2VDMB

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist tirofiban
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
461
structure length
456
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
total genus 125
structure length 456
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdmB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdmB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdmB03
1ZOOA 5HJ2A 5LN1A 4BJ3A 3IJEA 3BQMB 1ZONA 1IJKA 2P26A 3NIGB 3AFCA 4WK2B 1MQ8B 4Z7NB 4MMYB 1JEYA 2VDMB 4MMXA 3EH2A 2P28A 1FNSA 4MMZA 4Z7OB 2IUEA 4O02A 3OKWA 1UEXC 3IJEB 2I91A 3M6FA 3FCSA 4IGIA 5E6RA 2VDQB 2ADFA 4HQNA 1JEYB 3HI6A 5KYNA 1XDDA 3K71A 5KYXA 2VDPB 4MMXB 1QCYA 4G1MA 4C2AA 4MMZB 1M1XA 1N3YA 4M76B 4O02B 1L5GA 2X5NA 1DGQA 3FCSB 1AUQA 3K72A 2XWBF 1RTKA 2WINI 1M1UA 1MQAA 3PPXA 4WJKB 5KYYA 3K71B 4O3UB 1M2OA 5KYXB 4G1MB 2UZYB 5E6SA 1NA5A 1TYEB 1M1XB 3F74A 4CN8A 2B2XA 4PN7A 1L5GB 2VDLB 1OLZA 1QC5A 2ICAA 3ZDZB 4NENA 3K72B 5E6UB 3K6SB 1CK4A 1FE8A 4XW2A 3VI3B 2ODQA 4UM8B 3HXQA 5KYYB 4FX5A 1M10A 3V4VB 1RS0A 5E6SB 3BQNB 3VI4B 4GZ8A 1PCXA 2VDNB 1JLMA 1QC5B 1XUOA 4NENB 1JV2A 4F1KA 1SHUX 3ZDYB 1AOXA 1YUKA 2VDRB 2VDOB 1U0NA 2NVOA 5BV8A 3GXBA 2I6QA 3EH1A 1MQ9A 5KYWA 3OKYB 1U0OC 1SSLA 1V7PC 3TW0A 1T6BY 5E6RB 5HDBB 2ODPA 3EOBI 2O7NA 1JV2B 4C29A 1JEQA 3BN3A 3EGXA 3TVYA 1CQPA 3ZE2B 5ES4B 3ZQKA 4F1JA 3T3PB 4K3JB 4NEHB 4JDUA 3RAGA 4DMUB 2NUPA 2QTVA 1IDOA 1XDGA 1SHYB 1BHO1 1ZOPA 1BHQ1 3ZE0B 4IXDA 1JEQB 3AL8A 3PPYA 3EGXB 1M2VA 4FWWA 1SQ0A 2I6SA 3FCUB 3OL2A 1IJBA 4WK4B 2NUPB 1DZIA 1YVRA 1MF7A 4MMYA 3AL8B 4HQLA 4C2BA 2M32A 4CN9A 5KYUA 1M2VB 1Q0PA 3TCXB 1N9ZA 3T3MB 3N2NA 1PT6A 3EG9A 3IBSA 3OL2B 2VC2B 4WK0B 3NVQA 4WFQA 1PD0A 4HQKA 1YVPA 2VDKB 1T0PA 3E2MA 1PD1A 2WW8A 3EGDA 4A0QA 4G1EA 4UM9D 3EFOA 5HGJA 3QA3E 5KYUB 5KYWB 3F78A 1MHPA 3V4PB 1ATZA 3Q3GE 1LFAA 3EG9B 1U8CA 2XWJI 3EOAI 4HQOA 1MJNA 1RRKA 1SHTX 3AL9A 3NIDB 1AO3A 3ZDXB 2NUTA 3HXOA 4Z7QB 3PPVA 3EGDB 4JX0A 4G1EB 4IHKA 3TXAA 3EFOB 1RD4A 3NIFB 3PPWA 2XGGA 3ZE1B 4UM9B 1U8CB 4HQFA 5E6UA 3K6SA 1IDN1 4O3TB 1OAKA 2NUTB 4CNBA
chains in the Genus database with same CATH superfamily
3C15C 5KW9H 4ZC8A 4YNYA 2BRUA 1LDGA 5HXAA 4KPEC 4G01B 3WTTA 3KTOA 4B6OA 3VTAA 2D0PB 4IDDA 2F1IA 2BOCB 1PLCA 2F5BH 2M6LA 1CL7L 1HF3A 4P5MA 5M7EA 3MUFA 4WZAE 2F7RA 2V33A 3TNMB 3QEHB 3BW9A 3BWXA 3TT1L 4OA5A 1OZ0A 1AACA 2Q2QA 3ZWMA 4R97B 1FBIH 4RNRB 1ORTA 2Q7AA 5I4IA 2BZSA 5FW8A 3RGGA 3LA8A 3FAXA 4G5RA 4FG0A 3GS0A 5IJ0B 2YPLE 3FYUC 3N2GB 3STVA 4K6GA 3BPCB 4IDPA 1BX2B 5HDQL 1E0JA 2FMXA 1XD8A 1KJMA 4NDMA 1LGVA 1Y5NA 1QIEA 3E4CA 4G83A 2SNIE 1ZMBA 4ZXBB 1D1PA 2CBGA 4JLKA 1SC6A 3TPZA 3CSTA 4GH7B 1G64A 1M7UA 2JCGA 3BAJA 3KSBC 2Z5LA 4URUR 4BLOA 3D4YA 3PFWO 3QZWG 3Q2LA 4MDIA 1B4TA 3VXME 3WL6A 2PX2A 3RGVA 1KUMA 1JJ7A 1XVIA 4FYQA 3TOVA 4KDEA 1GG2A 4BK5A 4MV4A 4Y4KD 2V4ZA 2XZPA 1TFRA 5GZ1A 3HI6L 3SD5A 1R5NA 1EHKB 2CLZB 4KDWA 4BCDA 2XSZA 1F58H 2QX6A 1E5LA 1VC2A 5IAOA 1TZAA 3SJ7A 1SDAB 1V3MA 3GZNB 4JQOA 1CICC 3IJEB 1KI1A 3VI4E 2B9AA 1EFVA 4TS6A 4WCFA 1A2YA 1XGTA 4YT4A 3MEQA 4FFVA 3OSZA 1T2VA 4N7MA 2CXTA 4LJ8A 1HKLH 5TQ2B 3V0JA 3W0WB 3U46A 3ADOA 1TECE 3RTQA 5E9DD 5YASA 5DGDA 5C1BA 1G5FA 1KCBA 2DQJL 5F70A 4P2QD 3TT3H 4UEKA 1ETUA 2CYBA 5F73A 3P30L 1NG1A 1RLWA 2FHFA 1M2OB 3QJGA 2FPMA 1WMDA 4Y30A 3D6HA 1DTWA 3VOTA 2XN9A 4UIKL 2NADA 5ULLA 4Y9BA 3I6QA 3QZMA 5F7NC 1LHZA 2HKIA 2IU4A 3MLTA 1GZHA 5K9QI 3MS2A 1PEDA 5FDYA 1PGNA 1DKUA 3IEMA 4V1CI 1FIGH 1ITCA 4W5JA 1RZPA 3ZHCA 4CEIB 5U9CA 3AVUA 2CV0A 5FYJU 4UQOA 5BWBA 1A4RA 4P46C 1CUEA 2QRQA 2FSUA 3FDWA 2X4TA 4IHQA 3LUHA 4X7PA 2I2CA 2G30A 4UHJA 3RSGA 1C5DA 2CVHA 4IMLB 2WLIA 6FABL 1FC1A 1Q20A 2J41A 1U3NA 2PYEA 6PAZA 3KUKA 1LP9B 4X6XA 4PCTA 3DBVO 4GM1A 3GGWA 1A3ZA 2CJWB 5JCOA 3KP1A 5BJTA 5WRFA 4XXHA 1XCLA 3KBOA 2PIDA 1HRKA 1G7LA 1YU6A 2WUBH 2C57A 4NNXB 5FO2A 4GR5A 4I1RA 1J9GA 4Y1SA 5J4HA 3PQ7A 12E8H 3FCSB 3G23A 1B8UA 2DN7A 1CD1B 5D2CA 5LGKA 3BQVA 4LP5A 2MNJB 3A23A 3CLVA 5C70A 3TPKA 4URWR 2V9QA 4WINA 5EWMB 3II2A 4XW2A 5IBTH 2GSIB 4N1HB 1TXGA 3SXPA 4IIFA 1PCXA 2IUFA 2FMHA 3HYTA 4LRNH 3KO8A 3OD5A 4DSZA 1RHJA 4RM2A 4RMIA 3A6CH 2WBJB 4M54A 1ZT7B 3EYVA 3B5GA 4XGKA 1TCAA 4P58A 4TT3A 2EXSA 4A6YB 2IK8A 4IJUA 2XKKA 4R90H 4YGYA 1IM3A 1KCRL 3V8RA 5CIYA 4AYSA 1RBMA 5LLTA 2MR6A 3KYIB 3ZHOA 4X97A 1HNGA 2VQ4A 1L3CA 5I0WA 2VISA 2EJTA 2C42A 2OYKA 3EBLA 3U5ZB 3H9SB 3CRW1 1PZEA 3QIBD 5BN3A 4UE2A 4CU5A 3GSQA 4L9LB 1FYTA 3F58L 4AKPA 2ZAMA 1NYTA 4U1JB 1OO2A 5IESL 1JYVA 3BYZA 3UAYA 3Q5YA 3C24A 4UARA 1RBQA 1C7RA 4U7JA 4QVKA 3EPHA 2UWEF 4FG6C 4N3CA 4KVCH 2C2OA 1XTLA 3QYFA 5F96L 4JH0A 5DWPA 5FF6B 3HR5A 2OO5C 4G8BA 3QR1A 1F56A 1SCUB 3MGTA 3QHTC 3LAFA 1OQAA 2IWEA 3RVMA 2YD6A 1A5FH 4LAJH 4IYRA 1TJ3A 1A9ZA 2OMWB 1QANA 1S2NA 2I7CA 3QLTA 1BA3A 3LV3B 4BX2A 4MKGA 4JZJC 4DGYL 2FLWA 3TTTA 2WWRA 3CPLB 5LFAA 4JJFA 5DVOA 2O8NA 2JGJA 4HJIA 4NZPA 2W00A 5EVCA 5AOKA 5DI8B 2PJUA 4Q9JA 1Z0SA 1TADA 2JD1A 3BAZA 2FJUA 5LZ7A 3TLAA 5CVTA 3RCBA 3DO4A 3HNVL 3BTVA 4YWJA 1EXMA 1G8AA 2J5WA 2C5LA 4LOJA 3LT1A 1WW2A 1UWLA 2ZX7A 1KDPA 2QP9X 3AC0A 1X7GA 2CUAA 4OB5H 3QEOA 3ABZA 3L3DB 5FEMA 3P9MB 2IRWA 2A5JA 2FDCA 4R51A 2XUQA 1TMYA 3G79A 2DQKA 1OTSD 3A2LA 4B45A 3VKWA 4TTIA 1E9DA 2GXUA 2XQYK 4G80B 1G5AA 3GI8H 2WUFA 3HO1A 3IK2A 6CGTA 2HFGL 4QPPA 3GHBH 2B4AA 3HKDA 1VFBB 2R96A 2VDQL 4JI2B 3TFKD 1DVFD 3SZUA 1NCNA 3SDXF 4OBWA 3KLOA 2J2ZA 4EVNA 4Z4EA 2Y1DA 1RFDL 3S0JA 5B64A 1ZWKA 3F9IA 5E8PB 4TULH 1OH8A 4H2AA 3O3AB 2W6OA 4QU0A 1M8JA 2JWGA 3Q0TA 2Q6OA 4G8IA 2Z91B 3S7GA 1F51E 1JE0A 1X0VA 2VH2A 1VJGA 4HYTB 4EOWH 3TB4A 5K3SA 4OU3A 2G3YA 4DW2L 5J57B 3I05A 3HP4A 1PKXA 4CM5A 4JDZB 3KG5A 4AYGA 1LDEA 4Y19B 1MNQA 1B0UA 1N6VA 4UBLA 3ZDDA 1MAAA 1OV8A 2D7TH 1JHKH 1O7SA 1TUEA 4OHKA 3NMUF 2V3FA 1I6WA 5ABZA 2Z1DA 3HG1E 3DMHA 4NDNE 4WEMB 4P84A 2MR5A 5C0RH 1MQAA 3N50A 4Z18A 3BT0A 1DDIA 5F0JB 3UCXA 1JDDA 2GIMA 3C6EA 4YDLC 2FBJH 3CD4A 4KKNA 3BP6A 4R7NA 3L6FB 4C4AA 4HC1H 3GLKA 3ET4A 3EZGA 5EJFA 5C2UB 3C6SB 4R96B 3IYLW 2N59A 4ZALA 3MJVA 5F7HA 4PRDA 2WQAA 1QSEA 1FLTX 3AQDA 3W77A 4FYIA 2ZJ8A 4ZQCB 4GBXD 4LGSB 1IPHA 5F35A 3ZE1F 4K3JB 1QCDA 2V9CA 5CGTA 1E6UA 3DONA 4CBVA 5AVJA 5AUOB 2LU4A 4N65A 1GDHA 2XVLA 4K23L 2Q5OA 3CF4A 4L1BA 2AQ1A 2FECI 1P6FA 4CKZA 5A5EA 3GIVA 4FFVC 1HTYA 1LDPL 1J0ZA 1GKOA 1E3FA 1OQOA 2VXSL 4XRCB 4M3JA 5C7ZA 2J1LA 2GJ6B 3FFCD 5EXEA 2V17H 1HSZA 1FNDA 3WN5C 2G5CA 1URIA 4HCRH 4ZUUA 3HSKA 4N2GA 4G56A 3QJFA 3UOAB 1SQ2N 9PCYA 4EOGA 2RCSH 2JRLA 3ZS9A 5LOVB 4CEJB 1NF8A 1QU2A 1Y5IA 1U3VA 5H37H 4M4RA 1HL8A 1FNSA 2G09A 1W9HA 4I6GA 4HV4A 3DGGA 1XZJA 2VERN 1GZHC 4ZJUA 5K4GA 5E7BA 3P4OB 2WMDA 2D0IA 1BXGB 1JG2A 2B5WA 3I23A 1QUEA 3SJZA 2XITA 1U2GC 1IBDA 3GFTA 3FK3A 1NLFA 3NT5A 5EBMB 4LAQH 3NEAA 1E5YA 2ZKLA 3QY9A 4HN2A 3C39A 3JQFA 2QTRA 2X4OA 4CC0A 2F4VB 3ESVF 4D9QE 5BS0A 2RHGB 4YLYA 1WD7A 1QHHA 1WSAA 3V4FA 3AKZA 2JLLA 1XQVA 1DFBL 2PXCA 2KC0A 1Z3GL 2GBVA 3RVBA 4CMIB 4KE7A 1E27A 1DQMH 4XA8A 3GWZA 2ALWA 1XR3A 1JE6A 2D3VA 4DY4A 4FHJA 3VG9B 1ZD8A 5IARA 4WA7A 4MW1A 4PHGA 1T26A 3ZBQA 3LGAA 5HHMD 1LB1B 3KXPA 5LNEA 1CT8A 4LF3B 1QFZA 1FZQA 2OCGA 3ET5A 5IW6A 3DZHA 1RC8A 2EEFA 3IMRA 5EC2A 3L9WA 4P7JA 4QAWA 4ER7A 3CTMA 2I3AA 3O47A 4XO4A 4E5MA 3LBAA 5BMVB 3Q8MA 3QUZD 1XEWX 4XMVA 2XV6B 3Q2WA 1OHZA 3BXNB 4X5QA 4JN6B 4UBOA 1JHAA 2Q0ZX 5ALVA 5IZCA 1HBJA 3RTEA 2YEZB 4YCCA 1F3JA 1JAHA 5L6LB 2RGGA 4ZO7A 2YWRA 3ZNOA 1AXEA 3JZMA 1T04A 2DQCH 4PZ9A 4D3CH 1R6DA 2HF7A 1QM5A 1ZBQA 3HN7A 1XDDA 2MDTA 2AF2A 4MLZA 2H26A 2D1YA 4CEHB 5I6PA 1C4KA 4JLJA 3TMAA 3QLUC 3L4BA 1CDIA 1D5XB 4HJ0C 3NGLA 5I9IA 3R0IA 4GAAA 2AJYH 4A7QA 3BE5A 5AKTA 2FE1A 4YK4B 3B3GA 4XMPH 1KCUL 3VNAA 1R1DA 1J22A 4MJIA 3AY4C 4KE8A 5FOVA 1S7UB 2G1JA 2RGDA 4I9WD 4RIIA 2BNRA 5EZIL 5EHGA 1W5SA 4GPZA 3BEVA 1Z7YA 4NBZB 4XN1A 4MV9A 5ENDA 1BE1A 3PDWA 3GQBB 3U9LA 1S9WA 1EAOA 1NN0A 3QXDB 2KZ1B 1QE5A 1MFEH 2OR3A 4TUUA 3OG9A 1T7WA 2X89D 5INDA 4BJ1A 1IKNC 2Q2WA 3PDUA 4K26A 4PRPD 3MV9E 3C5HA 5CVJA 4C7JA 5J5VA 2VNAA 3KPRD 5D2LF 2RD0A 1AKJB 1BYUA 2FUG1 3VQ2C 3N44F 3I32A 3L79A 5JFOA 5LR6A 3IR5A 3OEHA 1Y7VA 1FA4A 1O4WA 1F6BA 3JS5A 1IQDA 3E3AA 4KZPA 4MTCA 5CLXA 2W83A 3TGWA 1IAOB 5LQKA 2AIRA 1YNKL 3GHHA 1MF2H 5B39A 5B7MA 3UEZA 3PHQA 3KR0A 2YVLA 4DPKA 3IP8A 5T3ZL 4MVJI 4FNUA 3BICA 1CZKA 4LCWE 5K8IA 3TR0A 1UPXA 2G04A 2JLUA 1DBAL 5M2QA 1ST2A 4CQMA 3LKOA 1RAAA 3TRFA 3TBWA 2DMRA 1BA9A 5DHUA 1KGXA 2C9YA 5E2BA 1R17A 3CCCA 4TNEA 1TQ8A 3BORA 1ZRNA 5CBEA 3AY7A 4RK0A 4JO3L 2JLXA 1RI1A 5COAA 4L8WB 1Y4SA 2VLRB 5LBSA 4GW1A 1PPIA 3AP2A 3SDBA 4ND6A 3U4GA 4G11A 2Y2WA 5E8OA 3WKQA 5HE8A 7YASA 2BERA 5D93B 1PG0A 5GP1A 4EFNA 3UO1L 3PL6A 4MNGE 2XDQA 3TN0B 4I81A 4F45A 2GUWA 4ZNCD 4P05A 4JFFE 2R7AA 3B82A 5JOQA 2I9LA 5T3ZD 1VB5A 5LWYL 1XHLA 5LXGL 2BWDA 1I7UA 3LRKA 3THXA 5FOBB 3I9PA 3AWEA 8ATCA 5KTEL 3AF3A 3U6RA 3HHRB 4H1LA 3Q8KA 4RZ3A 1QHEA 2YC1B 4NAHA 5GY7A 4QM7A 3ARWA 1NDGB 5AW2A 4GINA 1RXLA 2IP2A 2NXZB 1MUJA 5EGSA 2HNKA 3HDJA 3LYHA 4X5OA 2AJXH 1GAWA 4JRYA 4RXTA 1BG9A 1TO5A 4G72B 4ETQB 2UZYA 4P2OB 3T3OA 4HXAH 5IR1A 4LF8B 2Y5EA 4P3YA 1DDHB 1FG2B 2WT8A 4F7EB 3D69A 4F33B 1EG7A 3CMMA 4R4BB 4FXKB 5FHBH 2J20A 4IOFD 5J58A 3MACL 5C07E 4NF2A 3TJRA 3GKZA 1PX8A 3DHWC 4ZYUA 1F7VA 3NU1A 4KRLB 2E7BA 2RFXB 1JHMA 3QG6A 3PLNA 1NUNB 2DWEB 4RTMA 1YCDA 5GRYA 4Y1EA 1GHTA 1IGCL 5DEFA 4E5DA 2LVEA 1DARA 2FDXA 4TMFA 3RBZA 3T1NA 3FQNA 1S8DB 2SKCA 1A97A 1AKMA 3NHKA 1E61A 3K92A 3R77A 3VR4A 4O5LH 4KFZC 4LFBB 4TSAH 3WLRA 4F1SA 3K05A 3FYTA 4BYHA 5M3BA 1DBJL 2JIXD 5IB1B 3VDCA 3AL2A 3U44B 3VGAB 5LBUA 4I2VA 1F41A 4JR9L 5JHMA 2GSWA 4RHFA 1U5AA 4DIUA 1QFWH 1PCSA 5DNWA 4BRZA 5BUQA 4YCNA 5EMMA 5TE6H 4JYZA 3P2IA 1VIMA 4R9RA 3DOJA 1YR6A 2J9FA 3HK2A 1BWRA 3FTEA 2A6PA 2Z1NA 1MEEA 4AJLA 4LDAA 5AVVB 1IQRA 5A03A 1VCHA 2R2BA 2W91A 1V3QE 3U4EB 5HYVA 3BGAA 4FYTA 4WTQA 4LFCB 3TH4T 1NUTA 4L29B 5E95B 1NVBA 4IRSD 3MMZA 1NEZB 3KYCA 4HEMA 3IDMB 2BSSB 4HZLB 4BO7A 3PWZA 4DGUA 3VRIB 2G70A 2A5DA 3SHQA 3P0JA 3BP5B 3CVHH 2IVZA 5CXPA 2AN5A 3TTVA 4LSVL 1P84K 1SB9A 3BWZA 2BFDB 4TQAA 5ALMA 4ZO4A 4HAVA 3S4YA 2BBTA 4R5XA 3LHDA 2R0QC 4KR3A 4OAWB 4HLEA 1A8PA 2RGBA 1GAJA 5CJ2A 3WD5H 5GISL 4M48L 3L6EA 1Z28A 5FHRA 2CCLA 5IZCC 4N5UA 3R06A 2WLNA 2QSUA 4Y4KA 2IANB 2JNWA 1KCVH 4H2CA 3HTXA 5G0WA 2CE2X 3GUFA 4MDRA 1O5TA 4TL7A 2XB6A 5B1JC 1BZ7B 4HETA 4J4HA 2DW5A 5CD1A 5HDQA 5A5FA 3NFPB 4QZVA 1TNMA 3NMEA 1WGOA 1IBRA 1R8JA 2WYIA 3FCEA 2OMXB 3PI7A 1MRNA 5TE7L 1LRJA 2ZU6A 2EL9A 1N59A 2DY2A 1LLCA 2R8YA 3BXZA 2ZR0A 3AMVA 4N5ED 1T3ZA 1LU9A 2EDOA 2JHCA 2HIGA 1CZOA 1QNIA 5A02A 3Q9SA 2A77L 5D8JL 2ICWI 4AQZA 1MIML 2ZYRA 1HWGB 4X4XB 5DE3A 1BOGB 2DBYA 4YSCA 1FBNA 5M5BA 1E62A 2QQNL 5SX4H 1YB6A 9MHTA 5E8RA 4MV0A 4JM4L 5I6DA 4C88A 4UJ3A 5E9DA 1JJVA 1O96B 2PY6A 1E7SA 1I7LA 1HSBB 1H1TA 1HTWA 3TWOA 1VEOA 4KFUA 4RJ2A 4FQPA 4C4BA 1NASA 3RTDA 3HI6A 4UQAA 1FH5L 4ZG1A 1W8IA 1F90H 2XUIA 3WY9A 2HFTA 5LXTF 1F4XH 3OP4A 5IM7B 3UJTH 4ZJ9A 3C3AA 5AHOA 3IRVA 4REQB 3BCUA 3ACCA 1AGCB 3SQBB 1CE6A 1P5VA 2Y7SA 3EVBA 3B13B 1ADYA 4GIBA 1BS9A 4PONA 4AT6B 2UYCA 3D07A 2H7VA 3SKJL 4YREA 3TRIA 1ZIDA 1R3LB 2HXAA 1PZNA 3GJ8A 1A7NL 3FHQA 1P1JA 1GAFH 3BKCH 3UN1A 3OIDA 4EUEA 4D82A 3CJQA 5EL0A 3RUEA 1QPZA 1DLIA 4HDQB 1UMCB 4C2BA 4IJKA 4UINL 4Z9XA 5ERXA 4S04A 1SKAA 5LIRA 1W9XA 3Q5TA 2VR4A 4I66A 3BWEA 2H9YA 1YYCA 4FFBB 4PCSA 3LTNC 1OOWA 1U8IB 4C56B 4FCWA 4X1YA 3UTSD 2ZRIA 2OSYA 2EDFA 3VI3F 4Y18A 2VNCA 3AQXA 3ZWNA 1XA3A 1P4LB 3H53A 3QQXA 4XCVA 3ZDBA 4HRAA 1J1OL 4FE9A 2IXBA 2D5IA 5DHDA 5C0CB 3D3VE 3O6FD 4JFSA 5IN4A 2OYRA 5C8VA 2ZYHA 1K6EA 2FPIB 2QYSA 5FYKD 4DH2A 4A7GA 3QUAA 4GFDA 1W7AA 4RGYA 1V9CA 2P47B 2Q6IA 4YJDA 4R84A 2G76A 2PW2B 3PL6C 1GGHA 4MV7A 1UIRA 4AJ1A 5DJ6B 2R23B 2D2IA 1FNGB 1XZGA 2BNUB 2J3DA 4BAGA 2EDLA 2ZUXA 3O75A 1Z4PX 1T36A 4QDUA 1QABA 4LYJA 3UWSA 4B75A 2F68X 1R3UA 2BVPA 3S34H 2Q6WB 2JGDA 2G60H 4QSHA 1AOXA 1FPTL 3CFKA 1JAZA 3RB5A 3QIBA 4MI1A 4WO0A 4PRIB 5C51B 4I2XE 5E5LA 3BD3A 1YV9A 5MFZA 2PD3A 4OIFA 3KQYA 3F84A 3QU5A 1GY8A 2WT4A 4KH9A 1S7VA 4LV6A 3MCLH 3IBCA 1YKFA 3WHPA 3QSGA 3EFBA 4G6FD 4QEGA 1KK1A 4JM2B 3G0BA 5EORL 2C7OA 4OGZA 1T0OA 5DC2A 1ZLSH 5C0EA 1DUIA 1XU4A 4OZHF 4JFYA 2EYRB 4F37K 4NCC2 3QVUA 1DUYA 4I5DA 4B8YA 1Z13A 1G3RA 2IQ5A 4C7KA 4WGGA 3QEGH 2HNAA 4N82A 3NRCA 2ZXQA 3EE6A 4TUOA 4KFSA 5LO7A 4LCIH 1I2CA 7PAZA 4TUJB 3GM8A 4IDGA 1AH2A 1VE5A 3ENEA 7FABH 2R1YA 3SHTA 3GMOB 3SJCA 2QTLA 2Z6FA 5DV9A 3KDPA 3ALPA 1GOHA 1A7OL 3REOA 3FQTA 3GJRA 1V35A 2I27N 4PS3A 2W93A 5JSUA 4NKIL 1OC2A 4D4HA 1UEXC 1FK8A 4C7BA 5B58T 3Q87B 2Z65C 3A22A 3OZWA 3EJ6A 2WK2A 1J87A 1RTKA 3QJSB 1CQYA 3OB0K 1XNQB 4JFQA 5LA6F 4HIXH 4DEPB 2OZLB 1JJUA 1BAFL 2I6TA 1EWTA 1B2WL 4FFOA 4BBZA 3WO1A 1MXHA 3RWIA 4RE5A 4XP4L 4BWUA 2PWGA 3L7MA 3S7ZA 1G6Q1 1MFNA 3NP7A 3ZO9A 2ILVA 3QGMA 1GC1H 1KNOA 3OHXB 4LLMB 4DTGH 5K59F 1WC7B 1EAJA 2M1ZA 4C22A 5KBNC 3TIGA 1DVFA 1Y4UA 3PRZA 5JAQA 3ZI4A 2YS6A 3ARVA 3P2TA 2AUTA 1L7TH 3TKAA 1OM3H 4AG4H 4PC2A 3IFOB 2ED8A 1W30A 4ZPTB 3I1JA 3UZQA 1BGVA 3S48A 1JFVA 2DRIA 1HHGB 4FBGA 1N9ZA 4OZIF 2GJRA 3O4GA 4IOKA 1NUAA 2GKSA 3WLKX 1IM2A 4HIPA 2GBAA 4D9RD 2VEOA 2X0EA 3VR5A 5I71B 2GBUA 2R1XA 1R0LA 4X4ME 1SJ9A 4JUCA 8MHTA 2DS4A 1T0BA 1XQYA 5FWQA 3MJFA 1I8IB 5JNVA 4MUXA 1HK7A 3KKZA 1RQ5A 4K71B 4R69A 3ZGYA 2NSJA 4IS6A 4OZGF 4Y0GA 1TQBC 1E79D 3ALXA 4CETA 4YAOA 4Y4KC 4YQZA 1F8TL 4KAQL 1WUNT 1N3YA 1XZEA 2XMBA 4R3UC 1DN2A 3JQEA 2GFHA 4JCLA 5F9WC 1IBGL 2RI1A 4BQ6A 1OB5A 1G20A 4J7XA 4QEZA 2PT7A 1C7IA 4GBXA 1BKYA 6NULA 2EFCB 1G9EA 3UT0A 1W1UA 3VU9A 4KQ0A 3QXAB 1VZ3A 1F0KA 3U0PA 2LABA 1X7WB 3JVUA 2UY6B 3TGXA 4EF6A 3M5DA 5FLXA 1ZFNA 3GNQA 2A99A 3M4NA 4QHNB 5KSAA 4ENVA 1WOMA 5I1CH 3X13B 2ADIB 4C20A 1NFDE 1SIBE 2XHZA 1JDNA 2Y4NA 1MW3A 2HFJA 4IO1A 4MR9B 4DERA 1VA4A 5G0VA 4WW2F 1EVYA 5EIAA 3FFCA 2ZJ1A 4A8JC 2WYHA 2VYVD 4QDZA 4WKZA 2V9PA 2EVIA 5LZ2A 1EJOH 2W0SA 3A1CA 2P1DA 4QRQB 2HYMA 4JOBA 4IXWA 1OBVA 5ICUA 3AJ7A 3LPOA 1T03H 4XXCC 4I1SA 4YBLC 3SXUB 1FLVA 4QWWC 1MCPH 5K3FA 3LRSB 3JCZA 5D1XD 2VSQA 2R6FA 2HEGA 4EEEA 3AM1A 4TN1A 2ZIFA 5ISZD 4BJ6A 2WYTA 4LOKA 1F60A 3VISA 3M9WA 4Y1AE 4Z7NB 4OVVA 1O0VA 3EPPA 5BOPA 1R00A 3DBRA 4XVTH 3IUBA 4EY5A 1RHHA 3V5HB 1XRRA 5B3AA 1PZBA 3D0VA 3QWOB 4WCDA 1TZ8A 3MCAA 3LPMA 5LM3A 4G9FB 1VF5C 1XVVA 2CLCX 1I4OA 3RJ5A 2EECA 4NBKA 4KQXA 2YRBA 1SOUA 3N1QC 5CBAB 1D5ZB 1F0PA 4GMHA 5MHTA 2WD7B 2R8SH 1M1NB 2KYIA 1CVSC 1JWSB 5HI4C 1VMAA 4R2HA 4X6EA 3ZDYB 4MWFB 3IGAA 2ADGB 2P5ED 3KQTA 3N75A 2I67A 1E9VA 1XJCA 3JVGA 1N57A 1J5OH 3OJDB 1MABA 1JGUL 2OXEA 4RZKA 3W2DH 2GVZC 3VPXA 3QUZA 4WTOA 5LL6P 1AHNA 2IPKA 3ZV6A 3W9EB 3RSHA 1GGBL 2ZDQA 5JUEH 2EEZA 3VO9A 3T5AA 3DSFH 1MF7A 1BQHB 1TCRA 3S37L 3LPCA 3NDPA 4KR7A 4ELKA 1OR8A 2BMAA 4RH1A 4MULA 4ZUWA 5HNKA 3IP5A 3BUBA 1M72A 4MRCA 2BONA 1XCJA 1TITA 2DEUA 4MVJP 3N6RA 1NRJB 4V2IA 5L40A 2ZJ4A 4IWYA 5ALBL 5ENWB 3CVIL 4RPJA 3ESBA 1M7BA 5IB5A 3QIBC 2IWKA 5K8TA 1SDDA 4J23A 2DPLA 4NPCA 3FVWA 5TIIA 3R44A 4PTUA 3HRHA 4ARCA 3SDYL 3LUFA 3LLVA 4MLCA 3NPAA 1E4OA 3ZWAA 2E7LA 3OFND 4LOFA 1Q72H 3HJGA 1HYGA 1GYAA 4P2RE 3OUZA 1I3GL 4HCFA 4JG9A 1N2SA 4M1WA 4B17A 3BZEB 3JQRA 2F8IA 2CCWA 2P7TB 5CILL 5TGDA 4PJ5D 5K1VA 2P49B 1JHLH 4QRRD 3NG1A 2DCMA 1XZQA 1W85B 3HE7B 4EUNA 1J8FA 4NENB 5EF1A 4YUEL 2RDMA 1XMOB 3JQAA 3ABKB 3IDYB 2WSMA 4EMTA 4XR9A 1CICD 2UZIL 2X89A 1GV1A 2GHTA 2OL4A 3X14B 3BKWA 1Q90A 1II0A 3PCTA 5I0YA 2F7IA 2A1UB 3K46A 1KAGA 4PRPA 3HXLA 4PGBA 3QXGA 1PVDA 4HWBL 3KPRA 1KYDA 3ESZA 4P4RB 4UIMB 2G0KA 3EDFA 2DPYA 3BRSA 5IIEA 1DS6A 5KCZA 3CHSA 1ZGAA 5KAPA 1MLCA 3P45A 3KPSB 5DLQC 3QDMD 2PKYX 1J5XA 1FC0A 3WP1B 2O5VA 2AOVA 2J3MA 5ETJA 2AV1B 3NWOA 3RHZA 1J8MF 5JNUA 2NV2B 5GGSY 1EESA 1YEHL 2KUTA 4XGNA 3GMNB 2WSIA 2F74A 1YJ8A 5D7IA 2O2IA 2VQ1B 4PJIE 3L0ZA 1QE3A 5AR1A 1CD8A 2QJTA 4ZXFA 5B3NA 3K2UH 1J05A 3KEGA 1JZSA 5H37G 1OFGA 4LSPH 3E03A 1YDPB 2FEAA 5I1HL 4LN1A 3UZVB 4NDAA 2XUKA 3OWXA 1EAQA 1HVXA 1ORSA 4P46D 1TYDE 1U2DA 3K8QA 1QTRA 2VYRE 4F8OA 3KPMA 1MB9A 1HNNA 1MC8A 1U7WA 5JNWA 1TUGA 1AQHA 1SLWA 4LLVB 2Z04A 5EUOF 1XH3B 4XRRA 5FWXA 3CDZB 4I2NA 1IGYA 3R3YA 2XYPA 3TX2A 5KYWA 1FNLA 4OSEA 2LU5A 2GEJA 1FN4A 1OT3A 4KFMA 3OTQA 2V0GA 4Y6RA 3QMPA 2W4MA 4G82A 5JZMA 1ZU4A 1RAFA 1THGA 2GAJA 4QRUA 2HUPA 2NX5E 1M7DB 1ULVA 2CALA 3AEUB 1XE3A 4ER6A 1IX2A 4PBWD 2XODA 3FT9A 4ETYA 2GFQA 4B3SB 1SVUA 4N18A 1TZIB 3HRIA 4BRWA 3KOUA 4C7MA 5DZSA 3PXEA 2PWDA 4Q0XL 1YMMB 1HETA 1RHUA 4ZI7B 2JIOA 3IPRA 5EI5A 5DHAA 4QJ4A 5EXSA 2HPVA 1RC1A 3KSMA 4C6TB 2IOMA 1RLIA 1CP2A 3VI3A 1RP9A 5CIQA 721PA 3P02A 4S2EA 4KI5E 5LBVA 2QAGC 2GYVA 1N92A 1DEEA 2FPOA 4BHTA 5KSAC 1WETA 5TMPA 4FN4A 5JO9A 1GRWA 1RBZA 5BV7B 1CTNA 1PX3A 5EHQA 5I73C 1RQ2A 4DAEA 2DD8L 2HWXA 1E4YA 2YWZA 2IDCA 4NC1E 4YV1A 1Y8QB 4LRIC 4EGAA 1EZSA 3UPDA 1KZ6A 4TQUS 5D70L 1HT1E 1P2FA 2CNNA 1ES0A 1XGPA 2VTEA 2W37A 2X4QB 2ZE6A 4YQXL 4MHHI 3NSDA 4FG6D 2DHEA 3WYNA 2JFUA 5KBYA 1JZ8A 1AIPA 3ZVKA 2O3TA 3WJ2A 4PG5A 1UC4B 2AEWA 2CLRB 5CH5A 2QPDB 1U0OC 1I1RA 2PWBA 4ZTOH 2NMSA 2JIXA 2H0EA 1DVTA 1S8NA 1PVVA 4FFZH 2IEDA 4F3RA 5FHAL 2W8BA 3WFDH 2RIPA 2H00A 1X87A 3QCTH 2JAPA 5INCA 2GAAA 3DX1A 1YL7A 4Z7WA 3UFXA 3NJLA 2G5PA 1M1YB 3M6XA 4RMBA 3C8MA 5ILGA 2VC2B 2ZRJA 1XZMA 4FI8A 1FTSA 3FTNA 1U65A 1ZLVK 4WWOA 3D81A 3EFOA 4YX2H 2ZAYA 3L08A 1HJCA 3X1GA 2ZXFA 3A4LA 4U2YA 3FPEA 4M1EA 1EX9A 2FR4B 2JATA 4IRSA 4MJ6A 3PP3K 3PA6A 2IOFK 3ZQUA 4FP9A 1ZJ4A 1KIQA 2HCRA 2FN8A 1MI5E 3GWGA 5BORA 5A4JA 2RHLA 1PZDA 4MNQE 2FJ0A 2CLVA 4GPVA 2CAKA 4FQ2L 4ZZKA 4JFTA 1QTSA 1C8PA 2X6QA 4JASB 4CVZB 5FBLB 3WRYC 421PA 5IP4A 1A7RH 3P77A 1RIHL 3IQIX 3W2FA 3RQSA 2CHNA 1QC5A 3BKXA 5LA6A 2CH8A 2WLJA 2EH8H 4Z8FL 5FYJL 2YD0A 3BKJH 3OKNA 1ZXQA 3EUEA 4TXNA 2JCCF 3CEMA 1UBKS 1AQ6A 1KXZA 1QYWA 4XDGA 1AE1A 2B4TO 5TDHA 4CC4A 4L4RA 3MZGB 3RS9A 4F11A 4N0QA 3R1GL 5EO1B 5EIQA 1T2QH 2J6WA 3NSYA 2O05A 3TG2A 3IDXL 4ACBA 4MAUH 2Q5EA 1WBYB 3WJLA 2PSJA 1KR5A 2I6SA 2V2TA 3IUJA 2PABA 4H1VA 5A71A 5DOZA 3G5XB 5IV2A 4LHYA 1JGDB 3V2AR 2Z8VC 4QXPA 4OZIA 3VPFA 1FPMA 3ANLA 5F9JB 1KF0A 4R9HA 4CDGA 4PYJA 5FYJD 4YS6A 1ZANH 4F27A 2QRPA 3MV8B 2G06A 2OG2A 2WD9A 2E6QA 3A27A 1NX9A 1A4JB 1GTVA 3SHVA 4OVKA 2XZTA 4JYCA 1XP5A 3SOTA 1R0ZA 4WY8A 4ECEA 5A5GA 3NYWA 3W11C 1HKHA 4OZGA 2VWQA 4RKWA 2J6EH 2X6VA 3A6PC 4LHZA 5I5RA 3MWJA 2VM4A 5C52B 3N86A 3C5JB 1QQBA 1PLBA 3ESAA 1G5QA 4GUAA 2SEBA 1Z73A 2IHZA 2BPOA 3GNTA 5KAQF 1Q7CA 1KENL 3DJTA 2MKWA 3NUGA 5F97E 5I76A 3FR7A 3QZWA 2HFFA 2GITA 4C58B 4ABTA 2X2EA 1BD2D 4PYQA 1RCUA 1I8LA 1U6IA 2XN9D 2YKGA 1C12B 4JN1H 3KLBA 1OGJA 4CF6A 4HT1L 4OJNA 1UF9A 1YB1A 2OK0L 4D99A 1R0XA 1MHPL 2VTBB 2P11A 5C09D 2YASA 5F3BA 3B2XA 1UWCA 2FP3A 2JW5A 1W35A 5E2UH 3L0DA 3RX5A 1EEZA 2NG1A 1LW7A 1WEKA 3QFJB 5E4TA 5H9WA 5T1MB 1SD2A 4TQPA 4KPYA 5DJAA 2XXAA 3H17A 2Q7NA 3JQ6A 4U9UA 3AXLA 3ULUE 3CBGA 2YYAA 4KDFA 2WB2A 1BJMA 2LU7A 2VMCA 3U31A 3O3EA 1CFSA 3O6FA 2QN9A 2RHCA 1ML0A 1T9GS 1UJ4A 1OXYA 4MS8C 4XO3A 5BRAA 2PYED 3FA2A 5J9PA 3CX8A 3HBLA 2EQAA 1UDBA 5EH1A 1KTKE 2WAHA 2J6IA 3EXHC 4JRWA 4KBPA 5ITFB 4ZRGA 3UWMA 3NTVA 2GJ4A 4QQFA 1KJVA 1JUFA 4IQ0A 4Y2VA 1RQNA 1DVXA 4LX0A 1JMYA 2O2GA 1TUBA 5JXGA 2JWHA 4HEHA 5CJBA 3RWDB 2D3NA 4HCJA 3MN1A 2IALA 4JDVB 1K3TA 3LKQA 3GSNL 4RVFA 4DB4A 2VJXA 4Z99A 4WJKB 1DBIA 4XB7A 3K4QA 1R10A 3VFNA 3W4JA 4DN4H 4TVOA 1A6WH 5EEGA 2YHSA 3PAZA 3PDDA 1LSSA 4X8HA 3MQ4A 1BD4A 3OZRA 1Z9NA 2WIMA 1MCZA 4LYAA 3HWX1 5BQPA 3WY1A 4D98A 1AQDB 2N9UA 2J0UA 4MYTA 3EDCA 3RFUA 4KQIA 2QTTA 1HMYA 1KEVA 5HRCA 4GPIB 3VYWA 2BO0A 2WWNA 2NZVG 5KWYC 1OF2B 1RPKA 4JLSA 5CN1A 1FBIL 3IU3B 1BZ9A 1X8LA 3RTAA 4IKNA 2ZFUA 3STYA 4HJ0D 4I3SL 3UABA 2CVFA 3SWWA 3AZUA 2HVJA 4XCYA 1W0JD 5J6GB 1IOVA 5EZJB 5AW7A 1DBPA 1JDSA 1PIFA 4XSHA 1GPJA 1IZ0A 4AY6A 4H1WA 4E41B 2KHAA 3TJPA 5I4KA 3TBSB 1IB5A 2I7DA 1D07A 1KYVA 4RV4A 1PFYA 2ZKXA 1VCIA 4QARA 2WWHA 3HN8A 2QA5A 3AB0C 1BBJB 1KLFB 2NY7H 3NRBA 1Z12A 3WLOA 3IM1A 5LJYH 2Q21A 4GQAA 1SUHA 4LDZA 5K39A 5EXPA 1UP6A 3OC0A 3BCSA 4OBBA 1GQOA 5DM2A 2DF8A 3PGMA 4P80A 3NVKI 2P3QA 3O8LA 3WLSA 1BFKA 2YWDA 4EZMA 1PKQE 1G21E 2Z3FA 3AEYA 3MJ9L 1F8XA 1SBHA 3QPWA 1JWUB 2IXDA 2ECKA 3JD1A 3HKFA 4ZO8A 1VESA 2FN7A 3TX4A 3IKCB 5LQRA 1JEDA 2PD4A 1GYPA 2XUFA 1K8QA 3GMTA 1F58L 3SM9A 1MFAL 5I0DA 2CUZA 1HEUA 4GAYB 3NZ8A 2FQQA 3B7TA 2EINB 3SIWA 1KY7A 1Y6NR 3CSFA 3K9CA 1QLEL 2BN4A 2UZ3A 1OJ7A 2JGEA 4C4PA 3P0IA 1L4NA 5DMXA 5FBQB 4UMEA 4X6DB 1SK8A 1PZUB 3ZZTA 3N85L 3T54A 4UTPA 2O8FA 4MGYR 2IJ0C 2BFOA 4RZSA 5CMLA 3B8SA 4D5EA 2QRUA 4KGXA 3TT3L 1C5KA 5CUSL 2HX7A 4FKZA 3KRTA 1MIOA 1E5ZA 3G2OA 4BASA 1EO7A 1T15A 2JJSC 2R2EA 3REFA 3ZU4A 3AOEC 1A7UA 5C7IO 5JH7F 2CVQA 2V7VA 2ADFL 3C2QA 3NABH 1X7YB 5T5FH 1YKSA 1RZJH 5J1SC 1E79A 5DTFA 1JFRA 4BB0A 4TS3A 5LWQA 2QZ9A 1UD5A 3NAAL 3OQBA 4NI5A 4BRSA 1F3RB 3ZX4A 2YZGA 2JB5L 2HPHA 2ZIWB 4PRKA 3ZMNA 4YMUA 2DMCA 1FDTA 1VJ5A 1VJRA 4QRPE 1AKTA 4OSOA 3T94A 3T4UA 3F7QA 5ADHA 4JBWA 4J0QA 3UK1A 2BCKB 4XO9A 3WRWA 3ULUH 2NDFA 4KGZA 2AJLI 2GCGA 3PC7A 4TSKA 3ZE2E 2UUBB 5IB2B 4J43A 2VA9A 4CM9A 4U6YA 2XA3A 5EHFA 3NGXA 2ROQA 4EI7A 1BMGA 3MA7B 1HXKA 4A0FA 5EUOA 1F1JA 4BZZA 2VYVA 4B3RB 4XR8C 2VO1A 2MH4A 1TTCA 1V39A 1X8KA 2Y1YA 2WUBL 2DBVO 2W6NA 3RUAA 4WGWB 1EP9A 2P5UA 4KAAA 3GFUA 2OSLB 3GJYA 3PWVA 2WGNB 4R68A 4G41A 1GNSA 4F3YA 5D1XA 1QYCA 3ORFA 1XDWA 5GJTL 3VMMA 4FTWA 2B3IA 5IBTL 4TZKA 3CFEB 3D51A 2CXNA 5ISZA 2JI7A 4W99A 3LP8A 2R6DA 1ZCZA 2ARJB 5DUBA 3NWBA 4LRNL 4AXWA 1I1YB 2VF7A 1RXEA 3T8XA 4BFXA 2IAMB 2HWKA 2Z5FA 5EF3A 3E23A 3LBIA 4R90L 4AYWA 4D8UA 3D4GA 4O4YH 4L2LA 2OHJA 3SN6A 3WDJA 1ZTMA 1OLUA 1E1CA 4NBTA 1XDUA 1OCEA 2JLAA 3GRAA 1NVVR 1Q7EA 4I5BA 3H5TA 5I16B 3MU3A 4M1TA 4KKQA 3GPBA 1H5BC 5K33A 1N6QH 4I19A 1NBME 1IFHH 1KKMA 2O93L 1Y1LA 1BFVH 4Q8BA 1NUUA 4NEGA 3YASA 1HNWB 1ZLXA 4MV8A 2P5EA 5A3IC 3DDWA 4RLQA 1DHKA 3T15A 4FBLA 2LLNA 4JY6B 3Q6IA 5CW2A 4OUKX 1Q9WB 3I04M 5AKZA 4KVCL 1KDZA 2FAUA 3CFCH 4LVHC 2WWGA 2ZDGA 5AYQA 1UXMA 2WDPA 5K03A 4B9JA 2VW7A 3BSGA 2YQGA 4C5AA 3QIVA 3FYUA 5GGSB 5L0QC 4I3RH 1A5FL 3LDBB 4K0RA 3D4IA 1ACLA 3K6JA 1RQRA 5PGMA 5IG7A 1YBHA 4YHBA 3RZWA 4OXNA 4H1TA 3B1KA 5LB4A 4D41A 3VR6D 2NY3B 3OT5A 5HQ3B 3QEMA 2FB9A 3F65A 2YPLD 4GX2A 2DECA 2R6JA 3GRWL 3VDXA 5L51A 3DPUA 4TQEL 4PQXA 1RK1B 4EHAA 2A5FA 3FY4A 1MFCH 1P62B 1ZLWH 2FCAA 2HMSA 3JWPA 4GSUA 4X6CB 5KIAA 3KNBA 1NY5A 4NOKA 1K4CB 2RGYA 2VDLL 5TE9A 4ZDIA 4L0PB 3IDJB 5J1AA 4WI4A 3OFNA 2GCYB 3PIQA 2CZQA 2WUWE 1NEUA 4M87A 4G4IA 3IDQA 4FXTA 2LLGA 2JJUA 4G81A 5EVJA 4CF4A 1F2TA 1XTKA 3VXMD 3GZKA 3GHBL 4PJ5A 4JFRA 5MERA 2VXQH 1JW9B 3SJAA 3LPLA 1H3WM 5CMAA 2R8OA 4QRRA 2C8NA 3KSDO 4QOKE 5C0OE 5CDTA 1QCYA 1N2RB 1C1XA 3WTCA 4Y6GB 2BWIA 5JADA 4IKEA 4K9OA 4R2MA 5JS7A 2XUHA 2P24A 2EC9U 3LS2A 2YR3A 2ZZUT 1CICA 3IE2A 4L95C 4A04A 4R9SA 1A50B 4MJID 1E8DA 3KHTA 3BDXA 4OAQA 1GG8A 4L4TB 4EGCB 5IHZA 4N1AA 4LSGA 1ESDA 2Y1FA 5EE5B 5JYMA 1QV9A 2D7TL 1JHKL 3FQWB 4YGVB 1G5HA 5IEKA 3QJHB 1ZSVA 3QDMA 5A40E 3S98A 4X6UA 3QR2A 5C0RL 4P48A 4N5IX 3U7GA 3AB3A 2JG3A 3QIWB 4J6EA 2QFPA 4WRLA 2HF9A 2LE0A 3CNBA 3L4TA 3B9EA 3FYEB 1ZA3A 2IF7A 3ZZ1A 3JV0A 2GETA 3KKEA 4QFDA 2M6RA 3JPYA 3SE8H 4Z1PA 5HHQA 1KRHA 3EVCA 1XKLA 3HXOA 4RY9A 2EDMA 3BPNB 3VHXA 5CDUA 4D97A 2WQVA 2WUEA 1EO5A 4HWBA 3OEHD 4P46A 4HLQB 3M4YA 4HAOA 2NYZA 4AZ8A 4NZ9A 3ER8A 2H16A 4JVPA 4Q6KA 1H2XA 1IBCA 1GY2A 1YTLA 4PLYA 3PZRA 3GXPA 1NXXA 4Q93A 5ERWB 5KDLA 3KYMA 1BGXH 2C5HA 4EHIA 2NSQA 1TZ2A 4AM0Q 2O1SA 3IV9A 2V17L 5I1AB 1BZDA 1WU7A 4G4SP 2DQZA 3HEIB 4OKNA 5I75B 4URZR 1E6OH 1RWNA 2JH8A 3S1AB 3JX9A 2RCSL 1VA9A 4PY8J 2R7EA 3V0IA 4XUCA 1YEEH 1DTUA 2H32H 5MEQB 1XUOA 2JB6B 3TBTB 2XJKA 2BEKA 5T5NG 1BEYH 4XASA 4MA1B 2ED9A 1KBPA 4P0DA 1N4XH 5IMKB 4KJPC 1E28A 3MFFA 3AACA 4MQMA 2YPKA 2PF6A 1T9KA 1P7ZA 3LU1A 4JKMA 1DKMA 4MBRA 4ADGA 4HYQA 4I9XA 4RHEA 5FV1L 1F9AA 3GB7B 3H4MA 4QGGA 5DVLA 3PXDA 1C9MA 5B37A 1PS8A 1RQPA 4MD4B 3RUCA 1SVWA 4GS5A 2EFDB 2NTEA 2YRFA 2PGAA 2PNJA 1B4RA 5AVXB 4XH9B 2ZWKA 1DQML 4Y2XA 3IXQA 1A66A 2O0JA 3QS2A 5F1NA 3V8NA 4EI5C 1MTZA 4KI5C 4RUKA 2O9JA 1A9RA 3GMRB 1YNTB 5SYMA 3CVDA 3SO5A 4GP4B 2JCSA 1TD9A 4HHGA 3ICCA 4YE4L 1N7JA 3KLNA 1MC1A 4XMTA 2GKGA 3DX8B 4NC1C 2GF2A 5DJ0A 1QR6A 5H1YA 1KCWA 4P3CH 2NX2A 2OO5A 3I6LE 4N47A 2AHOA 3CZJA 3V0DA 1BRMA 1H4VB 5D1QA 3ASOB 3LIIA 2P8PB 3L9XA 3MTDA 3QX9A 4QOIA 3H5RA 5D87A 4JO4H 1AHKA 2O4UX 4U1MA 4JZJA 2FG5A 3QF4B 4XKJA 4IXNA 2V6GA 3K9BA 1LA2A 4Q56A 3VJMA 2DQCL 4D3CL 4S12A 2BGRA 3GBLA 3L0PA 5EJIA 4AZUA 1YR3A 3GEFA 3IB3A 4WI2A 1USKA 3DOEA 2E37A 1QGAA 3VG0H 1TUIA 5JDSA 2C5DC 5JPNB 3OKOA 4Q4AA 1Z18A 1F86A 4L6CA 5GM2A 4YRKA 3VR4D 4BP9A 3URKA 5FTJA 1H69A 2VOEA 1EDQA 2AJYL 3BGMA 1I4WA 2VDOH 4APXA 4CLRA 4KNQA 3L5JA 1S9YA 4XMPL 1DAPA 4KTGA 3R3VA 4F5CA 5TC4A 1QJCA 3RIGA 5IMOB 3SDAB 4M0MA 1L0PA 3RG1C 4OBRA 4ODHH 1VI5A 3B51X 4HS9A 3QU7A 1F3DH 1NL0H 1QO7A 3OPMA 2OZPA 5K2MA 4R7DB 1MFEL 2X12A 4URTB 3B2PA 3SY0A 5T3YA 2Z34A 4HK3N 4NBVA 2XDWA 4J3TA 5FYQA 5C0GA 4U2CA 1J20A 4WI1A 1GY1A 1E6LA 1WA1X 5CLIA 1ZOXA 3SJBA 1WPCA 1PJQA 3VFPB 2E6UX 1RJDA 3VI4F 3DLBA 2ZCJA 1QWSA 3KJ4C 4BMZA 1IWBB 1RKQA 2YN2A 4IU2B 3RFRA 2EKSA 3DRTA 4CG0A 3IQZA 3WBBA 2Q27A 2FMFA 2WZ5A 1HGXA 3QORC 5G2OA 4JP3A 2ZTVA 2JIMA 2IH1B 5AJUA 2EIJB 5DRTA 5HHXL 1G7JA 1PBTA 3OLEA 5DRYA 5IQMA 3PNMA 1MF2L 5KB3A 2NQCA 2DIJA 2MIIA 2A3NA 3RBVA 3T3PB 2WHPA 1HOCB 1XRNA 2ZI5A 1EZZA 2IUSA 1SBCA 2VNSA 4D9CA 1AV6A 3PZBA 4LA4A 1PQPA 2BM3A 4CMHC 1ZT4B 3E8MA 4FHEA 3CRQA 3RKDC 2Q3JA 3O8CA 3KDMA 3GUYA 2ZS7A 3FCYA 4YUVA 1L8XA 1ET5A 4IM8A 1TKAA 3TZQA 3SEAA 1ZHHA 4U9IS 5A3JA 2RGCA 1UT8A 3U4MA 4WXRA 5JH7A 5EZPA 1MEXL 1REQA 5JSYA 3A3NA 4PLNC 1ZUD1 2PP9A 2ZIDA 1UASA 2IS6A 2J67A 3UJNA 1NI4A 2NZ9C 1P91A 5MDHA 1GGCH 3LDFA 5JRJA 1CVIA 2WTRA 5IQNA 4JUBA 3WN5A 3BERA 3VVWA 2CSXA 4P0QB 3TBVA 1NUDA 4UBMA 3ILYA 1TW2A 2VLJE 4HKXA 4WEOA 4BH7A 1BD2A 1KG0B 2QV0A 3RNKB 2PSHA 4B4OA 4DMMA 5DOVA 2BC4B 2EG5A 5H4ZA 2OD2A 2QVLA 3UKDA 4UZGA 1A22B 4QWWD 3WS3B 2C9AA 2JI2A 2IYOA 5ES3A 3BVNB 2IDKA 3OCUA 4QNMA 2H9IA 5C09A 1CY2A 4QTHB 4E5YA 3O41B 1QSGA 4IS2A 4ND8A 1RJYB 2DMHA 1RS0A 1W6LA 1T9AA 1FG9C 2Z6QA 1U2GA 2J7PA 1IM5A 2FJHB 3LZLA 3I9JA 2FHSA 25C8H 2AMFA 1T1WA 3VOAA 1SJHB 2HY7A 1AS8A 1JVSA 4QHUB 1FJ2A 2PLFA 2MYNA 4HXAL 3JXAA 1QLFB 1ZJ6A 3DVFA 3C75A 1SCNE 4B27A 3L3HB 4DHLA 3PUKA 5ITSA 1RZKC 2YOGA 4JFEE 4WK4B 1KH1A 5JMTA 3RKSA 5JNYA 5FHBL 1W76A 3PDIA 4DP7X 1SEPA 3HB3C 4PY8I 3ULUC 3NHJA 4D9QD 1IBKB 5HI4D 2XNDD 1FLNA 4MGXA 2WOBA 4IGBB 2L3BA 1MHPA 5FKAB 2OHOA 1MD9A 5JIQA 3EHBB 2Z8ZA 3LNTA 1YDGA 3W8RA 1A0QL 1MFZA 5EKDA 3RKRA 1YGYA 4W5QA 1LVUA 1SVLA 4X61A 1VFNA 2COEA 4MRAA 4ZNEE 4O5LL 3UMSA 4TSAL 3LD9A 1MAMH 4XCQA 2WTOA 2QMEA 3BE4A 4DHEA 4L3WA 4F7CB 1KFJB 4GXVH 5MFPA 3QPCA 2ZIEA 3WGMA 3C2SA 2RI6A 2BUAA 1UUNA 1OWPA 4HPWA 4IHOA 1QFWL 2GB4A 4XQ0A 1ISRA 3HHSB 2WJPA 1X5XA 1OM9A 2O6HA 4FYRA 2WSBA 2FSPA 1U8MB 5BOJA 1CL7I 1CJMA 4KIGA 3QLUA 3BAEH 3Q12A 4AN1A 1QU3A 4S1QH 3LL4A 4YACA 2WB7A 1JLRA 1W0JA 3FQ4A 2VJMA 1TTAA 1MKYA 2O8CA 3FF4A 3GSNA 4EX6A 4U1LB 2YSSA 3SHWA 3AY4A 1R5JA 3CXUA 3JT2A 2LVCA 2VJBA 3WTBA 1AI1H 4DZTA 3FDZB 2CLDX 4RZQA 3CVHL 5CR8A 1JWMA 3EJSA 2C00A 1F2UB 4NH0A 4X4YB 3V4LA 2Y1AA 1OAAA 3RVJA 3OGCA 1P0FA 4BLRA 3INYA 3ECSA 3NN8B 4A2QA 1Y6MR 5F3HA 1YIOA 4Y4HB 5MENE 5D1QC 1XIVA 1NZDA 4K8OA 2X6TA 2FRVA 3NCYS 3F98A 4Q3KA 4RFOH 2DQ6A 2XQIA 5C08B 1KBOA 4LE2A 1IKNA 4QA9A 1ZPUA 3LCRA 2MCG1 3M6AA 2HJRA 2C78A 3MRHB 3QLJA 4IVQA 4AZSA 4KXBA 2CVZA 2ERJC 4NQVA 4RO0A 2YY6A 3HDQA 2WKOF 2XX1A 1SXJE 3ESRA 3CUTA 1AJ7H 2EJWA 2NU8B 2ISDA 1ZY9A 4HX1B 3LIZH 1E1RD 3MV9D 2BIMA 2FQFA 4JUTA 4X8GA 5E8DH 2X44D 4XBEH 3NCMA 4KUZL 4GKBA 5IQ9A 1AFVH 1Z39A 3DBLA 1O54A 1YNSA 1PFVA 5G0TA 3MV7B 3PCRB 2A6IB 3MJ9A 3A25A 1P5UC 3G88A 1T0UA 3EEFA 4HFJA 5I1JH 1DT5A 4OBEA 1FTYA 1NN5A 3OF2A 1MT0A 4MKIA 2P8SA 1Q12A 1F90L 1WS8A 1EH9A 5AVTB 4MFHA 2DQYA 1N68A 4LCWD 1RULH 4PCKA 3IP7A 2OKCA 4ND4A 2IOYA 1UJ2A 2XG5B 2VR1A 2IPTH 3WDHA 1OXVA 2Y25A 3ZBMA 1TGYA 1WF5A 2CQVA 3HY4A 2DBJA 1IAKA 4REOA 1R3KB 1MVFA 1POWA 5K3EA 3GL9A 4JG0L 1O7VA 3OMZA 4Q19A 3VR5D 4YMWA 1GA4A 2RGSA 3TVMB 2DPXA 1BF8A 4DVBA 1P4AA 5DU7A 1A4UA 1XMVA 2AFHA 4GKJB 4RWEA 4KVPA 3PV0A 4R2LA 3BKCL 2ZWZA 3BGSA 1Y5RA 2HMAA 3VNYA 1XCTB 2F43B 1WMAA 2W22A 4UNTA 3OMWA 5ITVA 2CO7A 1A5SB 3T7EA 4M37A 4JFFD 2NY2C 2ADFA 2K4AA 5DEJA 4S2SA 3QI9B 1U5BA 2AOTA 1JAIA 1CFNA 4OH2A 4GHWA 3OPQA 2K6ZA 2R4SH 3GLQA 1X77A 1TJNA 2WIIB 3UAFA 3LYAA 2J71A 2N4IA 1F5SA 1MC4A 2XD4A 4AK9A 2AV6A 1EXWA 3AEKB 1O6TA 3AW8A 5KSAD 2W60A 4Z0XA 2QIPA 4PBDA 3VGJA 1GPAA 5CZXC 2YGQA 1UATA 3MNVB 3K2KA 4HIEA 5FBWB 4LF5B 2YNMA 4U4AA 4QKTA 2FVNA 3CZEA 4RAHA 4UQPA 2XXFA 3FUWA 3G1UA 2Q3DA 4RDQF 1ZJWA 3LUCA 2QX7A 5C07D 2HI0A 3MLUH 1OFUA 3S34L 4DZ8A 2G60L 4H13C 1NAMB 4AGNA 4XP9L 3UM9A 5KOJB 2Z64C 3PJLA 3OWRA 2A83B 4FFNA 3WNPA 4A7GF 4DWJA 4FCAA 5CJOH 3IKKA 2VKQA 2PGLA 3PHCA 3KL0A 4RL6A 1NVGA 2JV6A 4RMHA 3W3BA 4EP1A 3US1A 3E7FA 2G75B 3B34A 5EIHA 1X8JA 1JXDA 5I8CA 1U0SY 4MJ5B 3HSYA 3IUEA 3MCLL 1BDHA 2QMOA 2A9NL 1DIOB 4YR9A 1NXTA 4JT8A 3Q4GA 4ETWA 5CZKA 2YDXA 1WJGA 3THYB 1ZLSL 3R9KA 3CVOA 2WWXA 2Y1KA 1WIOA 4XPBL 3H1FA 3QEGL 3KWVA 1K6XA 4J8RA 4LCIL 4YC2C 1UZUA 4TWBA 2BR3A 5B3KA 4X9HA 3CK0L 3VCLB 3E70C 4FT2A 4WZAA 1X0XA 4JUSA 3N3AC 3K6SB 4I4NA 1FSGA 4LLQB 4R0NA 2YJ3A 2FJFA 3MVEA 1YUKA 3VR6A 4KZKA 1UOQA 3R3SA 1SY6L 3TM6A 1UA7A 2YPLA 1TZHA 2QM7A 4D74A 1UVQB 2J57A 2IIJA 1E2JA 2W0FA 3RAGA 3ZU5A 4EY3A 3L8EA 3LIUA 3P0YH 3KT6A 4NZYA 3PT5A 1C4WA 4XBMA 4HIXL 1NBCA 3BILA 4AKEA 3SY6A 4RWYH 3VKUA 1F4AA 2GBPA 1QFSA 3FN0H 2CLMB 4DG5A 3IAUA 1LJUA 1H8OA 1NWOA 1UOEA 5AHKA 4NO2A 3HCCA 5B1JA 4CKQA 1BMWA 5EF0A 5LUMA 1GC1L 1P8JA 1Q0LA 3VXMA 3CWGA 1U8CA 3FZYA 2M6SA 1DKLA 2KH2B 1ZVVA 5DXFA 3EUAA 3LECA 2JFFA 3PVZA 4G3XA 3KXLA 3DRQA 5CCGE 2PW1A 2XFGB 4ZOBA 1RZVA 2Y36L 4CQNA 4HNAA 3MOGA 4CNBA 3EZ6A 3CRRA 7TAAA 4MEJA 3GRWA 1OM3L 5BUCA 4AG4L 2ZCUA 3MF4A 1F2DA 4DGIH 3GGOA 2OLEA 5K0JA 2V74B 3NJGA 3HFRA 1NSNL 4Q4EA 3H11B 2PYFA 5ALXA 3F8TA 5B4UA 3SDDC 5F7DA 3UC2A 1QBAA 2VRWA 4X8XA 5CLQA 4DESA 2QRVA 5I1DB 2VSOA 5DI3A 3CU1A 3G17A 3FUTA 1P0QA 2VQDA 4PPYA 3VI4A 2GWHA 1YDHA 5IGXL 4XB1A 4K7PY 2C07A 5KYYB 3AF0A 4YSAA 4HUTA 1MJFA 4DCMA 4B4VA 5DJYA 3GXNA 3JQAD 5J2TA 1DEAA 3W11D 5IMSA 1EFPA 3IULA 4ZTUB 3H7BA 3M6UA 1D3AA 3D25A 5C7YA 1TW3A 1QPGA 4AMGA 3AI2A 2FOLA 2CLSA 3IIMA 2VDMH 1A96A 2V98A 3H75A 5C81A 5L3RA 2OMKA 1GFIA 4KAXA 1U8OB 3PPEA 2R6R1 2F3QA 1V7MH 4IW4C 1DIGA 4YC7A 3QQ4B 3TWCH 5F9DC 1KN2L 4KIUA 1NKSA 1CB4A 5A6SB 5D96C 3BVUA 1GSMA 4CSPA 3MJ6A 3KKKA 2V5SA 3U3JA 3FUDA 2YWYA 1I7TB 3L3IA 1M8PA 5I1CL 3CFTA 4MA0A 4OJYA 1EFTA 1SB8A 4L4VE 3V0EA 4JP5A 2P69A 4HB4A 3OLIA 4PJXB 2JFNA 1BFDA 1JSZA 4XYEA 3BDVA 1BVRA 3IESA 4AWAA 5BSRA 2EADA 1HT6A 1NGYB 3LI2A 4G89A 1WR8A 5K8VA 1YVDA 2QGEA 4AK2A 5E6RA 2VL4A 4NFDA 1MVLA 3MCZA 1ATIA 2O5RA 4XCEA 1EWQA 3NSCA 5CKAA 3R6WA 3I6GB 5LAPA 4PJCB 4F91B 5FULA 5FPIA 4MS8D 3J81k 5BVJB 2QJOA 3WSTA 5F7UA 1HL7A 1MX1A 1OB0A 2W0PA 2R7NA 2IYRA 3WHE0 4F6CA 3BEDA 5EU6B 3RQIA 3D3QA 2NZWA 3IAM6 1BX0A 2E7CA 3D3VD 1KU6A 4Y2PA 4CG1A 1T6ZA 1FVCA 5CDFE 5BQDA 4I1PA 1Q9KB 3PKJA 2WAAA 3O6VA 3I85A 3V48A 1HX0A 1H0DA 2VZVA 2J8HA 3M2TA 5JI3E 1MJJA 4IS3A 4XVRA 4LDNA 1AO0A 4IIJF 2O3JA 4KNSA 2B1AH 1P0SE 4XP6H 5KZCB 3NKVA 4TNVF 1Q0RA 2PLRA 4LV5B 2OCDA 4BFEA 1XD2A 4ZI3A 3MMSA 5EPEA 1YY8A 5JIHA 2A9RA 2DQGH 2F1KA 2R44A 2XTJE 3K6IA 1FYHB 2F1JA 1K92A 4M3NA 4E68A 2BVQA 3G08A 3M5WA 4UI2A 4BE9A 1DC5A 3ESQA 2B36A 1L4UA 4AJEA 4B47A 1FE8L 1NE2A 3ARXA 1MRFH 5JUEL 3ZY5A 3FB6A 3L8DA 1AQKL 4H08A 3QJXA 3UEOA 2I29A 2OILA 2C34A 5HILA 1N6HA 3ROOB 4FYVA 1BEEA 1CS0A 2FRXA 4X99A 2IP1A 3IJHA 2YNMC 2HJLB 8LDHA 4F84A 3AY3A 4YJKA 3UWDA 5DHPA 4PYLA 4H27A 2Z9TA 2IEPA 1B93A 4DFHA 1N9GB 4FHCA 3C16C 4F12A 1QNLA 1V3KA 5CVEA 2ATCA 4V38A 5AW5B 1F11A 5I74B 5C8JA 1HMPA 1PFCA 3MRNA 2EFHB 3AG5A 5CFHA 3F5QA 2O8EA 2I6XA 5ESWA 5GV7A 1Q72L 3FN4A 3IQEA 4IR7A 1RXWA 4JDEB 3ZXIA 2Z5GA 1I2DA 1NXQA 2X2YA 2O06A 3LVTA 2NVUB 5E1MA 3M5PA 5TFSL 2D2VA 3OG4B 2F67A 1J86A 1AMOA 1JHLL 3D6MA 1MLBA 3OVUB 3MBEB 1DQRA 2WQ8A 2DBLH 3ZWWA 4WNJA 3KETA 1X6NA 3IMSA 5DRZA 3NHMA 4RY0A 4I0PB 4Q14A 4GRMB 1NBAA 2GYWA 1YEFH 3NWPA 2WFMA 3BIAX 3P2YA 3PI6A 5DMJB 4W68A 4HTAA 1UAGA 2AI3A 3FU5A 1RJ9B 4YDKL 1T4CB 3HS0C 2HCZX 3BE1L 3L54A 4YUAA 3IJ5A 3GH1A 3EC7A 4GPTA 5DASA 5ELXA 3E48A 3RRYA 4OGAC 3L7CA 4C0XA 2VXVH 5F7AA 1ZMYA 1FO0H 2DQFA 3CV5A 2WKOA 3U0VA 1XL6A 2ODHA 4Q02A 2GY7B 4ZX3A 3FN9A 4O51A 2B77A 4IICA 4A03A 2HLAB 3P9YA 3GMPB 5F89B 4LXQA 3MWKA 3DDNA 3TCNA 3NALA 3DIDA 4FX5A 2XWBB 3HG1A 4X63A 4YDVA 4XPFH 2YMMA 3K2UL 2VOJA 3E61A 4PLWA 4UV7H 2CIIB 2GEUA 3DHEA 4Q9NA 1ZGHA 3C7DB 3DVIA 4MB5A 1VHWA 3HM2A 3RODA 4YFYA 3IBOA 4I8DA 4MAMA 3AUAA 1QGOA 4PCAA 7GPBA 5I5EA 4FEGA 4U7HA 3S8YA 2E0PA 1PJ2A 4HS6B 1J8DA 4MLIA 4WHDA 3MNZB 3VUEA 1PF3A 2J5XA 4XQCA 4D9GA 5D7IF 4AGLA 3A4MA 3MRFB 4CJ0A 2NQDA 3K0AA 1MLDA 4OHYA 2ACVA 3KYJB 3WB2A 3ONVA 1WF3A 4HB2A 3L7DA 1L6XA 2VXUH 4XVQA 1ED3A 1MJ8H 5EQDA 4A8JA 1SBSH 1H5UA 4F9GA 2CMDA 2VRKA 1C7ZA 2ATAA 3P2KA 5E5MA 1X74A 1UH5A 3L13A 1N18A 4C4SA 5BW6B 3WZLA 1R5IB 1V16B 4US2R 5AJVB 4XXCA 3V55A 1XXFC 1S3KH 3LKRA 4QWWA 5IW8A 4JPWH 5FC9A 4A7VA 5EWIH 1PWHA 3KKMA 2BDNH 5AOAA 2WIJA 3F6BX 1M1XA 4DVGA 1RP1A 1WITA 4OGXL 5IJWA 3VFGL 2AG1A 3N8NA 4DO5A 3UK2A 5GRJL 2GEVA 4DQOH 4GMTH 1UYWL 2ICES 5IVOA 3CZ5A 4O5AA 2XA1A 1E4WH 1NPYA 4HEPA 3PLRA 2C4HA 2NNWB 4EKYA 2RK6A 2VWPA 1I3MA 3L8HA 4ZFFA 2XNDA 1JT2A 3K2EA 3QDJE 35C8H 2GEEA 1RMYA 5FTWA 4PZ0A 1UAYA 3LUBA 1YMUA 4TYYA 1W19A 3HAEA 4KB5A 5A3ID 4IIHA 4XIJA 2FN4A 3JV5A 3OPZL 2P4HX 5EHZA 2DUMA 5JDJA 1DJHA 3OCYA 5EMLA 2YMQA 2DY1A 3RFZC 4JBGA 4Q1AA 1KGDA 3C60C 3VWJC 5CFAA 2PGOA 3ZDXB 2B7BA 1KYOK 4Y2DB 2GRJA 1RRMA 3A4NA 3DAFA 4LDCA 3WFDL 2IC2A 4D8PA 1R5VA 3GF4A 4X5PA 2Q8BH 3ESCA 4KWUA 1QG6A 3T65B 4YJ3B 2IBZY 1KYFA 5DQJB 4PGDA 3RUGE 2P9GA 1LYQA 5AVWB 2P9CA 4J0EA 1A6PA 3WHXB 2FPWA 2IXEA 3QTLA 1M2JA 5CJQH 4JJ6A 5I4BA 5AKSA 4FS8A 2CCKA 3HG2A 2HT1A 5ESAB 2UYHA 2QM8A 2Q29A 1QH8B 3MPCA 3S4SG 4Z7WF 1SXBA 1CVLA 1DJSA 4IF4A 1D2NA 3Q7SA 3QCUH 2PKDA 4G5ZL 5HYQB 2QLMA 4O02H 5DBEX 4MYCA 1DQQB 3G5VA 1UMBA 2X8AA 5TMBA 3M8KA 4RTSA 2C54A 3RU2A 1G7MB 3FUNA 3CZRA 5JHDB 1UBGA 5GZNA 4PV8B 5TGZA 4XPAH 3I2GA 1A1OB 3KU4A 4XTCS 1OAKH 4P83A 4LPTA 2XDAA 4MO2A 5B30A 4P2RD 1A7RL 4N9GB 3QMMA 1PT7A 4ISCA 1IGIH 5J2UB 4TMZA 4PGCA 4V2UA 3SEZA 4M62H 3Q8FA 2HL6A 2EH8L 2VK8A 4LZWA 1JHDA 2YYZA 4M7PA 3BKJL 2Q3CA 4ZU6X 4Y5YB 2I2WA 4OB6A 1A9XB 3EQ8A 5JWOA 3GJFH 3T12A 2WC1A 4NERA 5CGBA 2WUCH 5DDIP 4NUPA 5A2QA 2D5LA 5CG2A 5JVDA 4ZQHA 3PXAA 5GJBA 3FNKA 3WMPA 3F2VA 3CVHA 1AZLA 1MVNA 3K0HA 2BBOA 3SBEA 4MAUL 3SZOA 1RJZA 2NQ8A 4GQPH 2OLDA 1E1RA 3MV9A 4Y2OB 3C09C 3O11B 4K9JA 4EI6A 3OIFA 4AMZA 3HBGA 5E7MA 1JZEA 3O03A 3ZHQA 3GYRA 5F44A 4C83B 4IUYA 5IJ9B 1SXJC 1U6JA 1A1MA 5D3MA 2DQTH 4UCQA 4YGAB 4F2PA 1M6VA 3C6LC 2W38A 3OC5A 4OLBA 4MQSB 2E4VA 3S88H 4JFHE 1U33A 3BSZH 1MRZA 1ZANL 3GO4A 4DKJA 3RB7A 3CXDL 1HYEA 4YPVA 2FRDA 2DJUA 3KTFA 3UJ9A 1IZ7A 5EFIA 3LLMA 4N25A 4RD1A 1OFIA 5L2KE 4LCWA 3WRVA 4I4TB 3NVAA 4OZ4A 4MJXA 3KDSE 4CCWA 1BAPA 1A9EB 1ZIPA 4ESEA 2JBHA 3B1TA 5GONB 3JTEA 1QSFB 1C3EA 4BP8A 3W6UA 1ZI6A 1EXGA 4L5JA 2IU3A 4RDXA 4QO8A 1OHHD 3RRQA 4G0ZA 3D5EA 1VZGA 3ZWOA 4AYTA 4UDNA 5DA4A 3HQ4O 4J8PA 4MNGA 4PS7A 3QP9A 3GLFB 4JN1L 1ZVSB 2IPAB 3DO8A 3OM8A 2CXUA 3JATB 4LRWA 2LR0A 1JNNH 4JFFA 4KJPD 2Q07A 3UPRB 2YHIA 4LI0A 4UPDA 2GTWB 4JKIA 2ZRPA 5FKPA 2P6RA 4FLFA 1ESMA 3MRLB 5ICXB 2BIQA 4GSRA 3HXPA 3QFDA 4B41A 3MSCA 4MQ4A 1RACA 1L5NA 3ZIUA 3KSAC 1TQDA 1FL9A 5AXBA 2Y6VA 4PZYA 2X6MA 4BE7B 2QAGA 3HP1A 4TPKA 1EX1A 1E1MA 1RZUA 1P1BA 4PD4J 3ZK7A 5F76A 4LHUG 4JP8A 2ED6A 2HTKC 3KOMA 3LDGA 4MRSA 2HQBA 4CM9D 4DO6A 5AW9A 3TD2A 1DVYA 4ALNA 2XJ4A 4BK4A 1U7DA 4EI5D 4LRIA 3NLLA 3GY0A 4RQUA 3FHJA 4KI5D 5E03A 1Q0SA 1GSAA 4KG7A 3TJEH 4HX5A 4TSRA 1T6WA 2AJ3B 4ZAXA 1NURA 1HZZC 4LRYA 3HCPA 3I52A 3HGMA 4I9GA 2VRNA 5DPMA 5C07A 4Y4FC 4ENUA 5FK9B 4E4YA 1PLAA 4NMLA 1PJZA 2XGJA 4LY3A 2DH2A 5DFWH 1KI6A 4AVYA 4OZFH 2QMUA 3GRRA 4UCFA 3DGCR 1A6WL 5L95A 4IIJA 2NYAA 3U7QA 5CWSB 1OFUX 2Q62A 1P33A 1DV1A 2RJ3A 1NWHA 5DYIA 1NANI 4PANA 1EUUA 4C01A 5TVGA 1DSFL 1KPIA 1AD9B 1KSJA 1QA9A 3LXRA 4XNMB 3AS3A 2RGWA 1OARL 1VPLA 4WXEA 1C3OA 1AGDA 1ICTA 3DH0A 1KJZA 3SDCB 4A2FA 2FP4B 3T7KA 2H54A 2CBPA 1NVKA 2JASA 2AFIE 1WEHA 2EQ5A 4O4LF 3HHMA 1YGPA 2VCHA 2I5YL 5A5VA 1CQWA 3MRBB 2R4TA 4EG7A 4BKOA 4D7AA 3JWGA 5KJ1A 4HMEA 3UBFA 3E2PA 3L02A 3P54A 4QM6A 1RXUA 3O8DA 5EFOA 2CJXA 4PWKA 4W6ZA 4UATA 2P77A 1VTKA 1OZGA 5G53C 4RSGA 2PT9A 1IGFH 1X5ZA 2NY7L 3WRYA 1MI5D 2CR6A 5LZ5A 4OFDA 4MX7A 1I7QB 3D8BA 1NMQA 4DUZB 1Y8AA 1YFLA 4PQYA 3H3JA 1WXHA 3NBZC 1G7QA 2G28A 1W0WB 2QSJA 3WWCA 3MRRA 1VMDA 4EMSA 2IHYA 4XDYA 5KBPA 5FS5A 3IP6A 5IT0A 2QORA 2VBGA 4ADJA 4HV8A 1SY6A 4YT5A 1O4VA 4AKSA 5AQ0A 3QORD 2KERA 1JMZA 2BY3A 1EHCA 3HC0A 3T1TA 2JEOA 2R0KL 1SRDA 3RFXA 3U6KA 1YZVA 4TNWK 2D5CA 1WB6A 4UUMA 2FHPA 4EI8A 3BSSA 1OIVA 1LO0H 1VFAB 1F6AA 4ZCLA 3FGNA 1ZWLA 3PF8A 1UXWA 3RKDD 3A1WA 4RH0A 5GZNC 4RIRA 4PJIF 3PE6A 5K0NA 5DDHA 3S3BB 1RE1A 3TV8A 3HMKA 3W8FA 5A2BA 4H17A 4QHPA 1GGUA 2COKA 4GNKB 2DQHH 2O26U 1INEH 5D00A 4KH0A 3NABL 1DWUA 5T5FL 1RZJL 4HDKA 4Z3KA 4UDUB 2HDHA 4Z51A 1PQUA 4J2TA 1BE6A 2NDGA 2FPPB 4FYJA 2NZ9D 2Y5TA 2N3ZA 1GGKA 1H42A 2F48A 3NBAA 4YQFA 4BBJA 4E6EA 4KNTA 4JKLA 2Y2UA 2HGZA 2IIVA 4HK0A 4ORZC 4FGSA 1Z35A 2DWDB 2GN2A 4DDTA 3K81A 5HHPB 3GP5A 5FT9A 1RZKL 4WTZG 4M8SA 1PJWA 3ETDA 3D5OF 5LCVH 3IKJA 4LPYA 2DF3A 3ULUL 1KDIA 4B80A 4PZZA 1CY7A 2YRPA 2FQWA 4LJ4A 5LDHA 4X42A 2KW5A 3GYBA 3DK2A 4X7EC 5FA8A 4TOYL 3S3SA 3VTZA 1W75A 1WHSB 3E7WA 1DXYA 3E5HA 1SFDA 1FFEA 2RKOA 2JGLA 3U36B 5AW6B 2I55A 1AP2A 3OQNA 1OL0A 3GZJA 2FCRA 3JAKB 4EPTA 5CHYA 2FRDC 4PPQA 5E4YA 1XNHA 3C3PA 2UYQA 4ODXA 3L49A 4ETMA 2C2MA 3KUDA 1AD2A 3EDEA 3I5MA 3VYTB 5HDWA 3HWSA 3Q1KA 1ULSA 3W90A 1LPSA 5LP6B 1HPLA 1GGEA 5GGRA 4Z7UB 3HB3D 3ULUD 4KI5F 3EXHA 5B4VA 1FIUA 3PC2A 4D0GA 3HUUA 2E1PA 3T9AA 1CQIB 5T5QA 2QVYX 1JOIA 1BMFD 1VM6A 3ICOA 5IF9A 3D3VA 3Q7TA 1F1BA 5A0TA 2P2NA 3E6HA 3SSGA 5EEWA 1XZ8A 3BULA 3MD9A 1K5PA 3GLDA 1HNZB 4RORA 1LZKA 4H18A 2E4ZA 4P5KA 4PRNB 4DT2A 3EA0A 3T0GA 4K3VA 1U0FA 1VI6A 3DOUA 4BNHA 4Y16B 4P5TC 1RLOA 2QTGA 1HH9B 2Z5VA 3L4YA 2YJLA 3RS4A 1N8SA 2PL3A 3ROLA 1EIZA 1V7CA 1JFQH 2ZQKA 1N6QL 2PNFA 1NFFA 3A9UA 3D7RA 1IFHL 1KP2A 1MZYA 1BFVL 1AGNA 4ZU1X 2DLDA 4FMDF 1Q6ZA 2FPRA 2QW0X 3U0TA 1GT6A 1SJVA 1XVTA 4I2XA 2HA6A 3IXAA 2PQ0A 5DB4A 3DQPA 4BFIA 1OKKD 4BAZA 4LMQI 1GPUA 2Z8YA 4YONB 3GAAA 3WEBA 5ABPA 4I3RL 4K6FA 4TNGA 1XTQA 4EG8A 2IH4A 3NJHA 4NRYB 3OR7B 3LQKA 4XX0A 4IBOA 3MYRA 1PYOA 1D5MB 4WASA 3SVZA 1PW5A 3KCPA 3VC1A 4LNHA 4Q6YA 2W2NA 4OLVH 2ZUDA 1L5QA 4BNFA 1BC5A 1YB4A 5D1QD 1BE8A 4WOPA 5IROC 2EZ9A 2D59A 5IM4A 2NXNA 1DB3A 3A32A 4KGLA 1I6KA 3VFTB 2PR7A 4Y0NA 2PTTB 2YKLH 3DHPA 4L7VA 3ATDA 1WT5C 4XDHA 1FE8A 2R0LH 2O5YH 2ZOTA 3G0DA 4ZJZA 2XXCB 1GOGA 4FDUA 1SKYB 2G9RA 4P2GA 1SOMA 3G8BA 3G5ZA 2YD8A 3L5IA 4C1NA 4D6PA 2D0DA 4Q2ZA 2VXQL 2AFRA 1MCKA 3NRJA 2AJBA 4POUB 2PUBA 1XAKA 2HN7B 3O0RH 3L5OA 4BFFA 1DLHB 2F58L 5DJ8B 2C1XA 4BQBA 2X8LA 4FQ8A 1TIKA 2DWCA 4BIMA 4E08A 3TNLA 3WV5A 4ZRNA 5JXAL 2NSXA 4ZOEA 3LOUA 3D05A 3V6ZA 4JFVA 5DBOA 1AKEA 2K7FA 5C34B 3KXIA 4ZQEA 1XXHB 1RAIA 2XN1A 4KI1A 2QDVA 3ZX1A 3RDJA 4GIPD 3CR7A 4L8GA 4TPRH 2OT3B 3DF7A 4X8CA 2QP4A 1NCWH 3C6ZA 2JJSA 3AOEA 1PJ8A 5UKDA 5L88H 3WWYA 4QGTA 4BRJA 2A4KA 5KTRA 2OA0A 2OBYA 1ZEAH 4X4MA 3O9WC 1T20B 2WXIA 5HIAA 4DJFC 2P28A 4WPGA 1NMBL 1JZFA 3OPYB 2XNHA 3I4FA 3KZNA 2VL5A 2BHUA 4E15A 1QPKA 4O9HL 4GOMD 3SE8L 1XCOA 5I8EB 4MVWA 1CFVH 4DUYB 2X0NA 1R1CA 4OHRA 4QLWA 2HXYA 3KQKA 1PWXA 1NMCB 3UV7A 5C3MA 1MCFA 1VG0B 3TCTA 3PHBE 4G0PA 2X0DA 4QDOA 1PY0A 4BE4A 1JDBB 3A8TA 2B1OA 4LLUB 1ZXLA 2N75A 2B82A 3CJTA 5JAZA 2ZTUA 2AC0A 3D2AA 4XP5L 1M3IA 2VJOA 1TTFA 5AJTA 1BGXL 1W87A 5E1GA 1MPXA 3GCDA 2NY2D 3MBKA 1WKCA 3WKMH 4P4TA 2HG5B 3HG3A 2HX1A 3EO1B 3EZ7A 4AUKA 4K9MA 1A69A 5BQ7A 3MINB 4L3AA 5CA1B 1PW7A 3T77B 5JTUA 1EK6A 3FLBA 3ZTWA 3CSSA 1GC1C 3DJRA 5ALKA 1NFDA 3CURA 4YDJB 4KR2A 4Y0AA 4GEJA 3SIPA 2ATPB 4D43A 1DSWA 1OGYA 5D71H 1OGAB 3UC0L 2GYUA 2WIDA 4J7UA 3RSLA 2JVUA 5I19H 3GELA 3OKMB 1Z83A 1N4XL 1DC6A 1Z0DA 1P2TA 4U1KA 1X4XA 1T8RA 1KLGB 4RCAA 1V96A 3L45A 2QRLA 2RK3A 5CZXD 4E07A 5HKBA 2ZSBA 2WTUA 1PJCA 1GAQA 3AX6A 3GLIB 3CM0A 1BCRB 3SD2A 4KTDH 3SLRA 4Z9KB 2GTHA 2H07A 2JKWA 4IDQA 1VKNA 1DAMA 1GU0A 3NFYA 4K05A 4LEXL 3GRGA 4Y1AA 1ZJAA 1KZYC 3O8XA 2Z1MA 3F8UB 3C3DA 1OZAA 1H5BA 4Q1CA 3KQLA 3GSRA 1Q8MA 1XGYH 2J7PD 2FATL 3V4VB 4H4NA 5DJDB 3RL1B 4MW0A 4BJ5A 2EJVA 1NMSA 4FADA 4XPIA 4ZZIA 4NI3A 2IY9A 2YXFA 1OSPH 3HZRA 5LGHL 1QTQA 5ID1B 1MFDL 3M1CA 1G8KA 4RMVA 4KXXA 1NBMD 2IPNA 2XMDA 3BWVA 2QM3A 4P3CL 2A0YA 4Y6LA 1ODUA 3FCUB 1R4MA 4KKAC 3HC2A 1NPTO 3IKTA 3MLVL 3KPJA 1ZGGA 5LZ4A 4B3TB 1D8TA 2YOHA 2H3NA 4OV6F 5A04A 4PF1A 1OF0A 3GXIA 1VERA 3GRBA 4PRZA 2N7BA 4M8QB 1JL8A 1N0WA 3HZKB 5L4NA 4MW7A 3SR3A 1QHGA 4ENSA 5CTJA 4BP3A 4OGQC 3VG0L 3ODPA 2XACC 1RERA 4TZTA 4AWBA 4LX8A 2IADA 2FH8A 4C0BA 5HY9A 3US0A 2WVVA 1CLEA 2R1WB 4CDRA