2VDMB

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist tirofiban
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
461
structure length
456
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 125
structure length 456
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdmB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdmB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdmB03
3AFCA 2P26A 1RRKA 4IGIA 5ES4B 4WK0B 4HQLA 1FE8A 1XDDA 2P28A 3OL2B 2NUPA 2XGGA 1U8CA 1FNSA 2XWBF 1TYEB 3PPWA 2NUTB 4A0QA 1M10A 2B2XA 2M32A 4MMZA 1RTKA 1YVRA 4HQNA 3TW0A 3EH2A 1XDGA 2O7NA 1JV2A 3EGXB 1U8CB 4O3TB 1PD0A 1SQ0A 3EGDB 3TXAA 2VDLB 2VDKB 3ZDXB 4NENB 1SSLA 3QA3E 2UZYB 1IDOA 1JEYA 1MQ8B 3OL2A 3V4VB 3EOAI 4MMYB 4UM9D 1MHPA 1AO3A 1M2OA 2NUTA 3EOBI 4UM8B 1U0NA 1OAKA 1M2VB 3T3PB 1JEYB 3PPYA 4FX5A 3K72B 3ZE1B 3EGXA 4F1JA 5E6UB 3EGDA 3OKYB 4HQOA 3IBSA 4C2AA 2VDMB 1XUOA 3ZDZB 3AL8B 1QC5B 1DGQA 4MMXB 4NENA 2WINI 5KYXB 3NIFB 1IJBA 2I91A 1MQAA 4K3JB 1LFAA 5E6SB 3OKWA 4Z7NB 4FWWA 4NEHB 3HXOA 2QTVA 4MMYA 4HQKA 1M1UA 3HI6A 3BN3A 3K71B 1UEXC 5KYYB 2VDQB 4DMUB 4G1MB 4WK2B 3ZDYB 5HJ2A 1JLMA 1M2VA 4CN9A 3EFOB 3ZE2B 4XW2A 3PPXA 3K72A 4Z7OB 1AUQA 5E6UA 3AL8A 1QC5A 4C29A 2ADFA 4MMXA 5KYXA 1T6BY 3TVYA 3EG9B 4O3UB 2WW8A 1PCXA 1YVPA 1CK4A 4IHKA 4JDUA 4WFQA 1ATZA 3E2MA 3NIGB 5E6SA 5KYWB 3F74A 4HQFA 1V7PC 3V4PB 2NVOA 3K71A 5KYYA 2ICAA 5LN1A 4G1MA 1ZOOA 4PN7A 3EFOA 1DZIA 1MJNA 3F78A 3NVQA 5E6RB 2VDOB 1MF7A 1PD1A 3BQNB 1L5GB 3VI3B 1SHTX 3Q3GE 4Z7QB 3HXQA 3GXBA 1M1XB 1U0OC 2XWJI 1RD4A 2VDPB 1NA5A 3EG9A 4BJ3A 4CNBA 4GZ8A 5KYWA 3RAGA 3M6FA 2IUEA 1MQ9A 1PT6A 4O02B 3N2NA 3K6SB 1JEQA 1BHQ1 3T3MB 1BHO1 3BQMB 4UM9B 1OLZA 4C2BA 1SHUX 2ODQA 4G1EB 3IJEB 4WJKB 2VDRB 2VDNB 2I6SA 5E6RA 2I6QA 1RS0A 1T0PA 1ZOPA 1Q0PA 5KYUA 3FCUB 1L5GA 1IDN1 3EH1A 3ZQKA 1IJKA 1JEQB 2NUPB 4CN8A 2ODPA 2VC2B 3FCSA 3NIDB 3TCXB 3PPVA 1CQPA 1M1XA 1AOXA 4IXDA 4M76B 2X5NA 4MMZB 1QCYA 1ZONA 4F1KA 5KYUB 4O02A 3K6SA 3ZE0B 1JV2B 1YUKA 3AL9A 1N3YA 1N9ZA 3VI4B 5HGJA 5BV8A 4JX0A 5HDBB 5KYNA 3FCSB 4WK4B 1SHYB 4G1EA 3IJEA
chains in the Genus database with same CATH superfamily
5CXUA 3N3EA 4L0MA 2Q50A 5F5NA 4UNVA 2I8CA 3K0BA 4X0NA 2GZHA 4LCWB 4HK3N 1HF3A 3NVAA 5EYPA 4X1YB 2HVJB 2DWDA 4L48A 1IZZA 3G85A 3AUWB 4PONA 5IJDC 4GJTB 2GCOA 3SLGA 1JXDA 1C7ZA 2REBA 2Z3WA 3CEPB 3L7BA 3KS9A 3T9AA 4YAKA 1YN7B 4NZRL 5D1QA 3P97A 4ETQB 1U0NA 2AAAA 1COZA 4JY5L 1DYZA 5PGMA 1LS6A 3QJVB 3VZPA 4ZQGA 1P1RA 2Q0XA 2FTKE 3DRTB 2QJWA 4Q1DA 4PJXE 5TF1L 1HI9A 3R06A 3PUCA 5I9SA 3TIDB 3V6OE 4BNZA 1DFHA 2H1SA 3D18A 4V0ME 3R41A 3ZKWB 3FI9A 5ANMA 1F4PA 3EXLA 4XEUA 1LSUA 4O2BA 4RGQA 3KWWA 5H35B 5L8LB 4JHWH 4FQCH 3C09C 1L5SA 3OD3A 4KKAD 4FIZA 4L4TA 3DA8A 3QW9A 2IUEA 1E6UA 4RY0A 1AXTH 3RSOA 3ZE6A 3FH7A 3DDUA 3WBDA 3K4PA 4H26A 1U3VA 1O9WA 1HFUA 4F97A 1XTUA 2GJZB 3UCEA 3VD1A 5L2KB 4ZMVA 1QX4A 3EXAA 4C7MA 3QUXB 2V6IA 3SF8A 4ZEVA 3N0XA 2CO4A 3OCJA 4WXHA 5AZ2H 4YC7A 1QHEA 4LSWA 3LG2A 3OPMA 1L9TA 2XUWA 3FHTA 3P2EA 5KZCB 2B4AA 3KYAA 2Y0BA 2NADA 2XHEA 4Y1GA 4W93A 4I0PD 3OX3A 3Q2OA 4XCQA 5EJ9A 1KYIA 4AEFA 3U2IA 2ZP9A 2I6GA 4DVBB 1W6LA 2ZE6A 4B48A 5E8DL 5AHXA 4F3TA 2AKRA 2OXGA 4YX2H 4TQAA 3T7KA 1AT1A 5JY1A 1TT6A 4V33A 3EAFA 4ENTA 2G0LA 2O61B 1MVLA 4X7DC 2F8OA 3NB0A 3PI7A 1GUBA 3WJLC 3X1FA 1JGDA 5C0BA 1OPXA 1SGKA 3WDKA 5F7BA 5DD6A 2C3PA 3AEKA 2DF3A 3ABOB 4BZ1A 4KITB 3GJ6A 1LO4L 2HMID 2P8LA 1KO5A 1YL5A 2J9FB 1MCWW 3LQZB 4NC2B 3KDPA 4P3NA 1JWBB 2OGTA 4UV4H 4RSHA 1U95B 4AJLA 3TVMA 2E5EA 1HKUA 1JLLA 1XK6A 2JCBA 4MA4A 3WELA 5C46F 3WEXB 5DW0A 4ZCSA 2KPWA 2Z98A 2IU3A 3JYQA 4AS2A 5SX4H 3DMDA 4EHDA 3GB9A 1KFBB 5MENA 5B7QA 3VPFA 5CMAA 5FA3B 3ZE1E 5E56A 2ZE7A 4YHOL 5DHEA 2A1UB 4ALNA 4LNRB 5IEKB 1TJHH 5FS5A 3NUKA 1UG9A 5J11C 3OLYA 2VC2L 2Q5LA 4G3YH 1IY0A 4ACAA 2FE0A 3L1UA 2GN1A 1CQXA 3ZQ4A 3H2JA 1VKHA 2DDQL 3U7JA 3MV11 1KEVA 2MT9A 1T0HB 2GERA 2X28A 1JFFA 4OLXL 4MMYB 4ESKA 4F3FA 1F4LA 4M9SA 4WHTB 3E48A 3TZQA 4ZCRA 5DO2D 2HA4A 4Z9AA 2EERA 4KTTE 4MO9A 4BB9A 3GT4A 1ACJA 4OI0A 4DQ0A 4HH9A 1WCIB 4O51B 2WAQA 3LY9A 5EG6C 4DR3B 4RMIA 2B1OA 3DTDA 1YBHA 1JNHB 1M75A 4MNGA 1MUJA 2V3VA 4S1TA 3ZWYA 2A8YA 2F5BH 2W6IA 4MKXA 4P08A 3QUGA 5LU8A 1AR1D 4NRXA 1E6CA 1PZ2A 4X8JA 1CGVA 4OHCA 4MXVE 1KS9A 3FB7A 1UZ6F 2P47B 5G2NA 1O9VA 2H65A 3GSUB 2X4SA 1TNMA 3QHTC 4MNTA 1H1LA 4KREA 4IIGA 4YAOA 2AAVA 1CEEA 4XX0A 2BPBA 4PJCB 1N75A 2BGRA 2ADOA 3MXWL 3O45B 4KO4S 4WNCA 4WZBB 3GSNA 2RHHA 3M5DA 4AB1A 4B3EA 3FRUB 5KJ6A 5LGKA 3K4DA 1KYOJ 4JL1A 4TXJA 3D6NB 5BV7H 2O0LA 3MLWL 4MV4A 3E7XA 4X7TB 2Z09A 1X80B 3RSLA 3ESQA 5JJCA 5DE3A 3IN0A 3HRZA 1EUZA 2EKPA 1HYSC 4MQLA 1M42A 1ZD8A 3QRWA 3TEFA 5FA5A 5EAIA 2FFBA 3RAFC 4JT9A 1ORRA 4HUVA 3C24A 4XP4H 3OWHA 2OESA 1C4WA 2HXSA 5F8RC 2VXBA 4RAVA 4UVHA 3ND9A 3L0IB 2CZCA 5FR2A 2VJAA 1ZE3C 1KZ6A 2VAWA 2Z1DA 5DK2A 5BP7A 3F7VA 5GAJA 4O2CB 4KQIA 1W5BA 2X0VA 4BMDA 1P0FA 3IBGA 2IXQB 3K46A 3PT9A 1JVNA 3EXIA 3MUJA 2FD6H 1F1BA 3NHSA 4L07A 3KVYA 1JN6A 4HFUH 3KR9A 3RIGA 4CKWA 3ZJYA 2R56H 4YLCA 3IETA 1JZ2A 5LQRA 4UOEA 3S35H 5F7JA 3ZE0E 3KGRA 2QQFA 5CVCA 3ZWOA 4IOFD 2KI5A 3CVBA 1P8JA 1M73E 3GEWB 5EJ8A 1SXJD 5IF9A 1S3IA 3AEUB 1W4ZA 4M1ZA 5DWVA 4JNXA 1R4NB 4M8IA 2FUCA 1SQGA 4HAOA 2XQFA 3MLZH 4EN3D 2VF7A 4U2GA 5A2BA 2PH1A 3QKRA 5DI3B 4GMFA 1QNLA 4R26L 3KWLA 4YHML 4N12A 1PAUA 3V1MA 2VAAA 3DQQA 4PSRA 4LRXA 4ND1A 1U7PA 4GW1B 4QG7A 3PRJA 1KTDB 1RLIA 1Q38A 1HEZA 2F62A 4U2ZA 1ZISA 1RR6A 4RSMA 1QLEH 4OUUB 2CNKA 4PBXA 1IN6A 4FCHA 1F58H 4I9UA 2EBUA 5L0QC 2OM5A 1DWQA 1XZKA 3KV1A 3RSQA 3RU2A 3CX5K 3VSQA 4N5HX 4CGZA 4ZXBB 3KHUA 2VDKL 2A2ZA 3H1AA 2VQ6A 1MHCA 1RMTA 3RAJA 4NI6A 3AQIA 4GBXA 1A7NL 1RQRA 1J8MF 4Z1MD 1LEKB 3G5MA 1EVUA 2JI1A 4GI9A 3SE3A 3LM8A 3TYFA 4B40A 2CKBH 1LBEA 3NEAA 2CV1A 4QOEA 2ZOKB 3FUUA 1DQDL 1SFRA 3ADOA 1T0JB 1RWMA 1RXUA 4ABQA 5HZMA 4Z7OF 2RIKA 3OXSA 3BERA 4H1WA 2CDEA 2Q8PA 2YPLE 2K4MA 3N8DA 3PFCA 5J1SB 3C5SB 4TMTA 3W2TA 1JRHI 4QXVA 4NDAA 1CQZA 1TF5A 1O03A 3ITKA 4QHUB 2QAGC 2ENPA 3L8MA 1Q3TA 5ITVA 5H82A 4OYHA 3VU8A 4OXNA 3R5JA 3QEBZ 1I2DA 4XN1A 3I8XA 3T5CA 2AJUL 2WHXA 3CFJB 3WKML 4GXQA 3DFKA 3ZU2A 4E9QA 2Q1XA 2XA9A 1AMYA 2IDQA 2WNIA 3N2YA 4CHTA 2FFHA 3RA7L 2NZXA 1ZGBA 3KOOA 1NVAA 3CE6A 4MUYA 4UHEA 4JKYA 2W0SA 5DCLA 3SR3A 2OECA 1G3MA 2O3QA 2WTAA 3D39E 3EBPA 2A73A 2HMSA 4JQYA 3N06B 5JH7A 4B4KA 4LCIL 3WJJA 5FIUA 4PJFF 2OSLA 2BIOA 1GNVA 1O4VA 5EIFA 5UKDA 4S0ZA 4TQ8A 3ZPDA 4WKOA 3HCDA 3CB4A 1RFLA 3ZBTA 4JI3B 4LRNH 1KH3A 2GUWA 2VCEA 3QQDB 5F9OL 5GZNC 1GRNA 4JRXD 4RZHA 1K0FA 3OD5A 1ES0A 4AM0A 4U2DA 3BGSA 1D2CA 3E8SA 3LV3A 3FT2A 5CIQA 4PUBL 1ZIPA 2ZANA 3IYLW 3ESBA 4XLTA 4XODA 2Q1WA 3AWEA 1NDMA 5KNCA 4GZ6A 2A86A 4LCUB 4M4SA 3FXAA 5TS3A 4GSUA 1S7SA 1SC9A 5CH8A 1RJLA 2R0LL 3E23A 4X42A 2B8TA 4IGBD 3IT0A 1XTMA 3GEHA 1HTBA 1WU7A 4MINA 2Q1SA 4MDEA 4BYHA 2JDIA 4IJVA 2XVGA 2A5GA 3GJFK 2OV6A 3QELA 3ERXA 5IKCB 2IXBA 2DQGL 3O31A 4PWIA 2HZBA 3M9LA 3RTEA 3AERA 3VXTB 4TRMA 2V2TA 3GRWL 4L73A 5KYUB 1EK3A 4L8CB 2VDLH 4HIPA 1I1RA 3APCA 3FVWA 3IAEA 2GBVA 4GLLA 4HY3A 3M3DA 5JNSA 5EFIB 1G5QA 4TUOA 4MVYA 1CQIA 4MFHA 1RYHA 4TUKH 3F9RA 4AKOA 1XSKA 1T8TA 2R0KH 1XMIA 2G4GA 2ZJ2A 4HMDA 3QUSA 3S2UA 1IN7A 3UCQA 1UA6L 3RADC 1DZ3A 5KSUB 2NUTA 9PCYA 4IRZH 1XZLA 4JZJA 4BNFA 2HLDD 2HLPA 4AQ1A 3TV3L 1VLHA 2YV3A 2EYTB 2D2VA 3DOFA 4MDJA 1B8UA 2FPGB 4ON9A 4DABA 1X1TA 4KMMA 3MWDA 4R68A 2E7MA 5ALLA 1CR1A 1FNSH 5IT2L 4MUXA 3RUFA 5JXGA 5C97A 2QKIB 1KY6A 1UD6A 4ZZKA 2I8AA 2ZSBA 5H9WA 4P23B 2PLNA 4MA1C 5IY5B 4TMVA 2ODBA 3DXFA 1D9KA 4ZBJA 3IJSA 5HGAB 4DWVA 3FPEA 1A3QA 5FWQA 2G08A 4C78A 4RA6B 2WWNA 1SZJG 2GILA 1P2CA 1CL7I 4LASL 2XUPA 2XGSA 3QKWA 2BD0A 3GUYA 3BMXA 2AQPA 1YJDC 1HC1A 2YD2A 3GDFA 4QPCA 1TTGA 2H1FA 5C71A 3ULVD 4HKZB 3VH8G 5A2JH 2PM8A 3PWJA 1QZTA 1UWGL 2L7JA 2X8WA 4MA7H 3KLKA 2VQ1B 5D5HA 3I6GB 5DHYB 1O6BA 3IKCB 2KDGA 3CK0L 4OTZA 2CA3A 5C9JA 4OMFG 5JJ5A 2NY6D 3O3EA 4MCJA 3E18A 3EDYA 1RVFH 1EGAA 4KPEC 4M1QA 5B38G 2H7XA 1ZRNA 2VCOA 2BM8A 5HGBB 4JDZA 3TN0A 3NDYE 1DQLH 3QG7L 3KM0A 3SEZA 1JJUA 4KROC 3BWEA 3PQYE 4EUPB 2O8DB 3GNQA 1L4KA 4UBDC 1OO2A 4TRNA 2W0PA 4W4OA 5ARDA 4B9ZA 2BCEA 3AB0B 5TDPA 1ZXXA 3H6KA 1AO7D 2XKSA 4GC5A 4QXRA 1IAIH 4Y4KA 5BYJA 3D6HA 1GIAA 1QTIA 2CE7A 2O23A 4K8RB 2IV7A 4NH4A 2PKYX 1N2RB 4XUDA 4QUBA 2NQCA 2EF0A 2DUWA 5DLLA 3KH3A 1RURL 4HJXA 1FMCA 3JYNA 1CY7A 3AL2A 1NKGA 2ATKA 1LK2A 2BRUC 1VBMA 1OQXA 1MR3F 4EF5A 1W4CA 1K5NA 5C34B 1ACYL 2IQ9L 4KXVA 1DDTA 2ZBGA 5C0DB 3O91A 2XVYA 4DN3L 3MRBA 2WW8A 3HP7A 2ZBPA 1JHYA 1P45A 5EQTA 3AWIA 4G9BA 4JS0A 1R5JA 1JGVH 3BJ91 2A9MH 2E8YA 5IOPB 1FJ2A 4M38A 3Q8EA 3ULVF 2OOSA 4U6VL 2FEWB 1P5VB 3IIMA 1PG2A 4H7PA 1C50A 3RHFA 3COYA 1I8LC 1RQXA 1A1OB 1W2KT 4PCSA 3MRFB 3WTYA 3BLKA 2VRKA 1U4OA 1KQPA 3ESVF 3GXMA 4G1EB 3W8RA 4XBEL 1SHSA 4ND2A 3LH5A 2CGYA 3SR4A 5DNUA 3OTWA 3L7YA 4R8KA 5FEUA 1QPBA 4IXDA 3ITDA 3AM4A 1UXWA 2Z64C 2XXAB 4YV0A 4RIGA 4YX9A 4G9FA 1FMLA 2FWJA 2W65B 2FWSA 4RVNA 4EEZA 4JP5A 2AJVL 5ICYA 1HR0B 1NFIA 4AJKA 3SDDC 5IZCA 2GVDC 3KG2A 3G2KA 4M3KB 4IV5A 3QYCA 1JG1A 5IVHA 4G8EB 3BGFC 1DQZA 4GPZA 1U21A 1MF2H 3DBRB 1QM5A 3KVDD 1P4SA 4OYYA 4R0LC 4YOKA 5JXWA 4FYJA 1M56B 1ES9A 4TLAA 3SEFA 3L8CA 4O1MA 2BI4A 1CMOA 3VZSA 5TE6H 1X5KA 2V3WA 3GRRA 4ZUTA 1C08B 4LEOB 3HAEH 1EM8B 4XOBA 2AQIA 4AQ7A 5FO8A 4LHYA 2F9MA 3P40A 5KMGB 4PS3A 4W4TA 1LNUB 1U8MA 2Q7XA 3KYMB 2JCWA 1WSST 1SFDA 4X4ZA 1N5LA 5IFJA 1IC1A 3B83A 2R4RL 2RCSH 2J7PA 4YO0A 4ER7A 3LX9A 2J4CA 4HJTA 4CIWA 4LECA 2XUZA 4KUHA 4W4NA 2YD3A 4ENPA 4FLHA 1IC4L 2IQAB 3EXG1 3P0HA 4NMWA 4PTLA 4DBVO 1Z4KA 4B96A 3OAAD 4OCRH 4F4CA 1OWPA 4XZ4A 1NMCB 3S1SA 1IJKA 3JTTB 1M34A 2QVKA 2BC9A 4N5LA 1AD9B 3IAUA 1HPLA 4EATA 1R0WA 1HM5A 1ZN9A 1P7QA 4PJBA 4XP9L 3CU5A 2FWLB 2WN2A 4V1DA 3S5LB 4NQXA 3E5RA 2VDQH 1BN6A 2YY7A 2P4QA 4WI9A 5HTOA 4PLTA 1IT9H 4PV8A 3FNFA 4NJOA 1RJWA 5DZLA 4TV3A 3UYPA 1Z28A 4HZAA 3H0KA 1J5OL 1S7XB 2BP8A 2EACA 2HT3D 3RRBA 3OL2A 3W4IA 3H0TA 3I6KA 4U2CA 4L9LB 1XLUA 4K28A 2B21A 1QWNA 4S24A 1CDHA 3BX7C 4Q3CA 5E9JA 1U3DA 3NMEA 2GFHA 3OE4A 1B0GA 1UM6L 1SDDA 4RSGA 4R40A 3O3CA 3RDTB 4L4VD 4DQOH 3GRZA 2XV1A 1UWVA 3BKJL 3W0LB 3MRQB 3EYSH 3DI2B 1QTNA 3LVBA 3VHLB 3AC0A 3EJYC 3KJ4B 1W0JD 1DTWB 5B1IA 3U5ZB 4L22A 3V4FA 3EW7A 2Z6QA 2CCVA 2PBZA 5I0WA 1EZUA 3L6OO 4ZYZA 2O19A 3FRPA 3MBWB 2ICWB 1DWUA 1KERA 4Y4HA 4P4KB 4Q9CA 1EAPA 4S1QL 3LPLA 1TQBB 4DR5B 1V8PA 3D3QA 3VXRE 4J1QA 1KAGA 1MXFA 4YP7A 3GMQB 3BXZA 3EYQD 4H6XA 4BH7A 4LXIA 1T4WA 3RJDA 4L76A 1PUXA 3N87A 3E6HB 5EBMA 4WGGA 5K0NA 2FB4H 1N4XH 5LBVA 3DJFA 4WOJA 4ZUWA 4JFEE 3HG7A 2L42A 4R7GA 3Q3EA 2R87A 2X53A 4C4TA 1S6YA 2VL4A 3OCUA 5KBLA 5AW7B 2V7UA 2GO7A 2DZEA 3RVOA 1TZAA 3OJVC 3IOBA 1PHPA 3GPIA 3TEUA 3E80A 3N6XA 2YWYA 4NHUA 1KYOK 1VB3A 4UBLA 2XUKA 3RUCA 4JPIA 3LS4L 2EDQA 1I2CA 3B9BA 1X5MA 3L41A 3B5IA 1G7MA 2IEZA 1RZJC 4CKCB 4IOSD 3IMFA 5FUVA 2H59A 3L3OA 2JLPA 2A58A 2KLTA 1TCBA 4G71B 2YA2A 1J5DA 1CE6B 3B9PA 5D3MA 5DSXA 2JWYA 1A14L 3R8BB 2IYLD 3T1FA 4M5YH 5JHDB 3UY4A 1WAMA 5AO9A 1ICEA 4QD3A 4ZAXA 1QP4A 1E7WA 3B3JA 3DNKA 1BQ3A 5ALBH 4NCJA 5B7FA 2HJ9A 2WQZA 1KJ3L 1GQOA 4IOKA 2QM0A 2F4NA 2JA2A 1F0KA 2E27H 4TMKA 4DNPA 3PWSA 4PJDF 3WHE0 3ENEA 1QVRA 3PF8A 3ZHFA 1LK7A 4JQZA 3WHLA 4MB0A 3I3DA 3UAXA 3QCUH 3TS1A 1HNNA 5A5DA 2YHGA 2LE0A 1TC1A 4D0GA 5IWAB 2R7KA 4EQ6A 2P9RA 1YIDA 3ZR5A 1ZD9A 3N1GC 3O6KL 1NUQA 3OFVA 4N85A 3QUKB 2VC2B 3HYRA 3PD0A 1LEGA 3APFA 3ZCVA 5TMBA 1CG9A 4L4SA 2D7NA 3OAUH 3NEJA 4LF3A 4TKVA 2FZ3B 1O9ZA 1RIIA 2Z7WA 3DHWC 5U4QA 4Q3OA 1FNCA 3OMXA 2Y7LA 5ITFA 1O97C 2QI9F 5DI8B 5D7LA 2WNGA 1MNNA 3FB8A 2JJTC 1QLJA 1HHHB 4BFUA 4DLAA 4PYRA 4B9YA 1XPRA 1KIQA 4NN5C 1IJEA 3E3QE 2J8UF 2ZB7A 4Y98A 4WJLA 1G6RL 1TJMA 3UJ8A 4I87A 5HM8A 3I37X 2OL4A 2XHZA 1QQBA 2J3SA 1XGKA 2PAAA 1OXSC 3OIVA 2V3EA 3JYBA 3SIKA 3FRIA 3GSOB 2I4NA 2QA5A 1WXXA 4FFVA 4OUKX 1XCQA 1JLMA 3FUKA 4J39A 4UU1A 3GYRA 3GN1A 2PK3A 2V8LA 4OAWA 4F9LC 3PHSA 1Z75A 1JGIA 3KT8A 4KQ3L 3W82A 1KOGA 4NZUL 1GO2A 4OZHA 3I2CH 2PGIA 4XARA 3QDMD 3OY7A 3MRJA 3E3AA 4YI3A 2YVUA 2DWPA 1T0MA 1MCHA 4HAKA 4RORA 1PG7L 1H0KA 4K7PY 1Z7WA 1ZR4A 3KGTA 4ERNA 1Z6PA 3KZKA 3MSPA 3OZ9H 3CC5A 3LKRA 4ZX3A 2PUAA 4AYSA 2XZPA 4MICA 3GZNA 1UZ8A 1KY7A 2YAMA 4ZQKA 1H5BB 1CO1A 1ZUNB 2DWUA 4GFXA 4FNLL 4LY3A 4MI1A 3V2AR 3DSNA 2YOAA 2DT5A 4WOBA 1OREA 1P5HA 1IBFA 4BBJA 4RHFA 1F2UA 5EP3A 1Y18A 2V2XA 5A7GA 3C5VA 4ANKA 5D2NA 1C5BL 4I2NA 1G59A 4YRGA 2VWPA 3O2DH 4J4PC 4DB4A 2FATL 2NWQA 2AJZB 3OMLA 4X5OA 1YEDA 4TVPE 1IJ9A 1H22A 1JPTL 5D7KD 5KZCD 4JANA 1PZ5B 3EO1A 4K3HA 1AV7A 4DEUA 3GEBA 5B2FA 1WSBA 2GB4A 3W79A 3QBDA 2WXJA 1ZTXL 1ESZA 2XZOA 3ANYB 3JWOL 1WEKA 1ADQA 2PGXA 5HYJB 1BTOA 3RTDA 3T0EC 4QHLB 2ZUBA 4ZS6D 1N0LA 5K1JA 4KN9S 2PO5A 2YUXA 2PO6A 4IFEA 5DX8A 2IVFC 2FLWA 3GUUA 5HJ2A 1QFXA 5ULLA 1A6ZB 4JFQA 3S96A 1L8AA 4DR7B 3UZEC 3P1VA 1SK8A 3O3UN 2SODB 2HFFA 5DHVB 5AXAA 1IGFH 5I7SA 4V3BA 1CDYA 2ZPAA 3CFDB 5E9DA 1RC0A 4HLJA 3UFBA 2PS9A 5DF0A 2JJSA 1CDEA 1GY8A 1JNYA 4Y2RA 4ND6A 3ZW9A 5JIBA 3QJXA 3FMIA 2YAOA 4G11A 1NC2B 1KVSA 4UXJA 2MQCA 1WUZA 3ZDXE 1PEAA 2XSZD 3A7DA 2RFXA 1OGYA 4F3RA 3BAFA 1BMFA 2YINC 3SZ6A 1O96B 4URXR 4FHJA 3QNMA 5FF9A 2QVYX 3IPYA 4G5RA 4TGLA 2YWHA 4MR8A 5I76B 4PWZA 4UDYX 2J5WA 2OMUB 1FSPA 3ISRA 1G7TA 1MIEH 4P3DB 3FPHA 4LWZA 5ETUA 4DZ8B 3GPBA 4ZTOL 2VXSH 3Q6FB 43CAA 4AT1A 3DUUB 4XVSL 2WZDA 5CD3A 1S9YB 2NT0A 2WLJA 2VDKB 5AVUA 4FP8H 1S5IL 2UWEB 3U26A 1A3RL 2Y7QB 4ZAKD 5I17A 5CS7A 2IYVA 2N1KA 3DWGA 3H4IA 4J07A 1DCTA 1Z4MA 4AAYA 2VISA 4M5ZL 2RALA 4YJ2F 3ULVL 3RIFF 4TUUA 4PZPA 1N78A 3BMCB 1WHSB 3TA4D 2PSDA 4KIFA 4P7GA 2WZCA 5LGJB 1VE7A 2IAMC 1NC3A 2EVIA 2IXDA 1A8IA 2CJPA 3Q2CA 4C4YA 4HC1H 3CLEH 4JFPB 1TAQA 2QXTA 1EIBA 1LK3H 5T33L 2RG1A 1VPWA 1VACA 1HG1A 4DP0X 3FOAA 4KTEH 2RHWA 4RHCA 1ZSDB 2OL3A 2ZWOA 3W3ZB 5IMBA 4RZ2A 1GGBH 2IFGA 2PRSA 1G7PB 3DX8B 1LJ8A 3BEVB 2QMKA 2PCFB 4UZSA 2PYEA 1N0IA 3CJQA 4L15A 2DTMH 2VRAA 4MARA 5GQBA 5F3FA 2O1XA 4FQXC 3TI9A 5D70L 3WFHA 4L4UA 5HF5A 3Q41A 2PKQP 1F38A 5K39B 3EGSA 3PWPE 3AT1A 3MRHB 4BFOA 2D06A 1LW6E 2HKAA 1D0VA 4W9ZA 3MLTB 3EDFA 5FBWB 3I0MA 3P9YA 1JFQL 1WETA 4R84A 5CN2A 1CE8B 5H8DA 3OIFA 3RNKA 4QPNA 4BATA 1FRGH 3ETCA 4QRPE 1R1DA 3SC2A 4X24A 4G8DA 5HM6A 4X0KB 1L5VA 1NX6A 2HRCA 2HJLB 3IM1A 5A7BA 1MH5A 4XPBL 4UBKA 3N1MC 2BW4A 3QHQA 2XZQL 1VGKB 1H42A 3EXFA 4P2GA 2QVMA 4HZUB 1AKTA 2I69A 4LAFA 2A9JA 1VLJA 5FX3A 1JSCA 3TO5A 1EUQA 2V33A 4J16C 1S46A 4P9HH 1ZLUK 1AD0B 2EIZA 5IB2A 3TQCA 2IX3A 1UOWA 2GPJA 4NBSA 3S3SA 3D31A 1PT8A 4RD6A 1E90A 1QJCA 2NSMA 3N75A 3ZJ4A 5IB3A 5DA0B 1EXMA 4XCFH 3UUGA 1EWRA 4PN7A 5EF0A 4ODTL 3LO8A 2O8CA 3MTBA 1QFJA 2NW6A 3S2GA 4Z0BH 2NY3D 2GCGA 1P5RA 3LQMA 3DH0A 3BUYB 4N5ED 3M6FA 1FFCA 2IALA 1G9NH 3PL6C 3LMJL 2DQFB 2TMYA 3N07A 4KOAA 3AG6A 1QFUH 4YH1A 4R5MA 5KWIA 4HMQA 2DOCA 4MS1A 1CK0H 5CKGA 1HYGA 4TOYL 4B76A 1IPFA 2XT1B 3C8KB 3O9WA 2OD9A 3CNHA 2VAPA 1INDL 3ZHZA 1MDBA 4WFIA 2QSZA 1YJ5A 4PPYA 3ZE2E 1X5XA 2UX6A 3O2QB 4EPVA 4ZFGL 3Q7JA 2PZ8A 2V3DA 4FT2A 1A8PA 1DS6A 1XVIA 5B5SA 4LOEA 2FN3A 2BOVA 4LLWB 2HPOA 4GMSL 5JCOC 3NCJH 4LIPD 2YO3A 5GGTH 4MA5A 2BGWA 1IRXA 1BZ9A 4LSZA 3E1KA 4ANXA 4BRUA 3EDRA 1GN9A 4TQPA 3LEXA 4JKPH 2YNMA 5DS2A 3RHWF 4Z6AT 5H16A 3WI7A 5EWIH 4QO8A 4CCYB 3GB7B 4OJFL 4CM1A 4CLEA 1A82A 4KHTH 3ZWPA 3HR6A 2QL6A 3R18A 1GRVA 2P5PA 3CZAA 4M1YA 3P9MA 4H20H 2XCUA 4XO9A 5DHSA 2MFNA 2WXFA 1X5LA 1TW3A 3O3DB 4UI2A 2Z56A 1N67A 2AK1H 4L9WA 1TQCC 5LZ9A 2L7EA 5C2UB 2XMQA 5DRNB 5T1DL 2GN8A 4WV1B 3WFEL 5BQ3A 4JC5A 4LGSB 3O6MH 4J1TC 2YDXA 1ZHHA 1DFXA 3BZ4B 5DRTA 2ZB8A 4LPSA 4Y0AA 2CVQA 1PK8A 5HPYB 1WPGA 4X80H 1EXGA 3VI3A 3FOBA 1OUMA 2X4UA 2KBFA 4JH0A 2QMZA 5E3IA 4MMZB 5FGCB 1TSHA 1QF7A 2CIKB 2B4RO 3GA7A 4P5TB 4JFVA 4FYTA 1I32A 1JJFA 2BJVA 2WPDA 4KK8D 4B7LA 3K4ZA 5HZGA 4OSUH 5EQDA 3V4VL 2R2AA 4EMUA 3H9SE 4X6LA 3UGJA 5CLWA 2ZOLB 4DIXA 4J8RB 1X0XA 3WBFA 3GMNB 2FRGP 1PS8A 1G0YR 2AE2A 3GRVA 4UCQA 1BYUA 2NO6A 1T1XA 4I99A 3QI9A 3PQCA 4QXOA 3EAKA 1U3HC 5I8KL 3MXVH 1AO0A 1S2NA 4J8QA 2FSEB 3HJEA 5BS0B 4Z2AA 3SK0A 4GAYB 5ED0A 4R2KA 1J1OL 4Y2DA 4ONGH 2FZ4A 2QVZX 2Q7AA 2APJA 1V4NA 5IIEA 4P98A 2FL5A 1GSOA 1B0RA 3WV4A 4JPSA 4ZQFA 1PJAA 3U7AA 4PW3A 1E20A 1ZV9A 2H32H 1ODFA 4I1OA 5EF2A 3LIUA 1IOVA 1KTLB 3GT6A 2QV2A 5L9DH 3X3HA 3R76A 4BXSV 5DOVA 2B2CA 4QGAA 3TBYB 4EOWL 3Q2WA 5A4IS 3M07A 2RGSA 3N2ZB 3EB9A 1YA6A 4IW3B 2J3JA 2PRJA 1YEGL 3KHTA 2B59A 5EU4A 4Z7WE 3KLHC 5BUZA 5B1KA 4BVGA 1J9CT 4NPCA 2G04A 2WG2A 3PQ5A 4IRJA 4XDYA 4YA6A 3AVUA 2MPAL 4NC1C 4WK0B 3TAXA 1TJ4A 1C1XB 5DT2A 3OOYA 1U8ZA 4OM7A 2SCUB 2XUHA 1AZBA 5HYEA 1UYWL 2X4TB 2K8QA 3SE8L 4RU1A 1F42A 3GBSA 2WXPA 3D52A 1C3VA 3HN8A 5I74B 3LYRA 2W00A 4Q6KA 1H19A 2F1IA 1P1ZB 2ENJA 2YMXL 4WU5A 3CO0S 5C0CA 3EEFA 4EMTA 4ZX6A 4LXQA 3ESCA 4BWUA 3UCFA 3AFIA 5HP4A 3SDYH 3PV0A 1WD7A 4GS7C 1VE1A 3HXOA 2XMPA 4HMCA 5A2QA 2FPXA 2OORA 1ECBA 3BS4A 1HUQA 3T0GA 4OKVA 4PFEA 2DPGA 2G2PA 3HCBA 1NCBL 4NP4L 4FFZA 3NA9H 2KS6A 1WULS 3HXTA 4ZYVA 1UJ3C 4YHHB 2PBFA 3ESMA 2PSSA 5LDHA 5FYLH 4IOIB 3N8NA 4I18B 5EJ6A 3NU1A 4Y4FA 2WJPA 1GKYA 5H8WA 2EBWA 2IEAA 4P23D 1DLIA 2ERXA 3LQKA 2GSGA 1PNVA 2I34A 3PNQA 4XFJA 4V1CA 3KOUA 4XH2A 2JFNA 1QKZH 3ZCTA 2UXTA 5DX0A 5I24A 4BLVA 5BR8B 4DR2B 4Q1VA 4IUBS 4OCMC 4EQ3A 3DX6A 2HJHA 4DCGA 1CDZA 4WUUB 1QG6A 1XRNA 2WBLC 2JTYA 1US8A 3WNCA 2RJOA 4QBFA 1KF0A 1RCFA 5EOCJ 3ISJA 4N3CA 1NXSA 1R6VA 3PGFL 4KHPB 2G4VA 2Y3IA 1P60A 5IT0A 4EJ2A 4ZAGA 1V26A 1AR1B 2XRAL 3CBRA 5EJEA 1DVFC 2NNLD 3VNQA 4MAZA 2V5RA 3OMAB 2NUAA 5KNDA 1OANA 4GXUM 2BRRL 2IADA 2XXGA 3QQ9C 5SY4A 4LY9A 3O90A 4S1DC 4KH2A 3G0DA 2FGZA 3VFSA 2BP7B 1A1VA 1T4KA 1YYCA 5C0JB 4Q16A 2OFFA 4LZKA 4CG0A 4X5WA 4DNLA 1EBBA 1Q20A 2WILA 5BT9A 1GAJA 3BT2L 1E30A 2H06A 3VWJA 3POHA 1BVHA 4NXNB 5K3FB 4JAVC 4DPRA 2PX3A 1NXWA 1K6JA 3F3HA 4JO5A 1SVCP 2ONZA 2WI8A 4CSSA 3KYCA 2J73A 3MLAA 3C3DA 1T7WA 4NOMA 5IAGA 4LPUA 1KTIA 4LSUL 3L1IA 3FT4A 4X44A 3TZKA 5EJ2A 3UPUA 3AKCA 1D5ZB 4GD3Q 1FBNA 4CM3A 3HE6A 3DVLA 4PI2A 1VL5A 1Z33A 2GAJA 4R97C 3SC3A 1JYWA 1H3PH 3U4EA 3WWYA 3H2QA 4C08A 4OHYA 3QJFB 2X12A 2VLRA 4B74A 4MCYB 1E1QD 1SLVA 1J0IA 5C35A 3RT9A 4HT1L 2ZYVX 2A14A 1N6QL 3P2OA 1HDZA 1SXJB 2ZIDA 2PGLA 3WFJA 3TEXA 4BZQA 4LHUG 3AGVA 4N5MA 4XOEA 5IANA 2GJ8A 3UHOA 1BYIA 1E9BA 3WWPA 2F54A 5JPNA 1DO2A 2X58A 4JB9L 2ZOOA 4JBXA 1N5YL 1W91A 1NM4A 1TU2B 3ZIAD 3HA2A 1MO4A 3U44A 4A7QA 4FNPA 2YZMA 2C00A 1CDUA 1MV5A 2TSBA 1O8CA 2BH9A 3K2QA 3KXFD 4G8IB 4O3UB 1SY6H 1KDVA 1A7PH 1SKUA 5KJRL 1Q0LA 2NR6D 1E64A 4PB9H 2FNBA 3HKBA 4HIXL 2QPUA 2SICE 1W0WB 3FLAA 3WK7A 5FYLE 2DFTA 2XLCA 3R4RA 4PJFB 3VQLA 1NBIA 4OJAA 3ZWAA 3NFNA 4MSUA 2Y7MA 3CXDL 2XDQA 4HEJA 1UIRA 5HRCA 1NVVR 3AR6A 1IGIL 4P59L 1SD2A 1J8HB 5I1GL 1KXQE 5FOBA 2XWZA 4EUNA 3LGAA 4TKZA 1M8PA 5H3LA 4QLWA 3FM9A 3LX5A 2W2TA 2QT9A 5KNLA 5FYDA 3CDGB 3VGPA 1OPOA 4EGCB 3NBNA 2IOYA 5FRDA 3DVAB 3HCVA 4PS4H 3NRBA 2G7ZA 1AS3A 4PPNA 1WWCA 1RUQH 2PSHA 4OQPA 4KJWC 1G6RB 2JVKA 4FE3A 4OK3A 1AJ7L 2VUKA 3LUJA 3REQB 2R29A 4XBGA 3QZUA 3SSGA 3H5RA 3ZZUA 3TBCA 3ZTDC 1QRSA 1XV5A 3WMGA 1R3LB 2AC7A 2XODA 3QPVA 4RGVA 4H1LA 4IBQA 4ZUVA 1L2TA 4TMPA 3NPSB 4IR7A 4JL6A 3G5YA 2V6HA 4CADA 4P46C 3UO8B 2Q20A 3SDAD 3VR3D 4XN2A 1HS6A 3TQIA 3BZFA 3OC6A 1I7UB 4NNOA 3HC0A 1G60A 4PGEB 3LKOB 3SF0A 2X0NA 2PG3A 1ND6A 2PD4A 5JHAA 4I0PC 4EW2A 2Z83A 1CYDA 4B6RA 5JPMA 3SZOA 1SMDA 1EEYA 3ALXA 1WIOA 5TTRA 2ZBFA 1W85A 2YXVA 4IEIA 4AY4A 3TFBA 3U80A 4L75A 5CDTA 4KJQD 2P75A 1HWYA 2AVNA 5I8CB 1WBYB 3CCHA 3MV7B 1OM3L 3NO4A 1RWOA 4E5UA 4JRXB 1IK6A 2YKLH 3VG9C 1UFGA 4U3HA 1DANT 1RU9L 2FOIA 4CMEC 4QHNB 1PR2A 4NQZA 4KMLB 1PG0A 3RG8A 3BM5A 3O4OB 2J3KA 1EI9A 4V0MA 3DJSA 2W9XA 5DX1A 1T5WA 4LMAA 2GLUA 4Z7QF 4LOLA 4K0KB 1PFVA 2VLKE 4IGBB 3RWFB 2ZYGA 1U0FA 3GLHB 4NF2A 1J9QA 4PVMA 5J9PA 4XNUL 2KUTA 1WTLA 3X1JA 5GGRY 1ODSA 1E1YA 1IAVA 1KK0A 1YRWA 2Z58A 2VERN 2CIIB 5JQGF 4O9HL 4PINA 3V7AE 4BUHA 3GJZA 3OA2A 4CMHA 4GAEA 1IBMB 2G88A 1A4JB 1F11B 3G1WA 2DUMA 1YNLH 4ZVOA 3GHBL 4Q3EA 2UV3A 2QJDA 4YRFA 1AP2B 4HNUA 4C06A 1NASA 1YR8A 3V8OA 3CH5A 3N2IA 1DBKH 4PYKA 5DNYB 3K2KA 2WQ6A 2KMLA 3MUY1 1NQBA 4U1GC 2C2HA 4BO3A 3KNZA 2TRHA 1XGUA 1Z07A 3VKWA 5BR1A 5M7EA 2VIRB 1IZ7A 4EB6A 4MZXA 4DKFL 1K85A 5FKPA 1H0SA 1E7VA 3JTSA 1U28C 3MWEA 4QKQA 1FFAA 2FECL 1TENA 4DCVA 3LT0A 1YAIA 3D5OF 3H5IA 4RACA 3W6PA 4MQUA 2GN2A 1PL3A 3S3JA 1DHRA 4QIHA 1SHZA 3HFGA 1AGCB 1TZ2A 5IEHA 4L9RA 2UZIR 3DHMA 2VDVE 2PUCA 1OBFO 1ED3B 2Y07H 3EWAA 3DYPA 2PMWB 1A72A 1ZVNA 3JXEA 1JPFA 3HUUA 2YMMA 1RYNA 2PMFA 4N1AA 2YYYA 1C8PA 3TSOA 1PL7A 3ILYA 5LCVA 3CCFA 3LFTA 1F2TB 1V11B 2IH9A 5D85A 4RRPM 3WSWA 3FJTA 3O11B 4US0R 3X2FA 3VC2A 4Y6RA 1HU8A 1O08A 1TZOA 1NBZB 1OWWA 2NY6B 5K0BA 5D86A 1Z63A 1Q14A 3B2PA 4K7FB 2FHBA 1OI7A 4I46A 2W9DH 3ZDAA 2QY6A 5HJBA 4G01B 3RGVA 1G84A 4KIWA 3WK8A 4QRUB 4PWFA 2AC4A 2CKMA 2HCRA 2GABA 1VESA 2QTRA 5BUAA 4BO1A 1AO7B 2QYOA 2K70A 1XBTA 5A6LA 1QYRA 5IFAL 3S36H 4WWKB 4XYLA 4NCKA 2GITA 4FOMA 4EGFA 5EXDA 3JV4A 4NYIR 2X5PA 1P5JA 2C9YA 2QBYB 4WY7L 1JH9A 3NVKI 5DVLA 3G5ZA 4U6YA 4JRYE 3X1ZA 2M6KA 4KX7A 2BPOA 3HBQA 4MWFA 5TFSL 4AMWA 3OWRA 5J06A 5KNBH 1TK3A 1QOQB 4LBEA 3LLUA 1A8ZA 1OAUL 5DQ9A 5GPRA 1Y6MR 1V35A 5KOYA 4O4LA 4X4YA 1FAKT 3ZV7A 2GWHA 3WWOA 1UJ5A 2J3EA 1RTKA 1RZ8B 3L4XA 1LM8V 4BE6A 1WBZA 1XTVA 1NCDL 4MMXC 2EX0A 5JIHA 3U3ZA 2YS6A 3R75A 4ONFH 3WNBA 1AQHA 2B82A 1K9SA 4LHQB 4F2GA 5A2LH 3BORA 4CEIA 5FHBH 3IJYA 2JBHA 1U5AA 4PTUB 1A9ZA 1C7RA 1ENPA 3IKMB 4HGZA 2V7HB 1Z9SA 4TUJA 4F1JA 3EOTL 4GQBA 4BFNA 3TSWA 4PYNA 1IL0A 1WL8A 3FVTA 4D26A 3RIXA 1ULZA 4OQLA 4K3GA 1CLZL 3FU7B 1VKXA 3O2SB 5HGHB 1E9EA 1QLRA 5HJ3A 4MLDA 4AENB 1T9ZA 4RH1A 2FJHB 3MRMB 2VE6B 4J29A 2KZKA 1J5EB 4ZVQA 2VSNA 4XZUA 5HYJD 1A2KC 2HLNA 5TQ0L 3DKVA 2F8VA 2XJKA 2W92A 1GYVA 2FSPA 4F60A 3VFRB 3D3NA 4OF5A 3ZGLA 4OV6F 4DA4A 3Q0EA 2FEEL 2HN7A 1KSHA 3FSWA 3VDRA 3MOBL 4M8RA 4ZAZA 1MOEA 5FX2A 5MN4A 2FG5A 1O6SB 3T8XB 3D0LB 3GLQA 4TSFA 5H2BB 5T4BA 1T1SA 3IOMA 1TJGL 1HDCA 5AI6A 4P5KA 3KT6A 3QKSA 4RKQA 1F8GA 1B0IA 2WJ6A 4IJMA 4AIXA 4QOKD 3QXVA 1Z0KA 4WHYH 1NC2D 2LVBA 1KUMA 4FCTA 2E7CA 1UENA 3T1WA 3L5OA 3MPUA 3KFLA 3QUYC 4D0BB 4QJ4B 4OZFB 1Y0LB 2YUVA 4N9GB 4RGYA 3IDUA 3NHJA 1CB7A 3GRKA 2MEJB 1EEUA 1N2GA 5DTQA 5G1PA 3UW3A 2FQYA 3ZWKA 4NHOA 2W7TA 4B47A 5EKXA 3L5IA 3HKEB 2AKYA 1KQNA 2OXCA 3ER6A 2A1IA 3CIOA 3VO9A 3GKWH 1YACA 1I8MB 3T0FA 1INQB 4QUGA 5KSAC 2HF9A 2BFVL 3EZ8A 4LQ1A 4D0SA 1ZIAA 3DV0B 1KCRL 4YQEA 3MNWB 2AR0A 3FU9A 2AZ4A 2OT3B 2XH8A 1K3TA 4LV5B 4WKZA 3QHFL 3QA3B 3QLJA 2AEJA 1HTWA 1X2BA 4P2RD 4QRIA 5EIAA 3LKPB 5DHQA 1LZLA 4MASA 3VXME 2UUDH 3TEYA 4NV3A 3UJPA 1HNGA 1ABBA 1IAOB 1BA9A 3IP3A 3HJNA 4XVUD 3LOQA 4JYMA 3HNTL 3VZRA 1PVDA 1W46A 5FPTA 1T9CA 2O3UA 4HCRL 5IW1B 4WO4A 3SKJL 2AYYA 5SWZA 2NPLX 4UT6H 4C20A 2BUCA 4K3EL 4S0XA 1P9MA 4YNYB 2VLBA 2VP3A 4O4JA 3ZKXC 1VA5A 3RRXA 2HA7A 4KI0A 1Z4QA 1QR6A 2FPWA 3ONDA 5CHNB 2WT8A 3C9NA 3A10A 4FRWA 4S04A 1JGUL 3CPJB 1A8HA 1V7MH 4L4VB 4MQEA 2JD0A 2VJMA 4LVEA 4NRYA 4KB5A 5AOAA 4KQ1A 1R0AL 4B80A 4MRSA 1EDOA 3TBVB 2QXYA 1TM2A 3DMMC 3F5MA 3SKNB 4JY4A 5F97E 2V7GA 2FX9H 1EQWA 1QOKA 3FQUB 5J56B 3P26A 4FN0A 4LSTH 2PH7A 4PJDB 4R51A 1AMOA 2IF0A 4JLAA 2EW8A 5HHQA 1PP4A 2JXMB 2UDPA 1KYUA 3MJHA 2P6MA 4KZ0A 4UUPA 1I31A 1TQUA 3GFRA 4HF7A 4QTHB 3ZHNA 3AJDA 5ENVA 5HUQA 2BY3A 1MRNA 4HLDA 4LXHA 4D0RA 3D39A 5BV7A 5FXMA 1LP9F 3OM8A 3NHAA 3PDHA 2EVWX 3BCSA 5FECA 2PUHA 3ICOA 3BIWA 4LSQL 3GI9L 4CUZA 2IZ1A 5KG9B 1RERA 4MB3A 3PGA1 1JTVA 4AM0Q 3KU1A 3IT3A 1TU0A 4HJ0D 1M7XA 1E5AA 5DD1H 3I6ZA 4RXUA 1KETA 1I2MA 1O4WA 1TZIA 2NSHA 5EZJB 3PENA 3RC9A 4IU2A 2ZYDA 4EX7A 4NFYA 3UKOA 2F7SA 5DEOA 4JD5A 2J8UB 4G1FA 5CWSA 1XZNA 4HUUA 1ZBQA 3QV1A 2Y1AA 2O6DA 1UFOA 1Q0XL 1E99A 3FD8A 2GBUA 4GG6E 3PPSA 1IIKA 3UROR 3V80A 1JL3A 1NDHA 4RK7A 5D1XE 3B9KD 2XYRA 2H92A 1UM5H 2C04A 4YDRA 3D69A 4C7JA 4A0QA 3NSYA 1P5UB 5AG8A 1I8AA 1TTHA 1JYEA 3VR0A 3OE7D 1H05A 5CEYB 3HU2A 4TNFA 4WN9B 2D31A 5PCYA 3VQ1C 1KCSL 2CR6A 4BVLA 5I7OA 2B9VA 2IDTA 1KTKE 1OAZL 3UBXA 2AV7B 3GARA 2LP4Y 2VYCA 3TE7A 1RIUH 3JATB 3ZNPA 2QN6A 5FAXA 3OKFA 4PV9B 4FNMA 3IXTA 1FG2A 4Q7DA 2PTTB 3JV6B 2XEXA 1GL4B 2CPCA 3AEXA 5C81A 4HHGA 3I0ZA 4BB5A 4PFQA 4DKTA 3ZWNA 4CDMA 4PGDB 1A4RA 4BNMA 1XB6A 3ZHOA 4L0ZA 1PR5A 1CD1A 4WV3A 4YFVA 4Z51A 3A05A 1RHQA 4YRZA 3V1YA 1GNPA 4JEUA 2ZM6B 4R8VA 3OZ7A 3R8FA 3QFCA 1EUCB 2Q8QA 1EHXA 1K6EA 5BSWA 1FFSA 3DOUA 4Q05A 1PJZA 1FORL 2XDHA 4K05A 3CLSC 4AYTA 2SBTA 3A32A 4F8LA 4H1HA 3THSA 5ESQA 1CRPA 1QBLL 4UVGA 2PA0A 4ZW6A 3PNYA 5K45A 3TL2A 1M7IB 1NN3A 3MWFA 1U2ZA 4GKVA 5A3IC 1NU6A 3I9PA 4KTDH 3SB3A 2I66A 4GIPD 2CKBA 3RGHA 2XQYA 2HSJA 2HTFA 3LPFA 3BVWA 1EEQA 4WTZA 1Q17A 3DI3B 3VU9B 3BRSA 4AY5A 3K70B 4TTAA 5SV3A 4U63A 3QDMB 4P5TD 4UREA 3KE8A 1B42A 3V4SA 1Q94B 3CONA 1L3BA 1QNZH 2ALWA 1ZJWA 4R2WA 3DEYX 4C2AA 4ELMF 5ABDE 4PZCA 3EAQA 2GBTA 3U1TA 5AVSA 2GQ0A 2X10A 4M7ZC 3U37A 4RK1A 5TGBB 1LTQA 5DT9A 4YFYA 1GQFA 4LQLA 4PEVA 2HNBA 3HSSA 2XYBA 1OT5A 3FLEA 5ILTL 1YUMA 3DPBB 1AHIA 5BS0D 3HI1A 1U92B 1KCUH 5DFVD 1HL5A 2EX1A 3H75A 1JYXA 1CTMA 1ESDA 4ZICA 3A6GA 3HO8A 2HUPA 1U9IA 4J0GA 4LRYA 4Y2YA 1U3UA 1ZJZA 2OR9L 4PM1A 2I22A 5E2WL 3KD4A 2LABA 5A7EA 4LHJB 1FXSA 3BW9A 3ML8A 4EZKA 5CJOL 3TJZA 3HZVA 4GUQA 2QUHA 3BXPA 4HL6A 4MSWA 5EZLB 2ETVA 1Q3KA 4M7JL 1CGXA 1UT2A 1TQVA 1Z1WA 4TSKA 4HSAC 2IODA 1K5GA 1I9CA 1O54A 1NCAH 4XNZC 1HQRA 5LXGH 2BMJA 2C0CA 4ZNEE 4YJ2B 3FUIA 1RM5A 2JLXA 2NYUA 2RGBA 1NLYA 3WLHA 4RDIA 4I3RL 2IIBA 4G82A 2ECFA 2EUXA 5J1TB 4Q74A 3WOHA 3DL7A 1BEXA 2QSCH 1M5TA 1ZIBA 5FO7B 3VSDA 1NCOA 1NQUA 3QQ4B 4FCCA 3LO5A 3O3BA 4JJGA 4GH5A 3ZS8A 6PFKA 3R24A 3LH8A 3P02A 1V2HE 3K6IA 3G1TA 1SU8A 2DQEL 4JFSA 3UNXA 2R8XA 2VN8A 1FP1D 3LQAH 3EJWA 3BZUA 2ITEA 5C0AA 1XVSA 2C5LA 4MQFA 2FOLA 2C7QA 1A7AA 3QVOA 5AFSA 2FIKA 4A27A 4J0HA 1L0XA 4D9RD 3AF6A 1E3SA 1FO0H 3D3WB 4QGHA 1X5YA 3QXDA 4KNVA 2QX7A 3GVPA 1IONA 4II7A 2I25N 4L27A 2NW2B 4HPXB 3RK1A 3TLCA 2D5CA 4NE2A 4Z4IA 3Q3GE 4HG2A 1XZQA 3MA7B 1BD3A 1DTUA 1DX9A 5JTUA 1DOAA 1HSAA 4ZAKB 1CUYA 3TSYA 3A1DA 1ONQA 1DUSA 2AV6A 2H57A 3OHSX 4R9VA 3RQSA 4D9LH 3PDWA 3FROA 3EOZA 4CM7A 3W1EA 3CZGA 1TU4A 5E08L 3H4FA 1JK8B 4OL0A 1TIBA 1YA5A 1C16B 3GGWB 1YIOA 1W0CA 1NC4D 3LJKA 3WIAA 2V03A 3SHTA 2D2FA 4KH1A 3GF8A 1FNSA 3TIEB 1MAML 2O7QA 3VDAA 2C7RA 4QPEA 4WUUD 3TYGH 1XDGA 4Y6OA 4F8PA 3C5EA 2VCYA 3O1IC 1F00I 2FZWA 1PR9A 1OU0A 4UINL 5GJTL 3CH8A 4E9XA 3AM5A 2EKLA 2YS7A 4QWWC 3IJRA 3DLTA 1AIPA 2BNQE 4WXPA 5IBUG 1JFTA 4ZT4A 1AA6A 1IY8A 2IA5A 3T06B 3ESXA 1LV8A 3RVVC 3JYHA 4PRDB 2VXTL 1NBCA 3EYQC 3ND7A 1SRDA 1U0BB 1JSZA 5K9KA 1BWSA 4LWOA 2EIDA 5LL6P 4KXUA 1K6IA 5TVGA 2C9XA 5KO2A 1TVKA 4DLLA 3C2AH 2W48A 3OKOB 2AG6A 3LRXA 1OH6A 4U7TB 1EAQA 3ECWA 1ZU5A 3TNJA 3X43A 3HZHA 1GV0A 2WWMC 1JBKA 4BZYA 4GZ5A 3PS6A 1DL5A 3KPRB 3I50L 3K4QA 1QLWA 3L7EB 2AW3A 3LCVB 2BRQA 3B6SA 1B2YA 2CWWA 2EAUA 1Y1RA 3VR5D 4O4IF 5AOVA 3DO7A 4ZPVB 3BSHA 4FG6D 2F3QA 4BC1A 3Q0IA 2WOOA 2HT4C 1N7HA 4MS4A 3DBXA 1T6NA 1EQ2A 1ZANL 3PXDA 4NUJB 4GMHA 3X14B 4P2OD 3GK3A 3QLUC 2PN1A 2BO0A 5E51A 3FHLA 4GNKA 3VH1A 1KPRA 2IYAA 4FLRA 1T3LA 3AKYA 2ZYIA 3X13B 1AGNA 2F1HA 3WDSA 1C5CH 3ZW3A 1DDIA 4A03A 3VRIB 1QGOA 3V6ZB 1P4UA 3T2NL 3FUHA 4J6EA 3RUPA 3RVKA 5C0EB 3T3MF 4COKA 3KBBA 1VPVA 5K3BA 2YXPX 1PK7A 2OILA 3VXRA 2NY3B 1WR8A 4Z76A 1QO3A 4ELDA 2I7XA 5J1AA 4MHSA 4MLPA 1N70A 3FTYA 1T8RA 4HIHB 2Q87A 4UF7C 2FBRA 2ERJC 2AK2A 4JY7A 5T57A 4JM4H 3O8CA 1JI3A 1LYQA 3F8SA 4BB0A 3FF1A 3WLBA 5DN6A 1XAJA 1DCFA 5CITA 3P4OB 4JFEA 4F57H 4CGUB 5IK3B 3ZRCC 5TGTA 2O6EA 4OUDA 2V4LA 4BE5A 3JQCA 1KZYA 3VOSA 3QEQE 5LWQA 5CW1A 2D9CA 2Q62A 1Z9OA 1UK8A 2HDHA 5EEXA 4BFIB 2LLLA 4H8HA 3AG5A 5HEKA 3TH3T 1PT6A 3BAEL 1NGZB 1PZAA 3EARA 2G0TA 2AXGB 4JKIA 4QNNA 3E2HB 2I6SA 1FXWA 3L4BA 4D45A 2D7QA 2ED8A 3U0TB 4EIBA 4RDHA 2CU9A 3WMRA 3BJEA 1UMBA 4X7PA 3RGBA 3TRJA 5J2UF 3TNMA 3UTCA 3T6XA 3SNKA 3NBMA 1J8HD 3AR2A 2NY5L 1Y4DE 3HAEA 1V6AA 4ZQIA 4HD5A 3AXHA 1RBYA 1X1DA 3ONFA 4E31A 1CZ8L 4H8QA 4ZW8A 3DVQX 2FCBA 3PP3H 5H02A 1Z32X 2E6QA 3USZA 4PRAA 1ZI8A 4DF3A 1JAIA 1VE5A 5CM9C 3NZSA 4X7RA 1CUUA 4WLFA 1FHGA 3WEBA 3GAMA 2WINI 1Z4PX 1P61B 1SBSH 5B1SA 4Q01A 2PD6A 2VAVA 1GZPB 1G5IA 3R7SA 3U6KA 2EJTA 3FNHA 1XR8B 2XZAH 2FO1A 4HLEA 4XUCA 3VPGA 1KDIA 3QVLA 3RBGA 1O6ZA 4PBVC 2IG2H 4JQIL 3SS9X 2O8EB 1J8RA 1PGQA 1KI7A 1C12A 3SCMC 2EL7A 5T5NF 1G55A 4LDJA 4BKLB 4AN4A 4Q82A 5HI4D 3QUXC 2VM4A 2MRYA 4LARH 4MAYC 4PCTA 3ZCQA 5CDHA 2BBTA 2W0FA 1LJUA 1XXHB 5ISMA 3I28A 1OCWL 1BHQ1 2AMJA 1MPAL 5DQDH 1QTRA 5CFNA 2WCGA 3OOSA 4XBPA 1V3TA 3WIBA 3TCXB 1KXJA 3KPQA 4QA9A 1D6SA 1G6VK 4PJEF 2Q6WB 1CHDA 3GFPA 2JJMA 2ONKA 2QOEA 5AG9A 4TMWA 1R6DA 3OFJA 2E89A 3MV7D 1U2RA 2N56A 1Z5WA 3Q88A 2ORBH 2FW6A 4DV6B 3PDOA 2ITCA 2W4QA 2HPTA 4RETB 4Q15A 5FL7A 4DDMA 3KKPA 2C9OA 1MB4A 1P0CA 1FVCB 4P5RA 4JFOA 3QEGH 3QUCA 3F58H 2W80C 2I2CA 4ZXPA 1UOKA 4EKIA 4G3XA 1AKUA 3C5WP 3INTA 3CGGA 4IWYA 2H4WA 2ZXCA 5GOTA 3WNJA 1XTRA 4KPYA 2W2MA 4YC2B 1NFRA 5TQ0B 1MQ8A 4PM4A 3A1WA 4A23A 2BSSA 4ZODA 4EG1A 1K98A 4YBHA 1NGQH 1H6AA 4HXBL 3D2CA 4AF6A 1HSBA 4JUCA 4MLIA 3MLVH 1H2ZA 2B4KA 4BE9A 1UDBA 2BLNA 4GG1A 4LCCB 1EHCA 1R37A 5AICA 4AKTA 3KG5A 3UADA 4U3CA 1NBMD 1GPNA 2O50A 2G3MA 5ALVA 4JR9L 3N7AA 1JZHA 1S9HA 1M1XB 1ZK0A 5D6CA 4UDNA 5I8PA 3T5PA 3BEWA 2B37A 1QXSA 3OB0H 5BQ7B 2E9SA 1R5VA 4HIEA 3H3XA 3F04A 5INDB 3EEOA 3P0YL 1JB1A 2DWEB 1RSYA 3UV6A 3VFMA 4G5ZL 3P9RA 4CC4A 4EPXA 2IT1A 2A6JA 1RWWA 3AQ4A 3ROZA 2H2PC 3I62A 4TNEA 2QDWA 2Y0SA 3I2JA 1FL3B 1NJ2A 1JZSA 4KXCA 3OTOB 1TJIL 3GTNA 4KQGA 4JLMA 3DURA 2AUMA 3NAAL 4LGRB 2FZGA 3R3ZA 2IBTA 1WUYA 4JR1A 1ZGLA 4ENVA 1JU4A 4I6GA 1SBCA 3BXNA 4P4SB 1KK2A 3MC1A 4Q6IA 3A6CH 4GT0A 4FWWA 4LKXA 1G2OA 3LDBB 2HWUA 3HM9A 1W16A 5K05A 1E4XL 4PAQA 3SDXE 1ZA6B 3HI5H 4OJTA 2PR7A 1V4BA 4N0PA 3N1QC 4O4HF 1PMYA 3FZNA 1RK1B 3IGFA 5AWNL 4Z3FA 3O4GA 2R9VA 2E21A 5C7XL 3TQHA 5F9JB 2YPVH 1QHNA 1OE2A 4DANA 1BZOA 3QZPA 4NOBA 3A1SA 3I02A 3E8XA 3O1HB 3QJRB 3QP9A 3RWOA 5CB4A 5AAMC 1Z4LA 4LPVA 4WWKD 5I5EA 2CHVA 1O5PA 2R1YA 4WKPA 3GM0A 2BW5A 5DLPA 2V0GA 3FSOA 4NZTH 2VJDA 3V2GA 1I9RH 1JHTB 3HZMA 1TR7A 3D09A 4O4YH 1WO2A 2J8OA 1MCBA 4ATWA 3HPJA 3QOWA 1UWXK 3BYYA 4E9SA 4C3VA 4RMVA 2ZUEA 3MNZB 1LU9A 2PRZA 4JJZA 1YTUA 3BE5A 4BZXA 1NF3A 3DTXA 4M7KL 5AW8B 2ZP8A 1NCIA 3AW5A 3LNTA 1BMWA 1U4EA 3S70A 1KYYA 3MBKA 3WN5A 3TGLA 2WF6A 2COUA 5IR1A 4KNUA 4PGHA 3G7SA 2EFHB 1R7RA 1NY5A 3TLMA 3L9RA 3C45A 4OFKA 4G5FA 3MRGA 2EXWC 4N5EC 2VTDA 3T7CA 1HILB 4DEPB 1IQUA 3T4UA 3H4HA 4F33B 4BS9A 4V2CB 2XRMA 3MJ9H 2PXYD 4XLZA 2ZWMA 4WVLA 2XZLA 4NO0D 3MLRL 3VISA 1PFWA 4CTNA 1X1BA 3PAVA 3CXRA 4N4YB 1A6WL 1CK4A 4BA8A 3WGKA 5T1KB 3OQIA 1H2YA 1F4WL 3SGDI 1YT5A 2F67A 1YFLA 2IOQA 3WUWB 2WJWA 2DI7A 2G5PA 4QRPA 4FQIL 1EA9C 4JBHA 5MHSD 2X4RB 3ZMEA 4NMLA 3BP5B 3O2DA 5CJ5A 3VNUA 3IJEB 3C8HA 3AHFA 3HUEA 5GGSY 3ZWMA 1DJYA 4J2HA 3BYTA 5FCDA 3UEQA 4WY5A 1FIGL 4PXAA 2X7LB 3FYCA 1U6AL 1ESCA 3FLBA 4EVRA 2UYQA 2ZI9A 4OB6A 2NZIA 1J25A 5LLSA 1LMIA 1XLWA 4RPHA 4ZXBC 1EHAA 4L0QA 2OX5A 3KXFB 4N0UE 1EFRD 2EU8A 3PHOB 4OHPA 3KQTA 4Y0GA 5K6AC 3UJ9A 4JRWA 4P0QB 4HFRA 4CMMB 2AERT 3I4FA 4MDHA 3L07A 3CVJA 5B3JC 1UDAA 2XR1A 1MIOB 4B7CA 3F5SA 3VNSA 2FA9A 3V0HA 1ZVMA 1FPMA 3OBAA 5ICXA 3BK7A 3JVGC 1ECGA 1VAHA 2IIQA 2RKWA 1DQIA 2IZOA 4RGMB 3K2UL 4AROA 4X6EB 5EHFA 4OF0A 2GZ3A 5J1SC 4CRWB 2CUMA 1JF5A 3G5XA 1YLBB 3L05A 2VT3A 3OJDA 2AN4A 3U6XS 4DM3A 1LBQA 2DMKA 1BMZA 1V7CA 2ANCA 1CQJA 1SC3A 2I60H 3NDJA 2G5TA 2BDNL 1PDKA 4FCVA 5DD5H 1CTQA 2XQKA 2ZOUA 4C6HA 1U8FO 1B2WH 4ME6A 3PGXA 5CSGA 4Z7QB 3DUSB 3BWAA 2O8BB 3UAGA 1U8JA 1A88A 4NO2B 1UPBA 1AUOA 4O02B 4OI8A 1X4ZA 4Q9DA 3H2BA 4WENB 4UAUA 2B61A 1YRBA 3PP4H 1REQA 1FW6A 4X6FA 2ZXEB 3ANLA 5GS0H 4P38A 3TQOA 4DPKA 3JQAA 1JAHA 3LHSA 1R5BA 3EYVA 4PJ9D 5JQGB 1LPSA 4KO3S 3QDHA 3VD4A 4HI0E 4BV8A 2F08A 1TZJA 2HL6A 3JQGB 1HCYA 2WLZA 4KACA 3SDAB 3F6IA 2QR3A 2WIGA 2K0RA 3B7GA 4OZIE 1BEYH 2X1OA 2YWZA 2O7NA 5BVJB 4HC1A 4AXWA 2O2EA 4G0ZA 2X2EA 1T35A 4WGFA 2HRQA 4HWEL 3DGGA 1QI3A 3C08H 3BXOA 3KZCA 1ETUA 1UKAA 2H7VA 3ARZA 4NJMB 1XWVA 2JCXA 3ARBA 2E4YA 3D8SA 1Y6KR 5IXJA 4X4ME 3UJIL 2Y06H 2V5MA 1LX7A 5C8XA 1F4XH 2AZUA 1IGTB 4X7MA 5A03A 3NCEB 5E0QA 1PJ3A 3MRKA 4HX2A 3ZN2A 1TZHA 4NUMA 2YXFA 4D43A 2G5BB 3TO4A 2WNWA 1MI5D 4CGYA 3GGCA 1WKBA 5JDCC 3WXBA 2KBEA 4HS8L 3D3VA 4XPIB 1UPCA 2PX5A 1IGJA 1WW3A 3TQFA 1OFTA 5H83A 3H9SA 1BXKA 4B43A 4KOCA 1QS0B 4A73A 2E59A 1J5CA 1SLXA 4TKMA 4F7PA 1JA0A 1JXJA 2J5BA 4TVPH 3IBOA 3N9GL 4M8VA 5DRZA 4M6NH 2MIZA 4IMPA 1X0VA 4F86A 4I3SH 3UMJA 4MXQC 4TS4A 2B1GA 3RLFA 2CCGA 3UHFA 1P81A 1QFWL 1Y3IA 4FFYL 3LKZA 4ZDIA 4A55A 1EDBA 1RYMA 1NOFA 3S35X 2J3HA 4Y9BA 5F96L 1SVSA 2ZSFA 2WGXA 4MJIA 4P3XA 4BNHA 1PZUB 1E9FA 1LE9B 3PGMA 5B57C 1LI5A 1S3KH 4PC1A 4ZT7A 3JZYA 4AF8A 1KY2A 2QKIC 1W2HA 4AGNA 2NSXA 3RX8A 3L4JA 3ESUF 2XYHA 5F7DA 4LLQA 1E6LA 3IAM6 5F5LA 2GGSA 3HVRA 3TW8A 1G6HA 5JAMA 2H3NB 3DROB 4K71C 2HO4A 2QDXA 2C7UA 5KVDH 4Z7WA 1CLOH 4D9QE 2C9BA 2RGYA 1EXVA 4TLSA 4UOQA 4PLOB 3WTTA 1AMXA 1TC2A 1QORA 2G0KA 5EZIH 2J4DA 2GUOA 2R6AA 4OV5A 4HOXA 4AW7A 4Q9QH 2ZCUA 3FRPG 4TLTA 3RUGA 1YNKL 5EOQL 4NJAH 2QGBA 2E37A 3EZXA 2P3LA 2A1WL 4N54A 4RWEA 2DCUA 3QO0B 1E6EA 4HLCA 2WXHA 2WG0A 2P4SA 1GTMA 1DL7L 4UHDA 1A71A 3T1VA 2EP5A 4J2TA 5J59A 4H8WH 1CZUA 3AB0C 3HFSA 1CZRA 2DLDA 5HCUA 2ZWYA 5JAHA 4Y1EA 5GGTA 3X1MA 4D8WA 3QLTA 4OLUL 2FEXA 4PPTA 4K8RC 1MREH 2CWRA 3PJRA 4LVOB 4JFWA 5F1KC 4XX1E 2F6RA 2ZCKL 3DC0A 1XXDC 3CZSA 4ZUSB 1MFEL 4C57C 3ZUPA 4HSQA 43C9A 2FN4A 5FHAL 5F1SA 1G8MA 2GZ1A 4YJ3A 1JV2A 3NOVA 3DSFH 5CCDA 3QZWG 5IJ9A 2PE5A 5CP3H 3V9CA 4QRHA 2XMCA 4HEQA 3F5DA 2I6FA 4ZUUA 5BRZE 4OV6B 1YB6A 2VNAA 2WTUA 4QRFA 1E9PA 2MSPA 4CMGA 3HMWL 4KBYA 5DQJA 3K70D 4PR0A 3SO3B 1EBAA 2EVFA 4HK0A 3PRHA 1L4IA 1DJWA 5EORH 4BELD 3WKEA 5DEGA 4Y1AE 1ZVSB 2PLRA 3DCIA 1R0YA 2HF2A 3SEPA 1T83C 5KX5F 4RZKA 1UM9A 5IG7B 1EBUA 2AJXH 3NTCL 3UHPA 2WIMA 1AQUA 4F2FA 5LUMA 3L1KA 3WP1B 2OSWA 3WGZA 4BKQA 3H3PH 1QRDA 2DWCA 5I5JA 1X7GA 1KI6A 4B7XA 1BFOA 2BZDA 1DEDA 2OTWB 3CNOA 2PS1A 4LVHB 2IW1A 5AENA 1DQYA 3LBIA 1FUUA 2X8BA 4NFHA 5JZBA 3QE9Y 1EFTA 4DDVA 3QKUA 4TF4A 3D2BA 4P53A 4UW9A 4E0RB 3K9FC 5HQJA 2R2CA 3ZX4A 4F4FA 3UC0L 2BIQA 3WTXA 4ZSOB 1IUNA 2OGSA 3D6JA 3DX2A 3KNBA 3PDJA 1W88B 1XGZA 1S6NA 2R2EB 1UVQA 3M33A 5BO1H 4LOUD 1JWSA 2H32A 4ZI5A 3NI2A 4WI2A 5EJ7A 3T3NA 4HAUA 3COOA 5HXAA 3HZKB 2NM0A 4M6OL 4F9PA 2WY2D 4ZOBA 3MTGA 1IFHL 5CJPA 4BCCA 3P3UA 4KGDA 4ZOLF 1Q9KA 1WSWA 3ZXUB 2WVHA 5ECGA 1PZXA 2Y1YA 1JRLA 1I7NA 2P3YA 1N1DA 4N6RB 3ZIDA 4DMUB 4R3SB 1RXLA 3GJFB 1A47A 3EJ6A 4NGHL 3U4BL 3W2HA 2ATIA 5KVDE 3UYOD 4QOKB 3RWCB 1RE1A 4ITVA 2IXFA 2AMGA 1PV4A 1RZKL 2AI2A 5KTRA 1RDFA 4GLOA 5CYOA 3NHWA 1NMCC 2IXTA 3LXMA 4DP2X 3EVZA 1AKWA 2F15A 4JX9A 4QTTB 2RGGA 4UAGA 1CYXA 1QVZA 3VGAB 1Q1NA 1T1ZA 3DMYA 5TQ2A 2ZRCA 3BREA 1I4LD 4KH9A 4M7OA 3INYA 1C8BA 2P8JA 1QMUA 4AVYA 1Z45A 1DJXA 3KUDA 3WFZA 1U2GA 5NLLA 4GE0A 3N6VA 3L92A 1MVYA 2GJ9A 1ZR2A 3P2JA 4UQ3B 3IMGA 4NZZA 5L7XL 2HJKA 4AY2A 2FMTA 5M95B 1XD2A 3FQNB 3JARB 4L9LC 2QP9X 3UJ3X 1XELA 4URFA 4A5OA 3OGOE 4P2RB 3D2UA 1RV6X 1K8ZB 2ENWA 2QYTA 3RDTC 2EDHA 1CY0A 2A0WA 1LP9B 5EC1B 4FFNA 1BF2A 3ZDDA 2CL5A 2FGWH 1EO8L 1JEDA 2ZFUA 3URMA 2LVEA 4G0WA 3RZCA 4RQUA 1WZIA 1CUZA 2ZSVA 2VP6A 2A4ZA 3KJ4C 3GG9A 1MJUL 4PS8A 5E6UB 4F4JA 1ZHNB 4WDIA 1YZZA 4M89A 2AFHE 5D7NA 3S2AA 5HYSB 1NM5C 1KXQA 2WBJA 4N6GA 1CGWA 4FOTA 4KMTL 2B6HA 2BKAA 4P4KC 3BH8B 3WYBA 2XOKA 4RA0C 4UMSA 1TQBC 2G17A 1L9SA 5IMSA 2FVXA 1ADGA 1Q72L 3N0VA 1N5MA 1V3LA 1MCLA 5FKAB 3JZMA 3KV3O 4WFEE 3TBSA 4D5EA 4U1HA 1Q0ZA 3NEEA 5CNHA 5IBRA 4AL8L 1I7RA 4LRUA 1HT3A 2VTEA 1MFAL 3WFIA 2KPOA 3KBPA 2JGKA 3RWIB 3OLZA 3DGCR 4Z8FL 4J2QA 1G8SA 1ONNA 4ITUA 3K0AA 5PNTA 1SPDA 2HVBA 3S4SB 3ARYA 5EOTB 2GZRA 4GI8A 3KPRD 3GCWA 1B2RA 8FABA 3P30L 4M93B 1KB3A 32C2B 2OC9A 2OC4A 4IDHA 4AVKA 4UBJA 1P6QA 2A78A 3LE8A 4K9RA 4LP5A 4RNDB 5DMIL 5ALPA 3WRXA 3UG3A 3PNPA 2DFKB 1UM4L 5TPWH 1RUKL 4XJVA 1Z7GA 5IAJA 4AO7A 1ZJ5A 1II8A 1B90A 4UUAA 3RY6C 3PBKA 1XALA 5KHAA 1KZHA 2V6JA 1TZGH 1BXGB 1GS7A 3X17A 1H4TA 3X2SA 5DSCA 4JN1L 1KI1A 4GECA 4JLRB 3VR2A 2IQIA 2N1MA 1NUAA 5KZMB 3B38A 4HEHA 1GSHA 4QYMA 3GMLB 1HDGO 3IUNA 2QLFA 4CG1A 3GXPA 4EE2A 3ZWBA 4J1SA 1L7IH 1TYRA 1PG7W 2D5BA 4JVPA 5EEGA 3CZ4A 3B9KB 1EB8A 2CMHA 5JFGA 4WI1A 2PU5A 3FZUC 5AB9A 4FI3C 3KLMX 4LLYA 1K0UA 1E2FA 3QIWB 3E53A 3C6QA 4ITRC 2VLKA 1WA1X 1OGTB 4OHKA 2NO1A 3M88A 3PWLB 3BIAX 1T5HX 1TT7A 1I8KB 5A05A 4KVCH 5GRUL 4BJ3A 3ABKB 2OK0H 4JBIA 4REQA 3ARDB 3ZE9A 3W3AD 4ZMTA 5DFWH 4AEHL 2ORIA 3PFIA 4NARA 1FZKB 4B7UA 1IQWH 4N0YL 2AV1A 1NUDA 1UBTS 1QPZA 3IBTA 3VKGA 2BMEA 4ARZA 4P4TA 2VOTA 3NG5A 2AI0H 5E5LA 4ELMB 1GTNA 3C3EA 4J03A 2O0HA 4DXDA 1Y3DE 3MOAH 3RYIB 4U1JB 3GDGA 3BQVA 1EA5A 3AUYA 5ES4B 3NJ4A 4I50F 3GGPA 1U8CA 1YYMH 2AEEA 4U7FA 5HKBA 3O3AA 3NH9A 3ZBMA 2D7OA 1I85A 1X9HA 1BEUB 4D5GA 3GD7A 3ZWWA 1WHOA 3IDXH 1G1KA 1SY6A 1JQLB 5IK2A 4PG6A 2JVJA 4JG0L 3JPWA 3EOBI 1IMHC 2V96A 4X64B 2BIHA 4G6JL 3KLLA 1FS5A 2IE8A 2J9RA 1N2EA 2C20A 4NV0A 3EGXA 2Q3ZA 3RU8H 2YSSA 5FQNA 1NW4A 3D8UA 3D3KA 5BWMA 3R0NA 2G7MC 1MFDH 4JYPA 3FHOA 3HVUA 3ECSA 3T0BA 2ZI3A 1KGXA 4HWBL 2FWIA 2X1XR 2ZR7A 3QPAA 2VJNA 3VVVA 4FERA 1NNSA 4GRLD 3WIHA 4Y7CA 1BVYF 4KHZA 4K2HA 2QR0A 2I85A 2WUBH 3N0RA 4PLWA 1YDMA 2BUAA 2ZUCA 3STXA 4WEEA 4KO5A 3RRJA 1RKQA 1MWAH 3BH7A 1PEZA 1SJ9A 4ZHQF 3NETA 3QV2A 3U4CA 3K5SA 4V0OA 4YWGL 3QRFM 2XECA 5K4AA 5JYDA 3I2YX 1H8LA 4BIMA 1T91A 3QE4A 2DAVA 1T4MA 2ZCHL 4CMIA 2RGWA 1XKXA 3K4AA 4ELKB 3U3KA 1MCDA 3MCTA 4KODA 3RE0A 5LQSA 3LPOA 1E28A 3M1BB 2EE6A 4X9YA 5DTRA 4H88L 4Q21A 4TQGA 4W6WB 3I5XA 4J2OA 5BV1A 1RZFL 3DL2A 4FCWA 2BM1A 2A9CA 3HN7A 4CTJA 3O2VH 2Q9OA 4RCYA 2D2CC 4G9DA 1ND0B 1SR8A 3DCYA 3LC7O 3IP6A 1E3EA 5G0WA 1PFGA 2WXKA 2YUTA 1DTEA 3G6AA 1ISHA 2XN0A 2C29D 1PNOA 4M1TA 4QO1A 1U3JA 1X7WB 1KOLA 3ZWCA 2BHRA 1AQIA 3GUZA 1CP2A 3WRYA 1DE0A 3WLFA 1YPZE 3VVWA 1NBHA 3ISYA 1TVMA 2ISQA 5JOFB 1WFNA 4WZZA 4ISVB 2EE9A 3N05A 3N8IA 3V4OA 1WNFA 5EUOF 4APQD 2YUIA 1WAAE 2I99A 1RKXA 3IDOA 3AR3A 5FOSA 3QDGD 3PABB 2EWWA 4CUKA 3ZYCA 3DDWA 2PSEA 2PX8A 3WLNA 1GNQA 1T3FB 2FPPB 1ISJA 3MB5A 1WTCA 4J6IA 1F17A 4UEWA 3C6SA 3IR5A 3R6DA 1NVFA 1BHSA 4XTCS 3KCQA 1TU3A 3BFWA 4F46A 2Y9RT 2WQ7A 1Z9NA 4JFTA 3PUJA 3M4ZA 2CHQA 1TL7C 3BZEA 1FLTX 3LY6A 1TSRA 3DTYA 2YD1A 4XDZA 5F88A 1E0OB 5C0FA 3HS0C 1TUBA 2BUBA 1QASA 3DZFA 4OAPA 4BYMA 3L4WA 4DP9X 3P45A 1XDDA 2JH8A 3ND6A 5K2OA 4YK4B 1D2NA 1HI6B 1HQYE 1BAPA 3SPXA 4PPFA 2Y0DA 5L8KB 3T5AA 2F1AA 3JT0A 2PMEA 1CGYA 5C37A 1QGUA 5K0GA 3WE1A 4IJUA 4YHNA 3HV0A 5D6DC 2Y05A 4FIDA 3EH5B 1XZMA 2IUUA 3AQXA 2JJQA 1FPTL 2I7DA 2VWHA 3JAWB 5BNWA 3LHPH 4P7KA 3NN8B 3S5YA 2R60A 4O4IB 1NYTA 3B9QA 1TD1A 5AK3A 1ZXBA 1CIDA 1ZS8A 2PPDA 5DFAA 3DBVO 2O5YH 4JXKA 3OQMA 1XSOA 4FFSA 5TE4L 1P7PA 2P67A 4BGDA 1IVLA 1NC4B 4ODHL 3LUFA 5L8JB 3NAGA 3FSJX 5LNGA 5CU7A 3MBEA 1Q9WB 2VUHB 2PPFA 4AY3A 2C9SA 3GEDA 4IBUA 2V7TA 2J0SA 4B4DA 3ZNNA 4WGVB 1VIAA 4XE5B 3JV7A 2ACKA 1YJBA 4HX1B 4HT3B 1J21A 1R5IB 3AY6A 2O7SA 4J28A 4HU2A 3ZX1A 2Q5EA 3CPLB 2R0QC 3T3MB 4L95C 3C1TA 3QGMA 3LLMA 2HTLC 2IP2A 5HBBA 3QU4A 4BUZA 4M7RA 5LP6C 4S0TD 1HINH 3VYNA 1NXVA 2JKZA 3GRPA 4YDVB 2ESVD 5E23A 1QHGA 1EAMA 4KKXB 5JO5B 1DIRA 1XFAA 4I7ZC 4FP9A 4UU9A 1V7QA 3EUEA 1BE8A 3LPWA 1OWLA 2Z93A 1SSLA 3EIWA 2DW5A 1K8YB 1WQVT 5HHNA 4A2HA 1OAQL 4XR9A 4F2ME 2C7BA 4PXYA 2RAPA 1U93A 4I66A 2FMUA 1ZTMA 2AQ8A 2OMWA 1L8OA 5BW8A 2GYUA 3NQKA 3WLOA 3R4CA 2BSTB 4NNXB 2MHAB 2J59A 4O0MA 3X3FH 2R00A 1E58A 4QG3A 3LN5A 1KI2A 4K9DA 5B1JC 4EPTA 3DRQA 4UQBA 3DJYA 5B4VA 5GXBB 2VHUA 4M9QA 4P2OB 4OLVL 5IDWA 5J2UB 3B2NA 1PUJA 1SXCA 4P5PA 3B5EA 2NQ2C 4MAUH 3F6BX 4C4SA 5KNBA 5JJLA 2MMGA 5FWYA 2DYPA 4IDJH 1L5GB 1AF7A 1I4TD 4C05A 2OY0A 3K09A 4BK5C 3I32A 1X9GA 3M6IA 4OJDH 1Y3CE 3P19A 1CVRA 5E4IA 4RL4A 5T1KD 1E5LA 4BFFA 4IQ4A 4I0KA 5BVHA 3I58A 4AMYA 4IWNA 3I9NA 1U8LA 4MWGA 4DCQB 1Q0RA 3DOOA 1ZK1A 1C3XA 3KR2A 5JNVA 4XPGH 4KDFA 3QYAA 1TX4B 1X7XB 5KOMC 1O3YA 1EB9A 3PYCA 3AUVA 5GRVK 3QORD 3BF8A 4JFDA 2XADA 4E42B 4ODUB 4ZFFA 3OURA 4ZI8A 4BM7A 1BXRB 5C3MA 1MJ7H 2DE0X 5AUMA 4XUEA 1ZLSL 5I1IH 3WZ2A 4QFDA 4BMVA 3LKQB 1G0XA 3TSAA 3KXLA 3AS0A 4UDOA 1JHPA 3P3RA 2G9NA 3MTQA 4RZSA 4HVCA 3IVKA 3MINB 5SYAA 2GESA 2BLFA 3JSAA 4U1SB 3BFKA 4YSCA 3BN3A 4MTLA 4GG6A 1IJNA 1N34B 4JZOB 4WV1C 1E27A 3IDIB 1AUQA 2YC2C 4PZZA 4QBGB 4OXIA 4C29A 2C77A 4PJEB 4MRNA 2KH2B 4FFWD 2P6UA 1KLFA 2NVUB 4MWBA 2Y1GA 2LW3A 4MYSA 2CRIA 4EHAA 2BIMA 3ASYA 4K7JA 1OC2A 4MMZC 3AETB 1QUPA 4LFHD 4JJ5A 1W72L 2FZLA 2WFZA 3QE3A 4AZVA 5LXTA 5HMMA 3R40A 3H1FA 3OOJA 2DX7A 4R01A 2P2ZA 1ZZGA 3U0BA 4LV6A 2DYSB 2Q1TA 2I3DA 1P2FA 2D8KA 3T2OA 1VI6A 2GYWA 1JN0A 1SRQA 3C8DA 3GHEL 2OWEA 4NAMA 2R62A 1OSEA 1B6DA 1ZT4B 3CWZA 4QULA 1MQKL 1ZNZA 2YHAA 3SFTA 5AJWA 3V3KA 2ZSJA 3DJTA 4KKAC 3CFIC 2DQUL 2REQA 3W34A 3MUNA 4PP1D 5D5QA 2Q0QA 3WNQA 3PHIA 1CXLA 4KI5D 1TDQA 1KRHA 4GKZB 4X4XA 4PAGA 4J3OG 3UERA 1CW2B 1YNTF 1T34A 3OKPA 2ZIZA 1FL9A 4KSCA 4L1HA 2QRKA 2X0UA 3P2DA 5I30H 3FYUB 3MMPA 4U0JA 2QTWB 3DYIA 4DVRH 3S2YA 5AJVB 1CFMA 2O8FB 3GV0A 5FBQB 3X1XA 2J4WH 1X74A 1RXSA 3AUTA