2VDMB

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist tirofiban
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
461
structure length
456
Chain Sequence
b'GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
molecule tags Cell adhesion/immune system
source organism Homo sapiens
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
total genus 125
structure length 456
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdmB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdmB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdmB03
1M2VB 1U8CB 5E6SB 1N9ZA 3T3MB 1YVPA 3Q3GE 1MHPA 4NEHB 4HQKA 1JEQA 2I91A 3AL9A 3NVQA 4WK2B 4M76B 3V4VB 1XDGA 5E6UA 4IHKA 3AL8B 1MJNA 2VDRB 2ODQA 1N3YA 1DGQA 1SSLA 3HXQA 4O3TB 3OL2A 1JEYB 4JDUA 1XDDA 3EFOB 4IGIA 4HQOA 5KYYB 1PT6A 2I6QA 3RAGA 3IJEA 4MMXB 1ATZA 4FX5A 2NUPB 5KYWA 1IJKA 1JV2A 1M1XB 5KYXA 4MMYB 2O7NA 1AOXA 3ZDXB 2ODPA 4MMZA 4C2AA 1LFAA 1IDOA 3FCUB 4MMXA 5KYWB 2NUPA 2X5NA 3ZDZB 3ZE0B 3FCSB 4UM8B 1XUOA 4CNBA 4CN9A 1T6BY 1SHTX 5KYYA 3ZE1B 1OAKA 1MQ9A 1V7PC 4K3JB 3BQNB 5KYUB 4MMYA 2VDQB 1RD4A 3PPYA 3OKYB 4GZ8A 2VDKB 5E6RB 3VI3B 1JV2B 5E6UB 2VC2B 1M2OA 2QTVA 5ES4B 2XWBF 4Z7OB 1PD1A 1QCYA 1ZOPA 5BV8A 3EGXA 3T3PB 4UM9B 1JEQB 3BN3A 3EGXB 4C2BA 3GXBA 1U8CA 3K71A 2VDOB 1BHO1 2NUTA 5HGJA 4Z7NB 2XWJI 4BJ3A 4WK0B 4C29A 1QC5A 1M1UA 4WJKB 1IJBA 3PPVA 1MF7A 5KYNA 1PCXA 4Z7QB 3E2MA 5KYUA 3TCXB 4O02A 2VDNB 3TW0A 1ZOOA 2IUEA 4DMUB 1L5GA 4G1MB 4F1KA 3V4PB 3AFCA 4G1MA 1L5GB 4FWWA 1IDN1 3HI6A 4A0QA 5E6SA 1SHUX 4G1EA 4HQLA 1JLMA 4MMZB 3EG9B 2ADFA 1QC5B 5E6RA 1SQ0A 2WINI 3K6SA 2VDMB 1M10A 1SHYB 1RTKA 2ICAA 4JX0A 4HQNA 3EOAI 3EH2A 4NENA 1T0PA 3PPXA 3EGDB 3IBSA 4NENB 3FCSA 2NVOA 3EFOA 3TXAA 3ZQKA 3VI4B 1U0NA 3OL2B 4IXDA 3M6FA 1M1XA 1PD0A 2WW8A 3HXOA 2UZYB 2I6SA 3PPWA 1YUKA 3OKWA 4XW2A 3IJEB 1NA5A 1DZIA 3NIFB 2XGGA 3EGDA 3NIDB 1MQ8B 3F78A 4UM9D 4O02B 1OLZA 4WK4B 1AO3A 3EH1A 4O3UB 3K6SB 5KYXB 3AL8A 3K72A 3BQMB 4F1JA 3N2NA 3F74A 4G1EB 1FNSA 2P26A 3EOBI 1TYEB 3K71B 2P28A 3NIGB 5HJ2A 3TVYA 1CQPA 1RRKA 2VDLB 1Q0PA 5HDBB 4CN8A 2VDPB 1MQAA 1AUQA 1U0OC 1ZONA 2B2XA 4WFQA 3ZDYB 1M2VA 1RS0A 1JEYA 1YVRA 5LN1A 1CK4A 3K72B 3QA3E 3EG9A 2M32A 4HQFA 4PN7A 1UEXC 1FE8A 3ZE2B 2NUTB 1BHQ1
chains in the Genus database with same CATH superfamily
1G8SA 3IBEA 1SC1A 5C4GB 2HAEA 1PFWA 4BEBA 2ZUTA 3EEOA 1HXYB 4P2RD 1F1DA 3FTXA 3QIUC 1YWGO 4S1QH 1SUAA 2GBAA 3WLEA 4F5WA 3GA5A 5D6CA 2BSTA 4Q9QL 4LVEA 2BOVA 1T0OA 3IV9A 4WADA 4OJFH 1IJEA 5ELMA 4E2ZA 1Z45A 2YIMA 4XVUC 3HB3D 4DKFH 2O9JA 1DC8A 1RHHA 3NTQA 4OCRL 2AJDA 2HVJB 2RAVA 2JD2A 5IHPA 4K7FA 3EJTA 1KENH 2DT8A 3VXSE 5AW2A 1NAKL 3T1HB 3UG3A 4AM0A 1IB0A 1L4IA 4AGMA 1DBAL 1QSEB 4JBLA 5I7SA 4GBGA 4GPTA 2ATAA 5KNDA 5A7GA 2WIJA 1BEYH 3ET4A 4CPDA 3AV3A 5F72S 2DFPA 1CS0A 1Q92A 4G5GA 2B5VA 3ULVH 4G8GD 3UPRB 1F8UA 3RILA 1LVEA 1EAOA 1YEFL 1RAMA 1KIQB 3AUKA 3WFHB 5EZLA 4FLQA 1OI7A 2Z8RA 1VBFA 1HVXA 2HX8A 1A6TA 4GXUN 3TO4A 4ZCSA 3WWPA 3CZGA 3PU6A 1A6AA 1DZ0A 2JJ8A 3BAWA 3LKRA 3KSAC 2R6DA 3SN6N 4RVHA 1U42A 4JKWA 3BD5A 2Q9CA 5J5CA 3QZBA 4TNVK 4R1TA 3HBZA 1KVSA 3IDGB 3VDQA 1DQLL 4TRRA 3C3DA 4PHCA 2ZR0A 2FFJA 3KFLA 3V0GA 3CC1A 2FPWA 4EG7A 1GRQA 3D1JA 2I7OA 5K0NA 1J0AA 1JV2A 3W5JA 5DJCB 1IC4H 2AI3A 3PTAA 4OZ4B 4N1EA 3X12B 2AUTA 3DLTA 4ZI7F 2I9LB 1Y4AE 1RJDA 2BINA 4O59O 3QI9C 3LSOB 2EEDA 2WGNB 2R6HA 1KSFX 4DEWA 1RHKA 3RKUA 3O4OB 4X7SH 4G85A 3IEAA 1H85A 4RGQA 1XGZA 3QNZA 5ESDA 4HPYH 3ZKNC 3UOAB 4M38A 3CFBB 5ER9A 4ZAKC 3N6RA 3EO9H 4D94A 1M8PA 4CKZA 4PGHA 4PLJC 5LN4A 1N92A 4N87A 1VI2A 2IJGX 1DBPA 1QJCA 2DY1A 4DKXA 1JLMA 3OPMA 4CW1B 4F8YA 5DIZA 1A88A 1D6EA 4X60A 2YPKA 3EJZC 4I2XB 2IG2L 4QRPE 5F3HA 4J2HA 3B7UX 1R00A 1RXLA 1QBLL 4QRRB 3IB4A 3NCCB 5KJ7E 3BXZA 2YK1L 4P5TA 4MWZA 1TYBE 4BHTA 3UGKA 2Y9MB 1C0LA 4TSRA 3GV0A 3G8DA 2WUFA 4XQCA 4AT6B 5HQ3A 5AW5B 3U46B 4ZW6A 3ZZ1A 3BG5A 2J85A 3GJXC 3BVDB 1RM3A 2GSGB 3G85A 1PYDA 1AR1D 3ORYA 2FDCA 2V7HB 4H6PA 5T4EA 5JPDA 2DYRB 1TTHA 4YAGA 4Y6QA 5HYEA 1X1QA 4EW3A 3HXLA 4MRRA 1F2QA 2FT6A 1CCZA 2A73B 3A6FA 3ND5A 2QQGA 3C12A 5LCVH 1QMPA 3PGXA 3WEMA 1G9ML 4JRYD 1WBJB 3AR9A 2EVFA 4Y7CA 1DC6A 5I1IH 1KCVL 4NBRA 2O72A 4OD1L 1VL0A 4A7GF 1AF7A 3LKQA 4PQEA 2HBYA 2FX7H 3Q01A 4QGFA 3KKPA 1SVLA 2PL3A 3BHJA 2BHSA 2O6EA 4REQB 4YWGH 4Z7WF 3CLRD 1TVCA 4MKXA 5F1IA 5BQDA 5A1TA 2I1LA 4UV4L 3FW6A 5EEYA 3BN3A 3GMTA 1XZBA 3RYTC 1JEEA 2A74A 3CJJA 1JG6A 3KT0A 3QRWA 2YOCA 2A6KA 5J47A 3A0UA 3Q7PA 3LMJL 3T8VA 3OKKA 4A2GA 3GU3A 3BTOA 3M81A 1B3IA 3GA0A 2X2YA 4DAGL 1QG6A 3NJ4A 2APJA 1QM5A 4H5SA 3ZRCC 3BC9A 1LDPH 2ZJOA 1SLVA 4ABWA 4RZQA 2IUYA 2X9QA 4WFHE 2CLLB 3RVDA 1CEYA 1TNDA 2F48A 4CL7A 4WXHA 1E94E 5FKJA 1OGAE 3X43A 1DSSG 2G8NA 3LCJA 4HFRA 1CUOA 1CR2A 3L5IA 1A9QA 4FTVB 5IEKA 2V2XB 221PA 3DVGB 4WLNA 2O07A 2Y07H 3HBQA 3W1ZA 5DRNA 2QP9X 2PH7A 2YBDA 2R29A 3PL5A 3O3BA 5JBIA 3T4AC 4AJ0A 3LQQA 2PL9A 3ZKXB 3V0EA 1O9BA 5LYJB 4WT7A 1TJMA 1HQDA 5KWYC 3A1CA 2WABA 1IN8A 1QAQA 3GMQB 4YLBA 4PJFE 1RPTA 1ENPA 4RKQA 4HMCA 1NZJA 3LUGA 4K81B 1QHGA 1D03A 3OA0A 4DIUA 3S3SA 3PNKA 3H3FA 3CUSA 5I8KL 4OXKA 4UT7H 2FPXA 3L8DA 5GS0C 2R96A 5KTRA 4OHWA 4LRIA 3EFDL 1QWNA 5BUPA 1LI4A 1XMPA 3ZYCA 2Q7YB 1NZFA 3LQAC 4R7LA 3IVAA 3BHNA 3CJRA 2O8NA 5DYGA 4JY6B 1GYQA 5E38A 3E81A 2P43B 3MBOA 1CFSA 1SU6A 2ZIWB 3ZWMA 3UW1A 3GDCA 4KJWD 1PD6A 3TA3C 1UJ3A 2J6IA 2RHOA 4Z76B 3BWZA 4KZEH 1G5QA 3EGSA 4AP5A 5DFVC 4KFZC 2ESVD 2K0RA 1BVLA 4HN2A 2I9LA 1YNTF 1MF2L 1BBJA 3QHFH 3GLAA 1A7OH 1OILA 3I2CH 5FV2A 3VXSD 3CMOH 3SDAB 1BPVA 3T3MF 3Q5EA 1UKTA 1KTVA 4M4RA 4D6XA 3ZI7A 4Q4DA 5IARA 1VCBC 5EF3A 1NHWA 4ZHQB 3UV7A 2Z5LA 3MRKB 2AKAB 4LRYA 2NU8B 5JA8B 4X6LA 2XWCA 1J8HB 3IUNA 1SG9A 2XZAL 3EQZA 5HF8A 3EGVA 5IF9A 4RVDA 1YASA 3HVHA 2CXQA 3G2LA 3AF2A 2ZUUA 3EDKA 4FYRA 2K6WA 5T3ZD 6PFKA 5KTEH 4TQAA 2P4UA 1ZH2A 2ZBUA 5A7FA 1TUBB 1NGYB 2X22A 4XNUH 3QQ3A 5CT9A 4R6XA 3X13B 2E4AA 5HPMB 1W36B 3FFXA 4B6FA 2HWZH 2VN3A 3VFMB 4XOUA 4UMFA 3S4SA 3WLBA 3PNLA 4CI0B 4JHBA 3EFFA 2X19A 4F4DA 4JRYE 5KVDE 1DG1G 5BP7A 4BYHA 4WKBA 5EZQA 3WLBB 4UTXA 3B3AA 2DWDA 4XYEA 3SHFA 1EDEA 2ODWA 3HWRA 1B4JH 3APFA 1SHSA 2ON6A 1J9EA 2AN4A 2B94A 5CKAA 3INOA 4TWIA 5FEBA 4Z3FA 3GHEL 3P9WB 1JIBA 1EMTH 3IJ9A 1C9YA 3U79A 1IFXA 2DAPA 3ZBUA 5K6AC 2HTEA 4EBFA 4HIEB 2F1IA 4AUKA 1VLHA 5G0WA 5EU6B 2Z6AA 1NANI 1UEYA 4KNYA 1JGDA 3Q7TA 1S2EA 1FNMA 1W8IA 3MCG1 3FN0H 1VIMA 2BM3A 3DK0A 1KBKA 4NNYA 5KCMA 2CJWB 2O5XL 3F05A 3RFCA 1XF5A 4D3DA 1L9MA 3Q13A 3DM5A 1YZKA 1IONA 1GL9B 1L0BA 4NMLA 4DABA 3IKTA 5ANHA 4L8SB 4M9ZA 4LJYA 5I30L 2BP5M 3FTWA 3P9CA 2JKRM 3H3PH 1DRUA 5HZHA 5KSZA 2HG5B 1U8TA 2L7JA 1A9VA 4U1MA 4RZIA 4EPYA 4A63A 1KIFA 1FGNH 5FA6A 1FAIL 2GBGA 4YJHA 1AANA 4G6ML 2G82A 3A31A 3ENNA 1J8VA 4ZX3A 3MRLB 5FUXA 43CAA 1NOAA 2NIPA 4IDHA 5MN4A 3THWA 2B6HA 3I6KB 4HMDA 3QORC 1MCEA 1WC7B 4WDIB 1VKRA 1U36A 4FXGA 1JYNA 1ULBA 4KGZA 1DAHA 1BOGA 4GXVL 3HSSA 5K1JA 3WMSA 3SZKC 3EF7A 3CZFA 4F38A 5BZXA 5EFIB 3I0ZA 2TSBA 4CN6A 1J1PH 4LOUC 4PG5A 4ZCIA 1PAUA 2B8JA 4K8RH 4ONEA 4AJJA 3CVDA 1DL7H 1G7LB 3H19A 2M1XA 4TKVB 2ITCA 4FB5A 4WXEA 1YMMD 3DTDA 4NXSA 1ESNA 1IC7H 1TQTA 2WNHA 4XWYA 3MV7B 1O97C 1QE3A 4BX2A 2MSWA 2VXUL 2JI6A 3IE1A 2A0YA 1AKMA 2DT5A 1T03H 2E6UX 4PRLA 2VDVE 1NG1A 4RBPH 1E1QD 2AZTA 4MDFA 1T1WB 4KOBA 3CSSA 1HYSD 2BHZA 1ZSVA 3WCYA 1JDBC 2BGUA 1WHPA 2VG8A 1J90A 1XDBA 2GEDA 3DROB 3O6VA 2Q6KA 1PNCA 4W9IC 4JI2B 3EY4A 5KOHA 3MJSA 3A9SA 3AP2A 4YO0B 1SM3L 2JIQA 2AN5A 2BOBB 1OM9A 2ED7A 5HYQA 1US8B 2R79A 4JI1B 2JB9A 3E23A 4G37A 2RIPA 1RHHB 1UOQA 5DO2C 3WHXA 4M6WA 2HHHB 3LTVA 3I6LE 4XWAA 1PKOA 3IPFA 1G5AA 1I01A 1C7FA 5GGTH 1M8FA 3N59A 2Z5VA 4QJ3A 4XOCA 4JCOA 5AT1A 4QTHB 5EGNA 4BEJA 5IJKC 3QVKA 4L3VA 5DK0B 2JIBA 2CUAA 1NRIA 2AEPH 5E8PA 1KJZA 1NWHA 4BIIA 1L9NA 4Q4LA 2QHLA 5HHMD 5E7QA 1DBWA 4YBHA 3RC3A 4A38A 1DVFA 3VX4A 2WAQA 1J9SA 1QBML 1JQDA 1M5TA 1ZRSA 1S7VB 5L8JB 1HQKA 4HDIA 1NVVQ 1V9SA 1TJYA 3QF7A 3GJ7A 4MXWH 1OFUA 1ECPA 1XK7A 5E1AA 5L4FA 2WTNA 3R20A 5FHQA 4INPA 5EWIH 4GYKA 5FLKA 3B5EA 5G4KB 3VPDA 2C8VA 1CO1A 1HE7A 3NH7H 1M6EX 2PKEA 3GL9A 4IBOA 3W39B 1QIJA 1Z26A 2YAHA 2X05A 4RKRA 3KVOA 3TZVB 1DGQA 2QXTA 4UOW1 3NUKA 1KZ1A 3WLJA 2HLFD 1M6UA 5IP4A 1S3KL 2FWPA 5DT1H 3U39A 4O2BB 4QAQA 4ZDKA 1WG3A 3QELA 1XR8A 4KXUA 4XPFH 5CSGA 4HEA6 3CV3A 4V0LA 2A84A 1GUZA 4PRHA 3OKNA 5JNRA 1H5BC 1HQRB 4NZJA 4Z1PA 4Y9TA 1DSWA 1MY5A 5HDBE 2AXQA 4B2YA 2VLRE 3MWDA 1DXHA 5DHVA 3V33A 2QJRA 5D1QB 4LHSA 1PT9A 3SE7A 4B9GA 2YIJA 4NC1E 3G7SA 3HPLB 2PX0A 4FWWA 5EBGA 1KGIA 1ECCA 4P5MB 4MJ5A 4ZI7A 3IFPB 1E3WB 1TCUA 1N7HA 4MWDA 2ZYHA 2DWSA 3AQIA 1QQ7A 1I3LA 2UYYA 2IE0A 3P77B 5ETJA 4F5YA 5CAEB 3EA4A 4FZEH 4IMKA 3VKUA 1NOFA 3LY7A 4S3MA 1P5UB 3IXLA 1L5HB 4UCQA 4KK9C 1G87A 2BVPB 2A9RA 5CYFA 2AFIE 1KMIY 4O0LA 5C09B 5F6IB 4YHPA 2X0KA 2UV8A 4F3YA 2OSLB 3NDRA 1T7YA 3N0XA 4L15A 2C8NA 3KFVA 2ARJB 4G8IB 1QK4A 1U8MA 1K7FB 1EJ0A 3SJVB 1FAIH 1PW3A 3II3A 3OCWA 2WZCA 2Y1FA 3LVQE 3NIGE 1ICTA 3R7QA 3B7SA 5ALYA 8AT1A 4NMXB 3MLYL 3HMWH 4X6EA 3D2CA 2YBEA 4MQXC 2DETA 2UZ1B 2PNJA 2F15A 1CUAA 4NRDA 1J5HA 4BLQA 3ZIUA 5AMXA 2D0PB 4FCVA 2COUA 2EDDA 2X3FA 2XMCA 4JM0A 2YXVA 1Z88A 1LD9B 4LEIA 1HKHA 2YVKA 4QDOA 3CUPB 2JDIA 1EFCA 1FSGA 5T6BA 1F0KA 4H4CA 1ZOIA 4JBHA 2NYUA 1U21A 2REQB 2OXEA 2VJNA 4D9NA 2FJPA 1BGXH 1PGQA 1ES9A 1FYHB 1FL6B 2IFFH 2BTEA 3LN5B 3SVTA 3TAXA 1CGXA 3JTSA 3GFPA 4WDIA 3PIRA 3B1KA 4L0CA 3RTQA 2P9CA 4JASB 4CT5A 1GIGH 3U09A 2GJKA 4F57H 2EDEA 4EGCB 4TVBA 3LT0A 3OX8A 1U8XX 3WR5A 1FQ9C 3UIZA 2G5PA 5CG1A 5C5IA 1UIRA 1MAML 2ENYA 3TSZA 5CA0B 4QFCA 3AMLA 3N2KA 4XH9B 5I6OA 3ZE9A 2FWLB 2WNKA 4WY8A 5MHTA 1CRLA 2DUWA 1ADWA 4PM1A 4E14A 3WG9A 2YXPX 4TSKA 4W1TA 4TUYB 3NIBA 3ZXYA 3NAAH 2O0MA 1YCHA 1JJAA 1KKLA 2EERA 2SKDA 3B5JA 1NAMA 2VH5H 5F7WC 3MELA 3P96A 4X6CE 3KW7A 1P29A 3PGDB 1JJ7A 2EX4A 2V97A 4M8QB 1KJVA 5T5QA 4KHTH 1Z5UA 4BH7B 3U3KA 4UOZA 2YV2A 4NQZA 2YWZA 4IXMA 4ZZ1A 7REQA 1GUFA 2YWFA 3WDHA 3REQA 2CHXA 2WHVA 2CO3A 4BUJA 3QUYB 5AKJA 3T65A 1T6NA 1K9VF 1UPFA 4LYEA 3IDFA 3MYJB 4HLZH 5D7NA 1S9DA 4EEKA 4KXZH 1XYYA 4QOSA 5DLPA 4QTIL 4X0KA 5E94A 1VTKA 4X8JB 1OARL 1D7AA 5HS6A 2V7QD 3QUAA 1ICIA 3G0BA 1GAQA 3ND8A 4EYQA 4LOIA 3DOUA 2H0JA 1A6UH 4LIQH 5PAZA 4CGYA 3QELB 5H94A 4RX1A 1KEUA 2A35A 1DU4A 1N8KA 2ENUA 3B1XA 3LX8A 2OMWA 3SKJL 3L2LA 1XMVA 1BAGA 2O06A 4R3UC 3D5EA 3OKCA 2W93A 2FX3A 1JQAA 3TKYA 4WU7A 3JVDA 1OTXA 2HUHA 1R33A 4HJJL 1N2CE 3MA9H 2PAAA 2EZTA 4R97C 4LIQL 3MUOA 4YC7A 3VZRA 1BVHA 3HLKA 3ZLJA 1NLUA 3BIWA 1E99A 4AGQA 4BFUA 2YDYA 4TUKH 5EXEA 2ZCLH 4OHUA 4YT4A 3HB7A 1C8VB 5K0ZA 1D5XB 3EVNA 3QJFB 4UNTA 3N9IA 1BV8A 1TTFA 4B3EA 4HJTA 1GGNA 3UC0L 3ONWA 4L6CA 2CDGA 2IP1A 4EFDA 2GAJA 3ZE2F 2I65A 2XZOA 1S8DA 3VU1A 4E9QA 3DJRA 4C6TB 4RFOL 1BWSA 3UFXA 4TYUA 4POOA 3ZW8A 2VHEA 3B8EA 5SWSE 1P53A 4OMFG 4HRXA 4FN5A 5DQJA 5JASA 5E99L 1KAEA 2IXFA 2UZ0A 2VRWA 2NPLX 1U3VA 3DB1A 2AUMA 1ADFA 3D50A 3FY4A 1EMDA 5IW3A 2Y71A 2FYVA 1I7NA 4LJ7A 2VAVA 2QV2A 1SZPA 3W9YA 4FL4B 4Y7OC 4FOSA 1OF1A 2Z95A 1BFOB 3ET5A 5HGBA 2R1WB 1LI5A 3AUTA 3VJKA 2MCPL 3V9PA 4JN1H 4RPCA 4B7CA 3VKWA 4Y1AA 4ML3A 4ENZA 2PVPA 4D0GA 1ISGA 2BGJA 1JWBB 1NI5A 1OK8A 5KJ4A 2IVZA 1QQ5A 4TSAL 4ACPA 1JSZA 4Y2DC 5F0JB 1XZWA 3IJ8A 2VTEA 3DMHA 5E2UH 5DGCA 4MAYA 3RBSA 3BGFC 1V3QE 3ABQB 3A3YB 2IFFL 1TNNA 2R62A 2EZ9A 1EEYA 4C76A 1Z73A 4X6FA 5E7IA 2ZJ3A 5LAXB 4KI5E 1ZTXE 3V1NA 4KTDL 1GDHA 3CDZA 4ZREA 3DG9A 5IF3A 2VPPA 4GUAA 3UENA 2PVSA 4RTNA 5I9BA 1TETL 3GMPB 4NABA 2CZCA 5IAJA 4EUPB 5HQTA 4DTIA 1S4MA 1KMMA 5K59E 1U8EA 5KS9F 1N36B 4P49A 3WLQA 3WIUA 2AZDA 1ZD5A 2EINB 3H2KA 5LQBH 5EUKB 1KELL 3K5SA 5I71C 3L5JA 1ZKMA 5HK8A 1LM8V 4GYJA 5AW2B 2ZSAA 4G8IA 4NNXB 2C9AA 1CNFA 4FP9A 1WUHS 2IYOA 4PICA 3CX2A 2D5CA 3X1ZA 1ONOA 1GQYA 4CM5A 4OF5A 4JJFA 5JS8A 1WQ3A 1OFTA 2OGTA 5DLYA 2NQTA 1O94C 4EABA 3FT9A 3AQXA 2F43B 4KAXA 2XWXA 3PQ2A 4BQCA 2AAVA 2WXOA 2CLVA 1L1RA 1SBNE 1OTTC 3C5ZB 4BFNA 4S12A 3RUHA 5GS0H 4E4RA 5T1MA 1W2HA 3OUTA 1F6AA 1N4XH 5IBRA 1Z29A 2XUQA 3FNQA 4X5XB 2ATPA 2C0QA 1NFAA 1Q7EA 4YGXB 1ZCRA 4LO9A 2FMUA 3AB0B 1NYLA 4EW6A 4KH0A 2CMKA 3IE9A 2PR7A 2QYTA 1CNMA 1TQVA 5I9TA 1GG8A 1CUBA 2GIXA 3P0RA 3DPBB 1UZLA 3TLJA 1W75A 4YX2L 3PLRA 4NJEB 3DKRA 3NYKA 4J1UA 3KQLA 1ZD2P 3HP7A 2PWEA 2X4LA 3FQ4A 4GP7A 1FYXA 1N7MH 5DX8A 4OPMA 3ASZA 2NXYC 4LDAA 4IIZA 2ZPUA 4QG3A 1FP1D 4MD4A 4MMYA 2PA3A 1IEVA 3CXFA 3DJZA 1M8GA 3BSHA 2A3TA 1BKSB 1KYOK 2NV2B 2WIBA 4IXNA 4CKVX 5EJ8A 1BBDL 2I76A 1HT6A 2QPOA 3FUMA 1YMMA 2ZF8A 3O3MB 4PBSA 4K9JA 1A5BB 2EC5A 3MA7A 1ABEA 1K68A 3BZDA 2Q7YA 1NIJA 1UCTA 4WOBA 1CBVL 3WJAA 1K5DA 1U0GA 1GAWA 2PGXA 3ETGA 5K3CA 4LF8B 2EUXA 3RWMB 3LW8A 3PJEA 2J21A 3ADOA 4RAVA 3OHXB 1X3DA 2JI8A 4D1YA 1OKKD 4P9MH 1XTJA 4F9FA 3P2OA 2FPUA 3F01A 1MCOL 1XALA 4KXBA 2E86A 1J0DA 1NA5A 5GJTL 3STLB 5C86A 3CD4A 1XTPA 1M71B 3OAYK 4OJMX 1N8ZA 4RD6A 4YDJB 1YBHA 2B8TA 1MQAA 1AUQA 3E3MA 1TQBB 4N2CA 1XGYL 4UNUA 1Z7JA 4F5CE 1ZAKA 4KKCD 4P4RB 2ZONA 2W6QA 4MVJM 4QU8A 2AV7A 2OFFA 2VH1A 4HPXB 4KRNA 4PTTB 4NAVA 5KVVA 4Z7UA 3MPOA 4TPRL 3ED1A 4PNZA 4ZFOB 2VZEA 4GEKA 4DQOH 4PJGE 4IJTA 5DUJA 2DHEA 4PCUA 1VHPA 2Q8BL 5A3QA 3IJHA 2QTGA 3CMCO 2AJYH 4JDEB 3WGIA 4MVBC 3RL1A 3SHTA 4YAJA 2VLRD 1R6AA 3FHOA 1I4FB 5C46F 3JRWA 3HR5A 4E5VA 2FSVA 3SE0A 1ZVYA 3C3PA 3TD6A 4L0PB 5K3FA 4LJ9A 4F6LA 4HKJB 4JJOA 4LPWA 4U33A 1VCNA 4F1KA 1NMQA 3CFDB 3V1LA 1NJ8A 1YAJA 1OIOA 4U1IB 2Q0HA 3BZFA 1BGVA 2RKWA 2XYCA 4IMJB 3QEMB 1JZTA 1MREL 4HS3B 4R2IA 4PZ0A 5MDHA 4QC2A 4LZKA 2UX7A 4GB9A 4IQ0A 2ZNXA 1RY7B 1I3KA 3R23A 1FS6A 2XZAH 1FFBA 5JAQA 3VFVB 3N86A 4K03A 4Q9HA 3B1WA 1HO3A 1JHZA 3MJ7A 3QEKA 5EOTA 3ALXA 2CXNA 1PJSA 5ALPA 3OCUA 1MHEA 3MVEA 3I76A 4ZTEA 2IDZA 3MB5A 1SCAA 1T5IA 3OKEB 3MVSA 1JVKA 1CLOL 1CMOA 1XCOA 4GZ3A 3QKRB 2H32B 4CMGA 1J1ZA 4NQVA 5EUOE 1RVDA 3WA6A 2JGIA 4ES6A 1XCQA 3MV9D 1RUQL 5H0IA 4AF7A 1CICA 1U63A 4JDTL 1TK9A 4LCEA 4F24A 2ST1A 4PCVA 3PWJB 5DVMA 5L45A 2RH9B 2RAPA 1SBYA 3LP8A 2HB0A 4E7OA 2Q45A 3ZR5A 1TU3A 3JVFC 1R1DA 4PYMA 2FSUA 2HT2C 4I3FA 3EYVB 3GGWA 5IM5A 3CSPA 4OYHA 4TN9A 3E8MA 4J7RA 5AOBA 3QJHB 4MR8B 3RYIA 2X4OA 2YVLA 1U33A 3N41B 4UT6L 3RBXA 3UFIA 2OVFA 3H7BA 1IUKA 3FUWA 2MIZA 5IB4A 3N1FC 4O2CB 1Z0ZA 2Z34A 1VACA 3T5DA 3RAJL 2UVPA 2JFPA 1H5BA 3JQAD 3G04B 4REQA 2WSSD 1T80A 4Y6LA 3ARBD 1R24A 5FK9B 1RI4A 3LWNA 3IUQA 4OLXL 1I4WA 2QGDA 2OL4A 1I8KA 2Z9TA 5DJ0B 2YWDA 4KV7A 4J1SA 4ZUVA 3ZZQA 2B6NA 3M7OA 2NX5B 1MI5A 4EF5A 2E59A 5IEBA 1DUYA 2ZXEB 4OGXL 5EP4A 4NO5A 2O2JA 3K1AB 5HUJA 3VH3A 1LBIA 4FQQB 3LJKA 5FCUH 4IY1A 4PLPA 4GX5A 1YA5A 1SC6A 2NW2A 4DC9A 3GUUA 2WQWA 4WQMA 4NARA 4L4RA 2ARJQ 2VXSL 2FHSA 4DZBB 2JLCA 4UOW0 2XPGA 5JNVA 2E56A 3VQMA 3ECVA 5I75C 3AL0C 3C60D 1SDDB 2V6GA 3K1TA 4M5YH 4G0UA 4PV8A 2FAUA 5D4JA 1ZNYA 4XPHL 4GC9A 2JFXA 3HAEB 4JB0A 2MU1A 1CB0A 3C6EA 3UWKA 1Y3AA 4LCWE 5J9PB 4L8SC 3EJWA 3K1DA 1KJMB 1GS6X 3HS9A 1B74A 2EJVA 2H2GA 1GL7A 1CDBA 1W72B 4IEIA 3Q1EA 1JJFA 1YZNA 3VO0A 4HOWA 1HWHB 2ZI3A 4FYKA 5A5DA 3EZXA 5IM4A 1AD9A 4JFEB 3OT1B 3BD8A 2O8EB 3IJ5A 1P4JA 1GCGA 3L6RA 4PJ7E 4RTMA 5B39B 4KI7A 1OA0A 3N1UA 3ZD7A 1J88A 1JZEA 4PVBA 3IUBA 1PZ5B 1DO5A 5EOVA 4UNVA 1CLEA 2XMZA 1OT2A 4P4KA 2WUDA 3I4CA 5LHDA 1THTA 4IM7A 3BWAA 4IBVA 5E6IB 4P9HH 3EGDA 1JL3A 4CM3A 5C0ND 1EZVY 2OC9A 1MRDL 4WFHD 4O5LL 4P2RE 1AB6A 3E3AA 3VJRA 4TMZA 2YKKA 4YDJA 1WCWA 3ULUC 5CLLA 1CY6A 4DVRL 2VZLA 4FPXA 3C70A 2FE1A 1F2TB 3WMQA 1KEZA 3AKCA 1EGJL 1R4MB 1Y6JA 5F8QC 5DK3A 4HD9A 3FPJA 3TO4B 3VGAC 5ALVA 1SXSA 3AU0A 3RU3A 5CMLA 4IRJB 2OZ4A 1E79D 4WF7A 4F3FB 4R51A 5EOTB 3LVEA 3JVGA 2PPFA 3L4BC 3F62A 2DQJH 2ZCZA 3KT3A 3RUFA 3HZHA 4YLCA 1FWXA 5JUWA 3FTUA 1AXGA 1GTNA 5CBEB 3JYLA 4X84A 5CH8A 3PCYA 4DZ8B 3L2MA 5JW4R 3KVQA 3AM8C 3HBPA 2DQZA 4PLGA 1FE8L 2HFGH 2F53E 1D5MA 1RLTA 3AAZB 3CHSA 4V03A 2AGJL 2ZOLB 3RK4A 5E8NB 1ONQA 4JY4B 2OM5A 1I5RA 5IAKA 4JU8A 1U3CA 1VPEA 3KJIA 4IIXA 4U1MB 2AQ2A 2YGOA 1GGEA 2YYAA 2TMYA 1VEPA 3IJHB 2GTQA 3H6AA 2BNRB 3L48A 3AJEA 1NNUA 2FL5A 3N2LA 3N3EA 5JUEH 3GJFK 4PRDA 3HV0A 4PJDF 4NKIL 1IPEA 5F76A 5FTWA 5J57B 2OSLA 2JIZA 4K07A 3H2GA 4XLZA 3TRIA 4JUSA 1TJXA 5E9QA 1E7QA 4Q7KA 5E9WA 3O45B 2YZKA 2Y7QA 4ZAKD 3I2FA 3TOXA 3AROA 3AB3A 2CGRL 3TFKD 4IRSD 5EDXA 1Z6XA 2JGMA 1ZLSL 2J45A 4IDPA 3QQ4B 1CB7A 2LAGB 2DR2A 5T1KD 4E51A 3KNBB 1ADYA 2J46A 4W1PA 3IERA 3AI2A 4Y0VA 2WD7B 4A2DA 4WWOA 4ONFH 4LVOA 3QPUA 2E74C 5K59F 2AK1H 4Q4IA 5D7JC 3G0GA 1C7TA 3DO8A 1H19A 1MFAH 4OLVH 3MS2A 1F3JB 1KGJA 3NP9A 1MF7A 2GT9A 3QEUB 4QYIB 5BW7A 4MJJA 3B4NA 1ORQB 2IAND 4NPYB 5H37A 2PSFA 3WELA 5DJ8B 2V6HA 3DL0A 1CY8A 2OY0A 1QV9A 5J2TA 5C0GA 3W9DB 4YT8A 1X80B 2YHIB 4P2GA 5AVWA 1JGDB 1RAEA 1ZD9A 2HK6A 1EJ2A 4N8CL 3IUPA 3ZZMA 1FL5B 2A86A 1X5HA 3CEJA 2ZSJA 5KS9B 3M5CA 4KXYA 4IOJA 3FTQA 5T3UA 4AJLA 3B9EA 2IPNA 3IUSA 4ZZ3A 4DMKA 3TIIA 3FTNA 1AGEB 3FXAA 3UFBA 3N6VA 3MA0A 3DXAA 3LN5A 2R1VB 4AJNA 4IDNA 1QGAA 3OG4B 3ROQA 3KBBA 3AY4C 1GRWA 2Z2JA 3F2LA 3GTNA 2DQCL 1X7YB 1DEEA 5B8CB 1HKLH 2XAUA 3GPBA 4WD3A 1PZCA 3ZYJA 5B1AB 3FUTA 2PUTA 1ESMA 1BMZA 1BWRA 4I0PA 4B6PA 1PS8A 2C3GA 1ZHFA 1A2YA 3WSQH 2X0IA 1VE3A 5EC1B 5L7WA 3SFZA 5DC2A 1NU6A 1VBNA 2RALA 4GKOA 3KM1A 2DKUA 2W9LA 2C4FT 2KBGA 3ZMEA 5BUSA 4MEBA 3E9RA 2NXCA 2F8IA 2OMBA 1Z4LA 3K2EA 4K71B 3LPNA 4JKLA 5FCSH 2V7XA 3DYIA 4WI2A 4ZQGA 1J5OH 4NZRL 4Q3EA 5BMOA 3SU8A 3FT1A 3IOCA 4XNYL 3AGVA 2YHAA 5AOCA 2H4ZA 1U7ZA 4XX1G 2X4UA 4PWEA 1Z8FA 1OANA 1FFNA 2NY6B 4U31A 3CEHA 4PVNA 4URWR 1HNGA 10MHA 4PX3A 4DO5A 2VLLB 1E7WA 3MBEA 1DE0A 2O8DB 4N0YH 4K3UA 1A7UA 5LG6A 2YFOA 2P1ZA 1NGSA 3HC3L 2W65A 3IXTB 1YONA 4YI5A 4K5QA 3O3DA 4KIJA 4L50A 2RGNC 2ITFA 5D1ZA 4BH8A 3VB9A 4OH1A 4U02A 5CXSA 3RVBA 2N59A 5C2BL 2GSIB 4DV1B 2M9MA 2ZRJA 4H7IA 4YHIA 4JJ8A 2VH5R 3UMNA 3WNOA 4Z53A 1W8EA 4I1RA 4IS6A 1B8UA 5GS3A 4JB9L 2ISCA 1XR9A 1ISPA 5IROC 1OQXA 3IS1X 1AR2A 3K16A 4J3OH 2RJ3A 4KLCA 2F1BA 1V10A 4NIYE 5FUQA 3QFCA 3BMXA 4G7VL 1RPJA 3P2BA 2F9BT 3O4OC 4LGMA 2PX6A 3FGNA 1SFRA 2WXGA 4JLJA 3LZRA 2J4WH 4F27A 1B0PA 4JREC 2ODIA 4DCTA 2VQTA 2E6QA 3DA0A 3NASA 4RMHA 4R1PA 1JSLA 1QVAA 4G3YH 4H6XA 4HL6A 5DGHA 5IM4F 3BFWA 5IV2B 2DQUH 3GC3A 2V5MA 4IBTA 2VF2A 4MI1A 3E8XA 5I75B 3QEHA 2H00A 4S0ZA 2R0QC 1LNUA 2WTMA 4RY0A 3RFFA 4MJID 4RWZA 1VLXA 3D8MA 4KR7A 3DQPA 4HLNA 1JMKC 1E2BA 1J5CA 5ERWB 2YJQA 1VPWA 5EFOA 2OV3A 3LAWA 4G1MB 1JQJC 1BG9A 3AY0A 1PWYE 5LJYH 4QARA 2A83B 1Y6NR 4OT1H 2DLHA 2JLSA 4RIRA 3L6FB 4L4JA 2XIJA 3IHTA 1AQKL 1G7QA 1W9MA 1CP3A 3SE8L 5CU5A 1IBGL 1HQRA 4IOSD 4LJ8A 1CVIA 4BHUI 4FOPA 2DLIA 4MQ6A 3FZUD 4HV8A 1RZFL 2F61A 4IDQA 2PR4H 1AM4D 5B7EA 2DJ4A 3M45A 2HG5A 4F3FA 2P5WD 4M4PA 1TT5A 3N8HA 3ML9A 4A6YB 1LQTA 2PPEA 4DHWA 3MUGA 3I39X 3P9ZA 5THQA 2DERA 5MENB 1XL6A 5LQKA 2ORVA 3AEYA 1MCLA 4MRSA 3ZIAA 4MITA 3MUGB 2XYVA 1E9EA 4XN5A 3SC2A 5BWMA 1OIWA 3JWOH 2CJUH 1M2WA 1UUNA 3RX7A 3QA9A 1QF7A 3ID6C 3D34A 2VJ8A 2IYAA 2XMPA 4MV6A 1FP4B 4XCFL 3GHBH 3CFIC 1P7QD 2NY5C 2PN5A 1IGML 5DEOA 2D3WA 3ZHVA 1L0XA 4D3FA 4MAUH 1P60A 1JNYA 5C71A 2QU8A 2I60H 5KU7A 5CCDA 1U8HA 2RHBA 4Y9DA 1A9XB 5BXFA 4C2BA 3IS0X 1QVOB 2J12B 4XTRD 2BWIA 3QIBD 1PKXA 3X3HA 2JFWA 3LNFA 1LD9A 3WKQA 3BAEL 3F7TA 5KSAA 1ZN8A 1G8JA 2B1AH 1E7SA 1TEFA 1RYZA 3EAFA 1ZVVA 1KTBA 4IOIB 4L8LA 1AZRA 1FNSH 3C6MA 2IU0A 1NFFA 1U0HC 3D7MA 2C2OA 1EFHA 4YFEA 5HYIA 5IT5A 4ZIRB 2QBYA 4M49A 5E7FA 2Y1DA 3PXAA 4OMCA 3PWVB 3HCNA 4OOFA 3JTTA 1YQWA 3EOBI 3A4YA 4F84A 5C0AB 3SEQA 4HLQB 1JH8A 1DLFL 5IOPB 2E5EA 3UHFA 4QBFA 1E69A 5DB4A 1N2GA 5MEPB 2EH8H 1CY7A 1RK0A 2OR7A 1O5TA 1C5BL 1ZK9A 4XAWL 2ZRLA 2OD7A 3BFVA 5GGTA 3GSWB 5KG9A 2ASVA 3HPJB 4JKOA 3HJGA 4C83B 1SKAA 3PJRA 2D7TH 3IRZA 1QRAA 3OR6A 4BJ1A 2CCGA 3SWWA 5I1JH 3DZBA 3AM8A 2XT0A 2P1DA 3D52A 2FZWA 4JP8A 3STZB 3HMKA 1VLVA 3GNLA 3DT8A 1SKYE 4HJRA 2R7LA 5HDBF 4AQ1A 1J9ZA 2FFHA 1UAAA 1ZOLA 5EA0H 2OOKA 3KXLA 2IYRA 4I87A 4QXRA 3ZU2A 2PBRA 4JO8A 1D2OA 3CO0S 1UB6A 2JSFA 1X7YA 1GPDG 3I42A 3TT1L 3CVUA 5IBUB 5BPFA 2JI7A 4AYFA 5CM1A 3DFUA 3ABRB 1U8FO 4NQUA 4YJGB 5JQGA 1XAJA 2H1PH 1I8TA 5LBVA 4MCYA 1D2HA 3FFBA 1Y89A 1PDWA 1A72A 3VI4B 3B52X 3L1VA 5E95B 2FUEA 4PTUA 1CS6A 1DANU 1WU8A 3I6YA 5KJRL 4HOZA 2YWGA 2I6UA 2AMFA 1Z5GA 5GRUH 2AH5A 3UA3A 3E7PA 5GGVY 2OQ2A 1EEZA 1SVSA 4JQIA 4O2BF 2JVUA 2P2GA 3ZDYE 4BV2A 2NU7B 4NG5A 3KJHA 1PWXA 1HBJA 2GN1A 3QJRB 3GRCA 4GXUM 4BGDA 2VHZA 2XLBA 1QV7A 4FFZL 1YU9A 2BFGA 2X7XA 5F97E 1RAIA 5I7AA 3VXSA 4ZOLB 3ESYA 4O2BA 1KJ2A 1AHHA 1J99A 3V5NA 4XBMA 3LV3A 2KE5A 4M1WA 2R8PA 4EI5B 1E32A 3O11A 1VEOA 3ENZA 1MIEL 2G7ZA 1DCFA 3CVIL 1TMOA 3SLGA 5C0DA 4M53A 3EGEA 4YRTA 1MO6A 3QAZB 3H65A 1YQDA 3WO1A 1KTDB 2X8AA 4MB5A 4UD2A 3MINA 5EO9B 4MKTA 4CBVA 5FS5A 3JWJA 3RVUC 2HYMA 2ZRIA 1N59A 2PCPB 3FRPB 4DGYL 2JIMA 3ARFC 4F93B 3OJDA 4KO2S 2HJVA 4Z8YA 2BFVL 1G98A 1RRFA 3HA2A 3T9EA 5JE8A 4MLZA 4EARA 5F1OA 5EZOL 2YFKA 4KUZL 1IO4C 2XY4A 4PJ9D 3YASA 2P45B 4O1MA 2DIJA 4YE4H 1KOLA 3LIPA 2ZRQA 3D4BA 3SKOA 5JADA 2GB4A 3LBHA 4K9QA 3VFDA 2WHRA 2Y5QA 3BN9D 4WHYH 1EUYA 4EA6A 5FULA 3T2PA 3TZLA 3REGA 4OZFH 3COVA 4JJEA 1G38A 4A1RA 4UARA 2FH6A 3TTXA 2ZPKL 3WKNA 5FB8A 1P2SA 4FGZA 4ORGA 4WSOA 3GGCA 1PTJA 3G2MA 1P1HA 3WENA 1G1CA 2ATKB 3SDYL 1XZPA 3IQWA 1FVCB 4R31A 1MJJB 4ZS6D 1CIVA 2WM3A 1FE8A 3VUEA 2WR8A 5CLFA 4PC3A 1MCKA 3LBIA 3LP6A 4XLTA 1Q0SA 4Y5YA 1LNUB 3VU3A 1AZZC 2AUNA 4FMDF 1O95D 3S1SA 1SBTA 2Y9RT 1TZKA 2IWGA 4HLUC 3QDAA 4UE3S 3RK0A 3A5VA 4K9RA 4NN5C 5IH7A 5GRJH 1AG0A 1KBOA 3UAJC 1AMYA 5D86A 1IXZA 4O4HF 3BGFB 3CDYA 1TDJA 3L17A 3KSDO 1TK3A 2EYQA 1D04A 3LEYH 3ZEAA 2IQIA 1QFUH 4D26A 2A2QT 3L7IA 4DSZA 5D4QA 2FEXA 4KR3A 3IA7A 2C5AA 3BB4A 2WVUA 1SIBE 3IDMB 4MSWB 3ZWWA 1L5KA 1NIEA 5GZ1A 3W2DH 5AB2A 1OBVA 2ZYSA 1MOZA 1SKQA 1SO8A 4DMUB 4P9ML 1X5LA 3FWPA 4F7TA 3IYLW 3DX7B 4BDTA 4XSGA 3RS8A 2JXMB 3FZEA 5MN6A 5DSCB 4NNJA 3HB3B 5AJZA 3BK7A 1YE5A 1PSDA 4FHJA 2BC4B 3LBNA 2PKDA 4RFNC 2CCKA 2PKCA 2ZI6A 4ZMXA 4YXLH 1USUA 3OAZK 3V1YA 3HA7A 2CIKB 4MUKA 1CFQA 4OFQA 1HSAA 1QW9A 4J28A 3AEUB 5HR5A 3QUXA 4NE9A 5A05A 1LNQA 5DHRA 1U2DA 3Q1SL 3DURB 2Q3MA 3D18B 4J9UE 3RYHA 5F1IB 3HTLX 3IMUA 1SCKA 3ZCPA 3SDCB 1P1IA 2WLZA 3HKZA 1NP3A 3TEXA 2WBKA 2GJ6D 4ISVA 1GITA 3BK2A 3TZQA 3NEEA 2O19A 5CFAA 3M8OL 1F41A 3LK7A 2LLGA 3H55A 2LU7A 1MRSA 2BEUB 1BTOA 4JSTA 1CC1S 5J56B 1F6AB 4PN6A 2GXSA 3KYAA 3T08A 3HKEA 4F3CA 4AVHA 5HEKA 4ZS7L 1JAYA 4HAYA 5KAQG 2A73A 5JSUA 3VM5A 2QORA 4X3OA 3RJ5A 4XVJH 4U2ZA 2R59A 1JHTB 3NEOA 4ER3A 2V4UA 4A91A 3CXDL 3P94A 2ZRHA 3D4OA 4KROB 2B08A 5GS0L 5KTNA 1BQSA 2WJIA 4PD4J 4UBLA 2PO5A 4DCVA 4KKPA 2H2FA 4EO9A 3L7FB 1JHUA 4KNSA 4B84A 3LEVL 2ENJA 2BIFA 3F5MA 4KUCF 3VMMA 2ZX9A 3D3JA 1A0QH 3LPWA 4P2CG 2J9ZB 3PRJA 2HJLA 1NCHA 2EEAA 2NW6A 2IANE 2WVTA 1JGVH 1UK9A 1Q72L 2VNJA 1ZQ9A 4JQVC 4QOKB 3ZNNA 2RH8A 3IFOA 5C7XH 3WGOA 2Y4NA 5LQBL 1IBFA 4DR5B 5GJBA 3O1JC 1JUFA 3W11D 4WERA 4KJXA 4DK5A 4EUFA 3VR0A 5ENWA 3E9CA 1I3RA 1I3CA 2GXAA 3DC2A 1NP7A 4QGSA 3B83A 1TO5A 4UTNA 2BFWA 2GW5A 1VYUA 1V3KA 3NZ8A 2WF6A 1ZWIB 4ZVNA 5BYBA 4YDHB 4C30A 4W6WB 1SHZA 3SODB 8MHTA 4NQSA 5JS2A 4QNNA 3RHWK 4KZCA 3BH4A 1JYVA 1X1CA 4H25A 3U3MA 2V5YA 3W77A 4NYLA 2A6IA 1YNOA 1SXJC 4LHWA 2O57A 5AI5A 3RWHB 1LF5A 4ZX5A 3EHBB 4TSAH 4D0CA 1QHNA 4OYLA 2YJTD 3IRCA 3D7LA 5JMPA 2O6LA 3GIVA 5J2UF 1ZH8A 3RLSA 4OCSL 1T4DA 4I8DA 3RZWA 3O93A 4AENB 3Q3GA 3FHCB 4AEHH 1WMDA 4HCJA 4GL2A 4CC4C 1BXRB 1DFIA 2BHYA 1EA9C 5F7FA 2XMRA 4JHAL 4RHTA 1BVZA 4LK4A 5JHGB 1RP8A 5TGBB 1D5ZA 1XMSA 3BP7B 1EESA 4W1QA 3LHFA 3OH8A 3IL2A 3U2SB 1TZBA 1W30A 1GKUB 5E2WH 4MIKA 3VO1A 3FFCD 2QEJA 3RGBA 2EARA 2KQNA 4RFSA 1U2YA 5E4AA 1G7QB 3CLTC 4DA0A 1W49A 5DRYA 1IMHC 5CH5A 3DX0A 4HTFA 2VK1A 4HWBL 3GK3A 1TF7A 4ETNA 5E8RA 1EPFA 1QZNA 4KPFC 3CFDA 1BLIA 2VP6A 3FQXA 5C08E 3NM6B 4G3YL 3PC8A 2AIRA 2ORWA 4D9IA 5MGBA 4OVVA 4KK5D 1UOVA 1CF8H 5B58T 1SVIA 4FS3A 5ID0A 1JDNA 1TT6A 1SC4A 1L5ZA 5E2JA 1N7JA 5B2EA 1JT2A 3MCAA 1G7IB 4FHBD 4JFED 4ZVQA 1NDTA 2XUGA 3GJ0A 2MMXA 1W4AA 3HYCA 3E6HA 3CHPA 1KEKA 3WXMA 4L8GA 4D0NA 2YD8A 2QS9A 3ASYA 3HNSH 2IALA 4Q9NA 4GAFB 2Q6IA 4D9RE 1IFGA 2HGSA 2OT3B 2ZWNA 2B61A 2BRUA 4XVSL 4NRXB 4P3CL 1H9DA 3FYUA 1X5KA 3SJVA 3LEYL 1FL9A 1J8FA 3PGA1 4LVHB 3L8MA 3ICCA 5H4ZA 4IGFA 3G8CA 4UXIA 1SY6L 1OJ7A 3GLHA 4ZW7A 2C3VB 4MJ6B 2Y36L 2EE2A 4LSPH 3AI7A 3ZCRA 3HG4A 4G9FA 4PP1D 3QZWB 3VPGA 4IVNA 2QVKA 4PAWA 1K2DA 1Y1TA 3V0DA 2ZYGA 3ZE2E 2R2CA 1C7SA 2GVZC 4N3NA 4WZAB 4UJ3A 3FMPB 4ONOA 3ZL4L 1SJHB 2MOQA 2R69H 1L4GA 2JAOA 1IAII 2K5UA 2WVHA 4TYMA 4GXTA 4K9EC 2A5YB 2P9TA 1PHRA 2YD5A 1Y6GA 1NQWA 1BXVA 3WNMA 2XYHA 4MLSA 4R98A 2C3XA 2P9QA 4APXB 4C7BA 5ITBL 3PKZA 4WMLA 3GJRA 4V1CI 3LX9A 2ESVB 2BEJA 3IVMA 3B20A 3E5NA 4P3PA 5IFLA 4OJYA 3RWDA 1HKLL 5KTPA 2FEDD 1JBEA 1QFWH 2AFVA 1DAOA 1QYWA 3VDXA 3AQ4A 4LC0A 2R25B 2XNAB 3E18A 1XGQA 3M6DA 5GQSA 4M6OL 4XA8A 1NPNA 3EXIA 3VPAA 5FYDA 2Z35B 2GM5A 4NYJQ 5A2FA 2YXEA 4D6YA 3U1VA 1DVUA 2C9PA 2C0CA 4PLYA 3WYBA 2W2MA 4ARIA 3SQBB 4JEGB 5AD1A 3IOEA 3CFQA 2WPGA 4YAEA 4KK9D 3SMVA 3NS7A 4RE6A 2H0QA 4AZUA 1T43A 2QLMA 2AXGA 4RADA 2Y1XA 3G0HA 2FQGA 2DEXX 3EGOA 3OPXA 3E2PA 2VF5X 2R8BA 2K7FA 4XO3A 3GFVA 3VSBA 2FR8A 1I8KB 4LGRB 1W36D 4P5PA 4J0QA 2OBLA 2Y2VA 3LKNA 1KAOA 3OFND 5HBGA 4Z7IA 3W6NA 2CMFA 4YZWA 4A04A 4RY9A 1I7ZA 3OZGA 1K4YA 5J3HD 1VFPA 1S7WB 3IMSA 3V7NA 1TLFA 2XE7A 3R3XA 2OSVA 1VZIA 2X4DA 2R51A 1EBPA 3MWEB 3QQXA 2F6AA 3G23A 2QMJA 3OQVA 4HGQA 5C0BD 1E9RA 5H16A 3FF4A 2ZRAA 1SXNA 2H8KA 2YA2A 3PKJA 4WPGA 1EDZA 3T4PA 1NUGA 4O02L 4LDOB 1M7DB 1F11B 3MYZA 5LWYL 5JR1L 4KC3B 1C81A 1E4EB 2I29A 5DW0A 1IKFH 1JBJA 1O94D 1WXFA 3F7MA 3VDNB 3EPRA 1KRWA 4JQIL 3B9KB 2JKNA 1T36A 3V46A 2ZIUB 1NOJA 3VRJB 1AO7E 3C5JA 1LPPA 2XE8A 4EUKA 2R56H 3ZY6A 3B34A 2OZLB 4F7DA 4AW7A 5JV5A 1QQDB 3ZHLA 5AW7B 4WUUA 2H7YA 3P45A 5CLWA 1V96A 1A6TB 3G3LA 3KWUA 3PWZA 5K9QI 1FE8H 5JPNA 3MRIB 3PFCA 4KHTL 4QSMA 3R7NA 4XUCA 3F85A 5DHQA 4GUPA 4MQTB 4M8VA 1UWEL 1G64A 3GUCA 3I61A 2C7UB 4LQ1A 4NL4H 3VMFA 3I64A 1U98A 3P19A 1OAOA 4U6TA 3G5VB 2Q2VA 2Y3NA 2RG7A 2ZKIA 3ZT6A 3KLNA 2JGEA 2EH7H 1FLRL 4EF3A 3L7BA 3DE0X 1GV1A 1RZJL 4MB2A 4GJTB 4OY3A 5M7EA 1SHKA 2IT1A 2LDBA 4C4YA 3OSKA 3Q85A 1R3IL 3EYVA 4FZ5A 5FT9A 3BX7C 5DT1L 4GBMA 3SIKA 3QX8A 5FORA 5GVSA 3Q6GL 3ACCA 2GTPA 1LSJA 4X0EA 2OLDA 2VLRA 3C5CA 3UO1H 1U7WA 3GIZH 2EFDB 1H2XA 4TZKA 4GW1A 4Z0TA 3KGSA 4RAQA 4BFXA 3UAGA 3FIUA 3O2VH 1J70A 1POWA 3P77A 2VQ6A 2AXHA 2WKSA 4JUAA 2RHJA 2I3BA 1U9ZA 4KWIA 4L8YA 3CFCH 3LA6A 3PGJA 3F58H 3DBVO 1BVYF 3ARDD 4BNXA 4LC9A 1R19A 4ZW5A 4I48B 1MNUH 3R3SA 1CU1A 1TCRB 1NTOA 3AVXA 1H93A 2HWKA 3BXFA 1TTUA 3NQIA 2QB5A 4XFJA 4LWPA 2EDFA 3C6LA 3ZHSA 4BQBA 2UZIH 1RXUA 3BPNC 4RGOL 3UC5A 3MCLH 3F97A 2ZTBA 3PL6C 4PWIA 1K97A 3F3KA 2Z2KA 1AO0A 4RISL 3C7KA 2BSCA 4XRCA 3PQ7A 4BMCA 4EIBA 3P0JA 4X7TA 2I7SA 4K28A 1O6CA 1E3WA 4LEXL 1P9LA 4RJTA 4ZVMA 1NOIA 3KLHD 2F19L 4XSVA 3WKMH 3FSRA 4N0CC 1YUNA 1J24A 2ZUFA 4B96A 3TBTB 2C95A 3OZUA 2HX9A 1KC3A 5BSHA 2EIMB 1TUGA 4I50B 3GNML 4PAZA 1PR3A 4N8DA 3FYUB 1ESZA 4JVNA 4GEGA 1Z4QA 3IUJA 4GD3Q 4YQYA 1IM9B 2CJYA 2JAXA 1JBKA 3WIFA 2Z98A 1NXVA 1K89A 2PLAA 2BOBA 3PS6A 1G6RA 3LS5L 1TU2A 1GP2A 3QFGA 1CJUC 1FPQA 4KYIB 3R2JA 2WYOA 5IDYA 4DM4A 1IDOA 2OXFA 1TQUA 1EE9A 1K2DB 5HY9B 3FTFA 3R8BB 5LQSA 1HH4A 5D70L 5E0QA 2ZU0C 1QLEL 3QIWC 3IUEA 5E94B 4KKVA 2CHFA 3C8HA 2I1WA 2P5WB 1PU2A 2O2GA 1KSHA 1X15A 2WUEA 2IBTA 4JIGA 4X64B 1ZGLM 3LDHA 3G5XA 4P2YA 3FUUA 4BAGA 5BT8A 4YY3B 4M61A 5C7OO 3KPRB 1B0UA 3MR9B 3DTUB 2K1MA 3Q2OA 3DMYA 4AE1A 3PTZA 3IAM1 3QZNA 4Y5VA 5I47A 2J8UA 1FJ1A 4BO2A 3D1LA 1QRNB 1H9VA 1SB9A 1X86B 3FQ1A 4TTIA 4GRDA 3A9WA 5D1QD 1NFDF 4QBTA 5CJPA 4FONA 4L1BA 4WUKL 3GJTA 1TU4A 4XBGB 5IXYA 3BVNA 3GNQA 4KLZA 4ENTA 3DE5X 3KZXA 1BM3L 5AKLA 2FEEI 4Z51A 1JHPA 4MYCA 1VB5A 1NEZB 4CM1A 4EW1A 4H60A 1GW6A 2Y69B 3DX1A 2YFYA 2A9CA 1W80A 3TBVB 4IRZL 2A99A 5FPHA 35C8H 3JYBA 4YE4L 4Y2NA 3IEUA 1WAMA 4IIJB 4Q4JB 4YJ2F 5KNCA 1TFHA 2XSZD 1A4RA 5I1HH 1F3OA 5FOQA 2H54A 1HEYA 2EJBA 3NCMA 1KNOB 5E5RB 1LK2A 3RJ9A 2ZTMA 1JI0A 4JIMA 1PKQB 4XN1A 2P75A 4B75A 4C0BA 1Z5PA 4TMXA 2B8EA 2K7PA 4KKRA 2OO5C 4MAZA 4DGYH 4Y9SA 3ITEA 1U94A 4V11A 4X8GA 3TQFA 3OX4A 1AOZA 5A02A 3FUCA 3TPKA 3LJ3A 3V7AG 5BSTA 4F21A 1DBBH 4HCRH 1FLAA 5G1NA 4ZVTA 1DBKL 3GMOA 2EKDA 3DXAD 4X9FA 3QBTA 4XH2A 1FRGH 4LVNB 3I04M 3D85A 1G5FA 3K6SA 1K8DB 2XXGA 4LL4A 4FNTA 1K4CB 1IRAY 1KI6A 1VLJA 3OM8A 2G9RA 2WMPA 4AC9A 4YSSA 1OH7A 3T9WA 3NMEA 1SJVA 3C4VA 1FNCA 1P6AB 4KQ0A 3MAWA 4JFRA 2R0LH 2XLLA 2EVWX 1Z0UA 1EUDB 3C6XA 1JZSA 1XE3A 2WV7A 1FP2A 1P62B 1DJHA 2C07A 4LL9A 1TRHA 3NFYA 1YY9D 3U4IA 2M6KA 1DFBH 4L22A 4MIYA 1ZINA 1A9TA 1XZMA 4N0FB 2FSGA 4IR7A 4J6FA 1MC1A 2ICWJ 3V4VB 3PC3A 3M33A 2BIQA 3L7DA 3NO4A 2YWEA 3DI2B 1CTNA 3I9AA 1Q2XA 1WW2A 5C6WH 1R3KB 4S1PA 4YPVA 3D8BA 3LMKA 2C1OB 1F8YA 3OMAB 1YV9A 2F3RA 2FP4B 1C3OB 2ZJ1A 3MV7D 5B3SB 4LQ4A 4Q0XL 1UASA 1RZ7L 2VNCA 2W1NA 5A4IS 2AK1L 2Y2UA 4DO4A 4DWVA 5F1KA 4HAZA 1PLKA 1LW7A 2PX5A 2EACA 5BWLA 2BH9A 4MQ4A 1T0NB 2CSPA 2QI9C 4G6ZA 5F23A 5FFNA 3F7QA 3G82C 3D3VE 3AHDA 2C7PA 1JPNA 2D7TL 1DFGA 1LEIA 2A9JA 4Y2QA 3CG8A 3UUWA 4KACA 5AZ2L 5BY2A 3QFDA 2V6IA 3ZKMD 3UOWA 2BWJA 3QR1A 3VHXB 2GHQA 4UEWA 1U8HB 4AYSA 3MJ8B 5GM2A 1UM8A 4EELA 2FN9A 1WY5A 4RK5A 3W9EA 3G9VA 5ESQB 1TVDA 1FS5A 3G5AA 4YRKA 4KQMA 3C5ZC 1FLDA 4BFCA 1RDFA 3OQOA 1VADB 5I2IB 2XX3A 2YV3A 4U1RA 2VPXA 3TF7C 5I8WA 2C78A 5K69A 1QEWA 1QVZA 3FO2B 4HC1A 1QK5A 1XV8A 3F6RA 4AQ1B 1N2OA 1YRYE 4O02H 5HILA 3O3BB 4Q00A 1RLIA 4G8EB 3L3JB 3WE6A 2I55A 3NTVA 1T4WA 1MB3A 4BP8A 1EP9A 5BSUA 4AXWB 5I1AB 2OSWA 5BMVB 1PVDA 4F6RB 3UT6A 5ALGA 4CNBA 3UKOA 5C0BE 4FFVD 4XP4L 4BFKA 3U62A 5HYJE 4UINL 7ABPA 4YHYB 2GC4C 4LA4A 1AQIA 2VSYA 1XRRA 4MPTA 1XRLA 1A2YB 3R6WA 4X98B 3MBWA 3JQ9C 1KPRA 4IDCA 3PDUA 3CPUA 2AW5A 4UDYX 2H6UA 1PZNA 5EJ4A 5JY6A 1FZOB 1LJUA 3ZO0A 3MTGA 4RVFA 3DWTA 4N6RA 4YTEA 2HRBA 4FG2A 2NYVA 3I5AA 4OV5B 2Z08A 4ELKA 2ZIXB 4HB4A 2HT1A 2BOCA 1XLVA 1PWHA 1A2OA 3OQBA 2Z2XA 2VPTA 1SVZA 3LPGA 2W8BB 4QRHA 5MF6A 1RZKL 1R8SA 2CJUL 2QLYA 1LK0A 4P2QB 2BJWA 3D3WA 1FZJB 4MYUA 1TZIA 2E37A 4QXPA 4N8PA 2BFVH 4DBLC 4BWFB 2J20A 3N05A 5PGMA 3EW7A 2H6EA 2Y05A 2FN8A 2V9RA 2IEAA 1K2WA 5IMOB 2FPLA 4P9NA 3PNOA 1MN6A 4MGEA 4OUOA 4P4RA 1NVTA 3N0WA 4HR7A 1CURA 4GNKA 3IJRA 3JWEA 2WCGA 3CMOL 4J4PA 2Y5EA 3DMMA 1Y1QA 2X23A 4CG2A 3T3MB 1UM9A 1OPGH 2BMDA 5EZSA 3HZMB 3LZOA 3WLAA 3THRA 3KEQA 2V8MA 3O4FA 4GG6E 1MZPA 3INTA 3LDBC 3L77A 3OPYB 2Q2QA 5AK4A 1DX4A 2P9JA 4QYAA 5H37H 4X8LA 1CGTA 1L8XA 1GXSB 3L9WA 3OCJA 1N5RA 2GXUA 1ZVSB 4P99A 3AZQA 1N1MA 1CF9A 1XNHA 2Y7OA 1KTLB 2RFXB 3FUKA 1LBEA 1ZM3A 2C5BA 3JT2A 2XN0A 3NBYC 4HZLB 3H1TA 2V3FA 3EO0A 2QNRA 3SDAC 1P4AA 4H3KB 4QAJA 1M66A 5AVQB 3O8XC 1ZIAA 3LNTA 5DFVD 3UC9A 4JENA 2F55A 2CPCA 2PDAA 1D2PA 2AFHA 3I30X 3P0EA 2XDQB 1AE6H 1CUDA 4F60A 3IFLL 3APCA 2V9CA 4E41D 3O4IA 4X8XA 1KZGB 2G63A 4P2RB 2O2IA 1UH3A 2H8GA 3BPNB 2JK0A 3QNZB 3VR5H 3IETB 2FSEA 4FR0A 4HUVA 4KY2A 4RTQA 1GL4B 3LXBA 5EEUA 3X14A 4X61A 5LDSA 5ESWA 1YR1A 3U2SA 2WLTA 3PENA 3OKLA 3OWHA 5J1AA 3QQ5A 2OHVA 5C8YB 1RL1A 4QRDA 3GGJA 4RIFA 4L1DA 1WPCA 2E4UA 3T34A 3FC8A 3ELDA 4YNYA 3MRDB 3RNQB 5LD2B 1T6WA 4TKUB 1U65A 1CR6A 4PPTA 3S3JA 1E8NA 5I74C 3N3AC 1WWAX 1G55A 4YUVA 5MI0C 6AT1A 3OMXA 1FNFA 2DQHL 3OKNB 4X1YB 3LQAH 3MD0A 2NNAB 1JP5A 4L4TD 2QRMA 5AW5A 2D3JA 4PRHD 1CI3M 3M9WA 1TKCA 3CN1A 4NYMQ 2J8ZA 1J05A 3PJSA 4J0JA 1XH2A 1DG9A 1EHYA 3F7YA 3LRKA 3BCRA 5H35B 4G5ZH 1RBYA 3HHSB 5CD1A 2AJUL 4TKMA 3GXMA 2DQJL 4B4WA 3TNNB 1ETJA 2DMRA 2FWAA 2JFQA 4Y2HA 3KQMA 3H9SB 1NBHA 3NACL 1X7GA 4YRJA 4KUEA 4ZI5A 3THOA 3J80A 2HPVA 2MQ0A 4DDUA 1T3ZA 3F7KA 5CFOA 3WYRA 3L3DB 2ZE7A 2GD0A 3TBFA 5C09A 4ZI3A 1T26A 4LJAA 3H1AA 5JQIB 3G2NA 3P27A 3ECQA 1L4NA 1LPAB 4L2IB 3M89A 4WFKA 5IT0A 1PZBA 4BMSA 4P46A 2GRAA 1MFUA 3M07A 1G6RH 1CDUA 1HM5A 5KX5A 2PWYA 3JWNC 4B3RB 1QX1A 3TT3L 5FO0A 1L3NA 4Q4HB 1KEMH 3PWVA 4I9GA 4GW5B 3M1YA 2AN3A 1JHAA 1Q0LA 4XW2A 1VL6A 3R24A 1PVHA 2DHCA 5DYIA 5CN3A 1RYDA 1R0WA 1IBMB 3FYHA 1T4MA 1CYXA 3M9XA 4HB3A 5KQSA 5AK3A 3D4IA 5K1VA 4FEAA 3QYPA 2HLHA 1AD9B 3CX7A 3TGLA 2CVHA 4KQ6A 4L8FA 3TV8A 4F5DA 2YEQA 5IROD 1U8OA 4PJEF 5L3RA 1UBJS 4GECA 1IHUA 4L8CA 4FEIA 3QG7H 5AKSA 1NR7A 3UCXA 3WQRA 4M0PA 4BXSV 2CDEB 1NULA 4V0OA 3JRNA 3UJHA 2Z4QB 3P1JA 3W2TA 3TX2A 3U82B 4U2CA 1JFFA 1SQSA 4H0GA 3K8ZA 1MC4A 4ZFQA 1U8ZA 1HE2A 1G9NL 2ALWA 4U1LB 3V0WL 4IQ4A 1XQ1A 2I54A 1D2MA 3TBWB 4OOEA 1IHOA 1PR6A 2EFGA 4HZ1A 4YGVB 4FG0A 5IYZA 2UYHA 2YJZA 3D39B 4JAMA 4UQ3A 5D00A 2CAKA 5TK4A 4XDZA 2D31A 3PPVA 4IRZH 1MQSA 4JFVA 2GK0A 3TLZA 1EWYA 3BMNA 3S2EA 1T4KA 3JU3A 4W4NA 4EHDA 1UZMA 4N0EA 4MV5A 2CGRH 5ITBH 1S89A 2E75C 4TPRH 4TSCH 1XCBA 2IOFA 1KCUH 1G6Q1 4ANXA 1KYOJ 4CU5A 1E5TA 1MHPH 4JP2A 3WLFA 5ABZA 4YS4A 1T0JB 5B39G 3O4RA 3NCYP 1ISMA 2FEWB 4KQJA 2YD4A 1T9ZA 1FZJA 3GSUA 3NACH 4NKOB 2B8NA 4HOYA 3GFTA 1VE5A 4H7EA 2JMRA 3NJGA 3H3BC 3PV6A 4NS1A 3WO4C 4DGIL 1AQ8A 2VQDA 1WP6A 1KI8A 5D7LA 2BHLA 4IVPA 4PYIA 1SJMA 2PLNA 4KPGA 1P77A 5CD5D 3ADBA 4CEHB 4WI0A 3E7JA 5KVDL 5IYZF 1EQAA 3OU7A 3STHA 4FHEA 2G1AA 4AROA 1DEOA 4K7FB 8ADHA 1I9GA 3ULVL 2DH6A 1CZUA 4ARBA 4NC2B 4KRFA 3CR8A 2F74B 2LU3A 4D4MA 5HKLA 3U4CA 2WLNA 4P5RA 4ZN6A 5IMBA 4PB0L 4JB9H 1EAMA 5FPSA 3GJ3A 2DP4E 2KB0A 4D3YA 4NZTL 4U3SB 3F6BX 2Z31D 2JI2A 2Q5IA 4C4AA 4Y7MA 2XKSA 4TWJA 2H6OA 3SF0A 2IALB 1LLAA 1ZUNB 3EO0B 2KYRA 3E5HA 4Z18A 2Q5JA 4JC5A 4B9EA 4KTEH 5EIIG 4MHTA 3ZE0F 2PGIA 1ZAYA 2XBTA 2CK0H 4KYVA 1UJMA 4KCGA 4NCNA 1G1KA 5F6HI 1FGVL 3WEAA 1U8LA 3K4QA 1J8KA 3QIWA 4YXKH 4D3SA 1X92A 1TFPA 2NMSA 1KI9A 2DBRA 3K0FB 3MS4A 2GWHA 2XUAA 3FD8A 3L3HA 4IGEA 5T33H 4WTXA 4IUCS 3VGHA 2WANA 4DUZB 2FV8A 3F4LA 1RM4A 3DPIA 4E15A 2UU9B 1X9GA 3K8LA 1A7NH 1IL1B 5FOWA 2GVDC 2E2WA 3JALB 3K6RA 4EN2A 4B45A 4HT1H 3LYHA 1J4AA 2CH8A 1ZI6A 4EO4A 3SD5A 1E40A 4L5AA 2ROYA 3R0JA 1SELA 4NEHB 4A2HA 1F4XH 5F9JA 3IQHX 1D2AA 4EYOA 2XA8L 3V8EA 1PG7W 2EEZA 3PNWA 4BTEA 2VL7A 1XAIA 1ZJ5A 4L0DA 3RKSA 2OA0A 3HFFA 1M56B 2HF7A 1IJFA 4MAAA 4AZ0A 2X89D 3U7IA 2IHZA 4GAYB 1WCXA 4ZVPA 1GAFL 1KFEB 3VVLA 3WHE1 4F56A 2NX5D 1QSFE 4OKVB 5FWNA 4YBQC 3K0CA 3IAUA 5A4JA 3AXTA 3RTGA 5GOTA 1YZ3A 3MJ8A 3L1OH 4OUKX 4CG3A 3IRUA 2WF5A 2BUCA 1DQML 4IK7A 1DRJA 2WSBA 4JJHA 4IKIA 5CA1A 3CH5A 2EE6A 4KVZA 3WMXA 1LWOA 5DE3A 1LY1A 2ESVE 4A2QA 2QPEB 2R1WA 4O2RA 4UYPA 4Q7LA 2FG6C 2CBTA 3QUKA 1P84J 2OK0L 1IZ8A 3FU7A 1D8AA 3LE8A 4PFKA 2JGAA 2OV0A 4X6DA 5EIXA 2GBCA 2N47A 4R9SA 5G2OA 2ZUWA 1W96A 4MUYA 1I3MA 4WNJA 2OMXA 4I0PB 3UWPA 1UWEH 2VXVL 3BT7A 1WCV1 1ZKAA 4UZFA 5BPHA 4LCWB 1NPJA 2G9ZA 4NX0A 3SKMB 2R69A 3D0QA 4YT2A 3DOEA 4JEUA 2BKLA 3CWCA 3GS0A 1EHXA 4U1JA 4KR2A 2HMVA 4YMUA 1QHHB 3WNDA 3WLMA 5EV7A 4JR2A 5A2LH 1JKFA 2FQXA 2Z2ZA 1G7JA 4N26A 3E1ZA 4A7QA 1KTKE 2A3RA 4FWBA 4F2DA 1AHWB 1B0ZA 2CO7B 3DROA 1B0RB 3K96A 3CMGA 2H3EA 5IAEA 1A3CA 2UUOA 4NK4A 1XH3B 3CU7A 5LDGA 2YFHA 1PJ4A 2XGSA 4E94A 3DRTB 1BC5A 1IQDB 1BVRA 1YEKH 1T83A 2IBZX 3BVVA 2R9HC 1XEUA 4ZJYA 1UM9B 3JQ7A 4QHSA 4QYTA 4QD2E 4J7XA 1EDQA 3L3OC 2HXAA 1KVUA 2I8CA 2AC2A 4QG7A 1T0PA 4XCVA 1QO3A 2M6RA 2NVOA 3HP1A 3HPJA 3P9XA 3V0AC 1AP2A 3EXLA 1A21A 2WXNA 4XB2A 4YI3A 4G36A 4GWGA 4MS3B 2MSKA 2EDRA 4K5LA 2YTZA 1SOQA 4TLBA 3BAIA 2Q6TA 2R56L 1X80A 2XF2A 3AR5A 3RI3A 3KMDA 4ARZA 3UXEA 2H59A 5BOJA 4AL8C 4BFRA 1U9CA 2XV3A 5E4EB 3WFJA 4TLDA 3C7CB 4J5VA 1Z74A 5F1YA 1T1ZB 3ARGB 2DMKA 5I5JA 2LW3A 5AKVA 3DMMB 3PXHA 4JR9H 4OAOA 1WV1A 4ODHH 2GBFA 4Q19A 2FFBA 1Y9DA 4DVRH 4MV1A 1IN1A 3QXDA 2RHEA 3NA9L 4P31A 5A2KH 2GILA 4NE7A 3FB1A 4POUB 4HG4J 2ZCHL 1KFKB 4HBCH 2Y2TA 1NLBH 2HU2A 3QT2A 3RM3A 5IKXA 2WIIB 5D7JB 1NUUA 5DV9A 3QVLA 3M1CA 1WZ1L 2EAUA 3C3EA 1SQGA 3WV4A 3HXMA 4H1LB 2BGIA 4FKKA 5E9DD 4JL1A 3GI9H 2IBSA 2P8PB 4UULA 2AJYL 4LSUL 2QPLA 3B7GA 4LGVA 2XZZA 4JB8A 4RPKA 4N40A 4WN3A 1INQB 4ALJA 1CLVA 1O75A 2JBHA 1E3XA 4F8EA 3Q0TA 4YUXA 1YB6A 3OZDA 1M3SA 3CA8A 3X2SA 1DBRA 2CKMA 1WMBA 1K6XA 1TR7A 3DDCA 2GJ8A 3IAFA 3QENA 4AX3A 3CSGA 1TK2A 5EU4A 4JXKA 1U31A 4N22A 1YJ8A 1L4HA 3UJ3X 4LY3A 1T3TA 4N5IX 1GY1A 4TYNA 1DELA 1WWWX 1RNLA 2F5BH 3QKSA 3VX3A 5JPCA 1GGVA 3SPJA 2XACC 1Z34A 2FEKA 3PVSA 1TKWB 3GGDA 5IW6B 2OORA 2Z8YM 2X3AA 4Y2OA 3WWCA 4TQ8A 4QTUB 4LHUD 2AR9A 2J7PA 2X4NB 2NZVG 2GCIA 3F6SA 4BOYA 4MXQD 5DLQC 4FA6A 4PHTA 4MQLA 4KDWA 2OP4L 1TXKA 3THSA 5KOMC 1CN4A 1HWYA 4DV6B 1IGJA 3HP4A 3OIUA 1PZXA 5HHMB 2QSVA 2REBA 2EFEB 1MJJA 1NFIA 4S1VA 4N1HB 1KZYC 4HX1B 2G5BB 3H1GA 2ZAMA 2PUHA 5DF1A 1FUEA 4WWKD 1PQZB 2C7GA 3DQZA 5FR1A 5AKRA 3HLTA 4KIWA 3H17A 1M1UA 1ILUA 1TZHB 1IM8A 2GR9A 3UMYA 4LXQA 3QEHB 4N6OA 1FDVA 2HFEA 1HQ4A 4PANA 2VQ1A 1YPZA 3EDOA 1JJVA 4KUHA 2IH1A 4QUIA 1VEMA 1JZ5A 1UACH 5D3MA 1SY6H 3HVUA 3IAS1 3STTA 4DLWA 1IB6A 2QQ0A 4ZFFB 4X92A 1Y1PA 2OB2A 3VRHA 1KJIA 2XT1B 1C4OA 3T3IA 4OZGF 2IAMD 1PV4A 1D3AA 5EYPB 2XUKA 3FAZA 4BZQA 1QDLB 3SHOA 1L4UA 3A2KA 5KJ1A 5IUKC 4CF5A 3S1AB 1FVXA 2CK0L 1PSZA 4CRPA 3P4OB 2FMIA 3QQPA 1YNTA 3ILPB 2P7IA 3L3OA 4D98A 1OZUA 4M62L 3WIHL 4UQ2B 4H08A 4FNOA 5F96L 2V8BA 2YV1A 2VF4X 4EN3A 4P48A 4YRGA 4J3NA 4O4YH 4JBXA 5BW7C 3C08L 5M2QA 1OP9A 5L7YA 3AVUA 2F08A 3RYCA 4IIDA 2HO4A 1F6DA 2WTPA 2H8PB 4R8WH 4BFOA 3WIIH 2VXBA 2B9AA 1N70A 4FQCL 2WUVA 4JN2B 2F19H 1WTCA 1UMCA 3M6MD 3Q3JB 2JJQA 2Y3IA 4E4YA 3MBEB 2PGAA 1T2UA 2VHQA 2G77B 3SZ3A 2VUSA 3Q9UA 1FO0L 4DCQB 1RE0A 4J2TA 4G2NA 4Q34A 5AJYA 2G30A 2VLKD 1A04A 1ML4A 4C4OA 1NGQL 3UH1A 4D43A 4B9JA 4MX8A 1BVNP 3T12A 1MLBA 3MBXH 5LDDC 2R4RL 4ZPTB 1JK9B 1Z3RA 3HUFA 3HKEB 3IDIB 1R9JA 1M2JA 3NDYE 2EIDA 4NKRA 3N2ZB 1OFVA 3C7AA 1G1OA 3G0CA 5AKGA 5J5VA 2JANA 4MKMA 2I7DA 3F71A 1MCCA 2FJFB 5E9DE 1FLTX 1EGHA 3ZG6A 4IS2A 3ESQA 3B6IA 3EH5B 4HYTB 4ALAH 1R4ZA 4EF6A 4AEHL 3VB8A 1ERNA 1CS0B 2FLWA 3HKBA 2FB4L 3A2NA 2J7KA 3PDHA 3ZTDC 4NUQA 3U0BA 2FFAA 5ALEA 3LVTA 1P2TA 1XF2A 1TLTA 4FG6D 1YYMH 2CJPA 1JFHA 4FSDA 1FP5A 3BT2H 2PXAA 3VWKD 4M6NL 2DBYA 1DX6A 1BIHA 3IR5A 1HY3A 1N5AB 1CD1A 4AQOA 1W73A 1J33A 3TA4D 4YMLA 1AS0A 4GF5A 2I6QA 1P6XA 3WYDA 3ABSB 4FJ2A 3BPOB 3KSRA 4JFDD 2X4RB 2ADFH 1K3IA 4BNGA 1JZ2A 1ZD8A 1JGLL 1NL0L 3FCUB 3I9IA 3TTWA 3QUQA 1QO3B 1BIIB 5L9DL 5ANMB 3ZGHA 1SVBA 4WNQA 2GFIA 1IGMH 3WLPA 4ZI8A 4NCIA 3RPKA 1HSOA 2FPMA 4MVJD 5D5MA 3IP7A 2XXMB 3O3OB 2ZIVB 2QRUA 1ZXLA 1VG0B 3S6JA 3DX8A 5ARBA 2WDPA 4TMTA 2H4HA 4GRWB 2PFGA 4DUYB 5T1LD 2WINI 5E8EA 5IQNA 3DXXA 5IWLA 4JGUA 2FUG1 2CCVA 3MRBA 3SAJA 3S36H 4DP6X 5EKXA 4PR5B 2GZHA 3U17A 3EGWA 5B7FA 2VHVA 1RR6A 5F7OA 3CT6A 2L8AA 4PV9B 4ZZFA 5AK6A 3NCXA 1M2KA 1HNYA 1KBBA 5KYXB 3CXDH 3GBLA 4MR9B 2F4VB 2AS5M 5P8WA 1SKUA 2BRUC 4L1LA 1FDTA 2DC1A 2ORYA 3NT5A 3ULUE 1LDMA 1Y1DA 1KO5A 4GXFA 4JQIH 4C7VA 5CD3A 1A6VL 5KBDA 4AMKH 1W87A 4CV0A 3INNA 1JKXA 2V45A 4QDGA 4QIHA 5GWXA 4JSYA 4B87A 4DKJA 2V7WA 2IP2A 2EFCB 2VNKA 2YH2A 1JWUA 5HSFA 4J0HA 4ZJ9A 4PLKC 3C6LC 1VKHA 4HJSA 4PLNC 4DL9A 3BIKB 3SGJA 4Y9RA 5FR2A 1DQJA 1T0MA 3V4UH 2I9KA 3OJVC 2ZJ5A 4UU0A 4DNLA 1I8IA 5SWZE 2VT7A 4JG1H 2EDYA 1KWKA 2VQFB 2DQTL 1KDZA 1NI4B 4BDVA 1U11A 3GLDA 3O8RA 2FECL 2HPHA 5DCWA 5G0VA 1WF3A 3GMSA 5K8TA 5B1CA 4ZX6A 1QBKC 4R2GD 5L2JB 2OMUA 2R6ZA 2OMXB 4KWUA 2H4JA 4JB2A 4BECA 1SOWA 2G9NA 1E3ZA 3UPTA 2V9UA 4AN4A 4NFHA 5EMNA 1THZA 4UZEA 1KJJA 4P0PB 3KQWA 1RHFA 3QXTA 3H2YA 4G97A 2GOYA 3NOOA 1HDGO 2P48B 1Q1NA 4IMLB 3GXDA 4O4HA 4BK5C 4ELMF 1PGPA 3GSRA 3QG5A 1GNPA 1Z4PX 3NBAA 4UU8A 5INDB 2ZYIA 3W1VA 6REQA 1YL6A 2QPUA 3P9SA 2QL7A 2WYVA 1EK0A 3JD0A 1AD2A 1DLJA 4KE7A 4YACA 5HPMA 4ZMBA 4CNIB 1XP8A 4D0SA 3T1TA 3APDA 1KQ3A 2G3YA 3EWIA 4GBJA 1LO3H 1DC7A 4AWBA 3EHEA 3LHIA 4N0YL 1HX0A 3IELA 2A30A 5BYAA 3GM0A 2XETA 1M05B 3E9MA 2JHFA 1HILA 2M8XA 4LF9B 5EU3B 3L7AA 4P5KA 2JJUA 1MHCB 1SDDA 3EVDA 1VFOA 2J57A 1CVLA 3KPQB 5T4HA 3O2JA 3BQNB 3A24A 1JRHH 3QUTA 4DZZA 5FM5O 4L8DA 4ZYVA 4K7JA 3AZUA 5EBWB 4LE8A 3TTSA 2B4CC 3GO4A 1Z4JA 3EZ7A 4NB7A 4K8OA 4MLIA 2CXOA 2GKGA 3ANNA 1VFUA 3MLVL 1R3JA 3KJ4C 2XHEA 3MMZA 4P36A 2XXJA 3HI6L 1W8OA 5AOAA 1ZSYA 3RRBA 3FFDB 3DVQX 1CUGA 4PY2A 4WX2B 2V03A 2GSWA 2N56A 4JE4B 1QGYA 1W9HA 1N0LA 1CWVA 4V2IA 5KC9A 1TZCA 2DL9A 4QUOA 2MSCB 5HHQA 3PNPA 3R4VA 1AK1A 2ZYUX 2P77A 3INRA 2CLIB 3L3GB 4LVNC 1NCNA 3OKAA 1ZDQA 2LTAA 5GRZA 4DREA 4CMAA 4XBPB 1EHKB 1T1GA 5HVHB 2ZXUA 3HBLA 3NDIA 3VGJA 4ODTL 4ZW3A 1M2VB 4F3NA 5HDWA 2CIKA 3SM9A 4PTYA 3NCBB 3DLHA 3C6SB 2ZPAA 2XKJE 4DXDA 5E4FA 4WUTA 2ZQKA 3QE0A 3ETBJ 4X8CA 4NRZA 3H2ZA 1O9ZA 4RVOA 5FAKA 1X9UA 2OXGA 1ICEA 3EXHB 4HV8B 3X3FH 3T9DA 4WI9A 3ONNA 1JDTA 4YXHH 2XBDA 1HXYA 8OHMA 1P2BA 1EJOL 4YASA 3BSYA 3TS8A 1IGIL 4MRAA 2CBXA 2AJSL 4Y16B 4OLUL 5DURB 1FYTA 1VMKA 3ZOZA 4XH2B 5C08B 4FZJA 1SOMA 1NE2A 3FYDA 1PJZA 2ZJ6A 4E9XA 3OFVA 1YMUA 1H3TA 1U8UA 5PCYA 2KX7A 1KIRA 2HI0A 3KJEA 3P5SA 2IH5A 1QU2A 3PDIA 2IDQA 3BBLA 3F83A 1E9OA 1BG6A 2JK5A 2A5FA 3APNA 3WK7A 5DGDA 4ZPVB 2D1TA 4Z99A 3DUSB 4U05A 2QTFA 2EWMA 3ZTCC 2GTWA 2QMYA 3HVDA 3OB8A 1W0VA 4DLRA 2M1ZA 1TZIB 2E4YA 1CU4L 3EZGA 1Y33E 2EZ4A 5EA0L 5AAMA 1E5XA 4XBEL 1T0UA 2D3TA 1XPOA 2RI1A 3N42B 3X1WA 4PVLA 1B8VA 1F4YL 2DQKA 5A4AA 1DRKA 5DP1A 4LAFA 1UJ6A 2R29L 5JSHA 4Z4HA 2J55A 1GSKA 1HAUA 2RH4A 5AZ2H 1LJMA 1CXLA 4MNQA 1GZPB 2FNWA 3JWNH 1A47A 2XPCA 3PTLA 1E8YA 3VBCA 4RETA 1ZSDA 1GZPA 2QVZX 4MH0R 4B2IA 2BONA 3VXMB 4PFJA 1RFDH 3QDGB 3L7EA 2XTJC 4KK3A 4X7CC 5AI0A 5AL8A 1H2YA 3TBSB 2CIIB 4WSKA 3GFSA 2ET6A 4URZR 4YRRA 4K15A 5EQDA 1F9EA 4RZXA 3BVPA 3ZBPA 4NTZA 5B7NA 1SXQA