2VDQB

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
461
structure length
455
Chain Sequence
b'GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 130
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdqB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdqB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdqB03
1QC5B 4WK4B 1SHTX 4Z7NB 1V7PC 3OL2B 5HGJA 1L5GA 2X5NA 1FE8A 1IDOA 5E6RB 1M10A 4JDUA 3IBSA 3ZQKA 4NENA 1OLZA 4O3TB 4IXDA 1JEYA 1IJBA 3PPVA 2VC2B 1U8CA 4C29A 5KYYB 5KYWA 1SSLA 2VDKB 3GXBA 1AO3A 3K71B 1UEXC 2ADFA 3BQNB 1DZIA 3VI3B 4GZ8A 1BHO1 3FCSA 3VI4B 4XW2A 3IJEB 1QC5A 3V4VB 3OKYB 4MMXA 4MMYA 3OKWA 1PD1A 3QA3E 2ODPA 3OL2A 1M2VB 3M6FA 2VDRB 1AUQA 2M32A 1SHUX 3EFOB 3K72B 3EG9B 4G1MB 4HQLA 3T3PB 2VDPB 3Q3GE 5LN1A 3TCXB 1N3YA 1XUOA 3EGXA 4UM8B 3EH1A 4FX5A 4Z7QB 2I6SA 5KYYA 1MQ8B 5E6SA 4CN8A 3K6SB 1ZONA 3FCUB 3K71A 4IHKA 5HJ2A 1AOXA 1CQPA 1T0PA 2B2XA 4WJKB 3AL9A 3IJEA 4JX0A 4UM9D 3EOBI 2VDQB 1SHYB 3AFCA 1JEQB 4M76B 3AL8A 5KYUB 3NVQA 3EFOA 5BV8A 2XWJI 2VDOB 3K72A 3E2MA 3EG9A 4G1MA 2ICAA 4MMZB 2ODQA 3F78A 4CNBA 1RD4A 2NUTB 1CK4A 1OAKA 1ZOOA 3N2NA 4IGIA 4BJ3A 1NA5A 5E6RA 3TXAA 2O7NA 3ZE1B 3ZE2B 3TW0A 2QTVA 3K6SA 4Z7OB 3NIDB 4HQFA 2UZYB 5KYXB 4F1JA 5KYNA 3PPXA 4O02B 2NUPB 3BN3A 1QCYA 5E6UB 2P26A 3EGDB 1U0NA 4WK2B 3NIFB 3ZDZB 1YUKA 4NENB 1BHQ1 1M1XB 1JEQA 1U0OC 4NEHB 4CN9A 1RRKA 1MHPA 4K3JB 4HQNA 4G1EB 4UM9B 2WINI 1YVPA 3HI6A 4HQKA 2XGGA 1M2VA 1XDDA 2NUTA 2VDNB 2WW8A 4C2BA 3EH2A 1T6BY 3V4PB 1Q0PA 2VDLB 4MMXB 4MMYB 1ATZA 1MQ9A 3TVYA 1MQAA 1SQ0A 2P28A 1JLMA 2VDMB 3NIGB 4O3UB 5KYXA 5ES4B 1IJKA 2I91A 4O02A 4WK0B 1JV2B 1N9ZA 2NUPA 3PPWA 4HQOA 4A0QA 5E6UA 1PD0A 1MF7A 3EGDA 3T3MB 1IDN1 4C2AA 3ZE0B 1M1XA 1M2OA 4FWWA 2NVOA 1RTKA 1L5GB 1ZOPA 3PPYA 3EGXB 4G1EA 3RAGA 1RS0A 4F1KA 5E6SB 1M1UA 3BQMB 1PCXA 3HXQA 1FNSA 3HXOA 1JEYB 5KYUA 1LFAA 3ZDXB 1U8CB 3ZDYB 4WFQA 5HDBB 5KYWB 1XDGA 1YVRA 4MMZA 2IUEA 3EOAI 2XWBF 4DMUB 1DGQA 1TYEB 3AL8B 2I6QA 4PN7A 1PT6A 3FCSB 1MJNA 3F74A 1JV2A
chains in the Genus database with same CATH superfamily
3CFEB 3BB3A 5JANA 2Z7WA 1FNMA 2WC1A 3S34L 1V27A 1TYZA 2BGWA 2XZDA 2IPNA 2JVJA 4HSGA 5J1SB 5HSGA 1DELA 4ZOLF 5J47A 2VHTA 1K1EA 3RUGE 1ZD4A 1H2FA 3PAUA 2ONZA 4KJXA 3S2EA 4IRUB 3P3UA 5JNRA 1SN5A 5I74C 5BS0E 2Q0QA 1RQXA 2F1EA 1GN9A 2FN8A 3ARGD 4RF3A 1P6UA 5E9DD 2E9JA 3GHEH 3WTWA 4C7BA 1C9NA 4HRYA 1IAQA 5FYKH 8FABB 4OIBA 3EF1A 1RERA 4XR9A 1JUFB 4GAJH 2XIIA 3ZJAA 5B4TA 5F6HJ 2MQGA 1MREL 1C8LA 1ISSA 2N9UA 2E8ZA 1WMBA 1R1DA 1VGQA 4Y4FA 2XT1B 4FMBB 1DRWA 4K07A 1HI6A 1VGEH 1PQUA 5K8VA 3T0EE 4H0LC 1ULAA 1A9YA 5K3AA 2W65A 2WB7A 1P7QD 1P1FA 5IBRA 2D59A 4GSDL 1U0OC 2ICWJ 4QRQA 4QRAA 5F7MC 4KXZH 3RX5A 4I7EA 2BFNA 5LGHL 5IR1A 1Y42X 3EO9H 1Z7JA 2Q20A 3EFBA 4GOND 3SEZA 3G3EA 4KYUA 2IC2A 2BOCA 1T36A 3P20A 4OUKX 3K8QA 1V39A 2NU7A 3QU5A 2Q2QA 4KFRA 3JD0A 5DD5H 4CT5A 1KOAA 4DNFA 3AY4A 1T5WA 4X99A 2WQWA 1C5CH 3ABRB 1BVLB 4XDYA 5GXBB 5K59F 2ZE6A 2OJZL 3JASA 4KOEC 1KDZA 2MCFA 1ULHA 3ZZ0A 4PJFE 2H17A 1L7VC 1RJEA 3SY0A 2HIAA 3OHXB 5FFOA 4ADIA 2G8LA 1WNTA 3DUWA 4GAYA 4KROD 4QLBA 2QQKH 3VXSD 3KLSA 3IHLA 5CBAA 1XP5A 4PNPA 2ZYUX 1G7MA 4HF7A 1L3NA 3PVZA 3PGCA 2VN7A 2MOKA 1F4WH 3S29A 2R5WA 2HO5A 2MMGA 4KNYA 2C3GA 5LWYH 3NK4A 1WIUA 3CZSA 3DONA 3S99A 2FAXA 5IJXA 4JYZA 2R44A 4OK6A 3RIXA 4E32A 4XCNB 4MYPA 2LLNA 1NKGA 1RP1A 2AJYL 2VHVA 5EJMA 1O5PA 3ZI4A 2QZJA 2CYAA 4WW2B 2I5PO 1TTTA 3B56A 3BN3A 4KROC 4YBLB 4R71A 3GGCA 2K5UA 1JWSA 1UWXH 1COBA 5HCIA 2XW6A 5KBDA 2PBRA 1T6BX 2V7NB 3RDTD 1ZSDB 3LZOA 5CJQL 1E79A 1T0UA 3ED1A 1X7ZB 2XQFA 1ZZGA 3GMTA 4G5QA 3R06B 3RE1A 1P4IL 2NY5L 3A1SA 2YBEA 2XZTA 3KHTA 3AG1B 4S1NA 2FJFB 4ONFH 5DMXA 2YW2A 1CY1A 2VZ3A 5ITWA 3MV7E 3RYCB 3R1GL 3EOAI 1SN2A 4OF8A 4N0EA 2V58A 3RKPA 1IC7L 3RQ3A 5DTEA 4E70A 3L6BA 3SE9H 4XCCL 3KR9A 1G0XA 4CM9A 1XVAA 2E55A 4F7WA 3EXHB 1R18A 4IU2B 5BRPA 2B1JA 3NN8A 3V9CA 5CRIA 1HDRA 1KWGA 3NUQA 4HW6A 3U26A 1Y3HA 1DXYA 2R56H 4B2IA 1R0AH 1UJTA 5JUWA 1QPXA 3W8EA 5CDUA 3ZK8A 4HXGA 2ZICA 1ORDA 3ZXIA 3OEYA 4UM8B 2NY4B 4M8SA 2B7DT 2WYTA 3BJMA 3ORRA 2B7BA 5CLXA 4GRWB 2DN7A 2ZYSA 5GRJH 3MUY1 3TQTA 1PJ4A 1SXSA 3LECA 3VSVA 5JIHA 5JH7B 3EG9A 1DQLH 3G6JE 4GEJA 2H2GA 2F67A 4PG4A 3MXVH 4R2IA 2AQ3A 4JN2A 4Q4JA 4D6PA 1ESOA 1ZA3B 2CKBA 1CZLA 2ZYHA 5F2KA 2CMFA 4JI1B 4K40A 3KGSA 2JA1A 3IN0A 1CK0L 5KVDL 2KERA 3NEOA 3D85D 2UXGA 1LK3H 1O03A 1V5FA 4WEBH 4PUBL 3PD7A 3K0AB 2Z8SA 1ZVNA 1JHDA 3TB4A 3UV6A 3TEWA 5AW1B 2ERJB 2GO7A 1V37A 4YLGA 3K4HA 4RD1A 1H6DA 2CRZA 4U4AA 4BINA 4F57H 1GCYA 4C76A 5BNFA 1J18A 2HTKC 3G5YA 4F4JA 8LDHA 3OSKA 2QMOA 5E5UB 1O89A 2CXSA 1SY6H 1LP9B 3PNKA 3UKOA 4OXRA 2QQFA 4C7MA 4ZEMA 4LRQA 3FZQA 3WNZA 5CJBA 2XICA 1V96A 3HRPA 1TUBA 3R19A 5HHOE 4KNTA 1ZK0A 3S2IA 3PNLA 4JFXB 4IDJL 5B38B 5IQNA 3RU8H 3FB1A 4PRHE 3A1EA 2IQ9L 4F60A 1U8HB 5I15L 1L0QA 1MF2H 2DQSA 4AX8A 5F1NB 4B3EA 3FO9B 1JKJB 3U6RB 4CL0A 3UJ3X 5JXAH 3O91A 3ADDA 3OXSA 1MW0A 2I1VB 2B25A 1SGKA 5CA0A 2OR9L 3QMVA 4UHCA 4H8WL 4QT5B 4PPQA 2AEQH 4O6VA 3ZR6A 1K3IA 5EFIB 5I7HA 3KOWA 4C4PA 1PW5A 4CT0A 3ENEA 1FFCA 3QELA 3DVGA 2NM0A 5F21A 3IDNA 3P4YA 4HP8A 3P4UA 5D6NA 5JOEA 2YXLA 2Q45A 4URYR 1KPIA 3HG1D 3PHOB 4JJIA 3ZKXC 5L9DH 1TPXC 3DPBB 4NWUL 4HS8H 4G1UC 3KT8A 5GISH 2HAZA 2A6PA 5JRDS 4I5BA 2P7IA 3D3VE 4R83A 3OR7B 3P2DA 1EDDA 2NUPA 3I9LA 2ZJ0A 1GGVA 1QAQA 1H9VA 5AM1A 2R27A 1JP5A 3MACL 1O6CA 1UOQA 4GQRA 3DNFA 3BZEB 1DDHB 1ZOLA 5JLZB 3ISRA 3MLXL 1FBIH 1MNUH 2WHYA 3EHEA 3RB7A 2HFTA 1QX1A 3N6XA 1P2FA 2XZQL 5FKJA 2P5WB 1FGNH 3POCA 1N0LB 5TDNB 3ZH9B 3OQ1A 1HSZA 3GLSA 3CZFA 2ZETA 3TASA 4D0SA 4QHUB 3QLUC 4OD0A 4OGKA 4LQDA 3EJPA 1RZGB 1TXGA 3QMWA 4KSCA 5INDB 3T34A 3OIGA 1H42A 3OOJA 5F1KC 3DBIA 2I9LB 1OP3H 4TS4A 4A6YH 2XHEA 4HOYA 2YFYA 3HSKA 1XR9B 2NAPA 3RZCC 3K9BA 1TF4A 3GK3A 4NN6C 2P3SA 5K6AC 4HUQB 4XM0A 3EEQA 1VCNA 3UROR 1DV1A 4GVLA 4PHHA 1P31A 1NWPA 3OZXA 1R7RA 2OE2A 1G1AA 4KH9A 1KMMA 5K4AA 4M5YH 3TXAA 2XX0A 3B6JA 2NNCA 3HBZA 3G23A 5I1DA 1SU7A 2FJSA 1CXEA 1U5BB 4C56A 4GOXA 1I82A 4E4RA 3URKA 3WBJA 4MYRA 4CC0A 3DBLA 2PZAA 1R00A 3C4JA 1CUUA 3C3BA 1CB0A 3G5ZB 1M2OA 2QVXX 4JJHA 1TW3A 3I3OA 3ZQUA 1KLFA 3T35A 4WTZG 2GSGB 4APXB 3U3KA 4FT4A 4PJGE 4OFZA 4OCRL 2Z8YA 3TZEA 3TYXA 2BBTA 1DS6A 3RUDA 4X9GA 4TVPD 3WQSB 1IGCL 2XN9B 3GRWA 3VH8A 2QZSA 3QHAA 2NY2C 5KWSA 4A2CA 2G1PA 3FNKA 4EOWH 3MOAL 4P32A 2OD9A 1BZ7A 3CFDB 3JTTB 1GQ2A 4ADGA 5FO8A 3ECCA 4LHUB 5EO1B 1Z9BA 1SUCA 4YK4C 3OKWA 3CU7A 3EHBB 4JRXB 4PRAA 5DDHB 5I5GA 3ECBA 2VDRH 2IOMA 5TF1H 4NK4A 3JTSB 2Q3XA 3H7BA 1JGDA 3AM3A 2WG0A 3GAAA 1L7BA 1GTNA 5F7KC 1KTBA 4CKCA 3L8FA 2GM3A 5FK9A 2QXYA 4X9BA 5ILTL 2ZM5A 1E8YA 3VXRB 3PQFA 2ADJB 4BC1A 3VJRA 2Z57A 3I9AA 1KBGL 1QGUA 1B4JL 4NNPH 4E88A 3BSHA 4DQOH 5I1LA 5HHNA 2CO6B 4Y1RA 4YJ3A 2D1RA 4JVSB 5KSVB 1I7DA 2V3EA 4NQED 1A5TA 4JASB 5ITFA 2Z4RA 3SOZA 4HWBA 3ATAA 1PKQE 3GMPB 2JATA 3IILA 1KPUA 3L0YA 3NRJA 1J0XO 2QTLA 1GZQB 4HFUL 2R9HC 1HL7A 5IGXH 2ZWZA 2WKOA 5KSBA 3ESAA 3G9ZA 5J3JA 1UFOA 4J27A 3VJ6A 3CE9A 3WBFA 4D5GA 2FV8A 2ATKA 2F17A 1CV2A 4K5QA 1AXTL 5AVWA 2JPDA 1LEIA 1FSPA 1QTSA 4FTVE 3WJ1A 4UAOB 3DV4A 4RVFA 1AUOA 1A6AA 3JQAA 4POZC 4WV3A 4YHIA 3BOVA 3UACA 4FM9A 4JQVA 4RA9B 2W0PA 4Y1TA 4G8GB 5AOCA 3WXVL 3L2LA 3PLAE 3F6EX 1VC2A 4HDKB 3LDUA 2HFGL 3FYUA 1SKMA 3U7EB 2B3DA 4LAFA 2RHWA 4N8EA 1EK3A 2VITA 4HDIB 5TE6H 3NJHA 2BWDA 4GVPA 3ORYA 3G5MA 4KK5D 3U40A 1LBIA 1BEYL 3VFPB 1SEVA 4RSRA 2EDDA 4R4ND 5EBWB 1XB6A 3HYSA 4PMEA 1VPOL 3EIFA 1T4CB 3O83A 4X94A 1GPDG 1GKLA 1QBMH 4B9PA 2AQQA 2FN4A 3KPQB 5I6PA 3G5VA 3L2MA 1ZCAA 3GXTA 2IS2A 4G0NA 1T43A 1RRKA 1AU9A 4I50F 2BGIA 3RJQB 1PX3A 5KTKA 3SJVA 3DYPA 4J12A 4MVBD 3AJAA 3WK6A 3GSOB 4CKWB 4LQ4A 4M3HA 1AFVH 2UUDK 1YBMA 5D1ZD 5I0WA 2XAAA 4MAZA 3MODL 3W5SA 3V95A 3R40A 4OCLC 1MCIA 4PJXA 5K39B 1NC4D 4FNUA 1HDMA 5H68A 1T5TA 4KK5C 3JTMA 2WF5A 1PFOA 3V52L 2ENWA 1KPVA 2JAXA 3HY4A 4WXPA 3AL8B 2VAVA 4R4NC 2WSPA 3E6HB 4EUHA 2XIBA 5IM4A 3VXKA 2VLBA 1JHUA 3MTXA 4WY5A 2OEPA 3CRVA 3QJYA 1SY7A 2DIJA 2X7LA 3QUXD 4HUJA 1R3DA 3BKML 3KWJA 3LJKA 1Q9KA 2VHYA 5JWHA 2NTSP 5EN3A 3I2IA 2MT9A 2VL5B 2I78A 1DFIA 2XWTB 1GV0A 2I3AA 2OMBA 1GGCH 5AVSB 4QAMB 4MVBC 1U8LB 3IQGX 2FEOA 4BNWA 4HI0E 2HFEB 1YA4A 4MVJM 2PN5A 3G2PA 4DA9A 3KXLA 5CJ8A 1RUPL 4NFLA 4KTGA 2MSEB 1H2YA 1F9EA 2YYYA 4H3HB 2C94A 1OZ0A 4BX8A 2Q5LA 1WFUA 2QRKA 4ZXBB 4X54A 1QBLH 2VR5A 4I77H 2DJIA 3QUXC 3ON5A 4KPYA 3N55A 3R0ZA 2DE0X 4UMEA 4M4RB 4O00A 3BRSA 4CCYA 3IDGB 4JREC 4S1RL 4QO1B 2SICE 5KAPA 3WYCA 2FWSA 4DO5A 4LVOB 4B96A 3RASA 2Z0UA 1HT2E 1MVFA 2AKRB 1MHEA 4C2UA 5TJ9A 3MLRL 4MNQE 5C09E 1NBOA 1F1AA 1CE1L 2YAOA 2RACA 1QA9A 3V2AR 1LWNA 2QY6A 2QVIA 2DKNA 4YCJA 1DKPA 4JCWA 4M87A 3QHFH 4EJ6A 2N1MA 3PP4L 3ME0A 2WCSA 5FBRB 4Z0BL 4C4ZA 5TGTA 4KJWD 4XUGB 4URWR 2CT8A 2XBZA 3A47A 2XPZA 4TRRA 2VYRE 4TSFD 1JV2A 3O9ZA 2LXNA 4UKDA 2FZCA 1MJ7L 1X4ZA 4OGYH 5I7EA 4XA8A 1WHSA 3S68A 4YT4A 4TLTA 1DAFA 3HJHA 2DHCA 2QJWA 3JVFC 1NQUA 1AKEA 4EI5D 2WWNA 2BRRH 2R0LL 1G3UA 3MM4A 2YPKA 3VD3A 5KTTA 3C60A 3MRDA 5BN5B 2ST1A 3D39E 4TKWA 4KRPC 3BQUB 3VZSA 3PTLA 2XXFA 1U93B 2BOLA 4IJTA 5EMYA 4AQZA 5KSPA 2JI2A 4KJWC 1P0QA 1O7DC 3L7DA 2FNBA 1X6LA 3LPFA 2HHAA 2HP4A 2YD6A 4HIIB 1A4RA 2H4HA 2NP6A 1NIPA 2ZAOA 1A6WH 3HUEA 3SSOA 3L8MA 3T4YB 3K73O 4N12A 1GYUA 3ROZA 5L0QC 3OTIA 3PF9A 4IOMA 4IQ8A 4RQTA 1GSMA 5IWCA 1PSKH 1BOYA 4OR1A 1XEXB 2C58A 3WN5C 4L48A 3VFDA 5TQ0L 4L8DB 2RCSL 2Z0BA 4NOJA 3BH8B 5FGBA 1UJ2A 2WUVA 5JIPA 1IEBB 2VP4A 1G3IA 4Z3TA 4O4IB 3KPSA 1BFDA 1SLUA 3SPIA 2UUAB 3K0KA 4PZCA 5FNVB 2W9DL 1VF5C 5DVZA 1GILA 2B7LA 1AHMA 1W8IA 4YIKA 2BP5M 3L6UA 1YOBA 5FKAB 4E12A 4XH9B 4Q93A 3I75A 3MTQA 3KYKL 5EIOA 4AD8A 4HADA 2OLEA 5BR8B 4AF7A 4ORZC 4OP2A 3WIIL 4ZI8A 3TLBA 5KTMA 4UHDA 3WJJA 3BMOA 1ZV9A 4KDEA 2G9KA 2C4UA 3VRLF 3K4DA 4JNCA 1UKTA 3RL1A 2A14A 4FBLA 1IM2A 4N54A 4KH2A 3VOTA 5FIUA 3VVLA 4F1WA 4P0PB 3NUZA 3O8NA 3ZUNC 1DOAA 3FMIA 2FMUA 5C5IA 5FAXA 3DO8A 2FE4A 2NWQA 2HIHA 5AW2B 4PJ8D 4ZICA 2KZWA 3ZE9A 1VB9A 2NYUA 1FYTD 5AVUA 3HCBA 2QL6A 4MJ5B 4GYKA 2DIAA 2FVYA 4PHXA 2F3PA 2CLMB 2AF3C 1GAFL 4DDKA 5AG8A 1LEGB 5JPIA 1M74A 5KVFE 4A91A 2ZCKH 1N0UA 3W6UA 2OTUB 1E2QA 3U4DA 1QLEB 4L95C 2WWMC 1JHXA 3COZA 4NNYA 1XH1A 1LJUA 3VH8G 1IQ0A 1QLFA 3ONFA 2X6BA 5I18L 2BGMA 1E43A 2EE2A 4MI3A 5IFAL 2P0EA 3C5SB 3GSNA 4F8JA 4NIMA 2QGEA 1WDMA 1U4OA 2QRLA 2DGDA 3UTPE 2O0LA 5ALDA 1GGHA 4JELA 3AJEA 5AJVB 3KVNA 5IQ9A 3PQ2A 3A2NA 3BFJA 3K5HA 1LSOA 4M6NH 3LNHA 1JZDC 1GDTA 3IERA 4EZKA 5BZXA 5HYJD 1G8FA 4YOKA 4DADA 5HYSA 5D7JC 2RHTA 1K85A 4C20A 1BXUA 3MYZA 3RS4A 5IJ0B 3W8DA 2GSIB 1PG2A 4IIJB 1TITA 2WSIA 4DEYA 2A78A 4PO9A 2I7DA 1Q8MA 2CXXA 1D4OA 1AMOA 1W8NA 3OJWA 1RW4A 3QXVA 2YWDA 5JW3H 3W6ZA 2ORVA 3KBOA 2GBCA 1KH3A 3D8MA 1H69A 3CRMA 1BECA 4U7FA 3MRIA 5EWIH 1CUOA 2IH2A 3ZWVA 2DLIA 2GD0A 3B3IA 1S7QB 3L3DB 3IESA 4X3PA 2OFWA 4DCQB 1YFZA 4QYOB 4G1MA 4TYUA 4HDOB 5KDOA 2EC9T 3HR7A 3FB7B 3TZBA 2HDHA 2ASEA 3S8MA 4O4HB 5CDFA 4Z8FL 1CYEA 3EDCA 4FEAA 3DMPA 4WXEA 3U0PB 1TZAA 1ETB1 2DQEL 4FR5A 4ZVOA 1IUZA 1LE9B 3PEFA 3ADBA 4G7RB 1G5FA 1K3TA 5F5LA 4MS3A 1TT5A 4TT3D 5IH3A 1AM4D 4PRPB 4OSUL 3GRFA 2XT6A 4GKAA 3MXOA 3LS5L 2YS4A 4JCCA 4UQPA 4BIIA 4HDNB 1XZAA 3BPOC 4D8PB 3T3PF 3WSQH 4A7PA 3UA3A 1RK0A 3GFGA 3O6VA 1J8KA 1QIKA 2A74A 2PJUA 4BGUA 2R4SH 5PAZA 4P93A 4BZ1H 1KR2A 2ONYA 5E6RB 4RV9A 1KTLA 2R8RA 4NYIQ 3AKZA 4RA0C 5CEYB 5TTRA 1D1SA 3MBWB 3S34H 1JE0A 3LBAA 3NZ8B 1U7UA 5FR1A 3ZHOA 3M6FA 3CX8A 3RV3A 3ARXA 1NUQA 1RRPA 3KQHA 4ZRDA 3WL7A 1DG1G 3VFMB 1FNDA 4BNIA 1E4EB 1KARA 3LFUA 1Y7VA 2OFFA 5B5SA 1IMOA 2O4CA 3QT2A 1V7ZA 4PB0H 2PXHA 3N8KA 1FZMB 3G6DL 4D4IA 1GN8A 3Q9SA 4KMOA 3G2LA 3IDXL 1G291 2Z2JA 1RWXA 2NU8A 2HSJA 4YSEA 4C4BA 3FMFA 4L5FH 1C3XA 3I02A 3UUGA 1RCUA 4UCFA 2CO7A 4C4UA 5I6LA 5L8LB 1JA1A 2BK8A 4PJEF 4OH2A 5I9NA 3VQ1C 5GGRA 4XWGA 5CP8A 5D9SB 4CC4C 5TFSH 1AXSA 1WAEA 2PLRA 4GSDH 3D4PA 4LF7B 2QLBA 4LCWD 3FNRA 4BGEA 5CYPA 3RYMA 3CJQA 3LKQB 1J2JA 1PNOA 4PJDF 1I53A 2JIZD 1IIKA 4JVOA 4M8IA 1Z75A 1CJTC 3GUTA 4QUDA 2DBYA 5JW4M 1UMKA 2R69L 4K28A 4B6ZA 4DETA 1N25A 1IBYA 4ZQKB 4RGYA 2BSXA 4BVBA 5IT0A 1H2BA 4WKBA 3BH9A 1QYGL 1OCOB 3W5VA 4Q18A 1W0KD 2QEJA 2N0MA 4IV5A 3SG0A 5I3CA 4Y9BA 1DXQA 4OQTH 5LCVL 2R4TA 3FOFC 4Z4GA 5EU5A 4GFTB 3WTBA 2JFYA 2EVGA 3SZMA 2YY6A 2XVAA 2XFXA 3B8YA 3I61A 4JT9A 1JJ7A 3WUZA 2R1WA 4I0CC 3N2IA 4N7BA 3WKEA 3TS8A 2WBJC 4GG8B 4LPYA 3GDGA 3EFOB 4W9GC 4JODA 4YSTA 4PWFA 3U30B 3L5XH 4ZI7B 1XYGA 2ZX8A 5BO1H 1IHOA 2X14A 4OF3A 1SXJD 3MG9A 2V2TA 6TAAA 4HWEL 3DE6X 3AMLA 4AZUA 4EIWA 3H8NA 4M93B 5E8JA 1E2MA 3BJRA 1QE3A 1TQ8A 3ARED 1TKRA 3SC6A 4PIPA 4FQIL 5HDRA 2ENSA 3ZWCA 4PGZA 1DKUA 1KENH 1XEFA 3GMRB 1AZZC 3A31A 2YIDA 4U1SA 5K20A 1VGKA 2IF0A 4MCZB 2AJYH 1NAKH 1THAA 4RD0A 4AXWA 5HM6A 2V7WA 5IFLA 2Z83A 2ZQYA 2PTHA 3IMKA 3OE1A 3GMMA 4B41A 4GMHA 1E9EA 1JWLA 3D69B 1PS0A 1GYVA 5FW6A 1E59A 1SXJC 1TF7A 4GO6B 1YRLA 3HEMA 3V8QA 4QRRD 2VWGA 2H63A 1JQ3A 4MIYA 2NY5H 1IEXA 4HJJL 2D13A 1UINA 3AREC 3SIRA 2XDQA 1USWA 5IDYA 3X1JA 3VFGL 1WCIB 3LZNA 5F9WB 1NX9A 2CXHA 4RHTA 2AJXL 4R7XA 4GLBA 4DW8A 2B77A 3ZWBA 1OHHA 2XOKD 2GXSA 3SSAA 1ZO8A 3GQBA 5B1AB 1Z9LA 1G6HA 4PJBF 3H8WA 4GX2A 3GZKA 4HWUA 2F8OA 1OCWL 3IAAA 3OXRB 5EF0A 4Y4FB 1XA4A 1MN6A 1MDTA 4IIQA 4RDQF 1EVYA 5LLIC 3KS0J 3Q5DA 1KBVA 2VQ6A 3U5ZB 2RB5A 4KMLB 1DRKA 3LEVH 4QRQB 4Q9DA 2W8ZA 4NKIL 4JDTL 3H9GA 5IR1B 1OAKA 2UXBB 3GRPA 2HLHA 4Y9SA 4IH4A 3ZY3A 3NTQA 3T5DA 3CV5A 1BFVH 3RI3A 3R8BB 4IIEA 1OALA 1JLHA 4H40A 2XKAA 4WCFB 2NU7B 2L18A 4ACBA 2ECPA 2J4CA 3KJQA 1AXGA 1T5WB 3WGZA 3DJSA 1CK0H 1FNGB 3LXBA 1PS9A 1W7AA 1B42A 3W7BA 2Y99A 3JASB 4LPUA 4IDQA 4JPSA 1FSKC 1RKUA 2G06A 3R3JA 3L8QA 3VQTA 4QM7A 3CSYA 1LM8V 4UAUA 4GAYB 4QRTA 4FC6A 2SKEA 3JQ7A 1FL5A 3F5WA 3FHLA 1U3CA 2B2CA 3VD1A 5HK8A 4PN7A 3M1AA 5CBAB 3KR2A 2GVNA 5EZOL 2JI8A 4KWEA 3NH7L 1JRHI 1G7MB 1AUPA 4OQYA 5K3BA 4QBFA 1HDOA 5YASA 3J07A 3R23A 1XRSB 1KU0A 3LUHA 2Y1WA 4KIFA 3H9JA 1EVJA 2GN2A 1YAJA 2X9GA 3DLTA 4IDHA 4QTXA 4BASA 4EYGA 4YAIA 3HFFA 3WG9A 2LTQC 3VFNA 3VX4A 1OOEA 1PEWA 2F54B 1QIHA 1D5WA 1FTYA 4HUXA 5D7NA 3N91A 2W00A 1WB5A 1DP4A 4P4LA 3NEAA 5IG2A 5JDIA 4J1SA 4K7PX 2X2OA 4WZBA 3VI4A 2CE6A 1CU4L 2YFHA 4PU2A 4GOMD 4DSAA 4H8WH 3RIFK 4NATA 4O0LA 1NI3A 1JWSB 5EZ5A 1HC7A 1AYRA 2NCEA 1WTCA 5GSRA 2IV3A 1M9WA 1QO7A 4W6YB 2GYUA 3H4TA 3BJIC 2DJMA 4C4RA 3DLBA 4ON9A 3NAZA 1P61B 3DL4A 4CXMA 3NBMA 2X8JA 4IIYA 4FDTA 1XNRB 4NWUH 2HNBA 2BO0A 4DEPB 1BH2A 4PG7A 4P59L 1QCZA 3B38A 1NVMB 5B3LA 4Z7QE 4KJPD 1LLAA 3CU1A 4YO0A 1VZ2A 3FX2A 4EG6A 3T0XA 4LQFL 1JNHA 3WDIA 1MIML 5CKGA 3PJGA 4CA4A 3HBQA 1Z9OA 2AK4A 3UMTA 2X58A 1JDPA 3MJ9A 1KTIA 3QPWA 1QWHA 3OE4A 4HRVA 2C1XA 1AO7B 4DHWA 3T2OA 4M0PA 2Z0MA 4OZIE 1LX7A 3ZGXA 1Z6QA 1G7IA 1YWGO 3K6DA 3VMPA 1TLMA 4E6PA 4AQDA 3L3JA 3SKOA 2QX6A 1EX6A 4CE6A 2B5WA 3GFFA 3EQ9A 3C09B 3EG9B 1LYQA 3UEZA 4UDOA 4I5IA 2A3RA 4JN2B 1NVVR 4WQOA 1GL3A 4ZC8A 1Q50A 4PVBA 3VU2A 4XWTA 2Y1EA 1UM9A 3S2YA 1DLJA 3AR9A 3CEJA 3MNWA 1YC8A 1SZPA 4BZXA 4LJ8A 3DXAE 1T8UA 4OCWH 3FH7A 5H5JA 4PC2A 4PCAA 2HBQA 1YUMA 3V0VA 4FG0A 1XKTA 3STZA 4P9HH 1G64A 2BIQA 3SKNB 2WDPA 4LSPH 1KSRA 5EEXA 4C4KO 4ZFGL 3OBAA 3A4YA 5F7EH 3U5TA 3NONA 1SKAA 5SZHB 2VWQA 5HRUA 5FDFA 4AZ3B 1I4FA 2VHXA 1OZUA 5ACMA 5F44A 4F2PA 2UVFA 4FERA 1IJKA 2AJZA 1Z68A 3FOAA 5CZVH 3K1YA 5A0TA 4V0LA 1TUBB 1PEDA 2WIMA 2EXSA 4M9OA 2WJWA 1EDQA 3FFCA 4P34A 1E6MA 3R6DA 1TQDA 5FYKL 1OWNA 1FCGA 4FX2A 3B7WA 3IP9A 4A68A 3FB8A 1SHTX 3ZSSA 4CMHC 3MA7A 5IB4A 5FBWB 1G9NC 1QS0A 3CFYA 2HSIA 1JIUA 1G18A 5CA0B 1GGBH 4FP8H 4YROA 1VGEL 2P3QA 1BQ3A 5J40A 4CADA 2ZAMA 3MV8A 4S10A 4J3WA 2XYVA 1MAML 3MOAH 2IANB 1NULA 2DCUA 5LG6A 4OQFA 3DVGB 3UH0A 4CU8A 3IDNB 1WXQA 3C39A 1S0UA 1MB4A 3B2MA 4HNQA 3MWKA 2EG5A 3IELA 2PSJA 3EO9L 4IHJA 1INLA 2RONA 5DGQA 4CU6A 1YRAA 3DDSA 1L5HA 4EYEA 4NSNA 1XD2A 3OTQA 1C4WA 3ASUA 2FSEB 1ZS9A 3ZGZA 2X0EA 4KXBA 4I5BB 4D0GA 2HG0A 4UU9A 4HOZA 1YZNA 2C7RA 2Z92B 3PGKA 1YR9A 3AETA 2EIKB 5ILTH 2NUPB 4HWZA 1UFQA 1KBGH 4K88A 4N40A 1GAJA 2F74A 5ESVA 2PWBA 2AFNA 2G2PA 3WV5A 2XGOA 3SBOA 4KVAA 2BMVA 4HLDA 4ZOBA 5CCJA 1TOAA 2WI8A 3RX7A 3PY9A 1MCQA 5LDUA 1ZI9A 2P67A 2WO2B 1ZD9A 3G7TA 1I14A 4FLHA 4YMLA 1QO3A 3EJZD 2Q5FA 2GD2A 4M2LA 4PX9A 4HPYH 4HFUH 4RL6A 5A5FA 3CZFB 4W1SA 1D8AA 4ZMLA 1P3DA 4KU4A 5GGSY 3FS9A 2NV0A 4OLAA 2J55A 2EP6A 1ZLWH 4UVIA 4OVVA 2EDJA 4J4PA 1YNTB 2LIPA 4HJ0C 4YHPA 5E03A 4KDFA 3N1PC 2PZ8A 1CTOA 5AKXA 3AQ4A 4ITUA 2I4RA 4LJ7A 1QNIA 1T0IA 1U8UA 1N6OA 1ADQL 2E75C 4PGMA 4EG0A 3WHE1 2O8EA 4PG5A 4JQIA 2ISSD 5I1DB 1XDSA 2HFGH 1E9RA 3QYFA 3NYKA 1QTPA 3JYCA 4C56B 2YXWA 1GTRA 4MTCA 2W48A 4YRAA 1DBAH 2QVMA 4E2XA 2PXYA 4FFYA 5EMNA 3U4BH 1JILA 4NXMB 1U3DA 3RV4A 1BEYH 2E5WA 4HEJA 2ZJAA 3MX0A 4JFDB 1CQWA 4A2PA 1M2OB 4MCHA 4Y2JA 1VPOH 2P9YA 3KFXA 5B36A 1T04A 1N5AA 1KLFB 4HUTA 1Q44A 2DH5A 5HTOA 4X5WA 2WDZA 3DFUA 3HZ3A 3LN5A 2FW0A 2I69A 3VH8B 5DRWB 1H9DA 4YJ2F 2GPTA 1ROWA 3IDUA 5IEKA 4CV3A 1IIBA 1HTWA 2FMXA 3DV0A 1CJSA 1GYCA 4XOBA 4LZAA 1W0WA 3L41A 4G0WA 4WUKH 2O8CA 1K5HA 4LBVA 4PRAB 4KACA 1FZJA 4BTVA 3RLSA 3MXVL 3V6BR 5LVAA 3H7BB 3SXPA 3TX6A 2I1QA 5FWYB 3QFDA 1XGKA 3I5YA 2FH5B 1BYIA 2WTNA 3BKMH 5HVHB 4CKCB 4TL8A 3O6FA 1LK3L 4RBPK 4WEBL 3ZIDA 4P35A 1JECA 2X9LA 5EP1A 3TPCA 1QGUB 3CX6A 1UJ3A 2EDHA 3T3ME 3ZWWA 5I1LB 1UAAA 4JCMA 4JX0A 5HHNB 5TK2A 3ABMB 3MUZ1 1GNQA 4YJ3B 4X80L 1XSKA 1AZRA 2JGIA 4PBWD 2WUWE 1OSNA 3CXHK 4NUMA 1CD1B 3VZCA 1RUPH 1UPBA 4ISCA 2A7XA 1ISRA 2HRDA 3L7OA 3OUZA 2W2QA 4NAVA 1A1SA 1PFYA 4AUKA 3IAFA 3SYQA 4MVJA 4TLCA 1ZC3A 3ORQA 2YQGA 1YMMD 2ZX9A 1L6RA 1H3FA 1W88B 3V4OA 1LSJA 4E22A 3V4VA 5HJEA 2AN1A 1P5JA 3NETA 3NJLA 5KSBB 4XWYA 1MC4A 2PR7A 3WTCA 3RU8L 3VJ6B 3LHKA 1H1LB 3C2QA 1PZCA 2PMFA 5C0GA 2ATKB 5L3SA 5F2OA 2WTOA 3MJHA 5GSVA 5AVWB 2VISA 1LEIB 4O4JF 4RDBA 1DJHA 2YHIA 1RE0A 1TEYA 4RBNA 1KXJA 4XIYA 5JXAL 5LIPA 3JW8A 3MLRH 4QUGA 3DV4B 2AMVA 1CE1H 3FRPA 3TK1A 3JQAB 1GZHA 2AEQL 2IAAC 4LSRH 2GW5A 5DTMA 3AB0C 1MIEL 3HJAA 3C3XA 3TUJC 1Q1GA 4Z0BH 3PI6A 3L4KA 2F3SA 1ZXKA 2EYUA 3FYUB 3VFTA 2QN2A 5BN4B 5FPTA 1HG1A 3TTUA 2VITB 1MJ7H 4N28A 3GN2A 3OCVA 2ZYTX 2V9UA 4DUXA 4H0HB 4F8YA 3KWVA 3B3AA 3MRSA 2OCXA 5L9DL 4PTZA 2BHYA 1EUZA 4HS8L 1C1XA 5GISL 2R0LH 3N07A 5DHAA 5D51S 4U8HA 3BN9C 3REQB 4KFTA 5A2FA 1DBML 5HVGB 2PWEA 2VRNA 3ELDA 1GMEA 2IHYA 1UXWA 2ONKA 1E62A 3M1CA 2WIFA 4L1BA 4K9JA 3SJVB 3HWRA 4LHJB 3ZI7A 2GAIA 2X4IA 4XPIB 2PYIA 3I8SA 3VKUA 4FFVA 3ZHCA 1MNUL 3BXZA 4F3FA 3DOOA 1FN4A 1ONSA 1KDVA 5LXTA 4TLDA 2APTA 2H9IA 1WJGA 4PJXB 2WFAA 1HDMB 5J2TA 1F0LA 1FGNL 4BNDB 4V39A 4JFOB 5IBCA 4AGQA 1KKLA 1DX4A 2WOJA 1HZLA 4EKJA 4Z53A 1JSLA 2ZYDA 3NJNA 2X7LB 2D9QB 5LAXA 4BFOA 3A14A 2BDTA 4A6YL 1Q9KB 2WXPA 1U21A 4L8LA 4PX2A 4DO6A 4YDMA 3RFVA 1CR9H 3HCCA 4D80A 4NIKB 4M0MA 2YJZA 2WNGA 1URPA 3PJRA 4LRWA 2B08A 1N10A 3M7IA 1PVOA 1W80A 2DEYX 3KEFA 4LX8A 5B1YA 3KYKH 4YDLB 4JEMA 1N4DA 4M5YL 4ZDIA 1LZKA 3AUAA 4BNLA 2WR8A 1TUIA 3QXJA 2Q7OE 2E46A 4OHKA 2INGX 1UM6L 3O4FA 2QNBA 2C9PA 5IB1A 5D2LA 3PIQA 2HV8A 3ZHBA 2P9EA 2JRLA 2PWHA 3A9WA 3EQ6A 4J2XA 1B0UA 1KZ6A 2P28B 3H9SD 1Y3CE 3IUBA 5AL0A 3B1FA 2ZPUA 1R5WB 4CCYB 3WGLA 1YK1A 1EB8A 3X1DA 2VRAA 1ZXQA 1JYXA 4IGBB 3O1LA 4IQ0A 4R5TA 1A04A 2SHKA 3H0CA 1MHEB 1UDRA 1LXMA 4E4YA 2P4UA 1BQHA 3KPYA 5D70L 4DGYH 4W4TA 1QA9B 32C2A 1FP1D 4LOLA 1QSZA 1OV4A 5I0XA 1OKKD 1ZWIA 4H31A 4MS4A 1PQWA 3WIOA 4MV8A 3GGGA 1JH9A 3LZLA 5JBIA 4CL7A 1U3FA 2VXTH 3OEHD 3WDLA 4HBQA 3CBQA 1BCRA 1RPJA 2O72A 4P82A 4LLWA 4LXQA 4KQ9A 1SQ2N 2GGSA 2LKCA 4BP3A 1JV2B 3EZ8A 1IB0A 2J1LA 3QKSA 5FBVB 5I18H 2NW6A 1ZK1A 3QY0A 5IFAH 5E3HA 2YIJA 1KXQA 2VDRL 1RZKH 1G84A 4ZAGA 5TF1L 2I8AA 2NLJB 2K3TA 5JRJA 1JFHA 1OD7A 4RY2A 1IUPA 3CN3A 4YXWD 2YPKB 2HUPA 5GTDA 1R3KA 5AKZA 5EKDA 2RK3A 1AZBA 3C60B 3MRDB 1UT8A 3GLDA 1XEWY 5AKEA 3KJZA 1LX6A 3CHRA 1RZQA 4OB5H 4C47A 3DRQA 5J06A 5H7XA 2FTAA 2ZUCA 4DQOL 4TSKA 4LMPA 3KQPA 4XAKD 3GPLA 5DMGD 5IJVA 1Z83A 3KL5A 1GAEO 4ZQHA 5CD9A 1NOAA 4BJLA 1IX2A 3LPCA 3FPBA 1N8TA 2Y6TE 3JZDA 5D7LA 2I7OA 4JJ4A 2J9GA 4G3XA 3FOMA 2JAUA 5A7FA 2VKXA 1XZDA 1I1YA 4AS3A 4BU0A 2MCPH 4FHEA 2FW7A 2ZIGA 2GCEA 1TYCA 2CDCA 3NXSA 5IGXL 2ZXBA 5J4VA 2X0UA 4ANVA 1KMQA 3PV7A 3LKRB 3ZTWA 1VB5A 2N01B 4KFMA 3O84A 2WYUA 3G8DA 2O30A 1SKQA 4J3OG 1AGNA 3TRJA 4Q58C 3KPSB 3I3EA 1CG6A 3TBFA 4HH9A 4L3OA 1G17A 2QZ4A 1X9IA 5DQ9A 5DMGC 4H08A 3FSGD 4UEJA 3QZLA 2Q4EA 4NWTH 3NM6B 3G04A 4AM8A 3I75B 5IAJA 4DYDA 1A9VA 4GUDA 2E5EA 2G88A 5M7EA 2CK0L 3BL6A 1IY2A 3BMOB 5F77A 5JS1A 2NSMA 4K1XA 1PFVA 1KB3A 4GRWE 1V5EA 4YFDB 1IM8A 3QK0A 4I14A 5JSZA 3H4VA 1RKQA 3U61B 1A0QH 1JZGA 1G6RH 4QKTA 1RHUA 1N7IA 3RL1B 4ACTA 2WV7A 5FYJE 4YV1A 4DW2L 5AWNH 2NVWA 1FA4A 3Q0TA 1RLJA 1Y1SA 1J90A 4M7WA 3WNKA 3FQTA 4U6QA 3DO4A 3V80A 2OILA 1EGJL 4F45A 3ZX4A 1A5FH 1QBML 4J3FA 2O2EA 1D3CA 4MMYA 4PJAF 1SBCA 3MBOA 2VLJA 1RYZA 1VIDA 1R33A 1KERA 2H4FA 2XVZA 4TQGA 4HYEA 1U8YA 1Q2UA 2N7BA 4AI6A 2H32H 1OSYA 5D7IF 4FJ1A 2NW2A 1BN7A 1AFVL 1KIPA 4O9HH 3ZCUA 3AEQB 2OQ2A 2HNKA 4ENUA 1Z9SA 4LYYA 3SPCA 1I3RA 4AVJA 1LP9E 1QLFB 5C0FB 2VW6A 4DP8X 4ERSH 3NIDB 3GLRA 4PJ5D 3GSNB 3FPLA 3H9UA 4ETWA 3OWHA 1DQRA 1YZVA 3SQRA 3WGQA 2ICEB 4GUAA 4KC0A 3VV3A 1X5FA 5L4NA 2EDCA 1F0YA 3PYXA 3ILYA 1W4CA 5IQ9B 1M6WA 2JI4A 2AQIA 4D9MA 3KG2A 4X6CF 2DQ4A 2KMLA 3VG9B 4XP4L 3SQOH 1O5IA 4U2DA 3X1NA 1QFPA 1TU4A 1CJYA 1DJGA 1SCDA 5IW8A 3R9IA 2EH7L 2VPZA 2X4OB 3PC8A 3H11A 3DGFC 4ZVUA 2X19A 4G11A 4ARUA 4CM1A 2R69H 2DQMA 2DT8A 1T2AA 4ZFZA 2YWFA 1AKWA 3MRBA 2X6CA 4BNMA 5AIBA 4GPEA 1XL4A 1F1JA 4FWTA 2NYVA 3LDBB 3B51X 1F6FB 3NJIA 4DJMA 2O6HA 5D6CA 3MRIB 1QBLL 2WAMA 1LLFA 2PGLA 3K1AB 1K7XB 4FEYA 4DV3B 1C14A 5KS9B 3B3IB 4F04A 3K46A 2A4KA 2OI9B 4G1MB 2YVKA 3H1EA 3K9NA 1UWKA 1A7RL 5K0NA 2I9KA 4QNPE 4UUNA 3UKJA 3JYQA 3QITA 4MQ7B 4L1TA 1H5NA 1DBSA 4S1QL 1E27B 2IDMA 3N2GA 3ENWA 1JTEA 4MQXC 2ZDGA 3LK7A 4UPVA 3SGKC 2EE9A 4OBXA 1S9HA 3QNUA 4BDSA 5AVQA 1XSOA 2YNMA 4AVIA 4B81A 3FRPG 5DC4B 3KSRA 1TT5B 2ZJFA 3JR3A 4KQGA 3RAEC 3AKDA 1NURA 5AJWA 4Y2UA 4TNEA 4F8LA 2FHFA 1PJ3A 1KCUL 1RK0B 4RZHA 6CGTA 5M34A 4ANXA 5LP6C 4P4SA 2BRRL 3WLOA 1UZ6E 2DFPA 3MFQA 4MRAA 3PPYA 4HOMA 3CSGA 4G5FA 1KTLB 2L7EA 1JR2A 1G9HA 4IOSD 1BPLB 4GI8A 3GGWA 4MMZA 1GRCA 4LRTB 5FTJA 2YIHA 3IJ5A 3S28A 3GJQA 4GM0A 1O7JA 1CICD 1YQXA 2DS4A 2I3DA 3ULVH 3GWGA 4WDRA 4HJJH 2WKLA 1ZN2A 1CERA 1SIBE 3NT5A 1I8TA 3RJ9A 1Y7TA 3MLTA 2GJPA 1A6WL 4DV1B 4AWJC 2FXVA 2AJXH 4JUTA 4V1CI 3O4LD 4XHQA 1PSKL 4HCRA 4CCAA 1W4ZA 2P9RA 1LLUA 2NU8B 1XUOA 2IPXA 4NI5A 2VXSL 2YEQA 3I02B 1XH3A 4AEEA 3P94A 5BYAA 5MEQA 4ZVNA 2DHDA 4D0NA 2ZDHA 4CM3A 2CO7B 4H0NA 4C5BA 4M9UA 1NNEA 2Z8ZA 2H5LA 3GVIA 2FP4A 3UTDA 1OT4A 3W1WA 3B6MA 4DGVL 3MGAA 3LFTA 1R9GA 1AXSB 3MNVB 4MB4A 2YCLA 3V7YA 2XN9E 4YC2C 3P4NB 1DJLA 4XXWA 4MRNA 2I71A 3IU3A 3GCZA 2HJKA 4NKIH 4R51A 2AJVH 3GUTB 2A84A 5F8RC 1I7UA 5ED4A 2EVFA 2I4LA 4JFED 2VEDA 1N57A 1XZWA 3X1KA 4A8JC 1MC5A 3I6SA 4BTEA 1Y18A 5IP4A 2YRFA 5FL7A 2ECQA 2WAHA 1T0OA 3WY9A 4CIVA 2I7VA 3A9VA 4GBMA 3TMYA 5T1MA 2HQBA 3VX0A 4XI9A 2V0NA 5EU5B 5K3DA 4CTMA 4OAQA 3CVBA 3CN9A 4GLFA 2QRNA 3BQVA 3JXAA 2QI9C 2R1WB 1F51E 1SJ9A 3A0UA 5LN8A 3VXRE 3I30X 3KHUA 3DFFA 5DWUL 1JZ3A 3VWJD 4Z7UF 1URLA 5ER9A 5FHAH 3DARA 5C8ZA 1H2WA 2IJGX 2IV2X 1IKOP 5EZOH 3NBXX 5JOQA 4BVKA 3NH7H 4TRMA 2IPMA 3RVWD 2HYMA 4OQZA 4O2AA 3D52A 1K3UB 1BQHG 3O2SB 2F55A 5H3HA 4RL4A 4D9KA 5JHDA 3MJFA 4OF4A 4FFZH 2AV7A 3IBYA 2Z6AA 3V00A 1NRJB 4QVKA 3QEUB 4OU3A 2VSQA 4LWZA 3IJEA 2C5EA 4LXYA 4U1SB 3H84A 1VGKB 2WKQA 4PS0A 5DW0A 3L4VA 3PFHA 3OD1A 1CU4H 4AXWB 2OR8A 3TKAA 4D26A 5C52B 5BWCA 1OHQA 2RGDA 1WRFA 3TH4T 4P5TD 3GMMB 3BH7A 1CGSL 1KE1A 4M6NL 4KXCA 4Z4IA 4XM2A 1Z1WA 5DVOA 5E4EC 5T3UA 3SZKC 1FZQA 3H2BA 3ZCPA 4BKMA 3RVWC 5AXAA 4YAOA 2YOGA 3D4IA 3WU1A 5BRZD 2Y07H 1L0BA 3B1VA 2HD4A 4YAUA 4HLEA 3NBYC 4OCYH 1LO4L 2XDQB 2BH0A 4X9XA 3M34A 1U1CA 2A9AA 2GJ6D 4B46A 3ROOA 1QO9A 4LL4A 3K1DA 5F2NA 4AJYV 4NZNA 4P59H 2DHEA 4LDEB 5EWIL 4RQAA 5HVWA 4B3SB 4WHYG 3GQBB 1V9LA 4Y8AA 5TQ2B 3WJLA 4QCIA 3EF3A 3UBMA 3ABIA 4LQFH 5DS8A 2H1PH 3OZBA 1RT9A 4PJCF 8MHTA 4BX2A 4P5TC 3FT9A 1EK6A 2CUMA 3V6MA 1KJIA 2CDGA 4UYQA 5DCWA 4R7VA 2XOXA 4RJIA 3MFFA 1XSIA 1JU4A 4ZO4A 3U0TA 1OTSD 1GVNB 1ADGA 2FWBA 1E5CA 2PX3A 4IKIA 2FF7A 3Q7PA 1NQVA 1TO4A 1ET8A 1OLUA 1QBBA 4QJ4B 1UDAA 1NF2A 1KBKA 1LLDA 1XJ5A 3D6JA 5IQMA 3W57A 2VL7A 1ZONA 4GOJA 5L7XL 2QTBA 1D6EA 2FUQA 3ZY4A 4KFCA 1J86A 4LLMA 3CIFA 2C8LA 3CT6A 5CWSA 1EIWA 5DFVD 3OB8A 3BAIA 4O29A 1G7HB 4K46A 3QKIA 1KDYA 4HQ0A 3IS3A 4IG4A 1ZY9A 4LSQL 1KYFA 1AGEA 1CRWG 1QEWA 2ZJ5A 3D0VA 2R4SL 4KO2S 1OTSC 2H7VA 3NAQA 4RMTA 3DEYX 2XDAA 2BCMA 1TZOA 1A7PH 1S2OA 4DGIL 4AWAA 1KP3A 4ZOLA 3CSYB 1X5GA 1WXHA 1E32A 3JQ7B 1FL5B 3F5WB 1MFUA 5KYXA 4ZFGH 4C6SA 1QF7A 4JO8A 2NZJA 5HI3D 4FQHA 5I9BA 4HJIA 1HEIA 5HKAA 5E9NA 5HDWA 2QP3A 4QBGB 5GS2H 2W8CA 4BO1A 3WB0A 1JEJA 2Z6UA 3V2HA 4N6RA 5DK2A 1AR2A 5DFVC 3AABA 3VFNB 1O6VA 5ALHA 4R5HA 4AKQA 4PB0L 2XLBA 2J4FA 2OMEA 2DCMA 2G5PA 5HBBA 4M8KA 4WTXA 1WAAA 3GSQA 3KT6A 3B37A 1DIRA 3Q8WA 1SYSA 1K8QA 4L5FL 1HU8A 5BR4A 4L9LC 1L4KA 3VI4B 3PXLA 5BRAA 2W11A 1KOLA 4MICA 2P5SA 3FDXA 4IW4C 3BK2A 2GVDC 1FORH 2C20A 4BGDA 2QMQA 4NBLA 5F7WC 1Q72L 3QF4A 1T3FA 5TFSL 5HI3C 1N2OA 1MAMH 5E2TH 4CVXA 4CJ1A 3NM4A 3DT9A 1CVSC 1HPLA 2CFRA 3TF7C 4UZSA 4Q4IA 3MJSA 4YHBA 3FTQA 1CEQA 5JNTA 1XVUA 3I12A 1V3MA 4Q7DA 3IS1X 3A37A 4CEJA 2CBQA 5AMXA 3Q7RA 4DMMA 3JVEA 5DYOA 5E7QA 1KXHA 2X8JB 1COWD 3HUDA 3DOCA 5CT4A 1ADYA 4KDVA 1J2TA 5F76A 2K0RA 4XH2A 1DXHA 4OQTL 4YO0B 5HHQB 4HN4B 3K8LA 4HF5H 2PMKA 4Y7OC 1JNHB 3R6WA 2HYIC 3NEPX 3SDYH 2OP4H 1TQUA 2AK4B 3VI3F 4NMHA 4JFTA 4JEGB 4FWIB 1VPVA 5B1KA 2GBTA 2VZUA 2JJ1D 3DX8B 5C5DA 4ESHA 1Q4NX 3PNRB 2PYEE 3GJEA 1KJ2H 5DT1H 3L5XL 3QWAA 5BO1L 3AVXA 3L3JB 2FYTA 3SKOB 1LFDB 1QQBA 4Y5XA 1FDIA 4RXUA 4QAWA 5TE7H 1SVKA 3KAQA 3LVFO 4G7VL 2EUXA 2QDVA 1PGRB 1PS8A 2I33A 1ZJ6A 4JAVC 3PE9A 1XZKA 2IZOA 2QE6A 4QOSA 2WTEA 1KENL 1UM9B 1SK8A 1NAKL 3MNWB 1PGPA 1Y5IA 4M1ZA 1U92A 3KKMA 5CCXA 1KKUA 1K6JA 4CR8A 4JRYB 5BV7H 1PJRA 2CFTA 5ERYA 3J81A 3FWKA 3KELA 3PQ8A 3V0VB 2R5NA 1ADQH 5SYMA 3STZB 1M2HA 2WLSA 4G9DA 2CHQA 3KH3A 3INOA 3MERA 2LLLA 3VR5H 3NBAA 3VO0A 2Y7OA 1Y48E 3I6QA 2VYQA 3S0JA 3Q01A 1XFPA 1M7GA 3ETTA 1I4FB 4F5CE 3EYOB 3IXTA 1NSYA 3HXLA 3DL2A 4N3TA 4R4FL 5AI0A 1IGJA 3PFFA 2AJZB 1ISJA 4HLQB 4G8EB 2A0WA 4XR4A 1WBXB 1V8OA 3DWTA 3ESMA 4TWJA 4P2RB 1AC5A 4F20A 5K4GA 3RSSA 3FFCB 4E13A 4E5VA 5U4QA 2NX2A 4G67A 5DHSA 4L8WB 2G1JA 1R5VA 3TUIC 3MA7B 5IB4B 1SPBS 2I4NA 4IJWA 3MCAA 2P1DA 4I4NA 1FYWA 1QS0B 1QH9A 5EIWA 2Q7XA 2IIJA 3N1GC 2ZB4A 1WCWA 1ZLUK 3GAMA 2IFGA 5K9KA 3MTGA 5HHMD 3P9LA 1BG9A 1GG9A 5CCGE 1FS4A 3OZRA 2BKLA 1ODCA 4JLKA 3LEVL 4QF1A 4DIOA 4ZT1A 5IJAA 2R7EA 3V6FA 1J88A 2WJJA 821PA 2GSDA 4MJXA 4NPAA 3N0RA 2VC2B 3WMSA 2QLTA 3NALA 2J6EA 2HTKD 2IDJA 4N2MA 3I50L 1D7OA 1BFVL 1L5HB 4WGGA 3TN7A 3OU7A 2HBYA 1XD2B 3CFTA 3L77A 4YEEA 3FA2A 2BNRD 3IGKA 3GM8A 4UU9B 4J94A 1TJNA 3PGFL 1Q0EA 3AETB 3HU3A 3U13A 3FUEA 4HWZB 1X5LA 4LTDA 2ZWVA 4QXTA 2OV8A 4AJNA 4WWKA 2FLVA 1I7PA 5EUQB 3SYPA 3ELQA 3WNQA 4FS8A 5ESVB 3WO4B 2Q5IA 1NDMA 4GIAA 3QBJA 4WWNA 4X80H 1BQSA 4P2QB 2J5KA 3CQ9A 1YAIA 4KO3S 3G0CA 1VI2A 4KE8A 3M6MD 3N43F 4RNRB 1ZJZA 2JD0A 4B6JA 3JPWA 2Q10A 5EFOA 3C85A 2Y5QA 5CG1A 4ARVA 2GUOB 5EMLA 4FKZA 4ARIA 3QH4A 3UAEA 5ECJE 2XWDA 4PZPA 1I8LA 3O92A 4O2EB 3O73A 1QK5A 4FQ8A 2KYRA 1SXGA 5ESDA 5KNBH 4M61A 4LCVA 3CF0A 4YHPB 1X15A 3KWTA 1KDIA 5IBPA 2OKGA 4RDIA 2BXYA 5G02A 1RJ9B 3UOAB 4XB6B 3IE4A 4JKMA 4TL9A 4XVHA 2O8EB 1MIEH 4E21A 3S3JA 2ZOSA 2IBMA 2YL2A 3UIZA 4BWVA 2Q1XA 2HLDD 2ZJ4A 1QFMA 3PI7A 5L2KD 1JVSA 4ND5A 4WEOA 4W9NC 2F7RA 1QFJA 6YASA 4PQFA 4ELMB 4Y2QA 5C0AD 2DETA 4OYHA 4PRPE 4M03A 4IRSB 2CB9A 3PC3A 1EEQA 2NV2B 1JXKA 4LZKA 4X5PA 3MX0B 2IZ1A 3AX6A 4KHZA 5CW2A 2V8BA 1QV6A 1Z47A 1R6BX 1CPUA 1J9SA 4XXDA 1N5AB 5TMDA 4IUBS 5E8DL 1DBMH 3TX4A 1U5CA 3KYMB 4X5WB 3S1AB 4X65B 3RZCD 4M89A 4FFPA 3DSNB 3LN5B 4RLDA 5DQDL 2Q4TA 4OJDH 1EGMB 3JWGA 4OGXH 4PBXA 5THQA 3Q9QA 4RO0A 1ZJAA 2Y1KA 5BSVA 4C2TA 1MY7A 1N9GA 2DTMH 1J4AA 1Q0RA 5IEKB 4ZAKB 1CS4C 3EBLA 4URXR 2HF8A 2FWLB 4NVRA 3DV0B 2HBZA 3ASNB 2WE7A 1W0WB 1J9TA 4DWOA 4WXRA 4TVSA 5JIMA 1FQOA 1GTG1 2O8CB 1LCIA 1ZLVK 3RC8A 3DW1X 4GWGA 3BJ91 1FZJB 3L48A 1JPJA 2HT4C 4WRLA 4ALLA 5I1IL 2CDBA 2G0AA 5EU6A 1TCRB 3QFDB 3O21A 2HF7A 2CGRL 4RA3A 1IXRC 2EYQA 5ADUS 4MWZA 1M2WA 5DEGA 2FMFA 2CL6X 5E4YA 4OCWL 3FWNA 3JPYA 3UENA 1UJ3B 2OT3B 4JUBA 2P75A 4K05A 1YYCA 4P9HL 4O5LL 4HD9A 4ODSL 4LSPL 3TO4A 1TVCA 3OC0A 5F7EL 4WGKA 2NY2D 1UM6H 5GS3A 4WDQA 4KXMA 1RJYB 2OLKA 5GPRA 3IE9A 5B1DA 2WLYA 5L4IA 3IRZA 4DR4B 5CZVL 1DEHA 1YR6A 1JGVH 4NDMA 2JI9A 2JTDA 4K26A 4NO3B 3NCWA 1YIAA 2P69A 2CUIA 1P69B 2ICAA 4H26A 3L4CA 1C9KA 4P5DA 1RY7B 2BUBA 2XMRA 2J1XA 4QATA 4YZFF 5L3SB 1IC4H 1GXEA 2IZ0A 2BSSA 3T3EA 5GSVB 2AHRA 3HBJA 2VISB 3RBAA 3N50A 2GSWA 5CSZA 4V2CB 4F71A 3GUZA 5D70H 1R3IH 2Q9OA 3JRNA 3FRPB 1HE1C 4ZS7H 3VHXB 1GZHB 1GGBL 4FP8L 4ZZKA 3HVDA 3IS0X 1PLLA 1O7SA 5ES4B 4J0JA 2F8IA 3UUWA 1IQUA 3ZMNA 5K8TA 1LDMA 3TEJA 3VGPA 4KXNA 3DQPA 1H6AA 4HK3J 5GVRA 3MMSA 4Z9AA 3IUPA 1JHTA 2EEPA 1D9KA 1Z3RA 3VFTB 3QLVA 4LYAA 1E5BA 3C6YA 4DLTA 1SQ5A 3OB0K 3ZH2A 3EA5A 5F97E 4XOCA 4OY9A 3OGOE 3PXDA 4UATA 4WOPA 2ZZMA 4UE6A 2R9HD 3ZTNH 2PPAA 3I6BA 1WOYA 3UTCA 2FSIA 4YO8A 1YQ9A 3KXKA 3SCMA 3G7SA 2PZFA 4DAEA 4TGLA 2XTJA 3FLMA 2ZSBA 1CRLA 1NUNB 2YMOA 1BDJA 1Y3FE 1GCFA 4FFOA 1K98A 1UXWB 4A2DA 4JYAB 2VDPB 2P2LA 1GFIA 4PG2A 4Y2YA 1RYMA 3IUNA 1JV5A 4KVFA 3QISA 4POZD 2WQUA 1QZTA 4X4YA 1CD8A 2VQUA 3WZ2A 4F3FB 5LNGA 1ZSYA 2XCOA 1FN4B 2YBGA 2Y93A 2VJLA 4NZYA 2VT6A 4X1YA 3ROFA 5LXTB 3IEKA 5DFAA 3OZ9H 2H47C 3ETBF 3OV6A 2OQJA 4XGZA 4RVNA 4HPYL 4GPTA 4S2UA 2PCFA 3D6FA 1TTCA 3H8VA 2R85A 3GSXA 5TXGA 2X8BA 5E0KB 3KPRD 5CDTA 4PTTA 2D2XA 5LAXB 2O8FB 1IBSA 1M5RA 4TXHA 3KJEA 3G08B 1C1DA 4IDBA 3GPEA 1KQOA 1I4DD 3W4JA 1WICA 1WBBA 1NCBH 2VB5A 1MJGA 3E23A 4OHBA 2C88A 5JO0A 3L4BA 4Y2PA 4XODA 1C3LA 2C5BA 2VCHA 2NY3B 2CK0H 2ATEA 4JUDX 2B0JA 3FUXA 4PZDA 4YUZA 2H45A 3FQ4A 4Z3HA 1JKIA 2VQ4A 3OKPA 1EFXA 3HKDA 1RZRA 4EGFA 3GMSA 1ZT7A 3EWIA 4C1NA 1UA6L 4Z3DA 1DBAL 3HS9A 4DW2H 4R8RA 1PQZA 3QA3A 3U4BL 4L27A 1OP5K 4UAJA 4BQPA 4EPSA 3HB3C 3GPCA 3W9SA 1WU8A 4FHDA 1EGJH 1J09A 2F3UA 2HB0A 4Q6IA 2QKIB 1Z18A 2POCA 3BGVA 4AV5A 4HXEB 1BQHB 1R4MB 1U3HB 4AL8C 1B8OA 2DV6A 4E9WA 3HJTA 1ZWIB 2R29A 4MS4B 5H80A 4ZO6A 1FYXA 1YR3A 2WA2A 4EB6A 1L5RA 3ACDA 4LLWB 4HNGA 4JLNA 3QKSB 1IJNA 3MOGA 4GRLC 5KAMA 4NDAA 4WUKL 2X15A 3QWIA 4U3HA 5CXPA 2BFCA 3C8UA 4JVMA 3AUVA 3DT8A 2F54E 3E1F1 2Y0PA 3EISA 2YTZA 1R3KB 1C0LA 3ZEIA 5CUSH 3OF2A 5CLWA 1UBNA 3B6SA 4PNZA 3B9KA 3CQQA 2XBUA 2P5TB 3DRQB 1QIDA 2CV0A 4QECA 5H81A 4XP4H 1JQBA 4WEQA 5ILOA 1X80B 1F4PA 5J12C 2EH7H 1JZFA 2IAMA 6REQA 5C8YF 1S7VB 3A10A 3SI7A 2R8YA 3AUXA 5D7LB 1TO5A 2NO1A 4HZAA 4UM9A 2KZ1B 4FG4A 4PZZA 5HUJA 3FOMB 2X8LA 4N5MA 2Z6VA 1I1YB 4EDHA 3KVOA 2Y1XA 3DWGA 2FDCA 3F1KA 3DLAA 5HGXA 4EJFA 1NWOA 2WSKA 4MXWL 1BN6A 3SDDC 2PL9A 3LFHA 3MNZA 1UOLA 4GI2A 3MSXA 4OX9Y 3W5UA 2V4ZA 3NV9A 2WD8A 4OXYA 2AGJL 1TQ6A 4BB9A 2JGMA 1A7RH 1TZBA 3BXXA 1S3IA 5JNVA 2R00C 3GAZA 4S1QH 1KMGA 1UIRA 2UYGA 4NS1A 4TPKA 1PJWA 5F71A 4EG7A 3CDFA 1NGZA 2EP8A 4KRPD 1QI5A 3G04B 4ERXA 4LSRL 1N7GA 2EFHB 1AO7E 1S9DA 1TMGE 3DM9B 3LPOA 4HAXA 3ASZA 2ZR8A 1E18A 4RGNB 1S2LA 3NPZB 5JSZB 1U8JA 1P1VA 3OLQA 3SYLA 4XRCA 3PFWO 2UWEF 4YLEA 4OQLA 1PBYA 1KCUH 3BRCA 1KH1A 1Z9MA 3D2UA 3QYJA 1V1JA 5K0SA 3FQTB 2C4HA 1QSFA 4KR9A 3LNFA 4U0KA 2RGSA 1V3UA 4PS7A 2EDOA 5KS2A 1ACYL 2VLJB 1D5MA 1KLGA 3ONNA 5BRJA 4YAQB 3CZRA 4UOW1 4ZQFA 2R1ZA 4DY4A 3VVWA 4AF6A 2P41A 1R0KA 3RJMA 2NW2B 2I6FA 4F4DA 3P2IA 1KIPB 3VW3L 1ODUA 1EEHA 3O41A 3RFZA 4MJHA 2EEBA 2JKXA 3JQFA 5A0VA 3T8XA 1I3RB 4E46A 4DWWA 3Q8AA 5JCOA 1HQRB 5I66A 2EDQA 2OCBA 1IATA 3JWNE 2Z2IA 1FVCA 4HKZA 1KYWA 2J6CA 5K05A 1CJCA 1E8DA 3US9A 3GGSA 3B9PA 2VXSH 1RUML 2Y2WA 5JI3E 5GGUA 2VJDA 2BS9A 4TUYF 3IQHX 2NXNA 1CR9L 4DGVH 2KHAA 1DJPA 1JYEA 4WO4A 5IB5A 3VDCA 3IF1A 4U7KA 2GM9A 4JBLA 2IPUK 3H11B 1DP0A 2IANE 3F96A 3HACA 3OPXA 4FNPA 3RU7A 2ADIB 4ZFZB 4QTTB 4Z51A 3MRBB 1OGIA 2WWMD 5F6HI 1FLTX 2AXHA 4BK5C 2COKA 2OM5A 2P1YA 4ZFFA 1JCVA 3RWIB 3H9BA 4R3WA 2YD7A 3BZ5A 2PX6A 2PL3A 1PV4A 1FZOA 4UQ3B 1I3VA 4OI9A 3OZIA 2OJEA 1E3JA 2ON6A 2I3GA 2YPVA 1USVA 1IBMB 3OWRA 4Y1AE 1TNMA 2Y23A 3TTVA 1KB5B 2ICWI 3ZOAA 4PJ7B 3R9XA 5DWUH 2X4SA 1ZVHA 4DGYL 3WKCA 3CLUD 4MITA 2CUNA 3AI2A 3BWBA 3N2GB 1F7VA 2IDCA 1OAOA 1OGAA 4OHOA 4UDYX 1GLNA 4A27A 2VBIA 1E1NA 2VXTL 4F7MA 1N7HA 3KQYA 4BKSC 4UMDA 1UD5A 1U7XA 4G0UA 5E8OA 3N06B 4XMZA 5KVFH 3PE4A 3FF1A 3E9YA 5B2ZA 2MPVA 5D7JD 1KZ7B 4WJ5A 2JGDA 4XO3A 4ZMTA 1YDFA 3A0RB 1SULA 3M4YA 1BAWA 3VR4H 1A9RA 4DEWA 1FRFS 1EQAA 2YH2A 4G4JA 3B5EA 4G59C 3DM5A 1RZKL 4ZMQA 1P0CA 4DOHE 2PIDA 4FQ5A 1T2EA 3BWSA 1RSZA 1H0SA 3E27A 4EN3D 5I6OA 4HUVB 1TTHA 3CLUC 1JG6A 5CXUA 3K74B 1OI3A 4LVCA 4NU8X 2PKWA 4RGOL 3VZRA 1NN1A 1P9NA 2B37A 1CGSH 3MBXH 4OB5L 3GGWB 4JKLA 3BWYA 3MHPA 4C6TA 3WQHA 4IW3B 1CFSA 2CW5A 4LECA 2IL1A 2PP8A 4QPPA 2JI7A 1A98A 1WXIA 4BNJA 5IHPA 2XG4A 1UT6A 2ZI5A 2VJXA 3QEJA 1MZYA 1LO4H 1ZY2A 5GS0H 4MUXA 4LXGA 4C56E 3MLTB 3ELYA 1TAUA 3HL0A 1FMTA 5CJOL 1UZUA 3BK7A 2MCPL 4H60A 5AHRA 1GRVA 1TJYA 4YRQA 4EELA 2G67A 3GXNA 3WL9A 3BFPA 4TL5A 4JFDE 4KVCH 1PI3A 5D93C 4PYOA 4EN3C 3B9RA 3S0PA 3U0BA 5MEQB 4MK4A 1N2JA 3SHOA 2NDFA 4FQXA 4DYVA 4ABQA 1FTNA 2X2EA 4Q9IA 3ZHNA 3RUEA 1I24A 4M8LA 4QPZA 1FQJA 1RACA 2AQKA 4NWTL 2ARWA 2NY5C 5CLYA 2FPMA 5A7HA 3CDGA 1SBQA 4NABA 2HJKB 3IEMA 2AN4A 2J30A 1QAWA 3OC8A 4J0FA 2IYYA 4M6WA 1I7UB 4WXYB 3ZD6A 5L7XH 1JAHA 1NTDA 3L8DA 2PX2A 4CW7A 4NX2A 3T1QA 4NECA 6ABPA 1A0QL 1Y18B 3HE6B 1G6RL 3COJA 4S0HA 1DZ0A 3MB5A 5T1MB 5FWAA 4OGLA 5AWNL 2Y1CA 3RIYA 4LSQH 4NEQA 2NX5E 1NAHA 2GN9A 5JIIA 2FRDA 2YZGA 3VU8A 2A9DA 1JLMA 3WKDA 1A5FL 3FN0L 3RRZA 4DGIH 2BHFA 3N7TA 5EZYA 5D3MA 1A8SA 3AS3A 2XQGA 1MJUL 2AXNA 3IK2A 1C8QA 1BLNA 1CUVA 1WF6A 4K5PA 4XXCA 1CT8A 1WXFA 3ZVKA 1F9AA 2E74C 1MC1A 1AZTA 1LWJA 1MJJB 3QUBA 3C15C 3AEUA 2JFQA 2EATA 4Y0NA 4O2AB 4CSSA 1JG4A 4O9HL 3I05A 3K5IA 5AW9A 4IXDA 4UFNA 3BPLC 3KTOA 5JCJA 3KZVA 3HG5A 3PHQB 3WYFA 3ZE1F 4ERSL 2MWMA 3V8NA 2NZ9C 3IJEB 3Q8MA 3QW4B 3OY2A 2ODPA 3DS8A 5AHWA 1KSHA 1PLBA 2ZKLA 2IDFA 4HQLA 3V48A 5JOPE 2DJSA 1U8AA 1YMQA 4MS1A 4P84A 3L18A 4FCTA 1GKEA 1Q72H 4W63A 4XVUD 4TNWK 4RMQA 2B1GA 3GZJA 3LRXA 5EVCA 2WBJD 3SQOL 5HJDA 2YFKA 5EE0A 4GO8A 1NFQA 2G7MC 2WF9A 3TQRA 1CQZA 2O7NA 4NO0A 3IDOA 2X0FA 5F9FA 5DD3H 3IHWA 5JXEA 1FFQA 5IVIA 1K4MA 2XRFA 5CJXA 3I2YX 4XRGA 4TLUA 3HMXH 3ROOB 2C26A 3ITNA 4ZP1A 4YNBA 3LT2A 3E35A 4TZ0A 2P0AA 4MV3A 1L0PA 3O0DA 2CLFB 4P80A 1AHKA 3SEPA 4H8WC 4XVUC 2CDGB 5DRXA 4ZJZA 1B6UA 4LCYA 1UBTS 3U0TB 4RIRB 3W6OA 1GL4B 1MCWW 1A8HA 1NC1A 5DHMC 3SJVE 3DJZA 1OLUB 3HA5A 1Q0QA 3W2FA 1VHQA 2A3NA 3K53A 1FRNA 1QHYA 1CFQB 1EAMA 1FO0A 2WD7A 3PL6A 1KIQA 4UMVA 1BGVA 3TNMA 1KGJA 1TC1A 4HAIA 1NCWH 4PJXE 2IA5A 4QWWA 3RBXA 4G7VH 4NQDE 2V5UA 1SGWA 5CWSB 2JJQA 1KYTA 3SY6A 4N9GA 3LRPA 5IDQA 1I9RL 4KRXA 1AGEB 3OM9A 2RHDA 3D0VB 5KYUB 4D3YA 1W52X 2ANCA 4BB5A 4U1RA 1NFAA 1XH2A 4ZOLB 3LPLA 4AXXA 4L0CA 4NQZA 1DJYA 3IURA 5KYXB 3CH7A 3USZA 1LD9A 3FLAA 1A3CA 2EKZA 1A4KA 1XCMA 1JGEA 3FSWA 4FL4C 3ULVL 1BJRE 4R4FH 1M2VA 3QUMA 5E4AA 2OMWA 4N5LA 5L3VA 3TKYA 4D9RD 3UTZA 1G9SA 5DK2B 2H5UA 2JKVA 1JRHL 1VTKA 4PJBA 3K6RA 3IUJA 4MULA 2ICCA 1P4BL 4N2LA 4B3IA 3V6LA 4RMJA 4FDVA 3GSQB 1IFXA 1XVSA 3I6GA 4FZ3A 1SYSB 2XU9A 2RMKA 5ECGC 2QMYA 5EPUA 2CHVA 3C14C 5BZZA 3BVDB 2AVGA 3BXPA 3UFBA 3ZHFA 2X5NA 1YMUA 4NQVA 2YV5A 1HI6B 1CW2B 1UKEA 3QF4B 1T3FB 2H4WA 4RHEA 2W65B 4CVXB 1U1IA 2AC2A 3JZ7A 1ZJJA 3T6QC 3OJOA 1P8AA 2DY2A 2AJVL 1YQQA 1PKXA 3HVKA 2WFZA 3TE6A 1CS0A 3BHNA 4MTMA 2VLKD 4W5RA 3I50H 4CEJB 3TCLA 1JH8A 3CRZA 3CZMA 2BOCB 1XBDA 1W87A 1T36B 4XMUA 3C7CB 3TT3L 4OLXH 4D8WA 4DCUA 1T1XA 4XH2B 4JG0H 4KUCD 4X99B 3HZVA 3PGFH 4N2AA 3HO6A 2XQJA 4ICWA 5FIEA 1Z38A 2HJSA 4IBZA 3I9MA 4OOEA 4L0ZA 1ZIPA 3M2TA 3SY0B 2DBRA 4O1HA 3HJFA 5EUCA 2NT3A 1NEPA 3M0EA 1A5SB 3N28A 1HILA 3SYKA 1FVEA 3GJEB 5FHAL 3ELUA 3T06B 2DI8A 2GNPA 1KI3A 3ETCA 1LDNA 4MDRA 4EO9A 1H3VA 4Y5XB 3PGCB 1CDUA 3CFNA 3PHGA 3ND9A 1X1BA 4F72A 3FF8A 4BS9A 1HIMH 2BUCA 3AL3A 5DA4A 4TWZA 5LMZA 3IT2A 5AOAA 2VMFA 3BDYL 4FFZL 1HRDA 4EPWA 4N87A 4L76A 4BFGA 3IMEA 1DL5A 3N2ZB 1IBKB 1ZVQA 2FEMA 5DI8A 3JVDA 3QNZA 1Q0XL 4NPJA 8GPBA 1UA3A 1A9PA 4KNSA 1IL1A 4JLSA 3BN3B 2JEYA 5TRTA 3PEVA 1EVUA 3KPSE 3IAS6 5EIXA 2VXUL 2FDRA 1EEYA 4G63A 1JAZA 5GZ1A 4NMLA 4ODXA 2K7FA 1E2HA 2RCNA 5DIFA 3EJRA 1WEKA 1IFRA 3VTTA 1B8NA 5E6SA 4W6XB 5CYGA 1OLOA 4R4JA 1STOA 2Y07L 4EDFA 4IDGA 2FAUA 3T7CA 3PUXA 2MR6A 4D4MA 4OCYL 1EG2A 3P2MA 3EQ8A 3I58A 4PZLA 2XMQA 5HYSG 2WU0A 1TETH 3K09A 4LZWA 4N8VA 1A8JH 4UZFA 3AVQA 3T38A 5BUSA 2VQSA 2XCUA 3O2QB 5E8DH 1QD0A 1PVHA 4ARZA 1R12A 4I1OA 3NN8B 1UCFA 5IDXA 4UOZA 2H1PL 5T4FA 1G7LA 1G7RA 3UJJL 2BDNL 5DQDH 5K9KB 3C6LA 1MQAA 2YJ6A 4JB0A 3P9LB 3WE6A 2ZQ5A 1Q92A 1I1NA 4WXMA 4YEDA 2R7EB 3V6FB 1M56B 1QLJA 3KTFA 5BQ5A 2ZP9A 4BFBD 1H8HA 1RLWA 5LC1A 2WUFA 1D5XA 1VLVA 4QBTA 3WTSA 4CBVA 1VPWA 2X1LA 4KCGA 5I1IH 3MRFA 3IPRA 2X44D 1HEZA 3U9PL 4Q4JB 4E08A 4HISA 2CKBB 2G04A 3OAYH 4O1MA 4PZUA 2XBTA 4QYIA 2CGRH 3FQWA 3O3BA 2AG5A 2V7VA 4JG1L 5K1ZA 4ZX5A 3P0VH 4MP3A 4TZTA 4RANA 2OR3A 5CIWA 4OATA 2YRBA 4B80A 4GO9A 2B34A 4WWKB 1I3OA 1V7CA 1I32A 3AEKA 1T5KA 4L9RA 1N9PA 1A7PL 1NDMB 4FHGA 4B79A 4EMZA 1JZJA 4NXKA 3WXBA 1PZAA 3UK6A 5DJ2A 1ZI6A 4O5LH 4ODSH 3VTKA 1Y4DE 4PW3A 1NM5C 5A9RA 3KRTA 2CJXA 1HE3A 1I7QB 3B8EA 4V0QA 3HBFA 3GFPA 3G5YB 1R0ZA 4JQOA 1WEHA 3QU9A 4ODHL 2IBGA 1RD4A 4GPZA 4DMGA 1OX6A 5GIPE 1N64H 5H0IA 4Z7OB 2X3BA 3QI2A 4LP5A 3UYRL 4J29A 4RDHA 2RTTA 1A76A 4PJHE 4JJKA 3ZS9A 1F06A 3N5CA 3HNSL 3HA2A 3TLYA 5KS9E 2O1SA 1L9RA 4KDTA 1LSSA 4M61B 1GSKA 4ZD6A 3JVIA 1P2GA 3W7VA 3UTTA 3MINA 3OXSB 4C78A 3MCUA 4C5CA 3P9QA 1FORL 2ZSAA 3DEZA 1CCZA 2HX1A 4K2UL 3SE6A 4D44A 1L5WA 4YIHA 3HABA 1Q77A 4HMQA 3HR6A 5E2TL 4MWCA 3LUDA 4P48A 4RTKA 3DF7A 3ARPA 3QELB 1ZK2A 1Z9PA 4PAWA 1MB9A 5L6MB 5CLZA 5F21B 4H1VA 2IQIA 3KXFA 2IVFA 3AU1A 3LUBA 2GBIA 4QTHA 4H1LA 4QXQA 4DQXA 1KJNA 1U8TA 2NSLA 5HPOA 2VDKB 4NV0A 3SJUA 1CZNA 5FA3A 3D6VA 3QVMA 3BD6A 1AS3A 4X93A 2BFDA 4RELA 3FHAA 3VNYA 4R9UC 4MPPA 5FPSA 4D45A 5HGAA 1T7ZA 4HF5L 4U7PB 7PAZA 4MUAA 4EA8A 4P0DA 1HOEA 2V5YA 1JHLL 1IE5A 3SDYL 4JY7A 2OP4L 1KCLA 4HJ0D 5EHFA 2VDQB 5HYEA 2GAFA 5ILGA 3AU8A 4K73A 4OYLA 2IP4A 4Q3KA 2G9HA 1KJ2L 5DT1L 5A0FA 4NNJA 4FKMA 3TOPA 1UCBH 4B97A 1Z62A 4UTAL 1GPBA 4DPKA 3ALXA 1XH0A 5TE7L 3T6WA 2FSVA 4EN2A 4TKLA 1XBRA 2FATL 4RKEA 4JGNA 4LSGA 2H2DA 4I0PA 3WNLA 2NNLD 4EFLA 1GUDA 5JHHB 2H4YA 3FTNA 4TTRA 4XPZA 4YMVA 5DEGB 2EZ8A 2FPWA 2IHTA 5BV7L 2ZUUA 1E20A 3FNBA 2JQMA 4PX5A 3Q3EA 4GMKA 2DX7A 4UUBA 5T6MA 1NLUA 2X4TA 2EWWA 3LF1A 1L5SA 4RMBA 2Q6WA 4U6XA 3BQNB 3X11A 3EDOA 4BLVA 3TQFA 3SQLA 1A7BA 4NDMB 1UA6H 4ZGWA 2N3JA 2XECA 3DBLB 4JBWA 3ILHA 3DWIA 2CN1A 2MJWA 5EP3A 3K3PA 1EFTA 2O6CA 4D94A 2WT8A 4L1KA 2DLDA 3NJGA 2DR0A 3B7GA 2O52A 1Q7EA 2BSSB 4HLJA 1R66A 3G79A 1TU3A 5CSZB 3DTTA 4Z7AA 2ZBRA 4CVWA 3T12A 4YJ2A 4QOHA 1EUTA 2H7XA 4FNGA 1QSGA 3FC8A 4E33A 3A6PC 1UT5A 1UXSA 4MQTB 3V42A 1EJ8A 1MB3A 4CMEA 1UJBA 4P2GA 2OBBA 3V8EA 1BZ7B 3ZKWA 1DPGA 1AK9A 2YHAA 3A3KA 5FO8B 4WPGA 1JHTB 1KYOJ 4Y7CA 5KYVA 3N3BC 1D9KB 1M8KA 3WDHA 2YOFA 2REXB 4MVXA 5DOZA 4BFTA 3GF4A 3PQCA 5D3KA 4M98A 3ECBB 5I47A 3TAUA 4Q1CA 1JGDB 1ICEA 1C7SA 3GEEA 3RIEA 4RZCA 4L15A 4EATA 2D5BA 4PLCA 5NULA 4DLYA 5K93A 5CM2Z 3SCMB 5AQ0A 3JZIA 5FK9B 2XTJB 3B7RL 3IJSA 4OGZA 2ILTA 2R6FA 1BDIA 3ZW7A 3E8VA 4AW9A 1BMQA 4N20A 1NHWA 3F71A 2EGGA 2X6VA 2F1IA 4Q3NA 4TX1A 1JV5B 2MOQA 1SA0A 1ZGBA 4Y1RB 1KZ4A 4CFZA 5ITFB 3HB4X 2ZI6A 4OV6B 2F7IA 1WXDA 3GX1A 4X7FC 1F8TH 3Q8KA 1KPUB 5DUPH 2FF5A 1OBOA 4EVNA 1PPIA 2OQJB 4S1DD 3QNWA 3WL6A 4X50A 3FF7A 5KVMC 4MXWH 3O82A 4O4JA 1NQBA 3BUBA 2NT0A 5LYJA 5AAWA 1M53A 2H00A 4OCZA 2G80A 1FUNA 4KWUA 2A35A 2QRPA 3HDVA 5IAOA 3S2AA 1C0EA 5HBRA 1WQ1R 3J7TA 2AGJH 1C1DB 5BVGA 5F4ZA 3BN9D 1S7WA 3FSVA 4ZNEE 2OV2A 1F2VA 3E53A 3RJTA 1V8ZA 3QQ9D 1A6AB 3WWDA 2D8KA 2PUDA 2D00A 4YHIB 4AX3A 3HZKA 1RI2A 1J5EB 1GTSA 2XWJA 4C2BA 3OKNA 3ZTYA 5KQLA 2I32A 5DUBA 1FUIA 4B9JA 2Z56A 4TTTS 4S1DC 4MVYA 4R8KA 1KGUA 3AAZA 4PTLA 4MXDA 2RK4A 3WHLA 2AR7A 3UTOA 2AUNA 5LBVA 1EFXB 4ZTUB 5E7FA 4J28A 1ZT7B 1UH5A 2GXAA 3QA3B 2VUHB 4POYA 4RPJA 1FFGA 4UU1A 5DF1A 2JFOA 2WQ8A 3RT9A 1G87A 3EF0A 2ZSUA 3QQ9C 1BP3B 3G5VB 4MUFA 1ACYH 3KZMA 5JTTA 2QB5A 5AAMA 1U4SA 2AEIT 1RWWA 5C7IO 2Y2YA 4D6YA 3BKYH 2XQKA 4OGXL 5EESA 2HSWA 2NY6D 1CFTA 4TQIA 5AKJA 2GK4A 4D9FA 3DDCA 2DTML 4EB6B 1XZBA 5J4LA 3VW3H 4JO3L 5JNYA 5HJ2A 2FT6A 2YVAA 1FOEB 4K87A 3EJYD 4EM6A 2WM2A 2OAEA 4ZMAT 1ZIBA 1M0EA 4G5RA 1KPVB 5EIQA 4N7JA 2BFCB 4FW9A 4YCSA 4BLOA 3HDJA 1QZNA 1NQOA 1RUMH 2BJWA 4QXMA 2I99A 2D1FA 3Q98A 4DZRA 1ZLDA 3HG4A 1XTLA 3B6SB 3K80A 3GYBA 1BZEA 2PGDA 3VI4E 1AY1L 2GYSA 4UZEA 1GPAA 3CW8X 2NY6C 2NZ8A 3CBKB 2NT1A 5F7HA 3NNNA 1X70A 4RNCA</