2VDMB

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist tirofiban
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
461
structure length
456
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 125
structure length 456
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdmB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdmB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdmB03
2XWBF 3V4PB 3AL8B 1QCYA 4G1EB 1JEQB 4IHKA 5KYWB 4A0QA 4WJKB 4O3TB 3ZDXB 3AFCA 1PD1A 4HQNA 2NUTA 4G1MA 4C29A 4MMYB 2VDNB 1ZOOA 3BQMB 4HQOA 1SSLA 3IBSA 1YVPA 1M1XB 3K6SB 1L5GB 5LN1A 3EH2A 5E6UA 5E6RA 3QA3E 3EGDB 1M2VA 3ZQKA 2XGGA 3EFOA 5KYXB 4Z7OB 4NEHB 1RD4A 4CN8A 3T3PB 1M1UA 3OL2A 3V4VB 1MQ9A 5HDBB 4GZ8A 1JEQA 1Q0PA 1QC5B 4FX5A 4CNBA 5KYWA 4XW2A 3TW0A 3Q3GE 1BHQ1 3IJEA 1YUKA 4Z7QB 2I6QA 4M76B 2B2XA 2XWJI 3PPXA 1CQPA 1MHPA 4CN9A 2ADFA 3TXAA 5KYYB 1L5GA 3AL8A 3FCUB 5E6UB 1M2OA 5E6RB 1N3YA 4DMUB 3EH1A 3EFOB 5KYXA 4F1KA 4G1MB 1IJBA 1PD0A 2QTVA 3BN3A 1T0PA 1PT6A 1MQ8B 2WINI 4WFQA 2VDMB 3ZDYB 1IDOA 1NA5A 2VDQB 4IXDA 1PCXA 3IJEB 3ZE1B 2M32A 3RAGA 1T6BY 1JLMA 1MQAA 4WK4B 3GXBA 3K71A 1V7PC 4FWWA 2IUEA 1ATZA 5KYUB 3M6FA 4MMXB 4IGIA 1U8CA 4HQFA 3FCSB 2VC2B 3K72B 1XDDA 1TYEB 1QC5A 3HXOA 3PPYA 4JX0A 2I91A 1CK4A 2P26A 1UEXC 4PN7A 2ODQA 4NENA 2NVOA 1IDN1 4BJ3A 5KYYA 3TCXB 3NVQA 2O7NA 2VDLB 1MF7A 1YVRA 3EOBI 5HGJA 4MMZB 5ES4B 5KYNA 1XUOA 3PPWA 4WK0B 3K71B 3OKWA 1JEYB 2NUPB 1U8CB 4O02A 4JDUA 3FCSA 1RRKA 2X5NA 4Z7NB 1XDGA 5BV8A 3HI6A 4O3UB 1SHTX 1ZOPA 2ODPA 3EGXB 1BHO1 2VDRB 1ZONA 1SHYB 1AOXA 4NENB 3N2NA 3ZE2B 3ZDZB 3AL9A 3HXQA 5KYUA 3ZE0B 1AUQA 4MMXA 1IJKA 3E2MA 3PPVA 1MJNA 4G1EA 1JV2A 3K72A 1LFAA 1U0NA 1OLZA 1RS0A 2I6SA 4UM9D 1FNSA 5E6SB 4C2AA 4C2BA 3EG9A 2NUTB 4WK2B 4MMYA 3F74A 1JEYA 3NIDB 1RTKA 3F78A 4HQLA 1M1XA 4O02B 4UM8B 3K6SA 5HJ2A 1DGQA 1OAKA 3EGXA 4MMZA 3EGDA 1M2VB 1FE8A 3NIFB 2P28A 1U0OC 3OKYB 2VDOB 2UZYB 1DZIA 3BQNB 2VDPB 3NIGB 4K3JB 4F1JA 3OL2B 1SHUX 1AO3A 2ICAA 2NUPA 1JV2B 4HQKA 2WW8A 1M10A 1SQ0A 3T3MB 1N9ZA 5E6SA 4UM9B 3TVYA 3VI4B 3EOAI 3EG9B 3VI3B 2VDKB
chains in the Genus database with same CATH superfamily
5D7NA 5IW3A 3RNOA 3ISTA 5IW1B 2OMXB 3PR2B 3VX3A 3GDBA 1CY2A 2JGDB 1QQ7A 2Q9UA 2XUDA 1G5QA 5EN3A 1PWZA 3QX8A 5B7EA 3GXMA 1D9KC 5MP6L 3RD5A 5JAUA 3N8DA 4GZ8A 4CG0A 4WFHE 3PRKE 2C3PA 1E2EA 3W5VA 2WVJA 2F7IA 4JFPA 2J3QA 5EQTA 4N5HX 3N28A 2RIRA 4QOIA 1ZVSA 1V95A 1BMFD 5L45A 5BRJA 4A2PA 3HKZA 4RIGA 3GRRA 2G5BA 3ZZMA 4AUJA 3PUZA 2F2HA 3LLVA 1DTUA 5JASA 4CQMB 5G55A 4Y7CA 4CMHC 3RKDC 3ALPA 1P1KA 4LRTB 2R0ZH 4ZDJA 2JFQA 4OIFA 3PD0A 4G3YL 1JYVA 5AW2A 1Y6FA 5DK6A 4EVQA 3UMSA 4ZQCB 2VLKD 1QSFE 4OM1H 2A74B 2IBSA 3LP8A 1IBKB 5LKAA 1YC5A 5BSFA 2E76C 3WFDL 2VL5A 2LKCA 3UBXG 4TQ9A 2OFWA 4L3ED 3CDZB 2BP7B 3WIUA 3NYWA 1BN7A 4H3SA 1YYMH 4WA7A 4BO6A 1LPSA 3RRFA 3JY6A 4NBWA 2O5ZH 4Y5VB 2YK1H 2H0PA 4A5SA 2ZIFA 5GTDA 3DPDA 3PJRA 2FPPA 1NXQA 1T5WA 4DIEA 3ILQD 3SQLA 2W2MA 2WN3A 2AZDA 1U3HC 3V2IA 4I55A 1SG6A 2HVBA 4IHOB 2D7TL 3DE2X 4OL9A 4MB6A 3HC3H 1O94D 3EDRA 1KY7A 1I7SB 5TS3A 4PB0L 3D6GA 1HK6A 2V17H 2JCSA 3I05A 4RJKA 4U49A 4DQDA 4GWGA 3V8PA 1E98A 5D96C 5C0GA 3D6JA 2VK8A 3A4LA 4KH9A 4KAAA 4EG3A 3RYHA 1XVVA 3ZXYA 3ZJ4A 3TEYA 4TN5A 5E9DA 2XTMA 2FZCA 3DMTA 3TBFA 2XG5A 3RHZA 3VGHA 5AVQB 4NOFA 4XVHA 4CU7A 3NHZA 5AM3A 4BUJA 4KE9A 5TQ2L 1CU4H 7ABPA 3ECSA 2BNRE 2FBJH 3FFDB 5IEHB 3QF4A 3V4VA 4IHQA 2WUFA 3R09A 3RVTC 1KTDB 1GDHA 1Z08A 5CYGA 2YQ4A 3WWOA 3LQMA 3R6LA 1M34A 4RPGA 1SXQA 5AM4A 1XTIA 4P8RA 2D4HA 1G8SA 4YI5A 1G1YA 1FMTA 3JASB 3GRBA 4G63A 1MF7A 4HH4A 5DYGA 4JJZA 1JMYA 1QV7A 2X4NA 2E1RA 3LKPA 4F6RB 2KE5A 4FA6A 4M0MA 5GZOD 1WF3A 2JE8A 3WWYA 4AZ8B 1KIRB 1NVMB 1XO1A 3QUTA 5IBUG 1ZJWA 4U0KA 3D5EA 2PYEE 3II2A 2XRYA 4YXWA 3ZZLA 4UMFA 3CCHB 5ICCA 1MW3A 1FQWA 1XAJA 2BSRA 4N26A 1P4JA 3JVVA 1RPTA 4BFSA 2I34A 4XR4A 5GGVH 1VCHA 1BQLL 3FUKA 3HR7A 3ZE0F 3G2PA 3ROOB 2A84A 2EFJA 3R3YA 5BRAA 4C47A 1JZJA 3JWGA 4L75A 2ARJA 3D87B 3RJOA 5ALMA 4JIMA 3KV1A 2CYCA 4WO4A 3RZCA 5FI1B 1VTKA 1R16A 5D5MB 3ZSSA 5JU6A 2VK1A 1G5PA 3JSXA 1CRWG 4RNCA 4A7UA 4C3UA 2GG1A 1HDIA 1MHCA 2VJOA 1CSEE 1JHOA 2P90A 1Z63A 1V7ZA 1VPLA 3D81A 1SXJC 9ATCA 2HQRA 3L01A 4JQCA 4HBQA 2AHRA 4KNUA 2E8YA 4NESA 1HE5A 3ZHUA 4ADJA 4KDVA 4HATA 3TVMC 4LC9A 2CNOA 4A8PA 1HHKB 1JT9A 3DX9A 3CN1A 2BVOB 3G2OA 1X1TA 4HWRA 4DQAA 3BB1A 1YIOA 2BR5A 1NF8A 2FD6L 2A9MH 2YJQA 1YDPB 4TVSa 5LAXB 3P4MA 3MJFA 4M1WA 1A95A 5JSHA 1XR3A 5I75B 2PZKA 3QWNA 3ABIA 4GQ9L 2MSDB 3ERCA 4QRDA 1QPKA 4ABTA 3ZYIA 3VD9A 4PIPA 3K9LA 4I5EA 3T1YB 5CKGA 2RJ3A 3DCNA 4RHEA 2GN4A 1B0AA 3QEGL 3NZ8A 4NUJA 4XE5B 1W46A 1P5UB 3I8SA 4ZVRA 3K94A 4BJ5A 3O03A 3MLWL 2GSDA 2VAWA 3BC1A 4F3NA 1SU6A 4DCTA 4BXOB 4R51A 5LCXA 1L5LA 4NECA 4YHKL 4EJSC 3PDGA 4NQCB 1H8HA 1FTNA 3WGJA 3G9XA 1ZSVA 4DCNA 2VR9A 1E3MA 4JUTA 3GLHE 2X3UA 3QPWA 5K3DA 1LNUA 2RGGA 1E9OB 2IIPA 3GROA 5JY1A 3BUIA 3L45A 3DJRA 5HYJA 2LGJA 2O2GA 3O38A 3UDWA 3DFZA 5BVJB 2NSHA 1IKNC 1NX6A 3FHJA 1HQ4A 3DO3A 2EDRA 3VXNB 4AOFA 2ECQA 4EDXB 3GXNA 5HZHA 1EGJH 4WZAE 3GJTA 4ELMA 2OQJB 1K97A 2ZUFA 3FN9A 5I8EA 1C4KA 3BA6A 3I5AA 5HP4A 3NEEA 1RAHA 4YAJA 1M6OB 2O6LA 1JWSA 3RDTD 4O4HF 5J6HA 5IPFA 1OH8A 3CSYA 3HVDA 3U0PB 1KB9K 4QJ4A 1HSAB 1ZONA 4AJ1A 1L7AA 4P7FA 2NZ8A 3CVDA 4HWEH 5HKKA 2P1DA 3TC9A 3RU3A 3PP3H 4HQLA 3KS0J 3I3SR 3MS4A 2JK0A 5GRUL 4R5XA 3VI4F 3OPYA 1K27A 3FCYA 5KTEH 1JSYA 4K23L 2V6FA 3GLHB 3ZOZA 5K3SA 1X7SA 1A0QH 4A0GA 3MROB 3W39B 1FZOA 1MFBH 3ESYA 3IU3A 2ZPTX 2G9VA 1FA9A 1B0GA 4MEBA 2H2PD 3G2LA 3EAFA 3L5IA 4WFJA 3A4YA 4ZT4A 3R19A 3KXPA 2AXFB 2MSWA 4AO7A 3WHPA 5BORA 4YALA 3RCBA 2CHQA 4PZZA 5F96H 2MSLA 3U48A 5KSAB 2ZZUT 5B1KA 5IB3A 1VG9B 2OZLA 2REQA 2YGOA 4G1UC 3KX2A 4FQHB 4GMTL 4APQB 3HKBA 3KVYA 5IBLC 3GAFA 3OIUA 5I4IA 2H2SC 4EGSA 2KWIA 4TLBA 5D3QA 4JO8A 1C16A 1QE3A 4LRIA 1H8SA 2OZNA 1YZLA 4ITUA 1Z15A 1RJCA 5D8JL 3VFOB 2PYFA 1RYYA 4WF7A 4M5SA 4Z7OF 5F9AC 1MCKA 3P9IA 1RCYA 4OFQA 1XR8A 3P9MA 2C26A 3CXRA 3QR1A 1YNTA 5L4LA 3F62A 5GGYA 3RREA 1F3JA 3OBIA 4L5IA 4R7NA 5AL0A 5DRXB 5BQDA 3PGCB 1YHYA 4MMZC 4FS8A 4AL8L 1MFPA 3DEYX 4C6SA 4A68A 1G42A 1TM2A 4X6CE 2BHRA 1UM5L 1IZJA 1Z34A 4GP9A 3ILHA 4PZCA 2OXHB 3H9SD 3ZGLA 3SDAC 3AERA 2IF0A 4O0LA 5L6LB 1O8CA 3OQPA 1M4KA 3U4HA 5DZOA 4RRPA 3VFNA 2B21A 1VLXA 1QFMA 2I2AA 1GZ3A 3R5FA 1MCJA 1FYTE 1Z0FA 3L0CA 4J43A 3LRHA 2P80D 1EG2A 5I30L 3HLKA 4BGVA 4TRPL 2ZJBA 3COPA 2O6DA 2OO5C 1Y07A 1W16A 4MDRA 3Q2OA 4G67A 3UMNA 2ENWA 5I7WA 2FBOJ 2D31B 3IQDB 2Y07L 3BXOA 1UT8A 5EEHA 4OXRA 1CNFA 3RRNA 3TF5A 1AGNA 1T1GA 4ZEVA 3LJKA 1AQMA 4HWKA 2JKXA 2NX5D 1PYWA 3AUAA 1SXJE 4C05A 4PR5A 5I17A 4KZEH 1A6WH 2OW7A 3W4KA 3OBBA 5SWQA 3WIHA 3OKWA 3BJIC 3CD4A 4DXHA 3OFJA 2N3JA 2TAAA 4A7GF 3S2ZA 2P6OA 1JKFA 1CICB 4RVDA 4Z7JA 2PY6A 3BS4A 3KLMX 1E5CA 2RK4A 4N2BA 1Q1JL 3TNDA 3W9YA 4XUCA 7PCYA 3OETA 3DLBA 2PWAA 3U4QA 1PL7A 4DGVH 1ISRA 5KWEA 3D52A 3DG9A 3D6NB 1D7AA 2FUQA 2XX0A 1C9KA 1OMOA 3P9XA 3P2IA 2ISSD 3OF5A 4MCNA 3QS2A 4MS4A 2HMVA 3RWGA 2IY9A 2VLJD 2KJQA 1N3NA 2B1HH 3PVZA 4H8QA 1OB1A 2PKCA 3GXTA 5BOPA 4KK3A 3O6FB 2OMWA 1KJMA 1WUYA 1CU4L 1DC4A 1FZKB 1K3TA 1QW8A 1AN0A 2CSPA 4K6GA 2F3RA 3AM8C 4YGXB 5F7KC 4QC2A 2XCUA 4FS3A 1YZZA 1R46A 4I66A 4ZRNA 5REQB 3SHOA 4HWTA 1BIFA 1WB5A 1AZVA 3E82A 4D3CL 3V0VA 1GPLA 2K7PA 4B0MM 2OMTB 1YZKA 2NUAA 3W56A 3L7NA 5FUMA 3DK2A 2EDNA 4B41A 5C92A 1GOHA 1OE0A 3J81k 1R66A 3U4AA 1RPUA 1KTKE 1BG6A 3C8HA 2CZCA 1Q3KA 3A24A 4OGAD 1IZ7A 1YC8A 1K68A 4HNSA 3FKUS 1KTBA 1H2AS 2Y9MB 3TD9A 2V45A 1PW7A 3REWB 3EFFB 1DUSA 4GAYB 2QK4A 4Y2YA 2AV1A 1QIEA 2GOYA 4GPAA 3I04A 4LF3B 1ZLWH 1PZHA 2CJUH 1G6VK 2H9GA 3TG2A 2QLBA 3SBDA 3NHBA 1MSPA 1CZLA 2AOUA 1UWKA 4F4DA 3KM1A 1IJKA 5T1MA 3CK0H 5J63A 1L6PA 4KWHA 4CF3A 1UCBH 3H2PA 2AG8A 4JXZA 2BI4A 4DUZB 1VECA 2D1FA 4TVSA 3QQ3B 1EZZA 2P5TB 1HX0A 5KTMA 4JT8A 4NMHA 4D6YA 4H1VA 3RKDD 2QKYA 1KP2A 1A6ZA 3HBMA 4NFSA 3F00A 3QXAA 4PP2B 3EYAA 3WNJA 2VYQA 5EIEA 5DSTA 1E43A 1FGVH 3E22B 4P84A 3T9CA 4ND4A 2R69H 2WTMA 3RU8H 3QNYA 5LNK6 1NURA 2X09A 5IFJB 5BR8B 5J1SC 5I9BA 2YC4C 1VKNA 4ARBA 4X61A 1RHFA 5JYMA 4Q9RL 1JDCA 2HKFH 5ANMB 3Q2VA 1X7HA 1S7VA 3MWGA 4JI6B 1K3FA 4KVCH 1AG0A 2HC9A 1WUTA 3T1OA 1OGAE 4E41D 4B9CA 2VJLA 3BN3A 5FF9A 3VVVA 3EZLA 1NMSA 3BILA 2K45A 5GIRB 2KBFA 1MI5E 4LVEA 3LK6A 2R5WA 2I3DA 1R4AA 1Y3DE 2W81C 3AR2A 3DE6X 4P9NA 4FW9A 4I7ZC 4OOFA 4M0EA 4KDCA 3HM9A 2BMWA 4JFPB 3V95A 1CMOA 3NVQA 3LU1A 4O51B 3WXMA 5K1NA 2Y22A 1PF3A 1S7WB 3C3BA 4O3UB 3O93A 2HLPA 3RIHA 4LLMA 4WLVA 4O4JF 1BAWA 3SQRA 2BRRH 5ETJA 1SMOA 2CXNA 1ZM4A 3NBMA 1ORQA 5CX1B 3DWFA 1U8MA 3UT0A 1T83C 3C3XA 4QG3A 1B43A 1QA9A 3BSWA 5FB8A 4RZHA 5T1JA 1SHUX 1OARH 2QZ9A 1YTUA 5IDQA 5KSBA 1KZ4A 3SF0A 4JMPA 1T2JA 4OYLA 1UP4A 3T5GA 2RCSH 4GX1A 1R12A 3BQVA 3CBJB 1KJ2A 1ZIOA 3HEIB 1P6QA 1J5OH 3FE2A 1SY6L 4UFNA 1X5MA 4GW4A 3ZHTA 1N18A 4G5FA 4CA4A 2WF5A 4I1SA 1MI5B 3U3KA 4LSUH 4MCJA 4DIXA 5KHOC 2FF7A 1R3KB 1LLCA 4BJHB 4ENRA 1R34A 2YJGA 4FD2A 1GGUA 3C7TA 4AEHL 1FFNA 1D6SA 1B8PA 3RS3A 4WEQA 4TQHA 1MVYA 2XRAL 2JKNA 2ZDGA 1EZVX 4GLBA 1P77A 1ZT7B 5IP5A 5D2NB 1O5DT 1JDSA 2J6BA 2A0KA 4LZAA 5F7HA 1FFBA 3IAM1 5DEFB 1S78D 2ECKA 4MUKA 1ZWIA 3MMEA 4TWJA 1RZPA 5LQJA 3RSLA 1AQ6A 5BN5B 1G21E 1EHAA 4N7JA 3CBGA 3JYCA 3BREA 4BFUA 5J89A 2GI0A 2RCSL 2XIBA 1UWYA 3VRJB 3W2DL 3IIJA 4PTTB 4QHNA 1RJDA 3ROMA 1QFHA 2A2QT 2FATL 4Z4GA 3DBIA 1SBZA 1DN0B 5FT9A 2QNIA 1X5FA 1MX5A 3N2GA 2G2PA 3B8EA 4MAFA 2I33A 1G7PB 2MOQA 2MCMA 5KOHA 4H3HB 3N76A 4QHLA 1XTBA 3FIUA 4NZPA 3OMIB 2OTUA 4HYTA 2Y24A 1DJNA 1YBFA 4JLNA 4URHA 3T5CA 3ARGA 3QIWB 4I2XA 3E3QC 4YHYC 3QZUA 1TQVA 3OQHA 3O3DA 1S6NA 1P3JA 4RZSA 1T1YA 2FUTA 2Z98A 4RE6A 2L04A 2IEDA 1WCYA 4YCSA 4X00A 2X9QA 2YARA 5MN6A 5TE7H 3OWHA 3W2IA 4X6LA 2DWEB 5JHMA 5IQMA 3CB2A 5C0DA 2WTBA 4TZTA 2R1YB 4CHGA 3QUGA 3RDTC 3EEQA 4RAUA 1X44A 1SM3L 1XBDA 3WOVA 2PPVA 3VQ1C 2O6CA 4PSRA 3VSCA 5JPNC 1SLUA 1NA5A 4L4UA 2YW2A 1KEGL 3I84A 3II1A 4GAGH 2D2VA 3ZE1B 1XKQA 3EPJA 2WIIB 4NP4L 5TARA 5TDOB 4TNEA 2ZJOA 4R0NA 2QKIA 2O8DB 3EJYD 5D3ZA 5IG2A 2NXWA 2C2BA 1QSFA 5J12C 2WMOB 3BGDA 5D7LB 4ZQTA 1XMEB 2F90A 4ODXA 2JXMB 1U1EA 5JG7A 3W6UA 3TOZA 5KCZA 4UOW1 5CDSA 1HE2A 5DFAA 1K6QL 1DJWA 2EATA 3FETA 1E7QA 1OL0A 4KB5A 1CUIA 5LNGA 2BGWA 3TCNA 2PCPB 3NPMA 4O25A 1QQAA 2YEZA 1T7ZA 1BH2A 3NK4A 1ZD4A 3NTXA 1X6VA 4LV6A 2YD9A 3EYQD 4AX3A 4UNUA 5BVGA 1RHHB 5B7MA 1BQ5A 4ENUA 2Q5OA 1FFYA 5DR5L 3F7NA 5CEXB 3E58A 3PJFA 3SBEA 4R1QA 1KMCA 3FB7B 1I2BA 3EW9A 4OK5A 2WXRA 2X4RB 2ZB7A 5AVZA 2Y3AA 3QBJA 3VPDA 2QGBA 3TIEA 3FROA 1SPXA 3WWPA 4FXLA 3MQIA 5KYXB 1P72A 3K2KA 3IMUA 3VHQA 4RMNA 2RHBA 5EOVA 1V37A 3E3OA 3VC3A 1L5GA 4MLZA 3COYA 1XKLA 2B0JA 1V41E 1PWXA 3F98A 2GAIA 4UT9A 2F53E 5IMBA 1B26A 2BCGY 1OIOA 2QP3A 4N7BA 2VATA 1I7NA 2LTQB 2JFZA 1UBCA 2A9JA 1XXHA 2I99A 4L2LA 5CCGE 5I1DA 3DD5A 3B2UD 3OR6B 2VC2B 1HJBC 2DQCH 1GZ6A 1K5HA 1WZMA 3V34A 2AR0A 3OSUA 5IB2B 2ZRQA 3CY6A 3RWJB 2OV1A 1BM7A 3MJ7A 2X1MA 4EI6B 1Y3IA 4BNYA 1HSBB 2HCBA 5I9NA 3QPVA 3NPZB 1A1NB 4JLSA 5U1PA 4XSHA 1RJYA 2IZ6A 1PL8A 4MXQD 2IG2L 3WHXB 1PZGA 5T4EA 3B9KB 4RA3A 1QPGA 3HDGA 5K8CA 1XZBA 4TT3A 4BO5A 3CUSA 5KNDA 4DWWA 2P65A 4AK2A 1RUAH 5GINE 3V4ZA 4LPYA 3CKKA 3VZBA 1T0NA 3QVMA 4DVGA 1WAEA 4NJMB 4ZUUA 5JW5A 1CUZA 4KW7A 4LJ6A 2LAGB 2Q8BH 2Y36H 5LUMA 1DKQA 1M10A 2ZJ3A 2EFHB 1RAFA 1VFBA 1YEEL 4V3BA 4HAKA 1G3MA 4XTRD 3OZXA 4WEUD 4PTLA 1UOLA 5D1XC 4LIPD 2QY9A 3N06B 3GWZA 2QD1A 3BQMB 1MCPH 4C3OB 2JRCA 1DEDA 3SBOA 4HOMA 4IKOA 1L8AA 4QRQA 3PF2A 4RFVA 2NW2A 1CF4A 5T64A 1AY1L 1N5DA 3W11C 3O9ZA 4OLEA 1FSKC 3NIDF 4IS6A 3A3YA 2AEWA 4ARAA 3CH4B 1IGYB 2LPMA 3I5UA 2HU7A 1I7ZA 2X2YA 2Y0BA 3PXLA 1DCFA 1C1YA 2AOVA 5CVJA 2DKUA 1USIA 2QL9A 1G1CA 2P62A 5C07D 5AVSA 3AKCA 3H0KA 4LBWA 1E2MA 4LQFH 4MW4A 4ZW6A 1TTRA 2P5PA 4I77H 3PFIA 4X6XA 2VL4A 4IUYA 1MG5A 2X8JB 5ERXA 5JH7F 2IYLD 4G2TA 2XOKD 3CO5A 3R6WA 3GZKA 1A4AA 3T04D 1WUJS 2E9SA 3AS2A 1EXWA 5D3KA 1G9NL 1QHHA 5AT1A 4KVAA 3O3BA 4PQFA 3CPLA 1SHYB 2BY1A 2MRYA 3IEMA 1X8LA 5AHRA 3ZYZA 1JOIA 5ITBL 3BXEA 4D2IA 4KMQA 3ILEA 5AW2B 2DH3A 5EUOE 4ZMTA 1NJSA 1JNHB 4I1NB 3K0FB 3VWJC 5F64A 3QI9B 5GGSA 3EMVA 3OL2B 4RKQA 1LSOA 1SVUA 1UBTS 3LDAA 3EFBA 1C7TA 5K3FB 4DP2X 2Y1OA 4JDVB 2QZQA 1HCFX 5CN2A 5JW4N 1Y48E 1WBXA 5ABZA 2LV8A 5AOBA 5K9OB 2X2IA 3TIVA 4X5QA 3ZTDC 4H3KB 2DQIL 1A21A 5I0DA 1LNZA 5DRXA 5CBKA 4YSAA 1X3LA 1RAGA 3AQIA 3JTSB 4LJRA 5K0ZA 4OTXH 4JBYA 4YSQA 2L3BA 2PLAA 2Y76A 2M1XA 1U4NA 1TJIL 4QRPA 5FCSH 3CSFA 5I8ZA 2J0SA 2BFEB 1E4KA 5AHKA 3A23A 4HHGA 4EL5A 3ERXA 3TFKC 1DQDL 4HNRA 1L5SA 4PJFA 3MGKA 4CMBA 3NGMA 1DX6A 4BTVA 2VQSA 2J3DA 3OWEA 1UK8A 2HL6A 5DTFA 1C5DA 3GMPB 1DCKA 1JZFA 2CRZA 3L4BA 4P48A 4QPJC 4BA8A 3O2SB 4BFIB 1XU7A 4GW1B 3AFNA 4LLUA 3QHFH 4YRMA 4KPHH 5B8CC 2VK4A 3SQXA 2D31A 2FPUA 1TCRB 4RAVA 2Q76B 1JKXA 3CFKB 3D4YA 4N2DA 1M2EA 4QDXA 4AN4A 1K5DA 1V8HA 3QH3A 3ER8A 2XNCA 1KDJA 2RKWA 1WQ3A 1B0GB 1NXWA 1X5XA 2ICWI 2OCXA 1L9RA 2XA8L 4EBFA 4LHYA 4ILDA 2OMVA 3GMQA 4KHTL 1TGYA 1QH0A 2JJTA 1U8AA 2HG5B 4IKJA 2WU8A 1CF8L 4E4TA 1SXNA 3UJTL 2FPWA 4XPAL 2X8AA 3O8CA 3L3GA 4E6PA 3B60A 4C29A 3MZTA 5K6AA 5E3HA 4YQXH 4XBPA 5SWZB 4I81A 5F7AA 3L7LA 4EEEA 2Y27A 1S2NA 5CT5A 4C9BA 4RLSA 2B77A 2FMHA 5LZ7A 2FAXA 2ONYA 4KJZA 4O5OA 4HEMA 3HS0A 2ZANA 3H9HB 2WM8A 4EN3A 3F9CA 4FT2A 1DEHA 1F18A 3VDQA 3SKUD 2ACWA 4N3TA 1VHDA 3KS0H 3FYCA 5EEUA 4WASA 2FATH 5FPSA 2AVFA 1SH7A 1DC8A 4QXMA 1GR7A 4M6MH 3L16A 3ITDA 4FKBA 4XO8A 3O8QB 1M8JA 1BZEA 5CVVA 5FUCE 4Q4JB 2XN9B 1NIBA 1JBJA 1FX1A 1WHTB 5CPBA 3DX1A 3D0KA 4FDVA 4NS1A 2CHVA 1XF4B 5CIPH 3X3GH 2N59A 1Z6ZA 3FCSA 3DLCA 4OI2A 4B85A 2I9KA 2CUKA 4FZVA 1B6UA 1CW2B 5I7AA 4K9JA 1SQ6A 4I46A 1NNSA 2BMKB 4HG4K 4AVHA 3PF9A 3IU3B 4YZWA 4ZALA 4GG6A 1ZPUA 3PHOB 1BVHA 1FF5A 5F8QC 1NL0L 3KZ8A 1WBDA 4PRBA 1M2VB 4BQSA 1T0IA 2VLJA 3M2PA 4JHBA 2Q27A 1AKWA 4HYQA 5COBA 3GJXC 1PNTA 2MOVA 4JRLA 1E9QA 4MNQB 3PAVA 1TXKA 3C5ZC 2NQ8A 4JVUA 1QIIA 3JZ7A 2Z7WA 1X1SA 3RWOA 4OQXA 1ISGA 4IUCS 4LVOA 1ZA3A 3EO1B 5A5GA 3D31A 1PLCA 1IC5L 4FX5A 4H40A 3ARZA 5BV7A 3T3HA 2XUFA 5HHQA 5DI3B 1T3FA 1OY3B 1THTA 3L6CA 1WZEA 2WMNB 4ZT3A 2WOOA 4Q9NA 2VWQA 1UXKA 3C3PA 1PTJC 5JOPE 1NCUA 4TNWK 3JZDA 1DQDH 2OEPA 4EQ6B 4EXPX 3T6QC 5BNZA 1IN8A 1E90A 5T5FH 4DW2L 4RJIA 2LLLA 3D64A 4FXOA 2R0KL 4EQ3A 4EFLA 1NICA 5AALA 3GNLA 4DVBA 3DHJA 1BA9A 3U6RB 2OP4H 3JAWB 1NCDH 4CAGA 3ADBA 3QEGH 2SKDA 5E1OA 3KNBA 3USZA 4KG7A 2IHVA 3T3IA 4ND2A 4GQAA 4RFSB 2VRCD 5HDQL 4N0UB 1DINA 4QXAA 2RH5A 3TOPA 4AMVA 4L8VA 3T8YA 3PIRA 1NBMD 3CW9A 3VR5A 1ZX1A 2X9GA 2VS1A 2VXQL 5CWSA 1E4HA 1ZVKA 2NDGA 3LH2H 5HD8D 4PO3X 2B1IA 2XHEA 5IU6A 1CR9H 3BWDD 1U8QB 1J0KA 2WLZA 5CXXA 2YD2A 4M55A 4R6WA 2JJ1D 2FX2A 3G8YA 1VCMA 3L84A 3IJSB 3A4NA 5FV1L 4LWZA 5E1AB 2WHXA 2A5YB 2A35A 4KN8A 4G8BA 3RBGA 1DXOA 3D0OA 2DUJA 4FFYH 5D70H 4B6PA 1CR0A 1IBRA 2B59B 1DDOA 1G4MA 4A8JB 3GPLA 4YUEL 4YNYA 2NMSA 4MYPA 4HQQL 5F73A 3NZEA 5DCWA 2FV8A 2RH9B 1FNAA 1JPNA 3GCXA 1BQEA 3R7DA 4QQRA 2R7AA 3G0BA 5GSVB 1ZJAA 4BPRA 1D1QA 2JCCF 3RWFB 4R9VA 4L4TB 3GRZA 2DQJH 4P2BA 2ZE5A 1OXTA 5M34A 1IQPA 2C04A 4FN5A 3VTKA 5CFNA 5DLMH 4NE9A 2AXQA 3SKVA 1Y7TA 1G5AA 1XB3A 1MFEL 5C08E 4KZDH 3W57A 1H3FA 1BZYA 5EKUA 4AQEA 1C5CL 3HRPA 5KJEA 1I2CA 1ZWIB 4DXDA 2PYFB 3GLGE 2NY4D 1NT2A 3D1MC 5EA0H 1KI6B 2WICA 1TPXB 1XJQA 4HS9A 1YFJA 2WIJA 4XUEA 3A4VA 3K5SA 3MPUA 5CEZD 1GUBA 2BTEA 1FP5A 2GCOB 2BIIA 1HDCA 5FNVF 4YP9A 1MHTA 5JADA 1YEKL 4BTEA 2BGIA 2WIKA 3ZKWB 3WRVA 4J16A 3ZGXA 2VJMB 3UG7A 4MV9A 1CU1A 4O2RA 2PZ8A 4BQRA 1UH5A 4CYMA 3MODL 5EHXA 3WFCL 2XZAL 1TM1E 3A6FA 3HHPA 1U8LB 4JANA 4OLXL 5DMKB 3AG5A 5IJDC 1SCUB 2HCZX 3U25A 3OHXC 4MGKR 3ZY6A 3BVWA 5FECA 1JQ3A 5DIFA 2QGCA 3LCUA 3CK0L 3E84A 1QLFB 1O77A 3SPIA 4EJ2A 4WWHA 1B1AA 1BX2A 3CG4A 3JQ7A 5IVKA 2ZJ2A 2R11A 1GAJA 3SDYL 1MJJA 2AV6A 1AO7E 3UJNA 3K8QA 2C29D 4R3SA 3GLGB 2ZR7A 3Q3EA 3V8RA 5B5SA 3TNMB 4NNYA 2EDTA 4Y1EA 1A6ZB 4IIEA 1E8MA 1X3DA 3KYJB 5FUCC 3H7AA 4BFYA 1UINA 1X5JA 1JPUA 1DO5A 3E6HB 1IQ0A 3OXRA 1JXKA 5H7XA 4F3YA 1HFJA 3TH4T 5JJLA 4MAYC 1BXVA 2VISA 3UJ9A 1B6TA 3L0IB 4ER7A 5LXTA 2P1YA 2QUZA 2CFOA 2RQ8A 4R7GA 1AZZC 3LEXA 5ULLA 1BAFL 4YJ3F 5IWCA 2V96A 4GP6A 3AVTA 5DS8B 1OAOA 4Y4FA 1YRBA 4WW2F 5HFNA 3ICOA 1T2XA 1HBJA 5M29A 1NBMA 1JU9A 3E70C 1P1ZB 1M54A 4ROTA 2OGSA 1VLVA 3LPLA 5HJ3B 5J2TB 5IUKC 5KNCH 1O9WA 4HJJL 3K91A 4D41A 3Q3GA 3QFGA 3LWNA 2V5TA 1A5TA 1OAAA 4XPIB 3C39A 5K6AC 5EIIB 3VBEA 1YEIL 4G42A 4COOA 4C0HA 4WLEA 4MRNA 4TLKA 1UOWA 3MR9A 3WS6C 1D07A 4PJIF 5DA0B 2ZSIA 3AP1A 2G4CA 1XZPA 2OMYA 1D1PA 1QLWA 3HS0C 3RYTC 4JLRA 3GXPA 4F5CE 1W47A 4M1GL 2JD0A 4AMWA 1DN0A 2ITEA 1TYRA 1UM9B 2H29A 1LV7A 2HG0A 1Z38A 4UTBH 4M93C 2EDBA 3AHIA 1HZHL 4GQIA 1SYSB 1X7DA 4JVWA 5LGYA 4EN2A 1AJ7H 2QGZA 1R6VA 1TJHL 1ZGHA 3LQAH 2A83B 3AGQA 4AGLA 3KQMA 5PGMA 3TIDA 4D4GA 2ZWPA 1SC6A 3EG9A 3C4QA 4NONA 3CGTA 4L3AA 5FHQA 5DO9A 5EHFA 2DQFA 1I4TD 2G70A 3HCBA 2GZRA 3P2DA 5L3RA 4DQLA 3ZYOA 2VEDA 2C0PA 5JRJA 1Q6YA 4FABH 2FWJA 5AYTA 2A5LA 4AQYB 4C0LA 3ABKB 1RIFA 3N7AA 4DJEC 3GSOA 4XZ4A 3O3EA 3IR7A 5GRWA 4ELKA 1ZAKA 1A6VL 2IZZA 4NWTL 3I6BA 2JB6B 4MWCA 5K0JA 4NG4A 2FUKA 4DKEL 3UFXB 4QJ5B 1YJ5A 4IMPA 3OKFA 4H1LG 2CCWA 5K33A 3V5KA 4NM4H 4Y2SA 3D0LA 1OOAA 1T2FA 3G2MA 3N0RA 3Q11A 1XIVA 1JI1A 1U2SA 3C0KA 3SZGA 1P5RA 4HLUC 1UB5A 1NEPA 4PGDA 2TMYA 1CDUA 1XZ0A 1KO1A 5ANMA 4YWGH 2QRNA 2A99A 2N1TE 1W15A 3PFHA 1SVMA 4LXQA 1AZRA 4GOSA 3BPNC 4J0IA 3EOBB 2GVNA 5DTQA 4G8FB 4XARA 1TTFA 3W9EB 4CCAA 4B6QA 1LQTA 1C7IA 4HIHB 3WMWA 3K30A 1MXHA 3EVFA 5AW6A 2VABA 2NNCA 2V7QD 1VQ1A 3IT8D 3ZKAA 3F6JA 1WEJH 2JAPA 1F17A 3WS3A 1BYPA 2PW2B 1DFIA 1SBTA 2JIDA 5CFAA 4BBJA 3MYJA 2BCMA 4BKMA 3RJZA 3NONA 4XD2A 4N8EA 4G6MH 2ZETA 2VPPA 3TO4B 3IPFA 4OYYA 1UVQA 4NQXB 2VUHB 3TTYA 2RJOA 3PYLA 3ZL1A 2DY1A 3O41B 4M5ZL 4Z76B 2D5BA 3DLAA 4DHEA 3OKDB 3M6XA 5E6IC 5DW0A 4NI6A 1PEAA 1BS1A 1OLUA 1B3RA 1EGJA 2QAGB 4MD5A 2YRPA 5EU4B 4JCOA 4OKIA 2GJJA 4E6EA 2ZM6B 2ZWMA 2HLFC 2AZXA 4OQ1A 1X7YB 1BXKA 3OOJA 1LPBB 4B33A 1ZPDA 3RAPR 5KYWB 1U41A 4I8XA 3WL7A 1GZHB 3ZPXA 1GLNA 1C12A 3U46A 4NYMR 2PTTA 5E99H 3QDGB 4U1RA 4XLLA 4JB3A 3G5XA 1VGKB 2P48B 4WV1B 3PE4A 4OLVH 3QI9A 1TMOA 4PU2A 1MG0A 4BNNA 1VSTA 1BLNA 2C9VA 2WCPA 1KGCD 3EYOB 4WY7L 1D2EA 4WCYH 4CU8A 4UTAL 2GHIA 2GHWB 1J8HB 2XVLA 2VLKA 5HY9B 4Y2DA 4NPYA 1U3HD 4A2QA 3QFFA 4EVSA 5KSVB 4LRXA 4QO1B 2FW9A 5DZPA 2ISCA 4D9JA 3NSDA 1N78A 1MI5A 1R3LA 1WD7A 1HXYA 3I92A 4XQEA 5ICZB 4GGPA 3FGOA 3E8VA 3OB8A 1EEZB 3HXTA 1E7YA 4NBUA 1DZ0A 4XQ0A 4LNAA 2E9WA 4DBLE 2X2OA 5FK9A 1EGAA 1LPPA 2HA3A 3G5YA 1N5AA 2YOFA 5EE1A 1V3VA 3FSRA 5F6IC 1LLUA 4PCYA 2RFXB 4QRBA 3H0EA 2AI0L 3DFFA 4F2FA 3PWNB 2TRYA 2BHTA 4JM2C 1RUMH 5DTFB 2CWDA 4L02A 3E9MA 4TNVF 3WIIL 5IW1A 4XB3A 3UTQA 1OQAA 1GRQA 1MJGA 1YJBA 4EGAA 2WKOF 2PETA 4MD0A 4QMEA 1CC3A 3Q48A 3LY6A 2VH2A 5JBNA 1MQKL 2BS8A 2VYNA 2VJKA 2ZBRA 1MRDH 3KBPA 2Y7NA 5DD1H 1D5BB 2Y69B 4RAVB 1LKZA 1Q6ZA 2IAMD 4WXMA 2FN9A 3HOGA 3IP7A 1BXGA 5I16A 1CIVA 4KZ0A 3D8RA 4NQCD 3U49A 1CR6A 4U1NB 3CO0S 1ZVSB 3D3QA 1RJ9A 2VHTA 4EJMA 4HOYA 2D03L 3AG3B 3L5HA 5D86A 3JU3A 3ONEA 1T0PB 1KXVA 5E0QA 1S3KH 5T3XE 1NNI1 3CFDA 5HDRA 1DCMA 1TEFA 2JGKA 1XH3B 2AQIA 5F3WB 4Q16A 4B73A 1XFDA 1M1SA 3EBOA 2LGNA 1MEJA 2YD3A 3RUCA 4JZKA 2O8CB 4M7KH 4IS3A 3DXFA 3KTOA 3H04A 2YWGA 2VR6A 2OUIA 5BSTA 3FXIC 1QABA 5E8NA 3FO1B 4ZVMA 2H32A 1CJBA 5EWIH 2J8OA 3VXME 5JDIC 4LLVA 3S8FB 1BQSA 3NK3A 4MDJA 4FQ8A 5C1OA 1EWKA 5FYKL 1ZHOA 2EDYA 4H1LB 1SC1A 3SCMD 4MLPA 5HBGA 4FD0A 3BH8B 3SPVA 1TKWA 2IU0A 4U0QB 1ZWKA 2VNKA 2ZKLA 4XNZC 3L6UA 4WENB 4BB9A 4X5WA 1M2HA 3GF4A 1WW3A 2CLCX 2GCGA 3ZCQA 1FVFA 1ZH4A 4WZ9A 2B99A 1FL5A 1XELA 5CA0B 5CR8A 1AS6A 2WC1A 3QKUA 4B0MB 3KYDB 5IZCA 4YFYA 2ES4A 2V7UA 3W5UA 1A5FL 4ZMYA 1J6UA 2QYSA 4D74A 3US0A 3OCYA 3B9AA 4P98A 4YCAA 4OB8A 1L9PA 4AX4A 2FKNA 3KD2A 4Z9YA 4YBLB 3EF0A 3S6CA 3ONFA 3HZ3A 1I1FB 1I1AD 4L5FL 3C98A 1IONA 2I2WA 5BMVA 5JLJA 2BMKA 2DIBA 2AMVA 3GUZA 4D79A 1ZMXA 3ALWA 4HQNA 4DBLC 5BVGB 1GN9A 4M03A 4OBEA 3Q44A 1H15A 1KG0A 2R1VA 1S8FA 3TBTA 4XBEL 1H2WA 5HIMA 1KT2B 1HXMB 2RK3A 3PEFA 2D7NA 3VXPB 2HAEA 2W2QA 3Q7IA 4JJKA 3L3JA 5DVOA 1JF1A 4MR7B 2UZIR 1R9JA 5ELLA 3GEIA 4X4MA 5CRIA 3QX3A 3AG6A 4B79A 3JD0A 3KM0A 2WQZA 4U2CA 4CILA 3ZW3A 4NSNA 2PO6A 5FOTA 2ZBDA 2BF4A 2VC2L 2NY3B 5AHOA 3HZMB 4JBXA 1S7RA 2LW7A 4OZIA 2X3YA 4HUTA 1Q1BA 5FR3A 1NAHA 4Z95H 3HVNA 2JQZA 4ZU6X 2XRMA 2ODEA 4G8GD 2C7FA 3W82A 2WXLA 3G17A 1LEIB 1VRCA 3RU7A 3TO2B 2VVTA 4YJHB 1L5NA 4NWIA 3LBAA 4FTVE 2ZR0A 3N44F 5FUVA 3G0CA 4LEOA 2PD4A 5L3SA 1UMCB 2C88A 3NCBB 3ND6A 3SGDI 4F4HA 4LLDA 3FTVA 1YECH 4ZJ9A 1GZUA 3P77B 4WOKA 3BN9D 1M1ZA 3ARUA 1I9RH 3QIBA 3HPRA 4FT4A 4TLLB 1TLLA 7PAZA 3R0VA 5CVCA 3PABB 3OLXA 3UYPA 2DJUA 1V7QA 3N0TA 3PTZA 1MCSA 2BSED 5DT9A 1WA2X 4KI5E 3BZBA 5GONA 2X8LA 1F20A 1DJHA 1NUGA 2ZJFA 2YHGA 3KLDA 4TUKL 2AJDA 2ZPAA 5M2QA 2Q7DA 5IJVB 4HJTA 2G1AA 3KU1A 3RSOA 1KQPA 5BV1A 3DI2B 3EBIA 3S3PA 3K96A 5AK4A 5I30H 3PX2A 3ADPA 4N01A 4LCWE 3ECBB 5J4KA 4MITA 2DJMA 1PG0A 2BCKA 3B2PA 2OHIA 4I18A 5B7QA 3DHUA 2CBPA 3N2KB 4UAOC 4PYQA 5FKAB 1X5GA 3NGBB 4QULA 4ALAL 3D39A 3MBEB 4BV8A 3BYYA 3GXBA 4QM6A 4FCTA 4WNYA 4B40A 3AITA 5TQJA 3GLAA 4ZDIA 2O7RA 3P02A 5A0FA 3RFZC 5MENE 3B7SA 5TQ0L 3OSZA 1JFHA 1VPOH 1KKLA 1V7ML 1J07A 2HKAA 5BPPA 3O3UN 5K2OA 4O4YL 2P4EA 2FTKE 4TLSA 1AHWA 1XDGA 1XNJA 1VLZA 1YONA 1N8TA 1UASA 4YSSA 4XCVA 4EB6B 3LY9A 4D26A 3NHFA 3RL2B 5EGSA 5IUJC 1VE5A 1WLHA 4NMWA 3LV3B 1KB5A 1OC2A 4Y9CA 1MT0A 1W0CA 3HMXL 1RBQA 4WLFA 2ICAA 2QVIA 4L16A 1IBDA 1AP2B 1HQYE 4LF5B 1J0JA 5EC1A 1Z45A 3AFMA 2Z8VC 1Z4QA 2R8YA 4OLFA 3AUWB 1AIPA 5TS2A 1G66A 4XPFH 3QYAA 2FXIA 1KY2A 4HWBA 3ARRA 3ROZA 1J9TA 1BEXA 3I6QA 4BKQA 4YGVB 3G0OA 4ME6A 3CHSA 3PBKA 3A11A 4L5JA 2GZ2A 3GLEA 3I9OA 1PR4A 4FCHA 1AQKH 3MJVA 4UT9L 2ZK7A 4GXNA 5IGXL 2IYEA 3CHRA 4OQEA 3BFKA 4MWTA 4KVPA 4REQB 4BMPB 5MFZA 5MHSD 2OTCA 4J3JA 3G1UA 3LS5L 2XEXA 3O83A 4MLCA 1Q9KB 1NBOA 4HV8A 4TV8B 4N20A 2O19A 2AQPA 2NSQA 4OQYA 3COOA 3UXEA 3DJSA 2GEFA 1UDAA 4BWTA 2BNUB 3LNDA 5JHAA 2X1OA 3ARDA 1NXOA 4C5AA 1NQOA 2H52A 3I9JA 3B78A 3PC8C 4PRHD 1PK7A 4QOHA 5A16A 5T8KA 3SJZA 4LASL 3RNQA 1I0IA 3FB6A 4HZAA 2QPEB 1AXGA 5ENDA 2ZXFA 5D3MA 3WL9B 4Q37A 5L7XH 2Q0ZX 4ZJZA 5B4MC 5KW9H 2JIXA 5A2KH 1V11B 5EIXA 3U60B 3ZKQD 3O2VL 4YJ2B 1ILUA 3EJCA 1FYWA 4XVCA 1TLMA 3SBRA 1HRDA 4B4OA 3AREB 1AHNA 1GR0A 1K4CB 2OB2A 3TL3A 3LHDA 5A9RA 1ZVQA 1TCBA 3SPXA 5E1HB 2BWQA 5KTNA 4CKEB 4ODIA 1K85A 2QL5A 3PY9A 4A39A 2OW6A 3AHHA 5KQMA 1I36A 2FDRA 1MEEA 4D7PA 2J33A 4HHAB 1FX0A 1X74A 1K5NB 2XSKA 3GT0A 3QXTA 4EQ6A 1XQWA 3H9BA 1T4BA 3GMLB 1WABA 1CI3M 1G7HB 4ZYLA 5BMFH 5SYAA 2DM7A 4ZW8A 1M0EA 1M2OA 3T1TA 1WDMA 1NI4A 5L3QA 4GS7B 3MV7E 3SZ3A 4F8YA 3CUYA 1SBSL 4OM0L 2F54B 1IY2A 4KR7A 2QR2A 2KZKA 2ZJSL 1JLMA 3RFCA 5FD8A 2Q7XA 4YREA 1Q84A 1S9WA 6REQA 3PVCA 4L4RA 2EXWC 4NQDD 4UHJA 4JCWA 3PSAA 3TB4A 4WACA 3HH8A 5JAMA 1JCKA 5DHRA 2ICEA 3QKTA 5ADOL 2V6MA 3TRKA 3LUCA 4N76A 5DV9A 3I6GB 3T3NA 4GRLC 5C7ZA 3BMQB 4G0QA 4W9MC 3IQXA 5IBQA 1I1HA 1M6EX 1I5EA 1IUKA 3AUJB 5DJ5A 5D84A 4K2UL 4AO6A 3CNHA 1HNZB 4QXUL 2OR3A 3P94A 5JD5A 4JX9A 2TMGA 4B3GA 2PYEA 4PJ5A 1TU2B 2Z58A 1HA3A 3HSKA 1ZXKA 4N9GA 2YRXA 2X7HA 3RODA 5DOVA 5JZBA 2XRZA 3KL0A 4YRJA 4Y8DC 3O6VA 4ARVA 4TUYF 4NXSA 5LKNA 5FECB 1CGWA 5FO8B 2Y68A 5HKLA 4Q05A 3UC0H 2YNMD 3WEOA 3V4SA 1W0VA 1MCRA 1KV3A 2BZSA 2PL9A 4GH7B 3VWKC 3A1WA 4AM0B 5IB1B 4UD6A 1QBLL 4DNQA 3MWJA 4PG9B 4AG4L 2IQ5A 5I66B 2OT3B 4G41A 5ICXB 1HH6B 4DR7B 5BQ7B 5KVFH 1KFBB 4HFNA 3QG7H 2IP2A 4LVOB 2XEDA 5D93B 3U0BA 1NBVH 3WGQA 5BOZG 2VZEA 5FA4A 4K55A 4MJ7A 3RTQB 4M7WA 4BH8A 3MRDB 4HWPA 5CNKA 4BYHA 4NKIH 4KBGA 1XDZA 4I9FA 1CN4A 4J8QA 3M46A 5J11B 4F7KA 1SOXA 4OBWA 1SXZA 1GU7A 2X3BA 1ZYUA 1GU1A 3ED5A 4QEKA 2NMVA 4YYZA 3JARA 2PWZA 2OCBA 3AVVA 1AGXA 4PJDF 4J90A 3GA0A 1OFGA 1J2UA 4RXUA 3GBDA 2CUIA 3X1ZA 3ABZA 2P47B 3NCFB 4GM0A 2VXVL 3L1GA 2P5WB 1JE1A 3ISVA 1F2TA 2VBGA 2FY8A 3EGOA 2JA1A 1HNGA 2IQAA 4HFWA 1NWCA 4Z7NE 4FQ1H 2IT1A 4MS3B 3BPCB 5BYJA 3O6FA 3ABMB 2WKQA 3GB7A 4J3OH 1IN5A 4N0PA 4XH9B 3ZWDA 2A9CA 3KLKA 2ZOTA 4JBSA 4KZCA 1BAGA 4JYAB 4UUOA 2X86A 4FDTA 4RMBA 4MXVF 3PQ3A 3LPPA 3HY3A 3HO6A 4NQVA 1Y6QA 4BQQA 4NO2B 1E9AA 4B3FX 5F9FA 2P46B 3F6EX 3GDGA 1TVBA 3I45A 3KGSA 4XVRA 3KXDA 3VNQA 2OV3A 3P2TA 1IBCA 4EMZA 3I6SA 5IZ4A 1WC7A 3AADB 3B83A 3Q3IA 3MUGB 5LPNA 3UPUA 1R17A 3KL4A 1MAAA 4JGNA 3P73B 5B8CB 2J09A 1PJWA 4CEIB 3MA9L 3U6XS 2JCCE 3EQ8A 2WZAA 5BRZE 2A78A 5FW8A 1YQVH 5FLEX 4UOEA 2REBA 4PV7A 1BXZA 5F44A 4L0QA 2QJOA 4WZAA 3DVAB 2BINA 4MGYR 4P3NA 1FH2A 3U5TA 4IBVA 3MELA 3DMFA 2NWQA 3NHRA 5AVWB 5MHSE 4CNIA 4RCYA 4FP9A 4MBOA 4O3MA 1KEGH 3AY4A 16PKA 1NMEA 3QQ4A 5FAAA 3VB8A 3IIEA 4ZANA 4I4CA 1RK1B 1QGOA 1YZVA 2IYSA 3SX0A 1A7RH 4NS4A 4NCNA 1X80B 3D3WB 4LHEA 1KLGA 3E6FB 4YHIA 1AHMA 1GGIL 3E03A 1CT8B 4XTRC 1C9SA 3AUFA 1AQJA 4D0DB 1RQNA 2WD8A 4FJ2A 4XB1A 5E6SA 3OGCA 2NTJA 2BGGA 4L9LB 4H7EA 5FWAA 4UUNA 3IVKB 5LZ5A 3RTAA 4QYWA 3UIEA 1RRCA 1A7NH 5IEJA 3EDKA 3OTQA 4DJDC 3AT1A 3NRBA 1VB3A 4DLRA 4QUEA 4IHJF 2GJ6D 2DH5A 5K0FA 2GLUA 1F3OA 2GMWA 4O2AA 1G0XA 3ZRSA 1ZKAA 1HHJA 1QGYA 4GL4A 1ND6A 4LKCA 1XD0A 4GW5B 2EQBA 3S0JA 3S37X 5IF0B 4ZQKA 3VBCA 2WKRA 1NIPA 4R41A 4KRXA 3D54D 3IMTA 1DKNA 2BKLA 3WAJA 1B2WL 1HKLL 1SKQA 2QIPA 4X1IA 3VJRA 3I32A 5TGBB 4LRSB 1UD6A 3FZUC 1XWWA 3FT2A 2IHUA 1Y1KE 4GZ5A 2RGUA 2CK0H 1DIGA 2V7NB 2VDWA 4EF3A 3TZEA 1XH3A 3BH0A 5H3CA 3HE7A 5CDFA 3H8WA 3NEJA 4MB0A 1JG9A 1WUZA 4B46A 4QQNA 5FAXA 1XGZA 2WLJA 2HUEA 4U1HA 3NCWA 5A5VA 4TXVB 1HLDA 2AWNA 4EHHA 2C2GA 4QYOA 3F64A 4GPTA 4KKBC 3RUHA 2VSDA 1PS8A 4Q82A 5D2LE 4TTDD 5L9DL 1AR1C 2XRAH 1AG6A 4L08A 1V4NA 3DGGB 4KGJA 4J4TA 2A4EA 3N59A 2AERT 2I62A 2B5IC 4RIHA 1PR2A 4AEIL 4ZMBA 1HE7A 2EYSB 3UWDA 2HLAB 3EDDA 3GIVB 2ORYA 4AI7A 4XBGB 5AVJA 1M3SA 4UT6A 2NXYD 3GZJA 3VUEA 5DDIP 4C4OA 2XLCA 4M2LA 5GRJH 3K7EA 5IHXA 2P8SA 2PXAA 3KZXA 1C1XB 221PA 4AIZB 3NHKA 2HPTA 2TMKA 4NFHA 3WFCH 1SBYA 2DEXX 1WK0A 5KSZA 3M5PA 5D2NA 1L5RA 2Y1GA 2CAKA 5LWHA 4GSDH 2I6QA 5D6CB 4Q7EA 2F18A 4RY0A 1QIHA 5KYYB 2XNDA 1ZSDA 2R00C 1FMFA 2I4MA 1GA2A 3ND8A 3C5WP 1GPOH 3NWPA 3IV9A 4AKPA 3WXVH 1NPJA 1DQZA 2VDQH 3BL8A 3PQYA 3IJEB 2R0QC 4WJZA 2AC0A 1P1RA 3V7WA 3QUMA 1KFJB 4HQ0A 5EIIA 2ONCA 3COJA 1CFBA 1ZQ1A 1AS7A 1W4ZA 3QB7C 2CXXA 5AKIA 4XPBL 3O41A 4UTCA 4R9NA 5HI3C 4EI7A 1KTDA 5ES4B 1B16A 4Z3TA 5HHXL 2X4GA 1S78C 3N2GB 3KQVA 3FF8A 2XKJE 1GG2A 2VQUA 2Y4SA 1X9LA 1U21A 3SF8B 4JI4B 2FE0A 2QRKA 1DQKA 5DSCB 1NC4A 3QG6A 3A4FA 4ALMA 5JI3E 4WHYG 1J7JA 1C12B 1KZYC 1EFXB 1ZIYA 5KX5A 3Q9NA 3K1JA 2IOHA 5T1LD 3FDXA 5FORA 2CO6B 1MREL 3KYKH 4Y2QA 1FG9C 3VX4A 4J2XA 1KACB 4Q7LA 2WBLC 4L73A 2JKJA 2PT5A 5ELIA 2HLDA 1PPIA 2XQFA 3IPXA 1ZIAA 4NCAA 4QDTA 3V0WL 1CZKA 2P5EA 4X1KB 3SM3A 1R3LB 1L3BA 4LNRA 2ZSWA 1TPZA 1LBTA 1FRZA 2Q1XA 1I85C 2UVPA 4MTMA 4ELKB 1ZMBA 3RVRA 1ZJ4A 5H82A 3Q8AA 3KVNA 2PRSA 3KWVA 4JYBA 2NT0A 1RZGA 4BE4A 3BD5A 1OI2A 1FS6A 2O8DA 2J21A 4HX2A 2PPFA 1SXGA 3HABA 4JL2A 1RPJA 2SCUB 4MVYA 1ZLSL 3SIXA 5CD1A 3IR5A 5AOCA 2RFXA 3UC0L 3RASA 2Z9CA 1LO0H 3UTOA 3JWDC 3WU1A 1KWGA 1E7WA 2BPOA 4G8EA 2IAAC 5I2IB 4JN2A 1GYCA 3LRLA 2ONJA 1K7EB 2X10A 2AC7A 2F53B 4O5AA 1QZTA 3BIJA 1FOEB 4L8LA 3LVRE 2XOTA 2DM4A 1Q9OA 4ZFZA 3TJEH 3RAFC 2IQ9H 3WY3A 2BIQA 4G8FA 3P9LA 1WT5C 4GRLB 4YE4H 2Q1EA 4N3NA 2Q20A 4DVRL 3KLAB 2JAOA 4L8YA 4UXHA 1C0KA 1W88B 5DI8A 3QPXL 2YFYA 5DJCA 1YBVA 4LA4A 3SPJA 3FVTA 3HUUA 4TKZA 3VFMB 1JEYA 4MRPA 3BKYH 1NIEA 5AKRA 1BWSA 5KYVA 3H9GA 3L4SO 1I1RA 1U8JB 2AFVA 2WWHA 4NO0A 2PJZA 2HM7A 3CLVA 2PG3A 2F2TA 3HY6A 4ILKA 2QQQA 4AWAA 1R0ZA 2B1HL 4BHUA 5T1DL 4KQ0A 1IIIA 5B6JA 2HT1A 1IVNA 4BIKA 3FCTB 4NJOA 4YXWD 2OV0A 4TTIA 3QJ5A 3T61A 2XXAA 1PFGA 5ERYA 3EO0B 3T3PB 3RX8A 1G7CA 3OTHA 1O9BA 4F8NA 1Y1UA 3WKAA 4C4UA 3EVEA 3FOLB 4I9NA 2W4IA 5DHAA 3PD7A 2ZYAA 3REWA 1E3ZA 5CGTA 3UFIA 4LCBA 3EYOA 5JR1H 3TBWA 2A9RA 3FGNA 5LU8A 3QLJA 1TFHA 3RVWD 1DKOA 1KO5A 1CL7I 1GKOA 5TMDA 3FPFA 4TZ0A 2YK1L 4D0BB 4NZUH 3GSNB 3NJFA 1KZGB 2GAAA 1FYEA 4R7NB 1RSYA 4JPSA 1KY4A 4Z77A 1DCTA 2R8SH 2MTAA 2B1RA 4LARL 3SEZA 1KZ7B 2DBYA 1C5KA 2EGGA 1DSFL 2OXHA 2MH4A 3LY8A 4N2FA 1P6AB 4JR0A 3UZQB 3VI3E 3ZUCA 5A4MS 2QMHA 4LW8A 3HDQA 4MDIB 5KUMA 4HH1A 3H4FA 3UZEC 5EKTA 2JB5H 4PIVA 1LL1A 3LLCA 1AGEB 4ZCSA 5EXDA 1RIVL 2V3WA 5CP3A 3LXXA 3QNYB 5IZ7A 3IAM6 3OTWA 4UM9B 3QDMA 4UT6H 5JE8A 5E5MA 3S3CB 2HTLC 3E48A 2C54A 3M8OL 4JSRA 2FX8L 3VXSD 2VJDA 1IAIM 4IJ3B 2FPGB 2NR6D 3BYZA 4G7RB 3ML9A 2NZUG 4QM7A 2VEOA 2MU1A 1VEMA 2ENQA 1YPZA 3BZ4B 5JIMA 3MXTA 3A0UA 4ZS6C 1JEEA 1IKOP 5CM1A 1I1NA 1WTLA 2CHNA 1ISJA 1R6BX 2O3QA 1NSNH 3ZIAD 1KAHA 4PSUA 3ZUGA 4RAOA 2I1LA 1WTAA 3A3KA 4Z4HA 4ZS7L 4FMDB 5IJCC 4WI6A 4YAFA 5BURA 1E9OA 4CGZA 1YY9D 3MJ9A 5K59F 4MQXD 2RGYA 3T1VA 3WLKX 4FOTA 2ATXA 2O8CA 1ULBA 4X7BA 4JP1A 1FNCA 4OGXH 5JOPD 1F14A 2RC6A 1JXDA 2A6DA 1H0HA 2QLJA 5CUSH 2YJ3A 4AKEA 3L2MA 3GGGA 4KPHL 4QRTA 3I01A 1SN2A 1JTEA 5K9KB 3A6GA 3D8HA 3D4PA 5KBPA 2O5CA 1FHNA 3UZVA 1C3LA 5HXAA 4Q89A 1E0OB 3GWGA 3W1EA 4HDCA 1KC5H 4FC7A 2YV4A 1BQKA 1RJWA 4AGMA 2H8PA 3GYRA 4ZOEA 5HPMB 1J1PL 1YWGO 2FSDA 3DXAE 4A92A 4OFDA 4OF0A 2YZGA 5DHTA 3NT5A 5LKRA 1UBKS 1DAGA 2UY7A 3S96B 4AC2A 2Q5JA 3KR1A 5JO5A 4XMKL 1E27A 3BMNA 4XUGB 5ALFA 5CZVH 1XYVA 1EIWA 2QG6A 2PN1A 3U6XA 2DE0X 1NN3A 3EODA 4D4JA 4QATA 2WXIA 3WY4A 2VXBA 1SLVA 1JIBA 2VRCA 3WRWA 3WJLC 1WP6A 2P77A 2JLXA 3MO1A 4B3CA 4YMUA 2FYVA 4ZV7A 4JJAA 1OZTG 2CJFA 5F71A 1OTUC 3BGFC 4ZARA 4GR9A 2J5LB 1HDXA 5J4YA 5KHAA 2HF2A 1TVDA 5MEND 4W7HA 5DVLA 1N57A 1VHWA 5IQ9B 3BFPA 4LECA 1SXCA 3HFFA 4TYPA 1M9SA 3MJ6A 1QKZH 1SNYA 1Z5UA 2XKAA 3D7NA 4U8GA 5M5BA 5HILA 5A6SA 1DVFA 1WPXA 1FP7A 4KKLD 4GRDA 4JYZA 1XZWA 2N1KA 1JS4A 2ZIXB 5GS0H 4OAQA 1K8IA 2O57A 4K9MA 2AABH 2VG8A 3N04A 1KGWA 3QEQB 4YNBA 1H6UA 4N9QA 2H6PA 1KGSA 2OA0A 1Y1DA 4OLZL 3SO3C 2R48A 1J33A 4FG0A 2P6UA 2OBLA 3KUCA 5H68A 1K2DA 3HS3A 1LD9B 3QNZA 2DOKA 2DF8A 3EJYC 5I1HH 2ITCB 4LJLA 2P49B 1PTJA 2W60B 4OIMA 3NDPA 4LE2A 1SVLA 2H1FA 3RWBA 4TKLA 4GKJB 1Q19A 3RT9A 2KQNA 1FE8H 3F4BA 4Y6OA 1XKXA 2M8XA 4YACA 4XWOC 1J1IA 2F8IA 2N7AA 5BN3A 1R74A 2QHLA 1RZKL 3QP3A 1QTNA 3U2IA 2XBLA 4MULA 4MDYA 4CN9A 3TXAA 3K4PA 3N3BC 3G2QA 1IOZA 3EFDH 3QRGH 1ZIDA 1KYQA 1OP4A 4XXHA 1OTTD 2Q49A 4YT5A 1MIMH 2NQ2C 1UADA 1QMPA 4KE7A 1TJGL 2ZYIA 4C76A 4AYGA 3ZV6A 4PWKA 2NO1A 4TTSA 5CHEA 2J3IA 2ECOA 2Q9OA 1G7LB 3BAEL 3QDJD 2COKA 2JPDA 4QFBA 1Q0EA 3VFRA 5FGRA 2MOKA 4JK0D 4LMRA 3A2KA 1FGVL 1A9XA 4XR8C 2ZAIA 4Q4AA 5EYPA 5CVTA 4HBZA 3JWDH 2OL4A 3ZJUA 4OB6A 4NPHA 4BVFA 2VMDA 4XYLA 3LM8A 4P5KA 2IC2A 4FR5A 3MUUA 2AK1H 5I17B 2GEKA 3OI7A 4HGWB 1WZ1H 5AB2A 1UCBL 2EDLA 4GXVL 3FH8A 1U30A 3MNWB 4M5TA 1W5AA 1XWIA 1TSRA 3ELAT 4S24A 3FYHA 2X4TA 4PV8A 4BAGA 5DNVA 4KMSA 4NE2A 2B6HA 4DQKA 1C9YA 1YBAA 3T65B 1ZLUK 3UMRA 2H1XA 1NI4B 1BDYA 4D2NA 4OZHB 1QACA 4NQEE 4JGGA 2V8MA 5TK2A 5M7EA 2F7QA 3HHRB 4PJCA 4RZKA 4DW8A 4LJKA 4CR6A 2HVJA 3EULA 2G0TA 1KY6A 4PJAF 3PV0A 1JEQA 1QRTA 3WL5A 2AQ8A 3EIEA 1KQOA 4MV3A 4AF8A 3WDHA 3CVUA 3H1AA 2OMWB 1QLRB 1T2NA 1TF7A 3GUHA 3P9KA 4F1KA 1XCTB 2V6HA 1N6QL 3IUBA 4F7DA 2M32A 3BZDA 4L78A 2UXVA 3ICVA 4UARA 3A14A 1FP1D 4DUPA 4AYTA 1XH2A 1DNPA 5D1QB 1B00A 3FO2B 3K1KC 4Y9EA 4RVUA 1E67A 5B3AA 4ZGBA 2Z35B 5HHME 2AFHE 4G5HA 3WY2A 2QGFA 2C3OA 2NYYD 1NWOA 3E7JA 4GZMA 2J3HA 5GVRA 1IAQA 3REVB 3KXFA 2J55A 2Y1AA 2JCXA 4HXAH 5KDOA 4YDIL 3V32A 4UWQB 4QYAA 4L4TE 4D42A 1BS2A 2G9QA 2MCPL 3KDPB 3P32A 5IMLB 4C2BA 3BTVA 2NTYC 1KULA 3UG6A 1O97D 4NO2A 3AEKB 3F7RA 5I9LA 4NQEB 3KZ1E 2J3EA 4S1PA 2CPCA 4DEUA 5H37A 4LEXL 4XT1C 5L0QB 1GYRA 3ZR4B 3SS7X 2NO4A 2YHIA 2EDCA 2IDKA 2Z2XA 1Z29A 3DSFL 4BH7A 1X8XA 2QRGA 3GRPA 3PFBA 1WISA 4NM8H 5DMIH 4H6WA 3F7VA 3M1OA 4AK1A 3MHZA 2C5SA 4E31A 5EPUA 2XTSA 4N0MA 2R62A 2EYSA 1S7UB 5AI6A 2ISQA 1WW2A 3O9WC 2ZCJA 2XBTA 3SD7A 3SY6A 4OXKA 2ATKB 3CRQA 3FW1A 2DM3A 3OCUA 1KIAA 4MWDA 1ZLUH 4C8XA 4ECEA 3N1GC 2F74A 5I3ZA 2Y9RT 4FFWC 2G1UA 2HF7A 3NPAA 2FX7H 2DJIA 1Q0UA 1QAOA 3WIEA 2AG0A 4JXXA 5IK3A 1QHHB 2QJRA 4Y98A 4JFFB 1GSKA 1U95A 4PRHA 5E6IB 2YINC 3KJ4C 4Z4IA 1Z74A 2VTKA 4ZTZB 3EJ6A 3VUFA 4UAOB 3OMAB 5CGMA 2MHAA 3QPQD 3L77A 3VM6A 2MSEB 2FJHA 1ZGLP 4N5ED 2QVCA 1U5BB 3D0QA 1HU8A 2ZIAA 4B7AA 4JUSA 4OLYH 1LRKA 4KQ3H 5B3JF 3JX9A 3TA3D 3QJGA 3MN1A 4LDEB 5H2BB 3H1GA 1PZNA 3BGAA 4O2AF 3CHPA 3NUKA 1AO7B 2VH5H 1ONNA 4B7CA 1KGYE 1YDFA 3Q5OA 2C4MA 3P9NA 1IXKA 3B1ZA 4KQ1A 2X4UB 3QZOA 4HOXA 3D39D 3MINB 2OZ4L 2WWXA 5EMLA 1S9YB 4DP8X 2GJ4A 2B82A 5HHVL 4UVDA 2J5QA 3C6MA 2HRPL 3VFSA 1EP1B 4C0BA 1YUHA 3PXAA 4HYYA 4CEIA 2JTDA 4KYVA 3KPSD 2UXTA 4YSUA 3QYMA 4W70A 1RIIA 4ZFQA 1T03L 4H60A 4IRMA 4ND8A 4PJDA 4OZGB 1R37A 3ZQKA 3SQWA 1HG1A 3SO3B 3GLKA 1SCJA 1QFXA 5B1HA 2GPWA 3LDBB 2ZX6A 1DSSG 4ATTA 5JDSA 2NY6D 4U1KA 3QE0A 5EIVA 3CLKA 1WU8A 4UTPA 1DTWA 3C5XA 4R3SB 1MCHA 3FPBA 4IIUA 3AXIA 3WLOA 2WV9A 5KYUB 2W9XA 4YIQA 1P4BH 4J1TA 4D45A 1OXYA 2CBMA 1EMTL 1FBTA 3FRHA 1XZFA 1RYHA 3TFOA 5LB4A 4B9PA 3IXTB 3PCXA 1E0KA 3DJ9A 3HW7A 2ERJC 1X1RA 4G7VH 1SVCP 5IR1B 1GKYA 3ICPA 1FJ1B 1FF9A 1GKLA 1L3IA 4YCDA 1BO6A 4BZ2H 3SVTA 3D6VA 2GM4A 1CHNA 1MIHA 3HY4A 3DBLA 4EECA 3EYSL 4OGGA 2HCJB 4KNSA 3HMXA 1BHJA 4JJ6A 4GG6E 5BNWA 2QGEA 4NKMB 4PRAA 4V02A 4UD2A 4LHQB 1ODFA 4DM7A 2MNUA 5K6TA 3KC2A 5JCJA 3VQ2C 3DI3B 3GQFA 3QQNA 1AZTA 4RTMA 3I50H 5T8KC 4PGEB 1F2TB 2RJMA 4HDRA 3FAZA 2CGYA 2DLFH 2WQXA 2IQAB 5LCVA 3IMSA 4JVLA 3VXTB 2E4WA 4G8JA 1RQPA 3BPCA 2MMCA 5EV7A 1RJGA 4P5RA 1RHHA 4EN3B 4PG8A 2XY1A 5L6MB 2DOCA 4B83A 4JT2A 1HINH 1GQQA 5CEXA 1MDTA 4RMGA 4MUYA 4P53A 4EMTA 3I9PA 1X15A 5JORB 1LS6A 4RF4A 5TX7A 2HYDA 3WFBH 3N86A 3RIGA 4C0JA 4E9WA 1HL7A 1AA9A 3B7GA 4HJ0C 1TVBB 1ZEAH 4RAHA 3LQAL 4JH0A 4BLUA 3ZD6A 5FO7A 1P1BA 1U7PA 3COVA 2XZTA 3GC6A 3MTDA 2X0IA 4LK4A 3H75A 3CZLA 4KRFA 4JG5A 4BLSA 5ILTH 5IB5A 1H0KA 1PEZA 3KJ4B 3WHIA 3LDHA 1L5ZA 2H5LA 2Z4RA 4LPWA 1X7GA 3ZCVA 4HU8A 1MVLA 1F51E 5I5GA 5KZCB 4QOJA 3L3IA 2V5UA 1LDPL 4YT4A 1O89A 2XGSA 1IY9A 3SCMA 2HADA 2A0LC 2VJ8A 4FQ2L 4NRYB 4GKSA 4WUVA 1D6VL 1PGRB 2CKBH 1C1DB 1QSZA 3CVHL 5AKLA 4MW7A 2GPNA 3W7AA 1ZW6A 4V24A 3WHXA 4QF1B 1KB5H 3QQ4B 5F78A 2Q41A 1PDKB 2F68X 3U9PL 4F1JA 3ELQA 1SBQA 2PYZA 1MAVA 4KQ6A 3HP7A 5C0EA 4Q3CA 5E6ZA 4P9HC 1UYWL 3WDKA 4LC0A 3TN7A 1EFTA 1E5VA 2ZLBA 5G0SA 1MUJA 3BWMA 2PP9A 3OPVA 4IRSA 1VFBB 1ZHBB 5FOUA 1WHPA 4GOLD 2ON6A 4KRPC 2OXRA 3DETD 2EDQA 5AI0A 1KJIA 3KTDA 5GGUA 4E0RA 2UYOA 3JD4A 4LJ7A 1OX4A 1T6WA 2JS7A 4R5TA 4I2NA 2JKVA 3ZGZA 5T67A 4MQTB 2PH5A 2FRXA 5FI0B 4FQCL 1WDLA 5IF0A 3GI8L 1OFHA 1JU4A 4RTPA 5CILL 3FU6A 4DDTA 1CFQA 1SOWA 4ZCTA 4ZVPA 1XGPA 5LXTF 5DD3L 4CMHB 5CFHA 3UP1A 3EYVA 1V10A 4P2OB 2LD4A 4N5LA 4DK3A 2PBRA 2L19A 1CG9A 3MMXA 3U7QB 2IWFA 1J90A 2G9RA 4Q66C 3KEHA 3U9UB 4MD5B 2BM3A 4OQLA 3P0YH 4QIRA 2IHTA 1D1TA 3TRDA 5DFWH 4R7DB 3CUKA 2DWXA 4DLWA 2VITA 1U8QA 2X41A 4FLHA 2GQ0A 4UQIM 1D6JA 2B2CA 2VYRE 3FUXA 3V0EA 3RIKA 4BL5A 4D9CA 3HG1B 2A14A 2NYRA 5AVXA 4PAQA 4MNGA 2IDUA 5B1JC 3PXXA 3BIKB 3EXIB 2FHCA 5DA4A 3HUFA 4NMMA 3T4XA 3K2EA 3UA3A 4ZODA 4F3CA 5B36A 4L9RA 2NY1D 5IX8A 5KUTA 4WO4B 5SWZD 3ND9A 2I07B 1GFZA 1ZSNA 4Y6QA 3BP5B 5T5FL 4YC2C 3T7DA 2X22A 1NJ9B 5GISL 4I0PB 5KQSA 1CP2A 2FRGP 4DIDA 4M6OL 3ROEA 1IM2A 1T5WB 4L8DA 4GU5A 4NE7A 3EJRA 1KELH 4UUAA 3DMRA 2XH8A 3IUYA 3ZVRA 3HA2A 4F1ZA 2VR4A 3T0ED 1M6NA 3RSFA 3QENA 5I8PA 4MVJM 1ZVMA 3KXLA 1ULHA 1QQ6A 3SEFA 3FTPA 1JI0A 3PQ2A 4LSGA 3GSUB 4BQ8A 1D5IH 3GW8A 1N5AB 3NP7A 1E79A 3UZQA 3CMGA 2BWJA 1G20E 1MA0A 4RMRA 4JHZA 5DCUA 3VPAA 3P9SA 3TSCA 3R0MA 4QNRA 1COWD 1VACB 2I9TB 3HQ4O 3T7KA 3BP7A 5AI5A 4W5JA 2JJVA 4L05A 4O02A 4PJHF 3IQZA 1DRJA 1Y33E 2N01B 1XF5B 3H9QA 4FQXB 4OKSA 2C1PA 3RF6A 4EPWA 2BVUA 2V6BA 4LZPA 3OM1A 3TT1H 4N5DA 4CODB 5LLTA 2DWYA 4NXMB 5BUZA 3QWFA 1EWRA 4PTYA 2OFQA 3WI7A 5J1AA 1BMDA 3KYIB 2EJBA 2BUAA 8GPBA 1AKMA 1NGZB 4NK4A 1OIXA 4O2FB 1T6YA 4ESKA 3EPPA 5A2CA 1P17A 2XDHA 1ZFNA 5C7XH 2M9MA 1TMGE 3FZNA 4RJTA 1N75A 1RZQA 3QC6X 1CETA 2WANA 3P0GB 5IOPB 3FTUA 1SCUA 3TS8A 1QEXA 2ZAOA 5DBGA 3U1VA 2VZ8A 2V9QA 4CDGA 4OQTA 1NCGA 5B38G 1RXUA 3TESA 1Z0ZA 3ZLTA 5IQ7L 5DW3A 4IG9A 4R9UC 5LQDA 5EU5A 3Q3GE 4H8WC 4I1IA 2VJYA 3UTSB 3FQRA 1G20B 2P2ZA 3DV6B 1ZIBA 3BEOA 1N2JA 2ZS8A 3E4CA 4W5TA 4M8LA 4AJ0A 1IQDA 1D6NA 4PREB 1RAAA 2WNHA 1CZRA 1BFOB 1MVUB 1N0IA 3D2CA 4B48A 5HI4D 3IKCA 2PX2A 3HMWH 3IMRA 4O4JA 3U0PA 4XP6L 3PEWA 3HE6B 4A1FA 1LK3L 5DJ0B 2W91A 2C9DA 1QK3A 3VX1A 3V9FA 4F7PA 4ELDA 2GGSA 3MFGB 3EK2A 4I6GA 3NABL 2JKRM 1SOSA 2VE6A 4WD3A 4W9ZA 4O4HB 5JAZA 4Q74A 4NCBA 1E77A 1Z5VA 3KEFA 2V7HA 1G84A 3II3A 4G4SO 2Z2KA 3FTZA 3ZX1A 1VJSA 1E9CA 4A15A 1JWMB 3MMZA 3PQDA 4PZ0A 3UPRB 1ODKA 1YEJH 2ED9A 1IQUA 1W93A 5B2FA 3LWDA 5IBUB 1M42A 1C9NA 2G6BA 2PX4A 3RO7A 1PTKA 4M3NA 2Q2LA 3WIDA 2AMGA 2H2FA 3ZWWA 1A5ZA 3B20A 5JXGA 3A4MA 1QI4A 4FGUA 4MQ7A 2D3JA 1PFYA 3UAGA 2JJUA 3Q3GB 3RABA 1CLEA 2FLVA 4FNGA 2X2FA 3PL6C 3AR4A 3REQB 5E6UA 2UXDB 4G42B 3ZKXC 2UZ1B 5CK4A 3GDFA 2QTRA 4QU8A 1JP7A 5C8YB 4G43B 4DC1A 4GXUN 3H3PL 3NZ8B 3IVGA 5DZLA 4Q1EA 4XE5A 4HZIA 2EFEB 3OOHA 3K6IA 2G9UA 4HIEB 1PG7W 2IYFA 4UFPA 2GIYA 4CQLA 1VJGA 3PTAA 1E9EA 3QUZC 4OCSL 1M6UA 4LAQL 4HFRA 4LCWB 2W70A 3AW5A 1EFDN 3L6FA 5AVKA 4GIBA 4RXTA 1RBZA 4Y5YA 3PFQA 1AYRA 4A04A 3KAPA 2ZRHA 4D9IA 4GUCA 1PKEA 3U4GA 4YV7A 3ZO9A 2WSSD 4OH1A 1BA3A 2L17A 2D0IA 2JVJA 1XCTA 1ML3A 1RRKA 3QKRB 1CJKC 3F8UB 1TB4A 4DVRH 4YDZA 4X3CA 1W6RA 4EHAA 2J7KA 1RK0B 4ELMB 3QEOA 5I7FA 3RG1C 4OUOA 3IETA 2G9HA 4Y16D 5MENB 3BMNB 3HGTA 4G83A 2WBJA 3B7PA 4PJXB 3F74A 4L1BA 3C1UA 3CRNA 4KV5E 2CA3A 2GYUA 3EBPA 5BXQC 1RBMA 3QHFL 1M0TA 4XJSA 5ALYA 3OM3B 1IBSA 2CW5A 4DCPA 4JKKA 1F0LA 1V8ZA 1Y8ZA 2COEA 4G1EB 2WM0A 2WE7A 2H63A 1KTJA 4IV0A 2OBFA 4CSTA 3L49A 4HK3N 4C2TA 5D7JA 1MRFH 1UPAA 2CDFB 4E07A 4C54A 3VNZA 2IOMA 2GTZB 4LQFL 4QDKA 3AMLA 1N36B 5F0MB 1G4UR 2YHIB 4MNQA 1BROA 4Z9BA 4MXWL 2G5UA 4PYHA 4BPBA 2WFLA 2WMYA 3DGEC 4UFOA 1DVFB 4GKVA 1HESA 3IBGA 3RIAK 4HFUL 3KQSA 1ZK9A 3O3AA 1K8XB 1DQQB 3OBAA 2ED6A 3B1WA 3QJUB 1NNEA 3ANLA 2RALA 2BOCB 4ELME 2R0WL 3TCLA 3PXCX 3U7YL 2PIAA 2I85A 2WWWA 2W58A 1LSUA 4B95C 5ACZB 1XALA 3FFTA 1C3VA 3KG5A 1XF2A 2IIVA 1FLNA 1I9IL 4LTMA 3UACA 1AA6A 2VDMH 2AJTA 1MH9A 4KU1A 1QRUA 3ZLBA 2NY5H 1CFZA 4WFHD 5MGNA 2PMZA 1X9GA 2N56A 4OXNA 4H2CA 3BUPA 5FUBA 3AF4A 3KBEA 4DUYB 5CMAB 1Z4KA 1KMGA 2YFHA 3VSDA 3RVMA 3OKEB 4X7DC 1ORHA 4IZ6A 4LT7A 2P24B 1HLGA 1DP4A 2JFBA 4BASA 5L3VA 3F7KA 5JV5A 1CB4A 5C35A 4EDWL 4CRWB 1LBEA 3KOUA 1QLRA 1QOPB 4EAQA 2BYTA 1KI6A 2VDQL 2FB9A 3HI6L 1B0UA 1MBZA 2EAEA 1PL6A 2H8PB 1H8LA 4ALLA 1QDEA 1D0IA 2IPMA 5F2KA 4H8HA 3TGWA 1I1CA 4FOOA 3FU8A 4IHBA 4YHNB 4PAGA 4BNWA 1REQA 3WLFA 2Y5TB 1J1XH 4EF6A 4P4KA 1L7PA 4PM1A 1FPMA 5BZWA 3PWUB 2ZB4A 2GK3A 3CF2A 2VW6A 1WIOA 1I9IH 2F1RA 4PVNA 4OUKX 4HPYL 4KGZA 4XI9A 4MVBD 2AEMA 3A2NA 1VL1A 4KO2S 1G2IA 1IBMB 2YZ2A 6LDHA 3D18B 2PTVA 3VJLA 2R751 3BCDA 1YNTF 4HSAC 3B9EA 1NSFA 1S8DB 2XG5B 5HHTA 2WHVA 3GPEA 5C71A 2C5EA 3UAXA 1V3QE 1R18A 4DANA 3MV7B 4O2CA 3HU2A 4R0LA 5FWNA 4E2OA 3RAJA 5E95B 5DD3H 2IYTA 1ES0A 4ZX6A 3VKUA 2HRLA 3EJTA 4MRMA 2V65A 2HMSA 4UW9A 3QQ3A 3T8XA 4HLZG 4TRRA 3EVNA 2PT9A 1BKSB 3MOQA 3GDOA 1ULVA 3ZCSA 3LEVL 2BLNA 2PMFA 1W9MA 1JBEA 3BORA 1XYYA 4Q6IA 3IU4H 2EACA 1OC4A 2FR4A 3WLAA 4URXR 4KN5A 3LPGA 5L53A 4YDMA 3HNSL 4PG7A 1BDHA 1XN1A 2BEJA 1OH6A 5IR1A 5CEJA 1JEJA 3BKXA 3SY8A 1SJHA 4MUMA 1R1CA 4A03A 3WO0A 3C41J 1TUGA 5DCLA 5E7MA 1YMVA 3N2EA 1NJ6A 1U0LA 1EJ2A 2W59A 3TK1A 3M6AA 3T4PA 4XPHH 4A7VA 1N6NA 3OWXA 5EO1B 4TYMA 1VPDA 3TQTA 2OMKA 1C5BL 4Z7UA 2OFFA 5JSYA 5CN3A 2J88H 4RMSA 2D59A 4IOIB 5I5RA 1JMKC 4MD4B 5FTJA 4XXDB 3S8MA 5AZEL 4RHYA 4H25B 4Q3BA 2GHRA 3WN6A 4URZR 4L8WB 4DV1B 3H42B 3IUJA 4IYJA 3FYUA 4O33A 4R2HA 3QIAA 3O84A 4AMZA 4B7ZA 1LZKA 4QL3A 4LNHA 2Y4OA 3SKMA 1GN8A 5DR5H 4K3DH 4JYCA 2OMYB 2OSYA 1AR1B 4WXHA 5JXEA 1B2WH 3W0WD 4UC0A 1T10A 3PEEA 5E5LA 1EGHA 1UD8A 4Y4HB 5KPDA 1IZYA 1I3KA 1DBAH 3K5IA 5DJXA 1UQTA 5CJQL 4WI2A 1EVQA 3N53A 4ED9A 2EHDA 3CXUA 5EYPB 4BQ9A 5C53B 3DAPA 3WOHA 1S96A 2OKCA 2O07A 1WAAF 5J9PA 1UK7A 2CNDA 4HWZA 2BDUA 4PYIA 1PZEA 3ASYA 3OWOA 4P2RD 4I4WA 4W9JC 4PJGE 2CXHA 1T1IA 5LQBL 2QQGA 3CZMA 5LQBH 3WYGA 3K70D 4G7SB 4HGWA 1MVNA 2UWEA 1ZS8A 4FC3E 3JV4B 5EJ9A 2HTFA 2P5WE 4NPYB 3F04A 3EVZA 4G09A 5JPMC 4DC0A 1EHLL 4GI9A 4GPIB 4DNOA 4WBNA 1W48A 3K8LA 1Z3RA 3STLB 4UZSA 1MCZA 1ZVJA 4NN5B 1U5AA 4JUBA 4CM5A 5L2KB 4D7BA 1SKUA 4B43A 4PQXA 2XYQA 5CO1A 4FMFA 3ZZTA 4KE6A 4O6VA 3NABH 1WXDA 4J4HA 3Q9LA 4CTMA 4JWTA 2PUGA 4UQLA 4GKZB 1R8QA 1HCVA 4JNKA 2Y1EA 5C1DA 1SG0A 5EU6A 5EULV 3DO5A 2PD6A 3G0GA 3S5LA 1BD2A 4NKMA 4HKZB 1HMYA 2XLLA 2ZI4A 1B9ZA 1P84K 1WXIA 3A21A 3JR7A 2UYCA 4ZK8A 4J07A 2YC1B 2O2XA 4WFGE 4C87A 5EXXA 1WG8A 1OV8A 1JALA 3WGLA 2FK7A 5CR1A 2W7TA 1UXSB 2CY0A 5I8CA 3ET9F 4XP9H 3DOSB 2ATAA 2YEQA 1FFTB 3LN5B 2OV6A 4S04A 1MABA 2ZOWA 3TWCL 4BEBA 4JV5B 4HQKA 1RP7A 1WXFA 3AF0A 1B4JH 3L4ZA 2MJLA 2WBJC 3TMAA 3JWNH 2F8OA 2XQBH 5HJDA 4Q4IA 4XMTA 3OKDA 1NP6A 3H5TA 2Q21A 4EHDA 1DTWB 1M71A 1OP5K 4ZMZA 2JI9A 1BIIA 4PRDA 3IPLA 5D7HA 1UUNA 1FFHA 1P5JA 4KO8A 4EELA 5DRNB 4WY2A 4Z0NA 4UV4L