2VDMB

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist tirofiban
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
461
structure length
456
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 125
structure length 456
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdmB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdmB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdmB03
3F78A 3NVQA 3OL2A 4WK0B 5KYYB 1M2OA 1MJNA 1QCYA 3TVYA 1M1XA 1V7PC 3EH1A 3AL9A 1DZIA 1IDOA 3NIFB 4MMYB 1JEQB 1ZOPA 4Z7QB 4F1JA 3V4VB 3K6SB 4O02B 2P28A 2VDOB 4NENA 3OKYB 1IJBA 1QC5B 3FCUB 5KYWA 3EGDA 4CNBA 4DMUB 4Z7NB 1PCXA 4C2AA 2VDRB 3HXOA 3E2MA 2ADFA 3PPYA 3AFCA 3HI6A 4HQLA 1YVPA 4FWWA 5KYUA 5E6RB 1XDDA 4UM9D 3AL8A 3EH2A 3EG9B 3IJEA 3IBSA 1JV2A 1OLZA 1T6BY 5KYYA 4WK4B 3K71A 1PD0A 1RTKA 4F1KA 2VDLB 1N3YA 1IDN1 4HQNA 1OAKA 5E6UA 1MF7A 4UM8B 3ZQKA 4MMYA 2O7NA 2ICAA 2I6QA 4WJKB 3FCSB 3VI4B 2NUPB 3EGXA 3T3MB 3K72B 4JX0A 3ZDXB 4O02A 4A0QA 1T0PA 1QC5A 1U8CB 2XGGA 2I91A 4G1EB 1MQAA 2XWBF 2NUTA 4C2BA 1RRKA 1N9ZA 1M10A 2X5NA 5BV8A 2VDKB 3HXQA 4MMXA 3Q3GE 1Q0PA 3EFOB 1M2VB 3NIGB 4NEHB 1NA5A 3ZE0B 1SQ0A 5E6RA 1U0NA 5KYNA 1BHO1 1U0OC 4G1MB 5ES4B 4O3TB 1IJKA 3NIDB 4HQKA 3VI3B 1SHYB 1XDGA 1FNSA 3T3PB 1PD1A 4HQFA 4GZ8A 1L5GB 1CK4A 1ZONA 4K3JB 3ZE2B 1JEYB 5E6SB 2NVOA 2VDQB 3EOAI 3FCSA 5HGJA 3OL2B 3PPVA 2WW8A 4XW2A 1ZOOA 1U8CA 1M1XB 1JEQA 4JDUA 1ATZA 1XUOA 3BN3A 3K6SA 2VDNB 3BQNB 5LN1A 3TXAA 3TW0A 5HJ2A 5KYWB 1RD4A 4NENB 3F74A 4UM9B 3EGDB 5HDBB 1MHPA 1SHTX 3PPXA 4M76B 2P26A 1FE8A 4IGIA 4IHKA 1JLMA 3EG9A 2I6SA 5KYUB 1L5GA 1AUQA 1PT6A 1JEYA 1LFAA 1YUKA 2M32A 5E6SA 3AL8B 1CQPA 5KYXB 1M1UA 4MMZB 3IJEB 1AOXA 1JV2B 3GXBA 4C29A 4IXDA 3K71B 3ZE1B 2VC2B 5E6UB 2IUEA 1SHUX 2NUPA 2WINI 2XWJI 3TCXB 1SSLA 3K72A 1RS0A 1UEXC 2UZYB 3EGXB 1AO3A 3RAGA 3V4PB 4G1EA 3ZDZB 3BQMB 4WFQA 4FX5A 4O3UB 3QA3E 2ODPA 3PPWA 2ODQA 4WK2B 2NUTB 2B2XA 4HQOA 3OKWA 1M2VA 3EFOA 3M6FA 1YVRA 4PN7A 1DGQA 1BHQ1 4MMXB 2VDMB 4CN8A 4G1MA 1TYEB 3EOBI 4BJ3A 5KYXA 1MQ8B 3N2NA 4MMZA 4Z7OB 4CN9A 2QTVA 1MQ9A 2VDPB 3ZDYB
chains in the Genus database with same CATH superfamily
4GPVA 3D6JA 3GOQA 4Z0BL 1JZHA 4JS0A 4EA6A 1U8JA 3BREA 3EOTH 2YLHA 4PXSA 4JRFA 1RCYA 3FPKA 4N24A 3LIZH 1DQQB 4R8LA 1XZBA 1EBAA 4GPBA 4UUBA 2Z8VC 4PWKA 2BGJA 1YACA 3BYZA 1BN6A 1N9PA 5KYYA 2HK8A 5F64A 4FQ2L 2G3YA 4D57A 3TXYA 3BFKA 1ZD1A 2ZB7A 3FCGA 2RI1A 2VTVA 1RY7B 3PXLA 2VLLB 3UAVA 4Z95H 2PUHA 2XQYA 2YD6A 3H8SA 2KC0A 3GTVA 4ESOA 2R87A 4E9SA 3RVSA 5INCB 5H16A 2HRRA 4YEDA 4LEBA 3IJHA 5F0PB 4JDUA 1YPZE 3K7UA 4ZFNA 1NAKH 2WTEA 4RGND 3RG2A 3GOHA 1JG9A 4PFQA 2BHUA 4BAGA 4M3JA 4HWTA 2AEQH 1F13A 3LLUA 4EKJA 2IH8A 1U8YA 3L46A 1Z7GA 2CWDA 3H04A 1H94A 4JHVA 2Y3IA 4R5TA 2WLMA 3CX4A 5I18H 1VPWA 2JANA 4FQ1H 1Y8RB 3UW1A 2BCKA 1ZLVK 1VZ3A 4FT2A 4AQEA 1KDZA 2WWKT 2C97A 1VSUA 3ZGZA 3NS7A 5IJ9B 3GPEA 4YDRA 4RTJA 4PICA 3B6EA 2VP6A 2GOYA 2HF8A 3TF5A 4K7PL 3MV9A 2QX9A 1UMBB 1RP8A 3S5LB 4WN9B 2ZI7A 2V6HA 5ELIA 2IEZA 4E3WA 2V7HB 4P5TB 1LS6A 4LDPA 4ASUA 3F8SA 3HI4A 3QWOB 4KXBA 4X42A 4QYWA 3G0HA 2YA0A 2Q21A 4FXKC 1NC3A 5C0NC 2VPQA 3TMAA 2UVDA 2YHIA 3L8FA 2QWXA 2J3EA 1JR3A 5CFRA 3KP1A 4Q14A 3LN5A 2LD4A 1DEOA 2YC1A 2NW2A 1UIMA 1IK4A 1HHKA 2PWYA 4CCYA 2UZ1A 4PLTA 2M26A 2VHUA 1OOAA 2CDGA 1A66A 2FAUA 3D3WB 2O14A 2O0JA 2H1XA 1IAMA 4BAUA 4MYTA 1L6RA 1YK1A 3V2AR 1ZINA 4FLQA 1MHPA 2P5WE 2WOBA 2GD1O 5AENA 1NQTA 3FS9A 2VTBB 1NBYB 4JFZL 2GN8A 3UHJA 3WTTA 4MDJB 1FL3A 1TYRA 1G0YR 1O7DC 2BIPA 4JOQA 1MWAB 5ICYB 5SWQA 3O2QB 1AGBB 3UJCA 1AJ7L 3KXLA 5IB3A 2E4ZA 3MTEA 3BT0A 1VLJA 2QN1A 3IAGC 3UWDA 3ROKA 2HKFL 3NZHL 1NDGB 1Q38A 1Z3RA 2PBLA 3T7IA 3HNOA 5EOTA 4K9EL 4LSSL 5DOZA 2A0KA 1HDGO 3HI6A 2XZZA 2FWOB 2ZIWB 3CWGA 4UPEA 1SKAA 4X65B 4YDVA 4JM4L 1MO3A 2Y1DA 2HG0A 1RWOA 3OQHA 3ETCA 3RVUD 2DPMA 1F4WH 5TGBB 1VKJA 3PJNA 1MCFA 2SECE 4A8HA 2P4HX 2WSLA 1INEL 3SQXA 3FU5A 3MTQA 1UKTA 2R86A 4L8LA 4NYJQ 3QWFA 3M5PA 3LY6A 3PC8A 4L8BA 3ULVD 2Z1KA 2QGCA 1XEDA 1V8HA 1O9BA 4KO3S 3FB7A 4P32A 1N36B 1F0LA 1DJYA 4BZ1H 2XUWA 4MLCA 1T21B 1JR4A 1FPTH 2P6RA 4R0LB 1CUFA 4TWAA 4EH1A 1TKBA 3OKLA 2F6AA 3QUCA 5THKA 3U26A 4ZUUA 2H5JA 3V8OA 2ZVJA 2QQLH 2YW2A 1PZ5B 4D9CA 5ITZB 1J25A 5CCHE 4C2TA 5KSAD 1OGPA 4HAZA 4KTDH 4AQAB 2XZAH 1MA3A 5D3MA 2YQ5A 3KEQA 1UKBA 3RVMA 3EMKA 3I9OA 4U1HB 3VW3H 4TXHA 1NOFA 1A9VA 4FZ3A 4G6AC 3W56A 3DZCA 4JY7A 4NM4H 4Q1EA 3HB4X 3GGCA 1Z9OA 4XP5L 3ENQA 5BNIA 2UVPA 3IS1X 3MGCA 2AI1A 1SD1A 3IDJB 3WRWA 2CBMA 2PXYA 3SVLA 2Q1SA 4OQXA 5AOJA 1DJPA 1YU6A 2P4QA 2O7SA 2VL5B 3ZQXA 3WMXA 1V05A 4Y19E 1JN6B 4KAAA 1E4YA 2RIRA 5C08A 2YFHA 3DX7A 3FT0A 2P9GA 3HGQA 5JYLA 4C9BA 1U2DA 4BN5A 4AENB 2WOOA 1EGVB 1JAEA 1SQGA 3PYXA 4G3YL 4IDOA 3QEGL 3K0YA 1CQYA 4WTZA 3DURB 2R6JA 4FTVA 1DQVA 3DHMA 1N5MA 4HVLA 3GSVB 2WZ0A 1YEIL 4NXSA 4K8RC 1Z26A 3II2A 2DEYX 1DBBL 1XMXA 1ZSYA 3IELA 4YQYA 4OR1A 3EVBA 3AERA 3BJZA 2XGMA 3V9AA 5I19H 2ZSWB 1IXSB 4BLTA 3V0DA 2JEOA 2JD1A 2Q6TA 3ZCUA 3AFIA 4MRVA 3TZKA 2YR3A 5L4JA 2HM7A 1MRSA 3LN4B 4BLWA 3BFQG 5FFOA 1A5BB 3VR0A 3MYJA 3KVRA 2YXEA 3TURA 5HHPB 1TJGH 3MV8B 1ET5A 4XAKE 4RFEA 3ZIYA 5B12A 3IMCA 2ZRBA 3D4OA 4AVJA 4B79A 4GOND 5EB9A 2QRUA 5FTLA 4ZMXA 2VCOA 3DEKA 4JFYA 3WEBA 1OY1A 3WLQA 5D2CA 3NHFA 1GZVA 3QJHA 2WUCH 2A1UA 5CS7A 1QSFA 1HSBB 2EVGA 1F90L 4HCRH 2BNQA 1SHUX 1FYDA 2VPYA 4HKJB 2RI6A 3UH1A 2C1PB 4DDMA 2YUWA 2Q7DA 4MQSB 2P24A 1PLKA 3HO6A 3OR6A 4QHKJ 3FBGA 4MHHG 2R8EA 2DYKA 3EG5A 1KNQA 3WXVH 1TVEA 2J5KA 2R6AA 4I2XE 1SFHA 2OQVA 2C4XA 4CVUA 1GS7A 1XD1A 4NCHA 4AUNA 3NIFE 4BQRA 4AYBA 2QGFA 3P4MA 1FJHA 2CZGA 4C4XA 3S96A 4HNAB 2X4NA 1N10A 2P2DA 2NWQA 4L02A 4ZCPA 1N70A 1FFOA 1ZHLA 3WXWH 4AJ0A 3F9IA 2E4AA 1A7OH 3DYBA 4ML3A 2GHWB 2MSWA 4J7AA 1NP3A 3K92A 5CUQA 4U7PB 5AQ0A 4ZOQI 2MMXA 1G41A 2J20A 5GJWC 4YBQD 1JHKH 1NLZA 1Z0KA 1DC4A 3WGMA 2VDML 4LXXA 1A1NA 2AP2A 4MIOA 4JO5A 4KBYA 3VJKA 4HJGA 1PW5A 1JPVA 2O2HA 5LB1A 3KL2A 3BZEA 1EFLA 2XBMA 1HDEA 3QJFB 2O30A 4GUPA 4ZVSA 5JY6A 5HJ3B 1MHPL 2O1XA 1CFQA 1U0TA 1WFJA 1E5XA 5DK0B 1GPKA 2H2DA 6LDHA 3IE1A 3CPEA 1WKCA 1HHHA 4FM9A 1M1ZA 4RA9B 4FYYA 5T1LD 2JJMA 4WGVB 4E7PA 1F4YL 3V8RA 3CSYB 3WICA 1R15A 1ENPA 4Q6IC 3I84A 2WZPA 3WD5H 5DGHA 1H0HA 1S7VA 2EF1A 4GINA 4RJLA 3HJEA 2O1AA 3PQYD 5J6GA 1Y82A 3Q10A 4O2AB 3TVMC 2M1XA 2C9PA 3E7PA 4ME6A 1K4DA 1G8JA 2VPPA 4WGWB 4PV1C 2Y23A 5IC4A 1MX1A 4O2AF 4FQXD 4HMQA 4RPKA 1K5NA 3JRWA 4NT6B 1GGHA 4MA4A 1ZI6A 4GR5A 2LV4A 1AHNA 3A6FA 1BLNA 2OENG 1V2GA 4M0KA 3TLCA 3MV7B 5F1KA 4MXQC 4KRFA 4P7FA 4M7KH 2JK5B 3TI9A 1GAQA 4I50A 2K7FA 5BPHA 2GIXA 3EJZD 4GT1A 4WD3A 4M7JL 3N6RA 1AI1L 1N6RA 3IIMA 4B0OA 2F1BA 1IZZA 4FN5A 3KLDA 3FLBA 5K6AC 1JIVA 4QG3A 4NOKA 3B2UD 3QDMD 3KRTA 3AW8A 1YA4A 3N05A 3SQRA 1TJ5A 5MP6H 2VABB 1XXLA 3U7RA 4EAQA 5KS9E 2VDNB 3DL0A 4QGBA 3MRCB 4RQAA 4H7KA 4D0DB 1K7XB 3EDYA 5BNTA 1NEZG 4HUMB 1M6UA 1L8OA 2PXAA 4ZS6C 1D2CA 4YN3A 3AM1A 4XVTL 2H48A 1J1XL 1PWZA 4IKJA 3L7CA 3MWEA 2YO3A 4FHGA 2OPBA 2XMDA 3TBSA 5D84A 2XZCL 3NTUA 2UYLB 1C41A 1DO2A 3CXUA 4QOIA 1S3RA 4P99A 1LO3L 3WY9A 4J2XA 1NRWA 4FERA 3OIVA 3RVXD 3JAKA 3QBTA 2R29H 2A9FA 4CQJA 2EKQA 1IEVA 2V9UA 4BH8A 3LIZA 4LSDA 1HIML 4LFHG 2EFHB 5GRJH 1RC8A 3U1VA 2AK2A 1M2OA 1THAA 2GZMA 1YQ2A 1SEBB 1VAHA 4NRXB 3GNLA 1JF5A 4HZAA 4FADA 1UMDB 4Z7VE 2VVTA 1X7YB 5C1OA 3KV3O 1UPBA 3ZHNA 1SG0A 2OHOA 1QHOA 4EVRA 5DJ8B 5C53B 3AESB 4U0JA 1C9KA 4OU5A 3FU8A 1L9MA 3C5ZB 1CBVH 2Y2WA 4GUDA 5DT1L 4OF3A 1VIMA 5BS0B 1KEUA 1JPGA 2BZCA 3KDAA 2WBXA 4JI2B 1X9GA 5E9DB 4K3UA 1K8IB 5DK3A 1Q50A 1X1RA 2AL7A 1NWPA 2DF3A 4HK0A 1WAAA 1I1AD 4KDEA 5I66A 3HQ4O 2WG2A 3UBXI 1NBOA 2IYFA 3ZWPA 4RPGA 4BB5A 4N2KA 2O50A 3TIGA 1FNFA 3GEMA 1NY6A 2OO5A 4J3WA 1G7HA 5JADA 2QLLA 5DS1A 4IKNA 4K2UH 5CVCA 4JKOA 3CISA 3LM8A 3FKJA 3RS2A 1PEKE 2XXBA 4ZQEA 3ZS9A 4JT9A 2JKYA 1F51E 4G9GA 1KFCB 2BM1A 4J07A 4PJIE 4JMNA 5FBVB 2C96A 4IYKA 1RBZA 3C6SB 2GK0A 5KVDL 4UIMA 1TM1E 2HDWA 4ZFOB 5KW9H 4J8QA 4IOLA 1RU3A 1JFQH 3GKWL 1AGDA 3M8OH 4D97A 2PFSA 4GZMA 1CDDA 4OZFH 1R9MA 2E5WA 3KNBB 5FKAB 5KSBA 3ZLTA 2JASA 2BRUA 5K3SA 3KQLA 1XAJA 1E7QA 1ZGGA 1NVAA 1P61B 2ONCA 3QNZA 4OCRH 3KLKA 4S1OA 4Q48A 3T35A 4OZHE 4EJ0A 4LJ5A 2I71A 3P9ZA 1HG1A 4HXAH 5KJRH 5IAAA 1DEHA 1T0HB 2W94A 4GP8B 2KYIA 1Z5UA 4C6SA 3M4NA 4QL3A 1VGQA 4AIIA 4YPGA 4KK9C 2J9GA 1UGKA 3L4KA 3KMDA 3UXFA 3JQGB 3V7WA 1KENL 1J86A 4W9NA 2PKXA 3DOSA 3VRLE 4OFBA 4PCKA 5AVZB 4G7RB 1JEAA 3OPUA 4V1CB 4X6FA 4KI1A 1ODLA 3G2JA 3HE6B 3JQBC 2YWRA 4FNOA 1LEGA 3ZZTA 4HEJA 4BNZA 4BQ9A 2FWNA 3UROR 4KZDH 5DJ2B 5GGYA 4IIQB 2QHLA 2FHBA 2G9NA 2CNYA 4OKVB 1RL1A 3ZHUA 4FRWA 4P4RB 3GWGA 1CR6A 1J9QA 2FXVA 5DNYB 2ZSKA 1UBKS 1PBNA 3VXTA 4R2MA 1DUVG 4Y2YA 3F65A 4MBRA 4ISBA 1XGUA 4QU9A 2C2YA 2OO7A 4UUOA 1KPIA 5A62A 1OT1A 1ZLVH 1APBA 5I6PA 4IJ5A 3IJ8A 5EN2A 4QY8B 3V8VA 3AEKB 3SR3A 4R01A 3MROA 2WFLB 3CN3A 4X6DB 4M54A 1ILWA 3QF7A 3SIPA 3EDDA 3IDIB 4HS4A 5LBVA 4G80B 4P82A 2MOVA 1EIZA 3ESBA 1VFPA 2QFRA 4X6DF 2G9QA 4HLUC 2J0QA 1HI6A 3ZKXB 2Z4RA 1FZMB 1Y6GA 1LO2H 4P81A 1F6FB 1JPNA 2MNWA 4X7DC 3BXOA 4NZOA 4BZ1A 1LWRA 1U7HA 2ZJSL 2OFOA 4CSZA 1CLYH 3IQWA 2Q5IA 3K6FA 3L5JA 3GMLB 3V0HA 4QT5A 5FKPA 1FXWF 5T4FA 1Z7JA 3GG9A 3DOHA 3RVQA 1NJGA 3MJ8A 2G5BA 2DIJA 2C5BA 4C3ZA 4Q34A 1QO7A 2OJZH 3R0XA 5AFSA 4XEUA 4F57L 3I3SR 3O6FB 5CNMA 2WNXA 1UZ6F 2PJUA 1JTFA 4R83A 1SU6A 1G4RA 1F60A 4FW9A 2DR3A 1OK0A 4W4NA 2J1LA 3EEQA 1KZQA 1RD4A 2IUSA 2CHZA 2XN9E 3QYFA 4DLTA 1EVIA 4BNGA 2DFDA 4UUMA 1IM5A 1E66A 1J0ZA 1IKFL 2EW1A 1R10A 3LOUA 3W5JA 4B6RA 3GGWB 5ISZD 3LWNA 4UAVA 1BXRA 1JNLH 1J1OH 3KYBA 3LVBA 1KWKA 4R2XA 2YV1A 1WUNT 4C0XA 2IO5A 2HFJA 1P4IH 1GAJA 2G77B 3EOTL 4FNTA 3E8XA 1BWPA 2CB9A 3LIZL 5F96H 3NCJH 3K5WA 1I4FB 4XXWA 3RWEB 2AYZA 4FZEH 3NT2A 3X1XA 4FEAA 3RZCC 1D2RA 3MAAC 1GR0A 1W2WB 1WIUA 3VYWA 3T5TA 5J3HD 1U2HA 4P59L 2PRYA 2IAMA 3I04A 1H22A 4B3HA 3RY4A 1ZDSA 3DXZA 3GFTA 3LUKA 3IMBA 5FTKA 1AZSC 2PYIA 3FUEA 4G9FA 4HDIA 5DRXA 1OZHA 3EGIA 1IFRA 4WBNA 3VKWA 3TD2A 2JI8A 2WPDA 4MWGA 2BFFA 2N0KA 1AA6A 1VZGA 1WUJS 4CUCA 4D6YA 1NAKL 1SPBS 3LWZA 1ES0B 2VDKB 4UHEA 3VSBA 3BZ5A 4WAUA 1QRKA 2AEQL 2H4YA 1YEEH 5HI3D 2ZBDA 1OUMA 4ZW8A 3CGWA 1X7ZB 1I9RH 4D26A 4ZOEA 4OIMA 4ILDA 1C8LA 5F8RC 4J0CA 5FA5A 1TZKA 3C4JA 5I18L 4OF6A 4FQ1L 5BV7L 1U3DA 4Q3AA 4IZ6A 2H0RA 4HCRA 3USCS 4KN5A 5ECYA 4YMUA 3MCZA 3MACH 1ZW6A 5A6SA 4IJVA 4IWNA 3RVVC 4FYMA 2V74B 2I5YH 3B60A 3PFIA 1NLBH 5CGZA 4O00A 1LEKA 4MI1A 3LC1O 3DE0X 3QU9A 2X2JA 3CXFA 1ANKA 1CFTB 1JYSA 4IQFA 1K7CA 3E9ZA 4NN6B 5D8DA 2QQKH 3MJ7A 4BZYA 2J71A 4WDIA 5COAA 2W92A 1P2VA 1WF3A 2YPLA 2NTSP 4Q01A 2OZKA 1H9CA 2RB8A 3PL1A 4G0QA 4KODA 2BVNA 3H56A 4LEXH 2Y1OA 5J9PB 3Q2KA 3O4LE 1NPTO 2PUTA 4OHYA 1CXIA 2DG2A 3KOZA 3TOZA 5DCWA 3S2AA 3QQ3B 1ONQA 1J5EB 3KGUA 2PZEA 5AVJA 821PA 3ARFC 2ZBVA 3MREB 2X4RB 2A78A 3SCMC 3SGLA 4Q9BA 3ETBJ 3HCBA 2LE0A 3DZJA 2H1RA 5TY0A 5T6MA 5AESA 2NXYD 4F7KA 2ZG6A 1UXWB 2ADGA 1S7CA 1IAIH 2KM1A 1BQHB 1NJ2A 2W6ZA 3FN4A 2OK0H 4B3XA 4DV6B 2HCRA 3E2HB 1DDTA 1ZYUA 3WGHA 4CAGA 4F6LA 4RV5A 4OOEA 2BF4A 3ZWWA 3ROLA 5F9FA 1NKRA 2WW8A 4UHKA 3HMWH 2KLSA 4U2EA 4S0SD 5EOCJ 3WIHA 4QOKB 2C7BA 3SZKC 4JFHD 1XZNA 4LQLA 2CDFA 3RAPR 1OH6A 1JWBB 4RZQA 2W6IA 2WJVA 5FR1A 5JQ6H 4FIZA 2BSTA 5ESVB 2OVFA 5IB5A 1JLKA 3LDBB 1KQOA 2W93A 3B48A 3RSCA 3L4XA 1N5YH 3MJGX 4HUJA 4EO4A 3DVRX 3HKDA 2REXB 2J33A 1F4WL 4YJGA 4TT3A 4A91A 4GI5A 1SNRA 3TRIA 5BQDA 4GGPA 1MIEL 2HWWA 1A69A 1KAGA 3BRSA 3WWDA 2NT1A 1WWCA 3LXCA 2Y1AA 4EK9A 2EERA 3U4HA 1ISSA 3HWX1 1XP5A 3H5TA 2ZG2A 1T15A 4CQLB 1DTWA 4Q9NA 2FSIA 1NBCA 4BZ1L 4FQIH 3S8YA 2CGRH 1FPTL 1E4KC 4QCIA 5K1VA 4QYTA 3X12B 4DGWC 4UDNA 5IG7A 2VQDA 2C95A 3DHYA 4PZAA 2O8CA 4S05A 3EGXA 1VPOH 4KTDL 1USWA 5FAAA 2XZAL 4OPMA 1NVBA 5IM4A 1J5OH 5A4AA 3BGMB 3VW3L 4ER0A 2IWKA 4K8RH 4M22A 3B5EA 4US0R 4NM4L 5A2KH 5F21A 3H9JA 2V59A 4PY7B 5DMGC 5L8JB 5CEYB 2DFPA 4CTJA 1C7TA 1W80A 1A9SA 1G8MA 2XGJA 3TN0D 1UUFA 2YFKA 5AOMA 3RHZA 1PFVA 3MIZA 5DA0B 5JMWA 1IM9B 5BP7A 3IEMA 1Y3CE 2PJDA 1KETA 2IPKB 1I7PA 4FFZH 3FFDB 3UAJD 4JKIA 3FO1A 2H8PA 5EMYA 3CDYA 2H31A 2ZWZA 3O9WB 3WYCA 3VQTA 2VA8A 3LY9A 3D69B 4I9GA 3HEIB 5CF3A 3ZR4B 4JN2A 1SMKA 3OE7A 3QJQB 2G67A 4BE6A 1YZUA 1NN5A 4P7BA 4LLYB 4UTXA 3T4PA 1EQAA 1VFNA 4P3DA 2QLYA 1A4UA 1YDPA 3C6XA 5I19L 5CPFA 3K6SB 1FMJA 2ARJA 3PQFA 2BEWB 2IELA 1FZKB 3QFTA 1CD0A 1BXAA 2AJZA 3D31A 4QWWC 4Z7IA 3VR4D 5DBFA 1DAHA 1J2TA 5FI1B 1Y9DA 1RQRA 3K5PA 3TLGA 5B1JC 1TJGL 1KH3A 3QKTA 1TD9A 2R39A 1LPOA 4CV0A 2QRGA 1OD9A 3UTTB 2IF2A 2QG9A 2IX9A 5KYGA 4LRNH 2UXDB 1YEDB 3IVAA 2PGJA 2QRLA 4IOJA 4CSSA 2R23B 4QTZA 3DNFA 3TM4A 1Q1QA 2WUCL 4K9MA 4HSAC 1KFAH 4TLSA 3W82A 1FFCA 4JJOA 4HCRL 3EADA 2WTPA 3RSGA 5SY9A 1ISPA 4YR7A 1WDLA 1DJHA 3PNOA 1RAFA 5IAEA 4CILA 5DRTA 3FBTA 4URUR 3IPLA 3DHWC 3QFJE 1F06A 3CR7A 4MUEA 1ENOA 4ZOAA 2BMDA 3WXVL 4DIDA 3A2MA 3QZWB 5CEZD 4U1LB 1NFDE 3NOOA 3D3VA 1EB8A 4GB9A 2GD2A 2WEKA 2C0QA 1DVFA 1YJDH 4N2AA 1J42A 2JCXA 4OZFA 3BP7B 3CAFA 4IWYA 2QM7A 1R3KB 2PP8A 1JBEA 4MR7B 1U9CA 3WXWL 4L4VD 2I24N 2XFXB 1A7OL 1FUYB 1MQ9A 3OMIB 2JBWA 4CDGA 4I48B 3NK3A 4IMLB 4X98A 5I0VA 1XHHA 2F3QA 1DQDL 3WMRA 4U7HA 1JZFA 3BKCH 4JLVA 2AZMA 3OOWA 2IWGA 2ZBGA 2FQXA 2NUBA 1T6NA 4HQLA 5JWRA 3QEKA 5IM5A 5CVVA 3UUWA 3B3IA 2E7MA 4JO1H 4CFSA 2G9RA 5KNBH 1COBA 1RTKA 3DMNA 2PPDA 2RH9B 2XWTB 4JXJA 4QM7A 3TTSA 3V4PA 4FFRA 2ZYGA 2WDPA 2N59A 1XCQB 2P4SA 4CI9A 3HUFA 4PRPE 2BH9A 2ZJ6A 1H5BA 1KR2A 2Q2EB 4DAGH 1Q9LA 1L2TA 4Q93A 4H60A 2OECA 3GD5A 1L5KA 4QVIA 1KXTB 1Y3BE 4A92A 1UXLA 4H0FA 3GHPA 5DSCB 4QBGB 4II3A 1EHNA 3IPAA 4Q82A 4BLQA 2Z3ZA 5DGIA 1CY1A 5JFGA 4NPKA 3NCYS 3JPYA 1Z25A 2IPLA 3IFOA 1NLMA 2MDTA 2X6QA 3R6WA 3D85A 4R8MA 3AOGA 3H2PA 2O4CA 1KY2A 2CIKA 1JQJC 3HS0B 2MJWA 2PX2A 4YP9A 1WCWA 1TITA 4X6EA 3K9HA 3C5JA 4J4HA 2B16A 4LXGA 3KJ4C 2QMHA 1S5HB 1HFUA 1PLJA 3R5JA 3R44A 3KE9A 2VLKA 4OL0A 5INTA 1PSZA 3L05A 2EJTA 3T3DA 2OULB 3UXMA 2XTAA 1LE9B 1R6DA 1B8OA 3UGTA 2VRCD 5L4FA 2Q07A 5DKFA 4Y4HC 2BMKA 1DIAA 2Z93B 3MRMB 1B3JA 5EERA 1QR2A 4K05A 4M7KL 2C7OA 3VXOA 4WI8A 4BKQA 1AS8A 1S7TB 4RVNA 1VENA 4M9RA 4PVLA 4RKYA 1CFJA 4F1KA 1KJZA 1E9QB 2DH6A 4RSHA 2QHRH 4LF3A 1NBVH 2OZPA 3K2MC 1SOXA 4UFNA 2XQYK 2XVAA 3A1CA 4LZAA 4DZBB 5MP6L 2J3JA 5F2OA 1URIA 4ZW3A 4Y2OA 2F1EA 4WO4A 3E6AA 4O0LA 4RLHA 3OHPA 4HO1X 1I9GA 5DU2A 3WOVA 1UC6A 1TZHA 1IRIA 4Q58C 3BISA 3IAS1 1BBJB 5GADl 1DJZA 2WJPA 2IXBA 1FH5H 3FLAA 1FU7A 4P5PA 3R2JA 2G3ZA 4CFYA 4CKXA 4ENEC 5HZGA 4L8DA 4XJSA 2CJWA 1KGXA 4I1YA 4DSAA 1CUBA 5ED4A 2VZ9A 1UH2A 3CDZB 5D5MA 2A0FA 3EO1A 1NGPH 2R29L 2EJUA 4NQEE 3ARBA 2WUDA 1DJLA 3UUFA 3VG0H 4O4HB 5GRJL 3LC0A 4PYNA 3OMLA 3RUGF 4G24A 5AUMB 1YQWA 5KTOA 3A05A 1Z4NA 4O4HF 2ETWA 5DJYA 4BJ3A 1RLBA 1YQXA 1PZNA 1P6AB 1NBZA 2JWYA 1QVOB 2H2FA 3I1IA 5LYJB 3QFCA 4IR7A 1CBVL 4R05A 3UTPE 2JCSA 4EL5A 3CHOA 1AQ6A 4QJ4A 5BXQC 4MUKA 5E38A 1RIHL 2P5TB 4L72A 3QUMH 2X58A 5LYJF 3EEYA 5MEOB 2QSTA 2F1RA 3ZIDA 2RGEA 4UMVA 3RRNA 3UGJA 2HMSA 4LSTH 4GSLA 3ZDXE 4ZCIA 1KMGA 4EQ3A 5C0JA 1TFHA 5HPOA 4POZC 3DT8A 2AXEA 1TA9A 3ZE2F 4UTBH 2XZLA 3X1KA 4E5UA 1WMAA 1R0SA 4FDUA 4K2UL 1URZA 1IWOA 2QV0A 4ABTA 4EY3A 3VD1A 4M7WA 4AJ1A 2ZT9C 2F1JA 2WOJA 3JVIA 3C9NA 4N8EA 1U2DC 2G72A 1NFIB 4BGIA 5TDNB 2Q87A 1BCRB 3IVXA 3BFWA 1A6WH 3D87B 3UAXA 2FPWA 1NVGA 2Q8NA 5CBEA 4ISCA 4QNMA 1PZCA 5H94A 5KW9L 4NCJA 2V7NB 2MSCB 1JFQL 3NEEA 3V32A 1DSFH 1WZAA 3M8OL 5HQ3A 2BGTA 1KP9A 4ZMQA 2Z2XA 4MRMA 5I1HH 4N5ED 4OI1A 1C2YA 3IU4H 1EE2A 2IC5A 4C6HA 4M6MH 4OCRL 1GLNA 1WPQA 1MT0A 3Q2IA 1GL7A 1BHJA 1RIFA 5I8KH 1DRKA 3NT5A 1V11A 3FCTB 2W58A 2JHPA 4OLUH 4HXAL 5KJRL 3HZKA 4J3SA 4NSKB 4LV5B 3CZPA 1XL1A 2X2UA 5JO0A 3OU7A 3LQZA 5C0IA 1E1RA 2D2IA 4B80A 3JTEA 2JNWA 3C8MA 5CJJA 1M5UA 2P2ZA 2HK9A 3WLTA 1YUHB 1UT2A 4NV0A 4UNIA 2HX7A 1TUEA 3RV3A 3D2UD 1SZJG 4W5TA 1M1NA 2NY3D 1W6WA 2EICA 2PR2A 5HIJA 4A36A 1I1YA 1I75A 3R6TA 3ED5A 1IFGA 2EEPA 4DJJA 2JLAA 4PLOB 4JZJC 2OCFD 4FABH 4KZDL 4FGWA 4DSZA 3GLKA 1A8JH 2IDTA 5LVEA 4HBGA 4O2EB 3CR8A 3DZ8A 1JUFB 1KZ4A 5IMLA 2Q3ZA 4G8FA 4BIIA 1R4ZA 2ZTSA 5DCLA 4LHSA 2ZUSA 4RTNA 2GRUA 2HFFB 2EXWD 3BUQA 5LQDA 2NY4B 3B56A 3P3TA 4XYLA 4Q4JB 1OD6A 2OKCA 4L15A 1J49A 2Q1UA 1E4JA 5DJAA 4PXAA 2AAVA 1ACXA 3QIWC 3V0IA 2NQDA 1FLDA 1GPMA 2PMFA 2QN3A 2JFVA 3KYMB 1XZHA 3AMLA 2XWJI 3QJUB 1ESZA 2V8MA 3R06B 2V98A 1FVCB 2WF6A 3PD0A 1GAWA 1GNVA 2CLOB 1FFGA 4OQDA 1UODA 2YH2A 4ND8B 1YZ3A 1A6TA 4XPFH 2EX1A 2OK8A 1M2JA 1UHVA 2FQDA 1BWRA 1FFDA 1LO2L 1RPZA 2SHKA 2B99A 4CG0A 1PRYA 2CDEB 1WABA 4KR7A 4TVOA 3EASA 1G9HA 5EXDA 4F3NA 4DJFC 2WXNA 1F8XA 4EPSA 4XJXA 1QVVA 2EBUA 2AV7B 4FMBB 1YN7A 3OJEA 4U6XA 1W4RA 1IHOA 5DTRA 1X5XA 1Z4IA 3VZSA 2YZ7A 5I1AA 3QWRD 2OJZL 1EO8H 1XLWA 4I5FA 4MINA 3IKMB 4CKZA 4A2DA 2A94A 4KU4A 2YS6A 5IH7A 2ZIAA 3U25A 3DTYA 4MGXA 3QWIA 2XB4A 4O8ZA 3QI7A 4K6GA 5KZCB 4XDZA 3SDCA 1E2BA 3UOAB 5E6RA 1NVKA 3P2JA 1WCIA 1CHNA 3AAZA 4KDTC 1PF3A 1XJWA 3BVPA 3ZWXA 4WU7B 5IFHL 3IJYA 3MFQA 1U90A 4WFIA 1HQYE 4Y4FC 1N8ZA 2IMNA 1KS9A 1WDWB 1MY5A 1JNLL 3RNLA 1J1OL 4FFZA 4PZLA 3SE8H 4OV5B 2PO6A 4ODWB 1T7ZA 1WD8A 3LLMA 1IC7H 1P4IL 2ZUFA 4W8OA 5BVHB 1XGTA 5F96L 4L5BA 3NCJL 1XB8A 1L9NA 3AL8B 1IM8A 1R46A 1NUPA 4HCGA 1N2BA 1ZOLA 2VP9A 4JQIH 4FZEL 1NVUQ 2AUNA 5L95A 1DAOA 1WXIA 1GARA 2D73A 1U2PA 3E82A 3RIHA 2OZ4H 4M3NA 4L29B 2XB6A 1NJ5A 5TD4A 4M49A 4KQGA 4JFFD 1K5GA 3KKPA 4KQKA 1Q92A 3KALA 4IKEA 4MB6A 4NFLA 1Q6YA 1E64A 5BWNA 5UKDA 5BW8A 5T5NG 2X0FA 4HXBL 3DKHA 3X1NA 1DJWA 4UQLA 2Q2OA 4HP8A 5IUCA 5BSRA 2FZKA 2QKSA 3K1ZA 5L9AA 3CNNA 1SYSB 2WF7A 4UNPA 1UXKA 2JI3A 4MS4A 3BM5A 1TQHA 3SFVA 3W34A 4QQNA 3FWYA 2UXBB 1YEEL 2XWBB 3TUZC 4YO0A 3ENEA 1GZQA 4CVXA 1UKQA 1TZCA 2ONKA 1OBVA 4KMTL 5DLMH 3KSMA 1I9RL 2AS5M 3DTVA 3IEAA 4A66A 4AJOA 2V5YA 1IOLA 5CEXA 2FMTA 1FZQA 3WK5A 8PAZA 4DO6A 2XWBF 5CGMA 4QEGA 1SN0A 2ZRCA 4PHGA 5AKEA 1EUQA 4JFPB 2NU6B 3D2AA 3MACL 5DDHA 4A2WA 2ADJB 1DOZA 5JZ7C 2VKWA 3LYRA 1Y3FE 1PJ9A 5JIQA 4DA7A 3C60B 3T0EC 2RKWA 1V48A 2YW9A 1NLBL 4NBUA 1ZHNA 4XXDA 5EHGA 1R4XA 3WBDA 3KTAA 4WZ6A 1J8MF 4BLRA 5BORA 1WG3A 4IGKA 8CGTA 3GJ4A 1XMVA 1J06A 3RTAA 3ZX4A 5I7OA 4AMZA 2DDQH 4NP6A 2WKSA 4WXYB 2COVD 3L8DA 3HI1B 2FFHA 2A0LD 2FX2A 5EAIA 3HOGA 1WF6A 1K2DB 4UPDA 4LEXL 1LTKA 5FS5A 4PAOA 1JFRA 2YVAA 3M6IA 1U3JA 4RGNE 1N68A 5CZKA 4Q6IA 4OY3A 3P0VH 4P0DA 3T08A 3IDGB 2MPAH 5MFPA 3L4VA 1U0SY 3CSFA 3I4CA 5KNBA 4QRAA 5C0BA 3GAZA 2PYED 3KVPA 4FLFA 1PV2A 3GIZH 3CN2A 1CNEA 3KPSA 2P4UA 3G8YA 1JZJA 1NF3A 3LKDA 3TVMA 4YRBA 3OWHA 3WQBA 3CZFA 1RLIA 3VYPA 1AKEA 1U8IB 3LUFA 2OK0L 5JO5A 4HJ0D 3MWJA 2I27N 5DE3A 4X7RA 4IDNA 3D6AA 1Q9KB 1PU0A 3MGTB 1IGMH 2HPVA 4WSOA 4B6SA 3NAMA 4B0MB 1LVGA 1H2BA 1JDVA 3Q9SA 3HMWL 1G2OA 1GW6A 1AKJB 2ECQA 3NA4A 4HAGA 4HR7A 3K2EA 3QFRA 3N7TA 3WGTA 1NCWH 1SHYB 3R8BB 4EECA 1CY6A 1Z6GA 5JQ6L 1SIUA 5C86A 2Y0BA 5K6AA 1N5YL 4HWZA 3VHRA 1E28B 4BDVB 4PZYA 1GR7A 2R6HA 5JCJD 3UGUA 4IZOA 2AXQA 3T77B 4LT7A 2IHUA 2ACEA 1C7JA 1RHHA 4CSPA 4FNQA 3IRVA 2VSMB 3HHSB 1MAVA 4DBVO 2MSLA 1W36C 4L9AA 2NYKA 2FN7A 3V8NA 2QTTA 4FQIL 1XF1A 3FUHA 2C3OA 3QQ5A 2CGRL 1Q91A 4AXXA 2VXBA 1BIHA 3KDMB 4W9NC 5GSVB 3MZGB 3NHLA 3RCBA 4HFNA 2C9MA 3KB2A 3FYDA 4ER3A 1VPDA 3EZGA 1PEYA 1GSOA 3JW8A 4NYLA 1VPOL 1VRSA 1A9EB 5HHVH 3WGVB 2OXIA 3T2PA 1J5OL 3MMXA 1A9ZA 4LPVA 3OAAA 1Q3TA 3VWJD 1T9HA 1KN4H 3POCA 4K8RL 1B1CA 4KQ2A 2VR7A 4IYJA 4RL6A 3ICWA 2C5SA 4P38A 1NAMH 1OP4A 1SC1A 3D50A 3ICPA 2H4ZA 3LP6A 2XAUA 2QD1A 3O3DB 4FQ8A 4X4YA 2BJVA 1GGIH 1AIPA 3FN0H 2BTQB 2WIJA 1DIRA 5AW8A 3D7SA 4HQ6A 1DQMH 1HV8A 3MUOA 3TSAA 4KKNA 4LIQL 5IG2A 1T8RA 4FFZL 1NULA 1U33A 4OAWB 2XBLA 3IT3A 4KQWA 5CIPH 3PFKA 3H4HA 4U6QA 1AG6A 4NFHA 4H77A 3CUTA 1QK4A 4J1SA 4PMFA 2X0KA 2PV7A 1G3UA 1R75A 4NK5A 5K6TA 4LJ9A 4XWTA 5CW1A 2XFGB 3ULVE 1CFSA 3Q01A 5IXJA 3VPXA 4XN4A 4W8HA 2P35A 1XGPB 4PGFA 5T6BA 3EHBC 1P4LA 1X5MA 5EZJA 5JA8B 3CG0A 3H11A 3O4VA 5F1OA 5ID0A 2OTWB 2GEBA 4ND1A 4PG5A 3QNXA 4BO8A 2Z7UA 3G2QA 4C1BA 1RR6A 4MICA 3LPNA 4QJ3B 2YZKA 2ZBEA 3QCUH 1KF9B 4U6HA 3VGFA 1X8XA 3LN9A 4B6JA 3H9SD 2F64A 4BNTA 4C7KA 4PJAA 3MNVA 3DUHA 1YRLA 1DC5A 3B3FA 4OSUH 4HUVB 4F84A 1YMME 4IDBA 3ZL1A 4LPSA 3II3A 3LQMA 1TJ3A 2ZR7A 4Z6AT 1KPVB 3OBIA 1UURA 5IR1A 3SC2B 1ZNQO 3IB4A 3MLZH 4LRNL 3IOEA 4UTBA 3GSRB 2MTPA 4OH7A 4L3FA 4YP5A 2HK6A 5TMEA 3FHQA 4HIIA 3F4KA 1LXMA 3ZDDA 1Y7IA 2R5NA 1KQPA 2YXMA 1DBVO 4OATA 1SB9A 3UPDA 2X4LA 4A0HA 4ND7A 3O3BB 4H25A 2PU7A 5TARA 2AN5A 1J0HA 1OWLA 4PJFB 4IIJB 3OF6A 3K4QA 2DLEA 4K15A 1YJDL 5DI8B 4PJFF 1DG1G 3GGSA 3QPCA 3DBSA 4P2BA 3DLHA 3JQBA 5FOWA 1VPVA 2IAMC 1YE3A 2DJ4A 3IDOA 3B2NA 4D9EA 5IS2A 1CWUA 1ZX1A 4N2CA 3ODPA 3U9PH 3NJIA 1X7TA 5DIFA 4R3NA 1OFHA 4F4HA 4GSDH 1LMKA 5ADOH 4II2A 3ICVA 4AC2A 2ZOKB 3BKCL 1CXEA 5I1KH 3M9WA 3KYOB 3RSLA 5TMDA 2JGAA 3HC3H 4YQFA 3K16A 4JO1L 2Z1MA 1YB1A 3IUYA 1TYCA 5E8EB 1LHZA 4D4MA 5DZAA 3H5IA 3MPOA 2PN5A 4GR9A 4FS0A 3HDYA 4XNXH 1QLEH 3MRLA 4WCDA 4ZARA 3ZK8A 2R7KA 5KOHB 3NH6A 4QDOA 4NZRH 3G5LA 3U6RB 3F67A 1LDPH 1ZHKB 3FFWA 3UC0L 4X4XB 1WTCA 4YGAB 1IGCH 2DCUA 3W5MA 1M34E 1JW9B 5KQRA 3N28A 5KWSA 4FOMA 2VXVH 4EIGB 4TRNA 4LLVB 1E9EA 4B34A 1E8WA 3PFBA 3KH3A 5IW8A 2FBJH 1ZD4A 2OYRA 4KV9A 2BLNA 3UPRA 2E6QA 4RGQA 1SXZA 4NGHH 3WBBA 5HHOE 2OPCA 1JZGA 2R8XA 5GRYA 5I01A 3N6VA 4DR7B 4JZOA 2G4EA 3STBA 1ZWIB 2WHXA 3FOWA 1CU4H 1XD0A 1N57A 5CLZA 1S8DB 5DHYA 2JHGA 4KRYA 1UL1X 5CGYD 3FZQA 1T8WA 1HNGA 2G4CA 3BEWB 3FSWA 1QHHB 2QLBA 1WUTA 5D7JC 2BBSA 1DSYA 4IIUA 5CAEA 1QRSA 5KJ4A 3PGMA 2DEXX 5HM6A 3HI6H 1QIFA 2NNLD 5AVUA 4F4JA 1WIOA 4JROA 4C0AC 1OP9A 2DQCH 2B8TA 3H7BB 3KXIA 2JLLA 3P71T 1CJCA 4YJHB 2C94A 5EOVA 3HEBA 3R24A 2QHRL 1NBVL 1IUNA 2V2WA 1LO4L 3Q6FB 1G0OA 2XXMB 2FJPA 2BT4A 1X5FA 3TO2B 3SE9H 1PDWA 2Q9CA 3DARA 2PL9A 1RKXA 2YY5A 3RZCA 4RLFA 2YA1A 4CJXA 3KW8A 2IADB 3HG1A 1G21A 1UJMA 2JGRA 1N64H 3QTBA 2IH3A 5CR8A 4S1QH 1FH5L 3REOA 2VAXA 3I50H 1KYAA 3TKLA 4TKWA 2DR2A 4HSQA 2AR7A 1GZ4A 1CZLA 1QP0A 2N01B 4H6VA 4RJ2A 1L4FA 3QIBB 3AVYA 3IQEA 3VI3B 5D8JH 1NGPL 3O0LA 2VDQB 1X5HA 3HFMH 5B39A 3VG0L 4Z99A 3DQZA 4DPLA 3OLGA 3W5IA 3IKLA 5JSZA 3WHE0 3DX9B 5DYWA 2EDJA 1JZ2A 3QOWA 3Q5OA 3TZEA 3WL3A 1GW0A 3ZTEA 4NJOA 4O1IA 4BNKA 3GSWA 3OSKA 3BESR 2DQKA 1X38A 4MQ6A 1UAYA 3H3JA 3W1EA 2OZ4A 2AEMA 1AZNA 3UC5A 4LIPD 4JKPH 3ADBA 2GA8A 3ULSB 3TT1L 1YBFA 1O0BA 3BPLB 4F9PC 5HR5A 3RK4A 4EI0A 1T25A 2Z6QA 2C26A 3DMTC 3QUML 4U1SB 3UFXB 1XAKA 2P2YA 3PU6A 3E1GA 3FGNA 3U49A 3UCXA 3H1ZA 2EBHX 2JCCA 2R56H 4HH1A 4XGKA 4LSTL 1E94E 4FZ5A 4MMYB 2LCFA 2X9LA 2BFBA 4JFXB 1U9JA 3BD4A 1ID5I 3CVHH 3LF2A 3BLBA 4LOVA 1VL8A 3RG8A 4R1LA 4A1RA 4RESA 4UE3S 1XU7A 4NQQA 4PJEE 5DHUA 5AM3A 1HHJB 4XP1H 5JW5B 1F4HA 2F54A 5EHXA 5JECA 4CKQA 1Q1GA 5E8PA 4M9UA 3WAKA 4GYYA 4BSVB 1JI0A 1A6WL 1QVZA 5DUBA 2IALB 2HMID 2Y6SD 5GS1A 1EG2A 3TE7A 1C1XB 1H65A 4Y5VA 1P4SA 1DSFL 1I7UB 4NPJA 2YEVB 1FQWA 5JXIA 1M56B 4TYPA 3WFBH 5I1HL 1T22A 4PYQA 2CO4A 2B1OA 4TUUA 3IMVA 3IU4L 3CK0H 1X3LA 1EHXA 1EV2E 1EWYA 1G2IA 5ER6A 3DVGA 4DTIA 2C0CA 2JAHA 4MVJI 4RA6B 5I8KL 1HYSD 4NUJB 5IBCA 2BI8A 3IDYB 4H5SB 4OLUL 5JQIB 3L2OB 3KL5A 1AZUA 1T7XA 2W0FA 3DV0A 5IC5A 3KPRB 1RYZA 1QQBA 4APQD 5EEXA 5EC1A 5EJFA 5I4BA 3LRGA 1HWGB 4X61A 3ILHA 5AVTA 1OZAA 1U3WA 4XN8A 1VGKB 3CE6A 4RV9A 3W8EA 1ADCA 4FABL 2YD7A 3G5MA 3WIUA 1SUBA 5HUQA 2R84A 2E48A 1GSIA 4J3UA 2H1CA 4OQ4A 3MBOA 4CM3A 4EJMA 5AZUA 4GQZA 1ITZA 1GOFA 4B53A 1E4KA 3BGVA 1YQGA 5SWZA 3RI5K 4QA9A 2IYEA 1JILA 1DVFC 1CJVC 4PZEA 2IANA 3H2SA 3V3KA 4AMVA 1I8KB 3EWSA 4U2FA 4UMEA 3WE7A 4IBQA 2XJ4A 4ONFL 3HCRA 1ED3B 3C3CA 1DAGA 2DY2A 4BRVA 4CDGC 4HWKA 2XU9A 1N2IA 3EW3B 3TW0A 5BWOA 4TRRA 4N47A 4ZAKD 4N85A 3U82B 3WSWA 3LT2A 1KL7A 2VQSA 3T65B 1FXSA 5EU5B 1RPNA 2FH8A 3CZAA 3QO0B 4L3VA 1NTDA 4M99A 3K8LA 1JECA 1FVXA 2HJGA 1E43A 3LYLA 2X7LB 4NBNA 4PRNA 3FJTA 1ECJA 3FQXA 4I0PD 2FX9H 2VDPB 3NHPA 3KD3A 1KXHA 1YNTB 1VSCA 1EO8L 1N5IA 3WTUA 1SA0B 1M3SA 4AG3A 1AKMA 4X1KA 3LKNB 4NYMQ 3QOFA 4OIBA 4D5GA 1U5BB 1KH1A 1YNTF 3N0PB 1NAMA 5C32A 2Q7YB 1RLWA 5I7AA 1N6VA 5T1DL 5EZLB 2K5UA 1EXMA 3FUVA 1WTLA 2ERJC 1RXYA 2JGJA 4KE6A 1K86A 4Y9UA 2F3RA 3DJFA 4IHOA 3STWA 4LI3X 4AJJA 2DWUA 3B34A 3OLEA 3QUZA 2J4WL 2E9SA 3IBTA 4YAUA 4ZT3A 3UPTA 3CJQA 4OY9A 5FV1L 1OAKH 4RHEA 3QEQB 5CIPA 1OGSA 2O23A 4MJ7A 1IC7L 4YA6A 4P2QB 5B1JA 3OM9A 3ADKA 2OXEA 4LARH 1SN7A 3GLIE 3BT7A 1KPUA 1A5FH 2F9LA 1H6EA 1B3BA 2GASA 4GKNA 4JQIL 4EPYA 4PM1A 2SBTA 2ZW9A 5F7ZA 2EIMB 3OLVA 3H2HA 3KFLA 3O3CA 1JHQA 4QXUH 4HMDA 1QG6A 2OZ4L 4LMQI 1U8UA 4Y2RA 4TL5A 3M46A 2HU8A 4Y7MA 5JQGB 1WSAA 4FG0A 3DLQR 2OXHB 2FE1A 1X5IA 4RQTA 4HUWB 2PR9A 2WKWA 3EZFA 3R74A 3QNYA 3W39B 4S1VA 4MUIA 4JGMA 5B1DA 1M1SA 5EZYA 2EYTB 5ACZB 2B39A 2XUDA 1E7SA 1MVUB 2CV1A 4WO4C 4E9VA 1VCAA 1EM8A 1JALA 5DJDB 5IVZA 5LQBL 4PCSA 4ZU6X 4P46D 2CPUA 4Y6LA 2KI5A 3NAQA 2FSFA 4JLJA 1HSZA 1P2TA 2VG8A 2HV9A 2IOQA 2MYUA 4XD7A 3TH2T 1OASA 1BGXT 3MX0B 2X2OA 4Y1AE 4YP0A 1GMEA 2WZCA 5IEKA 4UM8B 5EZIH 3EC7A 4HAKA 3VCLB 3ARBC 3FAKA 1S2IA 3GI8H 1T3TA 4JFDA 2W8CA 3WHXB 1UJTA 2H07A 2JKIS 3A9VA 2XDHA 1ACZA 2J56A 2PT7A 1EGJH 2PX0A 2V5VA 4L3CA 3QYCA 1K6IA 1QU2A 1DJNA 1KBWA 4J49A 2VFAA 2NUAA 1B0RA 3CUYA 3KFVA 2FO8A 4G8DA 2DDQL 1PHRA 3VZPA 2RGNC 1HFKA 1ZGZA 3W9EB 3I3EA 4OHMA 1MVYA 2CLRA 1JGLH 1V7NH 3DGGA 4A5OA 5BOSA 3VO0A 4JYAB 1XFPA 1IB5A 4EGQA 1KEVA 2JQAA 4HYEA 2NXWA 4GD3Q 3HNVH 3TEZA 3DKPA 2IYZA 3G2HA 2OXTA 3TBYA 3B85A 2EXTA 2UXFA 1Z16A 3P0VL 3RFFA 2WMPB 3GH1A 5FYKU 3AGQA 2VSOA 2YPKA 1XMPA 2MPAL 1TLKA 2KMWA 1NEUA 2OBBA 5HPYB 1I1NA 4UEKA 5TT1A 3DV6B 1JE6A 4RK7A 1YO6A 1SQ5A 4O2FB 3GIZL 4WWKB 5JDSA 1B6GA 1Z06A 1T5KA 4KDRA 3V6BR 1P1ZB 2OW7A 4C0SA 3SSGA 5FBQB 2PWZA 2BEKA 3CIOA 5KREA 3NBKA 4C3OB 3VD0A 2I2CA 1IGML 1VG1A 3NJ4A 1RXEA 1TIPA 4PYHA 4G1CA 3EQ2A 4IS6A 5DJCA 3S8EA 2ZSIA 1B6RA 3VPFA 1C0LA 3NRQA 4NKMB 3CFKA 2ZCLH 3SQBB 4Y4HA 3PL6B 3VBCA 2XNAB 1JV2A 2ITDB 1Y48E 1NCWL 2X4TB 2K87A 3O0DA 2BE9A 3TOSA 5EE5B 4V1DD 1DBSA 1FDIA 3DUWA 3SYTA 4GRDA 5EJEA 3N1QC 4FLHA 4N0UB 2GEDA 2H2IA 4EWLA 1L0BA 3CFIC 3BWUF 3QEHB 2VBIA 3WLKX 2XY4A 4QXTA 5HGHA 4EAEA 3V79C 4DNXA 4PREA 3EOBB 1TM7E 2R51A 3V5HB 5FYLH 2ZAMA 4G6MH 3P77A 1SB8A 5GS3A 3RVLA 2PT5A 4QQ8A 1HPLA 4PYIA 5JLZA 1X5KA 3ZI4A 1W34A 5G55A 3OEWA 1YTLA 1K3UB 2JELH 4PAWA 3HB3C 4MCJA 4U1JB 4HZLA 1UOKA 4LKCA 4EVSA 3KPPA 4EGFA 1QDUA 1BFSA 1XO8A 3GSQA 5C8JB 3SEFA 3P94A 2GB4A 5HHVL 4KQEA 4KFRA 1V9SA 4B3FX 4NLLA 4OMFG 1U4SA 4JRXB 4Y5XB 1FLTX 2RFXA 4E2OA 1KN4L 3N59A 1XLUA 4B4DA 3ZYZA 4AV0A 3FTXA 5A5EA 1YC8A 1F2UA 5IKMA 5CBPB 3KSBC 1I4EB 1NAML 1E9CA 2OJ1A 2JFFA 4M5ZH 1QC5B 2NLJA 2POCA 4BFIA 3N8NA 4RZUA 2I6GA 3G9QA 1GGIL 4ZPVA 2EYSA 3FN0L 4OREX 2C2KA 2KI6A 1UKAA 1DQML 4LDOB 4I18B 1XXHB 1LC3A 2BDUA 3T3MB 4NJEA 1CT8A 1SHJA 3CXRA 1F02I 4ZAXA 4I7ZC 3VQ2C 1HDMA 4G8IA 3ISVA 2L69A 2QR0A 3T3MF 5DTFB 2R1WA 4PRHB 5J11C 5D7LB 3FIUA 4CN1A 2CNOA 1EA9C 1YBAA 4JASB 1BGWA 5FEMA 3GLFA 4DLRA 2BOCA 2P8LA 2WTMA 3MUGA 5DHXB 4BP3A 1Y37A 4WEEA 2J30A 3PC7A 1NDQA 1OXYA 4OVUA 1M05A 3QCUL 3EISA 1ZNZA 4PJ7A 1MJGM 2OQJB 5I76B 1ND0B 5CDHA 5I9LA 1SK9A 1N78A 4B9JA 2XD9A 4X8MA 1SSLA 3IEIA 2LQRA 1NNEA 1HZKA 2HMWA 4OSUL 1O6VA 2DMBA 1CY8A 1YGPA 5FCUH 4DLZA 4GYJA 5IN4A 2BMWA 3VNZA 1QLRA 3MODH 2HBRA 1FRNA 3TH4T 3MLZL 3SDCC 3C6YA 2X77A 3CVHA 3FKUS 2J7LA 4GI3A 2V5MA 2J5XA 1EZVY 4I77H 1CBUA 3BBLA 3NZ8A 5REQA 2WY2D 1WFTA 1FZTA 4PRIB 1JGUH 1H4VB 2PO6C 4C5CA 4HZUB 4XE0A 3UMJA 1HORA 1XMOB 1IN8A 5C5DA 3A9TA 2R11A 1EMTH 2POQX 3T4EA 4KN9S 2AGJH 3F5WA 2QJWA 1FSKC 4DA9A 4RPIA 3LP8A 3D0QA 2VTDA 1RH8A 3LDUA 4JZJA 2HZHA 3ZTYA 3PVSA 3HCVA 1KI4A 2PKWA 1THTA 3W2DL 3SGJC 3BE1H 4TSCH 4YMGA 3IIJA 2F8SA 1UJ3B 2VYFA 2DE0X 3C7CB 4TMYA 4BFVA 2EQAA 3BGSA 4AKTA 2YXPX 3NTRA 1L7QA 5F7BA 3IXTA 3U9PL 3CF4G 4F3FA 3AACA 3BD6A 1BOYA 4OJAA 4GSDL 3OJOA 5ADOL 2XHNA 2Y2UA 1RUAH 1AGYA 2CRIA 1U8MB 3PP3H 2D0DA 4IK7A 4G6FB 1IC1A 1L0QA 4N8VB 4AZ8A 2WJ5A 3SGEI 3HC3L 1XGQB 2ZS9A 2AXNA 2V1XA 3PXAA 3QH4A 3QFDB 5KC9A 2QR5A 4G1EA 1TQBC 4DCQB 2JBAA 4K7PY 3QIWA 3TGPA 1CYXA 3LXUX 2J6EA 4G0XA 4XNXL 1QLEL 2P48B 1QHQA 3PWNA 1P33A 1XEWX 2H0QA 1IY9A 1FVDA 1JWSA 4PYJA 1P6QA 4BA8A 1LDPL 2B9BA 5LP6B 1CFVH 5E8DH 2O5ZH 3RA7H 4F2GA 4PSDA 1IGCL 2PCPA 2VXVL 3H5OA 5LP6F 5CEZE 5AW2A 1IOZA 2R2GA 4AN0A 2CR3A 2XQBH 5KTKA 5TDOB 5MF6A 4GLRH 3P73A 4Z7UA 1TO6A 5EUOE 2EDOA 2FBJL 1YJDC 3EH4B 3T9EA 3TRFA 4NGHL 1KMHB 5D5HA 4M21A 1VBNA 3QELB 3PR3A 1XJ0A 2OJEA 3KZXA 1ZH0A 2X09A 4OIAA 4TMFA 1PG7W 1M10A 1VGEH 3HBAA 3W81A 3QXDA 5BPPA 2P9EA 4RMUA 4Q12A 3OKPA 4AY3A 1CU4L 4DCOA 3U44A 3ILQD 1JIIA 1KI6B 3ZGYA 1E3EA 2YN5A 3WIHH 5FF9A 4EZEA 5EXEA 3W78A 1PZFA 3TCLB 4XPIA 3RVNA 4KDTA 1E58A 5LGJA 1SDYA 2FL5B 4NQCA 5CXQA 3M4JA 3HI6L 1OWRM 1ECFA 4LN1A 2IKSA 4ZUSA 4TWRA 5K05A 3RWCB 4Y4FA 4D0CB 4FHFA 1S9YB 5E7FA 4WUUA 1N2ZA 1QH1A 2KQUA 2K3TA 4P4LA 4GW5A 4XWAA 3HDJA 2EVWX 2OR3A 1F7UA 2O3QA 3LKVA 2P42B 4AVKA 4IUYA 2DS4A 3FCEA 5A4DA 5LGKA 2BKAA 4INAA 3UTDA 3SE9L 3ZXIA 4GSXA 2QUHA 3W0WB 2XRFA 1CO1A 3U4EB 3OFKA 3MTBA 2JCGA 4REQB 2A4KA 4GBXB 4N2OA 1MO4A 4KFCA 3N2KB 4OSEA 3A31A 1N64L 1A02N 2F7RA 4X0NA 4TQ9A 1WXFA 5E1AA 3ATEA 4S1QL 5DQJB 3H83A 3OQJA 1H6CA 2CL0X 4EGAA 1JHAA 3S97C 3HLKA 4WT7A 2VN4A 3AFNA 4XDYA 4OAQA 4ONHB 1QMGA 5D8JL 1OAKA 3DIFA 3NP3A 4XVRA 2X0UA 5ICXB 1QHXA 3GJ3A 3HFML 4AQ8C 1CBJA 3PV6A 2ZJAA 1Z3IX 4P2OC 3ZE0B 4DKDC 4LJ6A 4QGHA 3RWJA 3GMQA 1MF2H 3GEEA 4NKRA 2C00A 3EZ2A 3DEAA 4XW2A 3ZE0F 2Z3WA 4B3GA 2YAPA 4JKPL 1CE8A 3D8UA 4QHKI 1F6AB 1FS6A 2YIVX 4WI1A 1NIPA 4QF1B 2WWNA 1N33B 3MV11 3T0EA 2O52A 3NM6B 1F11B 3P5BA 4YAQA 3BPOB 1SVOA 1W0YT 2R56L 3KPVA 1VMKA 5FDFA 3SDZA 3PF2A 3O7MA 2CHWA 5BN3A 4KRMB 5FOQA 4G7VH 4O2BA 5J4LA 3WB9A 2VQEB 2CCLA 2WIGA 1FZJA 3ANYB 3I58A 1IGFH 3FQTB 3CF6R 1ZVVA 4F9LA 1YZYA 4NKDB 4UBLA 3CVHL 3OZ7A 3ARVA 4OTZA 5F1SA 3GUHA 2ZZKA 1X6VA 3WK6A 3FT2B 2IIJA 4L8CB 1S9XA 5I6XB 3F46A 1KAMA 4RW0A 2DQHH 3FO2A 1P6FA 4BVEA 3CBGA 4UNTA 5ALUA 4JPKH 1LP9B 2XY2A 4XP1L 2XUPA 1Z0DA 1ZFNA 4B7CA 2GSMB 2HH9A 2J5QA 2ST1A 2B34A 3VFNA 1JCVA 1ZGLP 1JFHA 1NUAA 2JH8A 2OB1A 3K6IA 1LP9F 5E5MB 1XR9B 2VP5A 5CK5A 4KWEA 4FG4A 4W6ZA 1LO5B 1EGJA 2QTGA 1J09A 2LXNA 4XCYB 3SKMB 3E4CA 3OKYA 5A6VA 4KAQH 2BUAA 3Q1EA 4YSQA 5JA9A 3LCYA 3V0EA 4H1WA 3BVVA 2OZLB 4Q15A 3MS7A 3SQDA 2QRVA 3L3JB 1WS8A 2G7MC 4BXVA 2BISA 3C7KA 3U5ZB 5BMOA 2HT1A 1TUGA 4PANA 3CEAA 1ZS8A 3LVFO 3OUTA 5A9SB 4QD2E 2DECA 1EA7A 3RURA 3LDHA 5HZKA 3RKDC 3K9GA 1A4JB 2LDXA 1NX6A 4NJ9H 2G1KA 3VM5A 4KJXA 3KPRD 1AUQA 3U7QB 2HJVA 5KYXB 4LXUA 1XSEA 3E3QE 5HDRA 4R26H 1YEFH 3KD2A 1QA9A 1AFVH 3KDPA 1E27B 1BF2A 4AJ2A 1SQSA 2I8LA 1HNFA 5EOCL 3NRFA 1E7UA 1I7TB 3S1SA 4H8QA 3RWGA 4B48A 3WNKA 1NBEA 5I1DB 4UTOA 3CX6A 2GBFA 1T3HA 4BRSA 3QVSA 1F3DH 1W6LA 4N3TA 4AH2A 5SWSB 2JD2A 3JZFA 3U4AA 4XNZB 35C8H 4QFMA 3OWRA 4HEHA 2RG1A 1PVDA 2GITB 3U0PA 3HYRA 1DX4A 5CLFA 2CNKA 1PCXA 1SD2A 3TTWA 3GMRA 3V4PH 3B2VH 4Y2NA 5C71A 3TT3H 3QI9C 2WBKA 1NEPA 2ZRDA 4XNAA 2N7AA 2ICWB 3LQQA 1B0PA 3OKAA 5F7EH 3HVKA 3NPAA 1IGTA 4OGYH 1A6PA 3GAFA 2QP9X 1NU8A 2JIMA 3TN7A 3BH8B 2NX5D 3MGBA 2A1TR 1ZHBB 3VKVA 3PWVA 2GSGB 2H9IA 3QE4A 3ALXA 3U79A 5F7UA 4P0TA 4S1DD 5I28A 3E2PA 1QIEA 2GJKA 3AIKA 5B4MC 1GCUA 5JSKA 3WFJA 4PXYA 2D9QB 4FJZA 3L4WA 1BAPA 1H2FA 1OTXA 1V27A 5HYFA 1ORVA 2EDXA 4YE4L 1D5RA 3QARA 2BHRA 4DEUA 4RSRA 4FQPA 3ND9A 4MWDA 4XX5A 3X14B 4D0LB 4TQAA 4WHCA 1WH0A 5A2QA 2FX9L 4NONA 3GGOA 3PCTA 5I17A 1M71A 2QLFA 4JI5B 5DNEA 2RHHA 1KORA 1JDPA 1AG9A 3SHTA 3QA3E 3CVJA 4O4JA 4B84A 3PX7A 2XC8A 3ONDA 3WDLA 3NI2A 2I4OA 3LKSB 1Q0EA 3VFTB 3I6QA 1RSYA 2FEMA 2B4TO 5I71C 5EU6B 3DV9A 2GW5A 2LE9A 1DZIA 1JF1A 2IIBA 2X9YA 3EF1A 4ZXBB 2FJHB 5CA1B 1PYGA 4Y9DA 2YJTD 4OA5A 1JZ8A 1O0CA 3TZ6A 1OAKL 1X0VA 4MW1A 4Y1RB 4U00A 1KULA 4HUXA 4BELD 2R6R1 4MB4A 5CA1F 4U1GB 3MBWA 4LARL 2ZAYA 4M1MA 4KEAA 1A5FL 4DKFH 1Z4QA 2ODIA 3FOAA 4X5WA 3FH7A 2X1MA 1ENYA 4CKBA 4LDCA 5M94B 1ZI9A 2VHZA 1XRLA 4PJXA 3Q5DA 4QXUL 5JANA 3IAAA 4I0CC 4XVCA 2YK1H 2GUWA 4FA8A 4GY4A 5LG1A 4YXWD 2JIOA 4WEUD 4JREC 5DZJA 4J76A 1YAJA 3WFHB 1Q3KA 3FSZA 3LTVA 3V52H 3HZHA 3F7VA 3F6CA 4DJDC 3HRHA 2XXGA 4Y30A 1TADA 3PITA 4RLDA 4OBEA 5I9MA 4QRTB 1G7JA 2OV1A 3HKBA 3BUPA 2Q0QA 4PS8A 4LHUB 2RC5A 4RS4A 1K3IA 4BVFA 3VUFA 4B43A 4PVMA 3SC4A 1BX0A 2GZSA 2V7WA 5EWIH 3JQAA 2IBMA 4UBOA 1CZKA 4QXPA 4Z95L 5E2TH 4YXHH 4AVHA 3D4YA 4MR9A 2WN3A 3B1KA 2FO1A 3EYQD 1YEGH 4ARAA 4QMEA 2JI6A 4NZYA 4G9DA 3FMFA 4E2FA 4RDHA 1QP7A 1IWPB 3EVGA 2C1ZA 1PGNA 4EN2A 4R7TA 5EZIL 3QW9A 5FB8A 3ZV7A 5U4QA 4JJFA 4GS7B 3KJNA 3GI8L 1IPFA 4Q1CA 3S98A 3AGPA 4BU1A 3MTIA 1YR8A 2FX8H 1A4KB 5E08H 1JV5B 4BATA 3VO2A 2DWDA 1EGJL 3VX4A 5ALBH 4YHBA 2PZJA 3ZZ1A 2W6NA 4I2VA 1UBJS 4RAVA 1XRSB 3E1ZA 4CM4A 4JFFE 4F3YA 3RQ3A 3B36A 3ZVLA 4B95C 1N2SA 1JGLL 1KDVA 1V7NL 1WCYA 2B6NA 4HMEA 1JL3A 4UHFA 2R2EA 2BFDA 1JHRA 4JLKA 2ZSFA 2OXRA 3VPDA 3CX7A 5E6SB 2YMLA 3HNVL 4Z53A 3QUXB 2H32B 3LGAA 3LU1A 1WGVA 1ZN2A 1T0NA 3P9LA 4AZ0A 2ALJA 3QLVC 3I0MA 4WEOA 1I7RB 5KYWB 1AZLA 2YTZA 3U36B 3ARZA 2WKQA 2L18A 1TDJA 3IT8D 3WV4A 5I73C 1D9KB 4HWNA 3EFEA 5C8XA 5IF0A 4YSTA 2C54A 1Y89A 1SXJB 1UM9B 1GLGA 4P5TD 4UM7A 5I75C 3MRIA 3IDNB 4IO1A 1J7KA 5IAOA 2UZ3A 4KDCA 1EFXA 2PZ8A 2YXFA 1OAZH 1UM6H 3QPQD 4KXVA 1V3QE 3BFJA 3LY5A 3QP3A 1ZMTA 1OA0A 4D1YA 4J7UA 2QD4A 2MH4A 5D7JA 2RBLA 3BH7A 1EIBA 2EJWA 2C9XA 4E70A 2AJVH 1LI4A 1IIIA 3U2JA 4HC4A 5GS1C 3QJRB 5D7HA 2BOBA 4OK3A 1H0SA 1PJ8A 3JVDA 1CJSA 4Y5VC 2GTIA 5EDSA 4H6PA 4L95C 4GWLA 3UWSA 2XVBA 5IT5A 1I3VA 1OT5A 3BIBX 3A26A 2PPCA 3IBYA 4Z86A 1JVSA 4RE6A 3KLHD 2XTJE 1D1QA 2B77A 4H27A 3D4GA 1RZUA 1U92B 2X3CA 4X6BA 5EMMA 4QYSA 1OWNA 3TH5A 3FKSA 3K32A 3L8GA 5DJXA 1XFAA 4OHCA 4AKSA 1KB5B 4X4ZA 5FYLL 3X17A 1RYBA 4RKWA 4DUGD 3BJLA 4G6ML 1E2UA 3HTXA 4NEHB 4DZ8A 3C85A 5F70A 5EGNA 5H02A 3X1FA 4EA8A 4ZNEE 1Z7YA 3U56A 1W4AA 3IPYA 2PYEE 3R4RA 2BP0A 2IEGA 4WY2A 1M9NA 4IDFA 2JELL 3FNEA 1F97A 5I9QC 4Z77B 4I36A 4ZALA 1FFPA 4JDTH 3BJMA 3HZ3A 3FK3A 1U8PB 3GJEB 2GM4A 1Z0JA 4QARA 2FO4B 3T7RA 3N87A 2CXTA 1YY9C 5EP2A 1SXQA 4Y9EA 1C29B 4F8YA 2FW9A 1BEYH 1RQ7A 3FUIA 3NP9A 4LZWA 2XZDA 2I2WA 1GAEO 2V9RA 4M5ZL 1UPTA 3QBVA 5AG9A 2AX4A 2KB0A 4M1CC 2H4HA 2GKSA 4R0MA 2QQLL 1U1CA 3FRIA 621PA 4F9PA 5B4VA 3MG9A 3KHSA 2CHQA 5EMKA 3CA8A 2CR0A 4EKIA 2RGUA 2CB0A 4TUKH 3DMTA 2BOVA 3BWEA 4U1IB 5ARCA 4LYDA 1LWNA 1GFZA 2DKFA 2GN1A 5FO9A 3WMPA 2ZXCA 1E9DA 2PXHA 1A6AB 2YFQA 3PWPB 3G13A 5GIRA 4FEEA 1FV1B 3ESZA 3T1VA 4KQ1A 2Q9AA 4XB3A 5E6UA 4I3HA 1NCIA 2HSZA 4F06A 4ERNA 4HIXH 1EHAA 4LLMB 2PRKA 3WKAA 5CSZA 4EUKA 4OI0A 3LO8A 1C14A 3RFZC 4ZPJA 3NG1A 3DVLA 2P2GA 1F20A 3A21A 1KU6A 3OCJA 5CR9A 1XWVA 1AXTH 3DWGA 1ZY9A 1F4VA 4NKOB 2JLYA 1Z4LA 3J81k 5LQSA 3I09A 1M33A 4CMMB 2NXCA 2XSKA 4RTLA 2YD0A 3H8NA 1B6UA 3DKRA 4LCEA 1JL8A 2C7PA 5FCUL 1DEAA 3BVUA 1YLBB 3VNBA 1H6FA 4IJ3B 4M62H 3MODL 4MWOA 3HO8A 3IKTA 1F0KA 1R16A 3RYHB 3R7LA 3KWFA 2JGNA 4MNGB 2R2BA 2WICA 1LLDA 2ZF9A 2VLRB 4DA6A 1M6NA 3T7KA 2MYPA 1VKOA 4QD3A 4I77L 1T0UA 3QUZC 3FW6A 4BMXA 4YY3B 1JGUL 1UBGA 4F8LA 3LWDA 2VF5X 3KPLA 2W8ZA 3OXSA 1KI3A 2J2ZA 2QGEA 3FX2A 1N67A 2Z5VA 3I04M 2R2HB 1DV1A 3MV8D 9GPBA 1EMTL 5FFNA 2AGJL 1N6QH 3LBYA 3PQ4A 1R12A 3BA1A 3N1FC 1LSSA 1U3HA 3ARGB 5IFAH 3VD7A 3HB9A 1BJRE 1VCHA 1ZVSB 3BKYH 3IETB 4R4BA 5EU3B 2FYYA 4M37A 2BD0A 4BEVA 1H9AA 2AK3A 1W5TA 4TSCL 4F7WA 4BVBA 4A0QA 1T2AA 1NSFA 2FWBA 3H9SE 4F46A 4K46A 1OHHD 4ZN6A 2BZGA 1BE1A 3H42B 3CHXA 3V6FA 2OXGB 5AHWA 1RUAL 1UENA 4GQBA 2EATA 2B1IA 2J4CA 1L7XA 4FD3A 3WP1B 5F9OH 4G6FD 4B3IA 2A9PA 2R0QC 2WWMD 2JKVA 2A6IB 3R5KA 1EESA 3PWLB 2IVFC 1GNRA 4JC0A 3U3XA 3DOCA 3NBXX 2WMOB 3M17B 5F9JB 4D8YA 3ZHOA 2C82A 2C9RA 4AM0Q 3FZUC 3NH7H 2RQ8A 3ASOB 1CFVL 5E8DL 1SOVA 2O5ZL 1QQ7A 5IX8A 1JHKL 1C9EA 3JZIA 2Y0CA 3SLRA 4IGBC 2MNUA 5FAXA 2Q8PA 4ZU3A 2KERA 4UEWA 5K59E 3CN1A 2PMKA 4XLTA 2BW4A 3VGDA 3JVGC 2B2NA 4N2IA 3PP8A 3W3AA 3ZHTA 4ZZ0A 2XQBL 2YVLA 1WJ3A 3II1A 1VMDA 4Q6YA 1GPYA 2XPZA 4C22A 4X6CA 3KHQA 5HP5A 1FMCA 2P6NA 3JR7A 4KU1A 5DHMC 3T0VA 5KCMA 2ZBUA 3L95A 5FF6A 1VGEL 1T1SA 2WT4A 3DPUA 1P2CA 5IUJC 4EUPH 5EDXA 5LKRA 4O1MA 1E63A 3TMYA 3WIHL 1DANU 1GAFH 2XSZD 4GLJA 2AFIE 5K20A 4LQCA 5E4EB 5LAXB 2KQNA 4XC1H 4AJLA 3VOSA 4FD2A 1ZLSH 3WD5L 3VVBA 5I9SA 4H8UA 3KHUA 3CU7A 5FYDA 2FZEA 1TL7C 4Q05A 3FU9A 4NG4A 2XLLA 2DHCA 1ITCA 2FI1A 1DTSA 1TTBA 2QQ5A 2UU9B 4U0RC 2JFNA 4JBWA 3CPLA 3LBNA 3FZGA 4XOBA 4FVTA 1UFRA 4CTMA 1OQAA 1PQZA 1KTDA 3B7UX 1N3NB 1H8ED 3ABOB 2B37A 2Q86A 4GSRA 1PZ2A 1VSQA 3GCGA 5EWMA 4CT4B 3OR7B 4OBWA 3VWKA 4X9XA 4MIEA 4L4SA 5HHMB 4MYSA 2GCYA 1W0KD 4XXHA 3GPLA 1ODCA 1MXDA 3L4BA 5E94A 4FG2A 3Q8XB 4G8CA 3MV7D 3LS5H 5CJXA 2CL7X 2B1HH 1CCZA 3WTCA 2X0WA 1UCFA 2WVTA 2P5EB 1ETJA 1GT6A 1V4NA 1DTUA 1XTVA 1DN0A 3EF0A 1CUGA 1F6WA 1ZUD1 4F8EA 2WQXA 1LV7A 1O95A 1FNDA 3I37X 2RGYA 1YVPA 5AXBA 2PYFB 3D3EA 1DJGA 1Z6PA 5I15H 3TR6A 1MF2L 1U8ZA 1SVWA 5TPZD 3CH4B 4BZWA 5D7BA 1UKVY 3ZKQD 2CFRA 2EIZB 5D7NA 3QU4A 3IDQA 4E9RA 5KNLA 4QXWA 1GSAA 3L4ZA 1M1YA 4EZMA 4F2PA 3D8SA 2VNKA 3ES9A 5AK5A 3EJJX 3HCAA 1FYTE 2WWKO 1OH7A 1TENA 4G7VL 1VZ2A 4ZFFA 1NC1A 2VISA 2EZ0C 5LLIC 3JRXA 1IGFL 1QOPB 2RGNA 3UFIA 1O3YA 4M8NE 2VRQA 2XDQB 3KVYA 3O91A 1T1YB 4LYYA 3WTVA 5CUSH 2CKNA 4OZGA 3C5ZD 2P4EA 2ZX8A 4RZCA 1VI6A 4DIFA 2DQHL 4YE0A 5AYTA 5BS0D 4JPKL 4WFFE 2ISSD 1JVKA 5E9DD 5E6YA 2Z8RA 1OJ7A 2XYRA 3TZCA 2CNDA 1I6WA 3MGAA 1W8IA 4YK4C 4XP6H 1O9ZA 3QYAA 4XM2A 4MS1B 2XMCA 1IM3B 3GMNB 3NIWA 4ZKEA 1T3GA 3CFYA 4YACA 3EYWA 1IGYA 2VUKA 1IH8A 4RK1A 4YEEA 1YNLH 3HBGA 5DLEA 3CFEB 4KAQL 3AFCA 3F6JA 4QO8A 3BMCA 5BRPA 4AITA 4H1LB 1X19A 4D9BA 1U65A 2NU8A 1FNMA 4TVPH 2Y22A 5CHEA 1RV6X 1PD6A 4Z5RA 5D3ZA 1MOEA 2BY0A 4ZK2A 4BFNA 3Q3GE 1A7PH 1GFWA 5FWXB 1UZMA 1KIFA 1GCYA 2EIJB 2XUHA 4NJ9L 1ECLA 2OMUA 5I47A 4E41B 2FPMA 1U2SA 3RPIA 2VWQA 4R26L 1YEFL 1ZN8A 2A3RA 3NT0A 5EWLB 4X20B 1AFVL 3FBWA 4IHAA 2WINA 2Y5TB 3U46A 2NY2B 3NANA 2CAKA 1GL3A 4F04A 2JGDB 3EXJA 3T04D 1IY0A 4O59O 4JJ4A 5L8VA 2V9CA 3OQVA 5DBEX 3FL7A 3APFA 1H1DA 1MTOA 5DK2A 3NO4A 3Q3IA 2WUGA 4IHJA 35C8L 1CG9B 3P4XA 1KYYA 2OI9C 4NYIR 1S7UA 3AP2A 3EY9A 2DI7A 5FYJU 3CLKA 4Q3DA 2FP4A 3V4PL 1NGWB 3HI5H 3B2VL 4EI5A 3L1KA 3EVNA 3TT3L 2YARA 1JKJB 4FKZA 4RMRA 1TECE 3ON5A 3C6LC 3HE6D 1EAYA 5F7EL 2E4XA 1W91A 3N1UA 4OGYL 4RQUA 4M0EA 4ZREA 4CGTA 5LD2B 1Q19A 2AOVA 3FHCB 2Z0MA 1JU3A 2CZNA 2V8BA 4R4JA 1WWAX 2ADMA 4QBIA 3BHBA 4C1NA 3L6CA 1ZGAA 4NF2A 2UZYA 2ARWA 2ADFH 3O45A 4ZYTA 1MFNA 2JJ1A 2QVCA 3GFRA 2NUTA 3DHVA 4N9GB 4UREA 3L5HA 1Z66A 5KMGB 5DLPA 2E5EA 1MMFB 5AKJA 2MQCA 1R4MA 3L54A 3D1JA 2G7ZA 3F62A 4FKHA 3TTYA 4NQDB 1ETHA 4JX9A 1PL7A 2VH5R 4M1EA 3QUBA 2Z92B 2OB2A 4KO6A 2Q5CA 3M5WA 2KPNA 3DIDA 3F98A 3J27A 5ABPA 4HP5A 1T2FA 5D01A 3ZRFC 4HTFA 121PA 4REMA 1CLYL 5JTWA 4WNQB 1K5DA 3NDIA 4FXPA 4NN7C 1OP3H 2OK7A 4HWSA 4OP2A 1RZRA 5EJ8A 1J33A 3K2QA 3GGGA 3I52A 4Q4IA 2JHAA 4LJ4A 3R23A 1T6BX 1UXIA 4ODHH 3UBMA 1OV4A 2A9MH 2Y7NA 4DIOA 1D5XA 3O6FD 4EDXB 4MCMA 3BUYB 2EDKA 4Q9IA 1I85C 2YZ1A 3V1KA 4DKFL 4BNDB 4GL2A 3SVTA 4LOKA 1Y18B 4TRJA 1J22A 3KE0A 5ACMA 1ZRUA 5KWVA 3AJEA 3M1IA 2E27H 2V0GA 2DERA 3DT6A 2YK1L 3A11A 3WY4A 5A3RA 4XPBH 5AKTA 2C9AA 3VH3A 3ABSB 1J2YA 3AVVA 3V52L 2Z1DA 2WXLA 5JUWA 2G30A 1AZRA 4JEUA 4Z7WB 4R90H 4Z0XA 3X1MA 1MDBA 3HMQA 1XMIA 1NATA 5B7QA 3DKIA 4Z7WF 1K08A 4EA9A 1OLOA 2FPKA 4C4AA 3SGJA 3U61B 1RPJA 2BMVA 2ATCA 1R5JA 3S3JA 3PWZA 1P3DA 3LNTA 5E2TL 4YXHL 2VK8A 3AWIA 32C2B 3ZXSA 4FDTA 1YEGL 3RZWA 4ZMLA 4Y2VA 1AGCB 4RQQB 2H1WA 4HWOA 3QF4A 1N3IA 7REQA 3G3EA 2P3OA 4WI6A 3OFJA 3BKJH 5JXJA 1LKZA 4DKEH 1DVUA 2GF0A 3CTMA 3FPLA 4M3KB 2JW5A 2RHTA 5GONB 2FX8L 5E08L 4WKXA 3W90A 3MKGA 4QXVA 4KXNA 2I76A 1WC7A 4B3TB 2WKLA 1LX6A 2ZSAA 1KE1A 4ZG1A 2VLJB 4BFXA 5GONF 2ZS8A 4AZ3B 1W4LA 1KTRL 4WOPA 4CMHB 4ZEMA 1IYZA 3K8YA 4E0RA 3S4YA 3ZQWA 4BJ1A 1ZA3B 4CTOA 4U4AA 2EO7A 4Q9QH 4ZQBA 4FWWA 5I5JA 1JI3A 3WRVA 5GWXA 3B8HA 4LC1A 2HFEB 2WUVA 2I5YL 2ZX5A 2R48A 5PGMA 2R8SH 4PONA 4RVGA 4WEMB 4S3MA 3ZGVA 5C0AA 1WRFA 1BM7A 4F11A 2QQKL 1FP1D 1CXLA 1JLLB 2X15A 3FROA 4PM4A 4E36A 2WM2A 1DQSA 4FF9A 2ORWA 4F9LC 4ES6A 2O59A 2F53A 3E9EA 1N2JA 4K9NA 1VCMA 1OAZL 2OYSA 1UM6L 4XNDA 4Y2DA 3QUYC 2RAFA 1O77A 5KYUB 4C0HA 3F7LA 5AI4A 1S8AA 3DP9A 3U6BA 2FE4A 1GJIA 3HA0A 1DHKA 4JEMA 4YSAA 1U8HA 5BVPH 3CNOA 4ADSG 2WC1A 3WGQA 1UXSB 2E4UA 4LSGA 2VF7A 2VHVA 4G5FA 5CLGA 1M9SA 1P2UA 3X1WA 1W1WA 3HUJE 1Z9BA 3LMKA 1IAIL 1YJAA 2E5FA 4G97A 4JUIA 3WGNA 3GROA 2V4LA 2Y9RT 1NMAH 1X6LA 1QRRA 2B0SH 1OBCA 3T38A 3CMOH 4MHTA 2IHVA 3TPUB 2I7OA 4POYA 2XI9A 4EUPA 3FULA 5IANA 2PH3A 4H0NA 5GMOA 1FSZA 1CB4A 3ZLQC 5FCSH 3FVQA 4XCNA 4EPRA 1IAIM 3C1OA 2FPGA 3ETTA 1EA5A 4UNQA 4QOKD 5KSZA 3NABH 1MCSA 3L1GA 1YHYA 3G2LA 3S5LG 1F3DJ 1FO0B 1ROCA 2ICAA 5B1YA 4LZPA 2NYYC 3BKXA 3RGHA 3QXJA 5J8OA 3SODB 2YGVA 5SX5K 3W3BA 1P9RA 1RWXA 1SJ9A 2WLSA 4L2IA 2R7EB 4DP9X 4K7FB 4JDTL 4W7IA 2HRDA 3ZY5A 3PUHA 4YBHA 3TU6A 3KWLA 3NSYA 4AQ8A 1SXPA 5C0CB 3ELBA 2VQ3A 2ZTLA 4NNYB 5BVJB 4Q4EA 4DF9A 4P2OA 5D2NC 1BEYL 5DD1H 1KMIY 4B17A 1OTSD 4M76B 3ZLBA 2BFVH 1TQUA 5I6DA 3JCZA 5IQNA 2HPOA 5SV4A 4QUGA 2HVJB 4XWWA 5DRZA 1AVAA 2GN4A 3DE5X 1KGIA 4X7FC 4IU2A 5JNTA 4KUZH 1KBGH 2WXKA 3QSYA 5ERXA 4TUKL 4FHKA 1QBBA 3HBFA 2IS4A 1C50A 4XB2A 3C7DB 2WJJA