2NSDA 4HOYA 4IDBA 4RTLA 3PQEA 1CDDA 5LGHH 1U9IC 1IAIM 1B41A 5DXFA 3J80A 4X8HA 3TEMA 3PHAA 1NBME 5JXEC 4PJGE 3QIUC 2I2CA 5BNZA 5D72L 4WQMA 3WHE0 4FKZA 2QLBA 4WHTA 1YS2X 3O6VA 3MUHL 3ABIA 2V7WA 2R0KH 2RG1A 3VU0A 4G81A 2BVNA 2IG2L 1IAQA 1NXXA 3P32A 4P4UA 3VXME 2YC4C 1KJJA 1CD1B 4G4GA 2HJKB 3MXVH 2ZYVX 6YASA 2Y66A 2DUUA 1QKJA 4G72B 3ZOKA 1DWQA 1XJ5A 1GITA 1L1FA 4DTCA 3FBQA 1Z08A 4UVEA 1MO6A 1NV9A 4NFBA 3HMXH 4NUGH 1P0FA 1DG9A 2GK4A 2D03L 3MRGB 3KG2A 3FD8A 3QUXC 1QBBA 3U0TB 2ALAA 4WBNB 3L2MA 4OB6A 1CUBA 4XB7A 3FOMB 2OMUB 3BGVA 3WO4C 5HF6A 4B7ZA 5JIBA 2I54A 1KCRL 1IKNA 5EOTA 5BOVA 3ZW9A 1Z45A 2XQBH 3AZQA 5CEZE 3ESBA 1GPH1 2R65A 1PL7A 4L8LA 1CUOA 3KB1A 4LLYB 2VXBA 4CL7A 2BSAA 1TLMA 4PRDB 5CJ5A 3T06B 1ODFA 2Q6IA 3GD5A 3E1GA 5JJKA 3TRKA 1WKCA 4MYCA 3RS0A 3REOA 5T3ZD 4LTNA 4AZ3B 3BUYA 5EP2A 4FKKA 2OR8A 2RBLA 4BWWA 1EK1A 1GUZA 2ZT6A 2VDWB 2HSDA 1VJ0A 3N70A 4PX3A 1CZHA 1I1FB 4MJLA 4RH3A 1AQMA 3PCRB 1C4XA 3F5QA 3UGQA 5SV4A 3EXJA 4K2UH 1Z17A 3IGLA 2ZM6B 4KK5C 4DAEA 2Y7QA 3P3RA 4I5BB 4AEIL 5ARDA 5HHOE 2YMLA 4HW6A 1N9ZA 3AKDA 1IC4L 1Z5LB 2A2QT 1C5CL 3VFRB 1WFJA 2BUAA 2PS0A 3D7NA 2UWEA 4D82A 2Q0HA 2WVVB 5THQA 4L3AA 3AWIA 1WZUA 2K4WA 4OP2A 2IH5A 4N1CA 2B98A 4QECA 2ZONA 1IAKB 1LQSR 5IV2A 4GUCA 3ZDFA 5JQ6L 1HNGA 4GWGA 2NW2A 1KKMA 4I46A 3H9JA 3SIWA 2HT2D 5B1JA 2C5FA 1FX1A 3MG9A 3W2FA 1J8FA 1HEHC 5D96C 4JHWL 3T09A 3VR4D 1GQQA 4CG2A 2BDTA 3GS0A 5LQJA 4G6ML 1SELA 5IJKC 2P8PB 1DNPA 4NONA 2H0AA 4JFXB 2LR0A 3KEFA 2PZAA 1FX0B 4AICA 3O4IA 4X93A 3RNQA 2BYTA 1XMPA 4A92A 4YI5A 1X44A 5KSVA 3P19A 4ZMPA 2ZBEA 2W6ID 3WYFA 3DPUA 3UCXA 1TJ5A 1Y3DE 4XJVA 3FQTB 4P5EA 4FQXA 3C3DA 3H0KA 3IRPX 3RAJH 1LRKA 1TG8A 4PLGA 2R8BA 5JYDA 3QXVA 4TLDA 4YIQB 3ECWA 3MRNB 1E4EA 3E3OA 2NZWA 3AWEA 4S1RH 1M7BA 3A70A 2BNRE 1BVUA 3IAS1 4N8CL 2DKFA 2DWEB 3OLIA 5HRUA 5D7SH 4PICA 1V16B 4G2AA 2VTBB 2ODIA 4C22A 4GNRA 1MLCB 4HN2A 3IFNH 4KV5E 4KI5D 4YRRA 3U3OA 1BQ5A 5CCHE 1E7WA 3IFSA 5HCNA 3QXGA 5FTLA 2OL3A 3UJ3X 2PF6A 4EX7A 5C7ZA 4MYDA 4ANUA 3LX6A 4EJSC 2ZYSA 4ZAKC 2PXXA 5EWIL 4JY7A 1DADA 1FN4A 2Z58A 1MGPA 1Q4NX 1GMEA 1DWPA 5FAKA 2JHGA 1I1CA 2J2ZA 5D1ZI 4OCSL 4PTTB 3NBAA 1ZTXL 3SKYA 2ID9A 1SMKA 5C7XL 3PGDB 3PWTA 2ZX7A 3NIFB 4UT9H 3FZEA 4D3YA 4DLKA 4HVLA 1M3IA 1RZPA 4ELKA 2BFPA 2VUHB 5I7HA 1QGDA 1G8YA 5FUOL 4IMRA 4HDMA 3P9NA 2MTPA 4FHKA 4GIAA 4WSJA 1H65A 4AMYA 4XNXL 1EEUA 1TEFA 3BKYL 3KPRD 5JIIA 3UJ8A 1RUMH 3DV6A 3MACH 3IV7A 4BIIA 3JYNA 5JO0A 2H7CA 4GKZA 3FWPA 3QPXH 4XO5A 1OCWH 4GKNB 4DQLA 3F12A 1GTFA 4DKAA 2FN9A 4ILDA 1DTWB 4DEXA 5IMOA 5B57C 2UZ1A 1F2UA 2EHDA 1QSZA 2IYUA 3WTXA 1E4XH 2E9WA 1T1SA 5JR3A 3N0PB 3IDQA 1JZ6A 4B5LA 2OBYA 2QAJA 2CYCA 5KVQA 4GLJA 1FQ9C 3N2KA 3QXUA 4AO8A 3BPOC 1FPTH 1J1UA 1SOXA 1ZT1A 1GJIA 4MAYC 3F4KA 5TF1L 4Y9DA 2H1OA 1HE1C 3IWUA 5AYUL 3L02A 5I6MA 1X7HA 4JPSA 1S1MA 3D2TA 1ZANL 1X94A 1G20E 4IBWA 3V4PA 5EQFA 3LIPA 4YDLB 5HGDB 2P1ZA 4BN0A 5JFOA 2Z5LA 1E2DA 5FA4A 3NDIA 5AB0A 1QYGL 5GS1C 3MF4A 5LYJA 1AG9A 3L4JA 2QGCA 2VJLA 3ONVA 5F1IA 1JBQA 3UK7A 5T67A 1XVUA 1Y37A 5JT1A 1KO7A 2Q6KA 2D7CA 4N8VG 1OVMA 3JQ6A 5J1TB 3R7BA 5EE5B 5JPCA 3O3BA 1I7NA 3R3VA 5DYNA 3RVWC 1XMOB 1NSTA 2Y0DA 4NNYB 1P39A 4L48A 4HVBA 3S5LG 4P86A 3FB7B 4U1MA 3CLUC 2I55A 4J07A 5P21A 3QQPA 4IU2A 4AQZA 2X53A 4AQAA 2O2YA 1ECFA 8AT1A 1SM3H 2ZE6A 4HAGA 4MV1A 3LIIA 3TQIA 5DMKB 2XUJA 4MKMA 2DIAA 5CX4A 1ESEA 2ODNA 1H22A 1SVOA 2Y69B 3KVPA 2JZNA 1J99A 1OHHA 3O94A 1FYVA 2YAQA 3E7DA 2XLLA 4FFWD 2CPCA 3HHPA 3KIPA 4BP3A 5C2JB 1V37A 2WC1A 5F1OA 3CVHL 1OTTD 4OB8A 5E5UB 4J0FA 1ZMTA 1CQXA 1E3QA 2C7RA 5FTNA 1YCHA 1JJ7A 4BFJA 5JNYB 3CEPB 1HNYA 1LPMA 4HEJA 4QT5A 4NJ9L 4BATA 1MX3A 3CUTA 4NJOA 3C7CB 4G3YH 4F8EA 1J20A 2CSPA 3WIHH 3L0IB 1FVCB 3WTCA 5JXHA 1A6TA 4CU7A 3AB8A 3T4EA 4DXDA 4E12A 1LC0A 4RSVA 2X2OA 5ED4A 4DUVA 1FO0B 3UBXB 4FKBA 1RERA 2P9ZA 1II8A 3AB0B 1YG9A 2H9GB 4M54A 1IQUA 5DVZA 1E4WL 4M60A 3K4ZA 1QP1A 5HKOA 1T0PB 4PIMA 1R5VA 5G53C 3AG4B 4YX2L 3ZCSA 3D69B 3ARBA 3VH4A 2O3UA 1JZ5A 4CGYA 2B83A 4QLOA 3SP1A 2C3PA 3SY0A 3KB8A 1CGTA 3I75A 1FTSA 5I8OL 3AU9A 5BYKA 3H0TA 1DPFA 1X9HA 4PCSA 3AW5A 1KB9J 3LK6A 3A3YB 4AVYA 1VM6A 2VQFB 3AJ7A 1WTLA 3DLIA 3EHDA 3TIDA 1TA4A 3A6CL 3LKSA 3SZKC 3THYB 1P7QA 3SSGA 2B9BA 4X98B 3ROOA 2I7CA 4D4GA 1UWGL 3HRZC 2VRCA 4QXVA 4HO1X 4ENTA 4AV0A 1A1MB 1G7IB 2ZX9A 1ID8A 3DK2A 2Q5IA 3BZDA 4Y16C 4UT6A 4NG4A 1DL5A 2JLXA 4N22A 1QQDA 2ACWA 3DC7A 5AVZA 2VJMB 1CUYA 5KMGA 1U3HB 4YUEH 2B4CL 2D0IA 1JQDA 3GT6A 5JHDA 1NP3A 2QAGC 3BG5A 1C3JA 1IARB 2Z8YA 1XTPA 1QSFD 2EICA 3OZLA 2A7XA 3NM4A 2QADB 5H4GA 1O9ZA 3LZNA 2BVUA 1IULA 4PBRA