2VDMB

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist tirofiban
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
461
structure length
456
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 125
structure length 456
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdmB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdmB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdmB03
1JV2A 4G1MA 2IUEA 4F1JA 3AFCA 3K72A 3V4PB 2P26A 2VDNB 4FWWA 4UM9B 1RRKA 5E6RB 1U0NA 3K6SB 1T0PA 5KYUA 4A0QA 3BQMB 5HGJA 2QTVA 1U8CA 1TYEB 2WW8A 2XWBF 5LN1A 1JEQB 4HQLA 3TCXB 5KYXB 1PD0A 3ZDZB 1QCYA 4C2BA 1XDGA 1CK4A 3QA3E 3NVQA 4HQKA 1RS0A 1M2VB 3ZE2B 4O02B 3EFOB 4IGIA 3EGXB 5E6SA 1N9ZA 1Q0PA 1MQ8B 1MJNA 5E6UB 3TW0A 3TVYA 1PCXA 4CN9A 4Z7QB 2P28A 4JX0A 5KYWA 3F74A 5KYXA 1OLZA 4NENB 4IXDA 1MQ9A 3V4VB 3EGDB 3K71B 3HXOA 1ATZA 2ODPA 3E2MA 3EH1A 1M2VA 2XWJI 4C29A 3ZE0B 3ZDXB 2I6SA 3EG9A 1JEYA 1IDOA 1SSLA 4WFQA 2I6QA 1SQ0A 1CQPA 5E6UA 1PT6A 3PPYA 2VC2B 3ZQKA 4G1EA 1M1XA 2VDQB 1M10A 3GXBA 3VI3B 3F78A 3ZDYB 4WK0B 4FX5A 3VI4B 1IJBA 2NUPB 4NENA 4DMUB 5ES4B 1ZOPA 1AOXA 4WK4B 1FNSA 1RD4A 1OAKA 1MQAA 1JEYB 3AL9A 1U0OC 3FCUB 2VDLB 4MMZB 1V7PC 4O3TB 1SHYB 3BQNB 4HQOA 2O7NA 5HJ2A 3FCSA 3T3MB 2VDKB 3AL8B 3EGXA 4IHKA 3TXAA 4G1EB 1M1XB 5KYYB 4PN7A 4GZ8A 1FE8A 1M1UA 4O3UB 1XDDA 2NVOA 5KYNA 1T6BY 1AUQA 2ODQA 5KYWB 3OKYB 4C2AA 4HQFA 3HXQA 1XUOA 3HI6A 2VDOB 2VDPB 3EOBI 3PPVA 4MMYB 2B2XA 2VDRB 3IJEA 1L5GA 3OKWA 3EG9B 3OL2A 1IJKA 3K72B 3PPXA 4WK2B 1ZONA 5KYYA 1QC5B 4Z7OB 5KYUB 3NIDB 1JLMA 1DZIA 1SHTX 2ADFA 4M76B 1ZOOA 1U8CB 3PPWA 1SHUX 1IDN1 1JEQA 4HQNA 4F1KA 1AO3A 1N3YA 2NUPA 1LFAA 5HDBB 3NIFB 3EH2A 3Q3GE 5BV8A 4MMYA 2NUTB 3NIGB 4WJKB 2UZYB 3IJEB 1L5GB 4MMXB 4O02A 2M32A 4BJ3A 5E6SB 3OL2B 4MMZA 3EFOA 3EOAI 1UEXC 4CNBA 1MHPA 3BN3A 1JV2B 4G1MB 3FCSB 4UM8B 4UM9D 3AL8A 1QC5A 1YVPA 5E6RA 4NEHB 4K3JB 2XGGA 3K6SA 1M2OA 3T3PB 2WINI 4JDUA 4CN8A 2X5NA 1MF7A 4Z7NB 1BHO1 2ICAA 3EGDA 3K71A 1YUKA 1NA5A 1YVRA 3RAGA 2VDMB 2I91A 3N2NA 1RTKA 2NUTA 1BHQ1 3ZE1B 3M6FA 4MMXA 1PD1A 3IBSA 4XW2A 1DGQA
chains in the Genus database with same CATH superfamily
1NCIA 3MWYW 5GJSL 3W9DB 4HXBL 1OX4A 5I17B 2WNKA 5IC4A 3MODH 1TJ4A 4GKNA 2KLBA 2HFTA 3SLKA 4KAXA 3GZTB 3AKZA 1IATA 4BUZA 2PW2B 4Z7QE 3MYRA 5DMGD 1ZQ9A 3KHQA 4MJIA 1BOFA 3QO0B 2IHTA 2PUQT 3KG5A 5L7XL 3FQNA 2W81C 3F8SA 5JUWA 5I8PA 3ULVD 3G1TA 2DYKA 4IQFA 3WJ7A 5AG8A 4OIAA 4Q56A 3VI3B 3WNBA 3MOAH 1VKOA 1DQKA 4LSZA 1CQJA 1OIVA 3BAXA 4IOMA 5EPEA 1BZYA 3BRGC 2P80D 2F8SA 5FUBA 4JUAA 1NBCA 4FC3E 3QEMB 3QIWB 2NY1C 3ZMNA 3E2IA 5CM8B 4NLLA 5D1ZA 1KULA 4FIDA 1C0IA 4M8UA 2AABL 1SM3H 1M1YB 1U2GC 2JDID 1BIIB 1SJVA 1XTRA 4I2XA 3MINB 2VWEE 1D6VH 4MS1A 4JLBA 2N01B 5A6IA 3IJEB 4LXIA 1YKFA 1XVTA 5JU6A 4C7OA 3R3HA 4DW8A 2Q2LA 4KLZA 4LX8A 1F2QA 4IV5A 3ZHBA 5AQ1A 4IUYA 2V7BA 4M83A 1RYZA 2VDMB 1I32A 4ZMRA 2Q5JA 2AFHB 4X54A 2J30A 1J5CA 1YVEI 3HKCA 5ANRB 3FUHA 5KYUA 1D1TA 2YX1A 1ZRSA 3PWZA 3IPRA 3CXHK 3EODA 2X1WL 5B3JC 4XODA 2VNHA 2Q7YA 4A2MA 1PJCA 5KOHB 5FNVA 1EHKB 4YO0A 1W0VB 3CLRD 1GAJA 4Q9LA 5TNXA 1C12B 4QQKA 3CX3A 2PGLA 3FOLA 1JIKA 4OL9A 3SDCB 1QYWA 1FW8A 2Y0PA 4KVCH 1F8TH 5CVDA 2W6OA 4AX8A 4NQCB 2W6ID 1EQUA 5FTKA 3TTYA 1E58A 3I1FA 3ZZUA 1BWQA 4H6WA 4WZBE 1MZZA 1U8IB 1XA0A 2DV6A 4HQOA 1B0IA 2D6FA 4ROSA 3NN8B 5E7MA 1JLSA 5LQKA 2A58A 4HEA1 4A8JA 4YHLH 2ZBDA 2C88A 4QRRB 4O4IF 2UXBB 2WBWB 2Q0HA 1OXVA 4QTFA 5GJCA 3R8QA 3OQ3B 4PWFA 5BVJA 4NWTL 3PC4A 4KOCA 5F7ZA 3QXXA 4S1WA 1NKGA 2FLWA 2FFJA 1T0PB 5IUJC 2GEEA 1DE4A 3ILPB 3U5ZB 1EVEA 1WMSA 2D7MA 4HK3J 4ZMVA 3FTQA 3SF8A 5EHNA 4MP6A 1ZHNB 1AAJA 5DMJB 2QROA 1CZLA 3VXTB 3M1CA 4OLXH 1PV4A 4U6TA 3G5TA 1K88A 3OPZL 3QI9C 4PRHA 2P49B 3FROA 2GH1A 3NUZA 3PXHA 1FP4A 4WUUB 2BOLA 2GG1A 6PAZA 4UFOA 1LQSR 4XIIA 3EFHA 4DC1A 3O4LB 1X70A 1ZN7A 3KD3A 3ZPXA 3JWNG 4X7BA 2GEVA 3NC4A 3PDGA 1U8CA 1E90A 5JJLA 5BR8B 5EOTB 3FCTB 3Q40A 3D2UB 3C5WP 2BD0A 4OHXA 4DLXA 1MCDA 3RPBA 4KYTA 3HJFA 2DF3A 4NCAA 2ZKIA 5AW2A 1M67A 4KX9A 4B5EA 1KZHA 5CVUA 1ZOLA 4ZI7B 5T5FH 3L4CA 3PQYB 4AUYA 1FPTH 4PS8A 1M72A 5JNLA 3PFHA 1A7BA 1JGDB 4OGZA 4PGCB 2B37A 4X9YA 1FFTB 4G7SB 1YS9A 4EJ6A 2VXYA 2XKJE 3MFFA 2AJUL 3C12A 5H9VA 3CZ5A 1XTJA 1EG2A 5AAWA 1NNLA 2YGNA 3UYPA 1W0KD 2W2TA 5IM7B 2VVTA 3NPZB 4LXGA 4MR7B 5JJBA 1OP5H 1ZI9A 4I1SA 5BS0B 1OVGA 2DHQA 4YDQA 4ZK2A 4FQLH 2YFNA 3FKQA 1E3EA 1HLFA 1VM6A 3PSHA 5EC2A 1GY8A 5AKSA 2XWCA 2WC1A 3LQAL 2YNMD 1FZTA 4FERA 4NBNA 3N0WA 1KCRL 1PFWA 1RC8A 4NI3A 4E2FA 1BD2B 3ND8A 3GLVA 3EXHB 3F3KA 5IBRA 1XH1A 5I7RA 1M9NA 2RHWA 4KX5A 5F98A 3GMIA 4IWXA 4BX2A 4YXFA 2OHGA 1Y33E 2UZYA 2B4CC 4H60A 3W82A 4QFMA 1X6NA 4C57C 4J0EA 2YPVL 4N49A 2PWZA 4NCDA 4IYRA 1DIHA 2DWYA 4N7BA 4OA8A 1RJGA 1LBHA 2WHEA 1FYVA 2JI4A 5CB6A 3ML1A 5DNYB 2CMRH 4IIFA 1ZUD1 4PWHA 1WAEA 4FFVD 1W8EA 5ALBH 1EIBA 1V3LA 1U9YA 4JQCA 5JDSB 1ZXQA 3OAWA 5LDSA 2BT4A 4GX2A 3CVWA 4EDWL 3DP9A 1KJQA 4FJYA 1MXFA 4E42A 1XGTA 3EMDA 2DQHL 3UJ3X 2WM8A 1FUNA 3PWTA 1D5BA 5K09A 1U2RA 4LCEA 4GKNB 2PS1A 4NNJA 5JXGA 3HIZA 1SCDA 2PX8A 3OEHD 1GGIL 3ZHLA 3QPUA 2WMOB 4QOKB 4PHHA 2FD6H 3H9YA 1QONA 4FUTA 3IMSA 3W0WA 3L4XA 5DPMA 1Q94A 2A9BA 1NAMH 1O9GA 2VJKA 4Q7JB 4XNXL 5KTKA 3AF1A 4BUCA 3LFHA 1JU4A 3W57A 1TCAA 5JRDS 2X70A 3B9DA 2NQ8A 3G02A 3LS2A 1XEXA 3K0AB 5FEUA 2QR0B 5D4JA 5BZZA 4HIXH 4KG7A 1TJHH 4MINA 1ODLA 4D02A 3LCVB 1KPRB 2QRGA 4X9HA 4NWUH 1L5HA 2MJWA 4CSSA 4OCSL 2FJHA 3GHPA 1KOFA 1TCVA 2H9GB 4PGEB 3JD1A 4DVJA 3W7AA 3VJ6B 1EUQA 4X80L 4Y6GB 1VMEA 3L1KA 2XN9E 1JSCA 5CEXB 5HGJA 3GRGA 4XNQA 5B39A 1X77A 3ULUL 1ZUHA 2H59A 2PLAA 4CJXA 4J8RA 3ESDA 2ZIDA 3U7WL 4LP5A 4BUHA 4OFVA 1HHKA 3ETEA 3BUYB 3DVIA 2WU4A 1MW0A 2IBZX 2BE7A 3JR7A 3QDGE 2R751 3G7SA 3GZPA 3QLEA 2LWIA 1WW8A 2ODNA 4FGLA 2FCBA 1Y0LA 2YBDA 2YLKA 1DRVA 3AUJB 2YZ7A 2AHOA 3SPHA 5FL7D 5FTWA 1UYWL 2E1PA 3AESA 3N8KA 4XNMB 4QRPE 2WMPA 4EFKA 2WINB 1L4EA 3K92A 3MLWL 2DWTA 1NI3A 4D3CL 3UMTA 1Z9OA 1CQIB 4ZQBA 5CEYB 1A2OA 4L0PB 3RF7A 2D03H 4JREB 3ITEA 1LP9E 1W25A 1WG3A 3NP4A 3CZ4A 4EUPA 4P81A 2Y99A 1MJJB 2VJ0A 2WKQA 3JYOA 4J0GA 1LPPA 3QT2A 3HL4A 1NOJA 2V54A 3AHCA 3QLTA 1JEEA 3ELBA 3G8AA 2OL3A 3SX0A 1DJWA 4PCUA 1QR2A 1D1SA 1C4WA 1DBVO 4MI1A 1QG2A 3JSXA 1CDEA 3D09A 1NINA 4W81A 4JZJC 4OVKA 5LP6A 2P0YA 1QDUA 5FR1A 5H0IA 4TQUS 3D2TA 421PA 1WA1X 4C83B 2G25A 1FFSA 4XXWC 3DTXB 1NXXA 2WWOA 1QSFE 3BIKB 4KZCA 1OC2A 3ITNA 5IJWA 1K63A 2CL7X 3QENA 2WYOA 3BF8A 3FN9A 3G5ZB 3SY0B 4KY2A 1NC1A 4WO4B 5FXMA 2Q3ZA 1LH0A 2QKIA 4Q9IA 2A1TR 4DNPA 4O51B 1OO2A 1ZK3A 3TW8A 1HI6A 2G08A 5LC1A 2JAOA 2BNRB 1ODUA 4WHYG 1MGPA 4Q0MA 4JC4A 4LSPH 2VPIA 4KNVA 2PRYA 4K9MA 3N1PC 3H7LA 1RIVL 3IRCA 4AC4A 3T0DA 4JUFA 1NQUA 2Y25A 3PXEA 2QMZA 1F38A 4Z3HA 4NESA 2BOBB 5FC9A 2CL0X 2DQJL 2RCSL 2GJ4A 3FSWA 3SNHA 5I7EA 1C16A 4JFXB 2VLJE 3X12A 5MEQA 2GJZA 1UWLA 5EFOA 5MN4A 3D39A 3OWXA 3T99A 5BW4A 3M6VA 1V5WA 4EW3A 5B7QA 2WAOA 3ZD8A 3HBAA 4R7TA 3CHSA 4CU7A 3AR6A 1G7IB 3FB6A 3WIIL 4MJID 2O1SA 3C5JA 5AVVB 4ZXBA 3TOXA 1B3JA 5EULV 3T9EA 3PHOA 2R4UA 2PYFB 3T9BA 1F2VA 5B1BB 2BFBB 3RNOA 3LT5A 4QU0A 5GRVK 3EDOA 3EXG1 4Q3OA 3U6RB 2XCSB 3V2UA 4KSCA 2H4FA 4UNVA 3ZHSA 1OGAB 3LQAC 5DWQA 4B7XA 4EBFA 3WFCL 1EP1B 2H11A 4EIUA 2A9QA 2Z6AA 3F00A 2R44A 4XMTA 1KPGA 1S5HA 2YUVA 4MVBD 4LLUB 3FWZA 3QQXA 2NX5E 3Q8WA 2WF8A 1UD3A 2ODPA 5FIUA 5KTEH 3D2AA 4RE5A 4N2IA 1V8HA 4G0VA 4YAQA 1QH1A 2Q2WA 3QDGB 1DEDA 3L9EA 3K0FA 3WGQA 2NY4D 2XRFA 4BDVB 4E1AA 4YN3A 5FYJL 2ZOTA 4YJ2A 4ESEA 2UYCA 1PLBA 1WV0A 4PHZA 2I9TB 4QDGA 2EUZA 1D7BA 1J5XA 2XHZA 2WIIB 1M1UA 5AOZA 1INDH 4EEKA 1NTOA 1E89A 3LC1O 5JXED 2A6DA 1CP3A 3UROR 2IZ6A 4UWQB 2PZEA 3H11B 3HGQA 1JW9B 4BKLB 3NJKA 1KYVA 3CSYB 1CEXA 1I7ZB 4KTDH 5L2KD 1C3VA 4W4OA 4TUKL 1RUPH 2XWZA 4D94A 2NY7H 1FFHA 4TL8A 4M6WB 4JUCA 3RK4A 5JS2A 2CU9A 1I24A 1K3UB 3CX4A 1I75A 3A6CH 1F0YA 3RUGF 1FMLA 2PT5A 1S46A 3CHPA 1I8LA 4DGVH 2DEWX 2ADGA 1O94C 2IYRA 3MT9A 3OJCA 2TRHA 2WEKA 4OSEA 3SEQA 2RSLA 1QSZA 2BP0B 3EGOA 4JFXA 4C54A 4GUDA 3BRWA 4RQQA 1RWOA 3GTTA 1YC2A 3ROQA 3RLSA 3IUBA 1DVYA 1DADA 4MJHA 3LZOA 4YP1A 1E67A 1INQA 4L15A 1VI6A 4PV1C 2ZAGA 3NABH 2CFIA 2X0IA 4R9VA 4E5NA 1P1CA 5HGAB 1IKOP 4CQJA 3CH7A 4LWPA 4NOMA 1I4FA 5KNBD 3AZPA 4L9AA 1JNYA 2C4FU 5G4OA 1B90A 3FB5B 1E4WL 3QKRA 3NZHL 4ORZC 3AT8A 4Q9RH 4QHSA 2O4CA 1G21A 3Q8KA 4JCMA 1FGVH 4MUEA 3ABMB 3TOSA 4MARA 4TWAA 3IIKA 3A1FA 4GSYA 1I2BA 3W1ZA 4U6VL 3MAWA 1T5WA 2QDKA 1JWBB 3UJCA 4LOIA 1I4LD 4LAJH 4NE2A 3A25A 5IFAH 3PEFA 4DN3H 5MI0C 1E98A 4EHNA 2K7QA 4ZIRA 4PJAE 2PV0A 1MO5A 3VNZA 1WFIA 3O2SB 4GW4A 4XP5H 3AHGA 2HJLB 5AW9B 1W6RA 5IB5A 3QXHA 2BPOA 1KV3A 1L7NA 4PJ6A 1RWMA 4K15A 2VF8A 3V0DA 3RGGA 1PU0A 1J5OH 3IMVA 4LNHA 3D5EA 4W4TA 4BFNA 2DOKA 1EYZA 2XUKA 1WPXA 1KTDA 2J3MA 1TM1E 1MZPA 1R0WA 2SEBB 5E2TL 3AGPA 5D72L 1YU6A 4QHPA 4HBGA 2OYMA 4KJYA 2C2KA 1W49A 2H1PL 2DR3A 2Q7NA 4DEPB 3PHAA 4OQTH 5T5FA 4P3KA 4CQLA 1RWKA 2AW5A 2ZE8A 5CLJA 1N3NB 5NULA 1WQVT 3QQ9D 3V5DB 1K86A 4O5OA 3WLEA 4FQ5A 3N44B 3HS3A 2H2IA 2MWCA 1P5VB 1V6AA 3T3GA 1XV5A 1RZGB 4MCAA 3DBHB 3SCMA 4W9FC 2BEUA 2LXNA 4GUAA 4W4OC 5IBUG 1KO8A 2BFCB 4YCMA 3DZIA 3ZDYB 4CKYA 3HN6A 4FX5A 1TNMA 3NYQA 3VPDA 1V1MA 4WK4B 1T1GA 2LUOA 3K35A 4HHGA 3FSZA 1EAMA 2AV7B 4PJHF 3WTWA 3L5WA 4D45A 3UJJL 2C92A 4IIJF 1C7IA 2BGGA 2YW2A 4X63A 3AXLA 3ARBB 5T4BA 2P24B 3QC5X 4DNOA 2Y71A 3EEYA 3TA3C 1B6GA 2NP7A 2EDYA 4E03A 4GUCA 3JWJA 4KQJA 2FVYA 2OXEA 4RA3A 4N0RA 1D03A 4FKMA 4UE2A 3PE4A 2ITEA 2MCG1 3ZWKA 3RRFA 3QPCA 2VQUA 1G0NA 3Q3GE 4O08A 3ESRA 4WCVA 3UF0A 3ASOB 1QQ6A 1S96A 1DPFA 4P2OB 4R5TA 2EYQA 3E3AA 3CFJA 3ZMRA 2DQDH 3QUSA 3TGPA 4JRFA 1BVYF 4IJMA 2CJWA 2V58A 4BQ8A 4A03A 1UBJS 2K6GA 1QS0B 1WUIS 6FABL 1TQBB 2HA6A 3UMVA 1SXJA 2E6KA 4KI0A 5KQSA 3ZHZA 1E1RD 4OCXH 3F9IA 3DBVO 2VR1A 4ARAA 3HADA 5D5HA 3RHTA 2NMVA 2BBOA 5FA5A 4MKIA 4OKDA 3EVNA 3BDYL 1OPGL 4H7PA 4LJRA 5CGZA 3RL1A 3NJRA 1T9DA 4HH0A 1EAYA 3IURA 3IB6A 3LGSA 2VDOH 1CFQB 4IS3A 4F7TB 2EZ8A 4Y1FA 3VSDA 1GIAA 1YU9A 2O26U 2GBUA 4X99B 4WHTB 5IGXH 4OF6A 2J41A 4UEWA 3HM9A 3I12A 1ODSA 1U8XX 4FFBB 4FMBB 4FG6D 3ZWWA 2LAAA 5ICXA 5CHYA 5HHOE 3QKSA 3Q3GA 4FNRA 2WJHA 5G0VA 4EHBA 5IK3B 4OV5B 1HO3A 2BY0A 4ZEXA 3M4NA 4PYHA 3IU3B 3M1BA 5D84A 3VFTB 2NYYC 1NZJA 1DSSG 3NIGF 4PJCF 4LMPA 4DHWA 3EQZA 4MQXD 4C4YA 1W7AA 2B4TO 2GF2A 3A9CA 2NNAB 2X8LA 3HXTA 1A88A 4N5HX 5BZDA 2EXYD 1NKSA 1PSDA 2OXGB 4IV8A 2I4NA 4PW4A 3QUCA 1HQRA 2P41A 3RSFA 1XHLA 3QITA 2Y1AA 1VIAA 3ROEA 1QTSA 1U93A 3BC1A 3ME0B 4TTTS 4MAYD 4P3CH 5B39G 3L6BA 5IFLA 1JH8A 2OHOA 3ZUPA 4L9DA 3R3VA 5H02A 1GCYA 3A36A 3DTYA 1QX1A 5HRUA 3HDVA 1CR4A 4PZZA 4F4UA 3K94A 3BTVA 3HFFA 1WDMA 5B1AB 4GC5A 3REVB 2FWJA 1NGQL 4LFHG 3QUMB 1TEFA 4KKQA 3VDQA 2IWKA 4AZ0A 1E2FA 2FJFA 2O48X 3JQAB 5I6PA 3PDDA 1V3QE 1SJ9A 3AEKA 4GRLB 3TF4A 4O4JB 5GS1B 5FTLA 5JPCA 2FSDA 3OTWA 2EKBA 2V7TA 1R18A 2IZ1A 3QUMA 4JQSA 2O6DA 4UOZA 1PSKL 1U3VA 4GLLA 4H0NA 1W88B 3MRNB 2FEMA 4V2CB 3M5CA 3INGA 4JB2A 4F4HA 1L9KA 3FT4A 1G291 3C6BA 5TXGA 5GS1A 4GEJA 4JFUA 3RAJA 4Z3OA 3LAWA 3PWLB 1L4KA 4K5NA 1PGNA 5FYJU 4YXKH 4AQZA 1EUDA 4Z3JA 5WRFA 4C5AA 1VPLA 3ASWA 4YBRA 2RFXB 3U0BA 2AC4A 4LVUA 4BCYA 3SD2A 3DOHA 1HDMB 2CH8A 2AOWA 3T1QA 2V5SA 1RYDA 3PD1A 4O8ZA 3VXSE 4WGFA 5H68A 1D2PA 2YPLB 1TEZA 1I1RA 1L8QA 2NLJA 1J8VA 1T6YA 4JJGA 4AP6A 3HRHA 1D9ZA 4S24A 3U82B 3AR3A 2BJWA 4MRRA 3KPRA 4IJUA 1XPJA 3RM3A 1MO2A 4RU1A 1YONA 2PO6D 5GS0C 3CCFA 3DZ8A 2COVD 1UK9A 4OGQC 5I9TA 3WZLA 2AWOA 3NT2A 3KLNA 4GRWF 5TF1H 2HLNA 3WLAA 1LQ2A 1X39A 5SWZA 4UAOC 4MR9A 1J9EA 1XBRA 2EJTA 3EQ6A 4ARCA 1YIAA 1DDGA 4V2UA 2XPCA 3DVAA 1U0QA 3LNCA 3TBWA 3TEZA 4RH4A 4P3DB 1CG9B 1FVFA 2A6IB 1C3XA 1CQZA 2VDOB 5FKAA 1SBCA 3EZNA 2WTAA 3H4IA 2DSTA 4FQIL 4C6TA 4AL4A 3GRYA 3AXSA 3MRQA 4TQEL 4A4DA 1WCIB 4PYJA 4G8BA 3MV8E 1LDYA 3PU7A 3GP8A 4MVWA 2WQWA 1UA7A 5JZSA 1LCIA 1FB5A 3O90A 5LNK1 2YFKA 4D7BA 4ZD3H 2JH8A 2KZWA 3B3JA 1AZBA 2ZYTX 4Y9RA 1PQYA 2BM8A 4PZDA 4FFZH 3C5ZD 2H0QA 2HJHA 2OAQ1 2YQ4A 5K3OA 4B2PA 3D4IA 4CADA 2AJYL 2R39A 1YA8A 2Z2YA 2DMHA 5C0CE 1V4BA 3TFOA 3FPLA 5IBTL 1T83C 3B82A 4JC8A 1CYXA 4GI8A 4L4ZA 3V8CA 5HVHC 3U30B 4RSRA 1SMDA 5AKRA 5C8DA 3BSZA 4ZI3A 3AFOA 1K4MA 1QQDB 5HPMA 2R0ZL 4OP3A 2X8AA 1Y4ZA 5EJGA 4OD3H 4RD3A 2VBIA 1KEGL 4WLFA 4L74A 2Z35B 5MEPA 4AMGA 1JPSH 2ADFL 3N44F 2FH5B 4XQCA 2UUCB 1T0NA 5KVGH 4PPFA 2BVUA 4NPKA 1JDBC 3DBRA 3PRHA 2HVJB 2YJ6A 5CAEA 3LPGA 2CRZA 4RMQA 2ARJQ 1JNNL 5EJ9A 2R69L 1DXOA 5CKAA 4CIBA 3KQOA 2NTFA 3OF3A 5DGDA 5DRYA 3EYFA 4IGBC 4RORA 1RXVA 1GXSB 2AOTA 3NTQA 1WE2A 3L5HA 1I8KA 3DYPA 4RULA 1TA0A 1WZKA 3RJMA 3ZR6A 3I9LA 1QUPA 1L7MA 4X6CE 4FGKA 2OC9A 2HHHB 4U1HA 3E9ZA 2QKSA 4XWWA 3ZX5A 4PVLA 4W1SA 4I1IA 4I36A 4X65B 1Z6JT 1FSFA 2MINA 4BJ3A 4BQNA 5LXVA 5A4JA 3WQBA 3GDFA 2ESVB 1B1AA 5GM2A 1MXGA 3UTQB 2IPOA 1GT91 4CT4B 2GJZB 1I8TA 4FXKC 5CCGE 2QVIA 1GPWB 4WNCA 3C5XA 1PFYA 3HB3D 4JQVC 1YEKL 3PDJA 5A5FA 4DEYA 1I1HA 3LPWA 3GRUA 4GI6A 2ZB7A 1OZGA 4OXYA 4ANXA 4WINA 2P2LA 1G4AE 4ZARA 3BHBB 1KSFX 4KHXH 1AHWB 1TRHA 4BQPA 2OZLA 5H82A 1CS4C 1JHKH 4OM0L 4QLOA 4ZSOA 5T41A 4ZVNA 3ZNPA 1P4SA 3BQUD 1Q0ZA 4JFEE 2XKNB 3U7JA 4QUGA 1DQDL 4F3NA 2PK3A 3M70A 4FYIA 3C3EA 4WI6A 2R7MA 4PLGA 2EV9A 3WTYA 1FAKT 4EARA 1AOXA 3HS0B 2W2MA 3TJZA 3X43A 3ETHA 3LYAA 3IGAB 4GEKA 5BVJB 5DCYA 5DJ5A 1T5IA 1LO2H 4NC2B 4YJ3A 4HALA 1CUZA 1MHHA 2WXHA 4UREA 3EPRA 4OJCA 3UO8B 1KMHA 3L4ZA 1EXVA 3VKHA 4B71A 2C9CA 5MN6A 3FJOA 2QIOA 4B8YA 4DDHA 1PL6A 3U4KA 4DRYA 4N40A 3F01A 1PZNA 3D39E 2J85A 3RS9A 2BUBA 3QV2A 4GBXA 3X1NA 1KDRA 1YYML 4Q7DA 2ZXWB 2V03A 3WS7A 1B0GB 1ZOIA 1JBJA 5EHQA 3A8TA 2Q9BA 3WRYA 4XX0B 2FWPA 3DM5A 5DP2A 3SOPA 1CFMA 2PJRA 1F1AA 4UAGA 3E1KA 1A47A 3R3JA 2JFWA 3KWLA 1M56B 3UIEA 1E8XA 3NK3A 5FDWB 2Q2NA 2L7QA 4PPGA 1YN7A 4IGBA 2IFTA 3TUJC 5JYCA 5LU9A 4N24A 5CH8A 3B7TA 4KO2S 2ICEC 4I2VA 2BKLA 2ESVA 3TLKA 3OT1A 4PTZA 4I0KA 3AY0A 2EH8H 1CY7A 4DLKA 5L4IA 3L7NA 4MVJG 4H1LG 1CLYL 2N47A 3VSTA 5AD1A 2B9AA 4C0KA 5EPMB 3HAEG 3HKCB 2Z5LA 4EZMA 2HFJA 4TLBA 1WDWB 3FDFA 1TO5A 1UMBA 2H5LA 4O2EA 3M3HA 3JXEA 5DNCA 3U6BA 3U4IA 4TLUA 4X98A 4ZJ9A 2LP4Y 4R69A 4N8VB 1BD3A 3PFWO 2V45A 2Z0BA 1SBIA 4NPHA 3E35A 2ZXBA 1JZHA 3B8YA 3NJGA 2O6HA 2PYEA 3SXUA 2V5RA 3L05A 4R2HA 1G42A 4EOGA 1LBQA 4G4GA 4R68A 1A77A 1E4YA 4XXCC 3RPKA 5J57B 1ORHA 2Z4RA 4D1YA 3E2PA 2CKBA 3GMNB 5CDSA 4JM2D 3WIHH 2Q49A 4JBGA 2EICA 1QC5A 1FSGA 2BERA 1IC6A 5ECJE 5A0FA 3FT1A 3ZDRA 1E2KA 4PQXA 2IXAA 3D8RA 1Z22A 3TJHC 4Q34A 3WKNA 4EF3A 1SXAA 1XBDA 5D7KD 1XPUA 2BNUB 3KELA 2NXYB 2FEJA 5AI0A 2WRZA 2QLBA 1D1QA 3QF4A 5JVDB 1L7IH 4JT8A 1XIWC 4KH0A 4P4GA 1J9ZA 1CLOL 3DMMA 4E13A 2XVZA 1ZICA 2HIAA 2ZYRA 1KE2A 5K4GA 4HVCA 2DI9A 3NO4A 8PAZA 1DO6A 4OFPA 1EBBA 3N28A 4WKCA 5I8ZA 2J20A 5JRZA 1UBUS 1J0XO 4KXWA 5D8JH 4H7HA 4B5KA 1YJXA 5IT9A 5GRVL 2VDMH 4JFWA 3NCXA 2OAGA 3VR1A 4GWKA 4OTXH 1GHTA 4MAAA 2J6BA 3WFJA 1FFXB 4X4YB 1OLUB 2ICEB 3UCQA 2XJ4A 1L5FA 3IDMB 3BUDA 1RK0B 1RI1A 1UC8A 4LX0A 3TAHA 4MUNA 3T9FA 1DANU 3M2TA 3DJ9A 4PBSA 3HHRB 2EUVA 1J56A 3PP8A 3QUML 4HPJB 3EYOA 3WYBA 3JTBA 3E8XA 3I83A 3IV7A 1TU3A 2QUKA 3TB4A 3GKWL 3UV6A 3M4JA 1EM8A 3I52A 3RRBA 4J2TA 3AXLB 1T1YA 3MO1A 3KKOA 3AXHA 3V0WL 1G5RA 2X13A 1W52X 1H6TA 2G4CA 4F4CA 5IKMA 3QK0A 1KGCD 2EO7A 4F6RB 2YPLA 4Q1FA 1VSTA 4MR7A 3HCDA 2XTMA 1BHQ1 4ABUA 5KWSA 3BP6B 2ICWI 2F54A 2R4SH 1ECBA 1SVOA 3D6HA 4DQ0A 1MCPL 1QPZA 1X14A 1SC4A 4F0JA 1OIXA 1FTQA 4H88H 3RWCA 5CFMA 1KC5L 1ZT1B 1RK1A 3WLSA 3PI7A 3GA0A 4K6CA 3PE9A 5I9LA 5BV7C 5K59E 1Y8RB 3SGDI 4BSWB 2VSDA 2WUBL 5CEZE 4O3FA 4UOJA 5HBGA 1X6VA 2YD4A 3BXNA 2PLWA 3O2VH 1NSNL 4Y19E 1G0XA 4N8DA 2W2LD 4WWKC 1U65A 2C3MA 1SR8A 4H8UA 3SYKA 3A3KA 1QNZL 3SPVB 2UWEA 3IMFA 4I4TB 1I4WA 4B9ZA 1RM0A 3SKOB 1IXZA 2IPLA 4ZVSA 3OKNA 3DS8A 1M71B 4KDTC 1A7PL 4NT6B 2ATKB 3VGDA 3ZL1A 3IAM6 3N1UA 2HT3C 4AL8C 2IPKA 1N33B 3KAQA 4KODA 1SUBA 4L08A 4MRNA 4Z4IA 3IVKB 1Q0TA 3LVRE 7CGTA 2YC4C 2SEBA 4FS8A 3GI9L 4EUPB 1IYZA 5DVMA 3G5WA 2PGAA 1LWNA 3F49S 5L0QB 4U00A 2BSCA 4GYBA 2WM2A 1YYLH 4RJJA 1DKUA 1T80A 2AGJL 5FW7A 4JVLA 1PDOA 4D9LH 3L7EA 4DH2A 1L7XA 1V37A 1KGIA 1L5KA 2Q5EA 2YC1B 4YHOL 1GPYA 3UQYS 4YO0B 4KK4A 3RFXA 2D1RA 4M0LA 2QRHA 4OQTL 3SEAA 4D9EA 4NUPA 5DJ0B 3U4QA 3FTDA 3OF2A 3SCMC 1BP3B 2A5JA 1RK7A 3BKYH 1G60A 5THKA 4D2NA 1CF4A 4HJUA 1YIDA 5HFJA 4YC2C 3GKWH 1X7GA 3SGKA 4HJTA 4Z7WE 2EDEA 4M61A 1HOCB 2AJ8A 4LCWD 35C8H 4QT5A 2FJHB 1UQRA 5IJDC 4AO6A 3DX0A 3CUSA 4XVJL 5C4MA 2O5EA 3FNKA 2CDCA 5J9PA 5CMAA 2QBYB 1MAJA 4HEJA 3RJTA 2WWWA 2VPTA 3NBZC 3GCGA 1KAGA 4LVNB 3RWCB 2QPLA 3KZ8A 2Q5OA 1W5SA 4QRAA 2UUBB 3S1AB 2KLSA 3MLEA 1BFTA 3AVVA 1KIMA 3RWMB 4JT9A 1FS5A 5CN2A 1G7PA 1IRAY 2IAMA 2AMLA 2TS1A 4RQUA 2DH2A 2MYPA 3S28A 5GZNA 2MSCB 1V7NL 3V5KA 1QR4A 3L4EA 3BGMB 3DOJA 4GAEA 3FUWA 3R7WB 4DQAA 4XPTL 4YRRA 2C4UA 1C8VB 4A55A 1XXHB 2OQJB 3TLYA 2C00A 2VITA 1TQVA 5IG7B 1ONNA 2IVFC 3X11A 4YCJA 4LHUD 4G8FB 4UTVA 5H80A 1X5JA 1PBNA 2C5LA 4W5HA 4PJBA 4YX2L 4DF3A 3IDYC 1QZUA 2XYVA 1QV9A 2XTJD 4LCUB 1GNRA 4ZAYA 3ICVA 2VDQL 3QBVA 3IP6A 1BKSB 3GK3A 4O1IA 1RZFL 2PSEA 3CVDA 4HIHB 3SDYH 2YUTA 4YPGB 5C09E 3ZBUA 2OM2A 4Y9DA 5E4OA 1MC4A 4OKVB 1JHMA 3V6FA 1C5BH 4V2IA 4AWJC 1HT3A 4HIIB 3MJ8A 4DJ5X 4BE5A 5KN5B 4BFIA 2IYYA 3L02A 1JG4A 4KU1A 4JFED 5IMOA 3UO1L 1A6TA 3VGAC 3M0EA 3I6QA 1X1SA 1LK5A 1EH9A 1A25A 3U1QA 3VE0B 4U63A 2XQIA 5BRZB 3Q7TA 4NSKB 1RKXA 3F97A 1CVSC 4HN4B 4IJKA 4EOWH 1ZD2P 5IW3A 1JVNA 3IQXA 3EQ2A 5GGSY 5A6MA 2E4FA 3AKCA 1FUKA 4AKIA 3B9RA 3U46B 1UPUA 1QWSA 4XTRA 4UKDA 2PDAA 3N87A 1XHHA 5TQ0H 5TGBA 3B3AA 4U2FA 1U8JA 3AYXB 1E8ZA 1ZH4A 1NC4D 3B2EA 1OTSC 2P9RA 5HKAA 2XDYA 4BTEA 2Y24A 3H16A 3LLMA 1S8DB 2D5AA 4WZ9A 3VZSA 1P4JA 1MFCH 4MYWB 2FI1A 1N57A 3A1TA 3MBEA 5LCVH 5DOVA 1SOAA 5BMFH 1ETUA 4A91A 5CH5A 5EN4A 5ENZA 2FSSA 2R2BB 5DWDA 2DF8A 4AENA 2BOCB 3LKNB 4GLRI 1W6LA 1YNKH 2LKCA 4MTLA 3BN3B 4M6ML 1IONA 1IFGA 3L95A 1P7QD 2WTOA 5FFGA 1VA9A 1Y80A 4P3CL 4MQEA 1U2DA 1U4SA 2YICA 4DQLA 3JPWA 4J43A 4KTEH 4YJHA 3RREA 2NR6D 4KLNA 3LUPA 2XWTB 1J8YF 1A5BB 4YHKL 3EADA 4C0SA 5IZ4A 3N0AA 4HS3B 1YMHA 2GAAA 2OCIA 1K9TA 1VPWA 4DVRL 4NVRA 3KQSA 4LECA 4QVIA 5EVJA 1L6ZA 1EUUA 3ZQUA 4N0FA 1F48A 4X98B 2CUTA 3T3ME 1ET5A 1J5HA 3PV7A 1M10A 3C7DB 1GVIA 1YBAA 1ZDMA 2BKUA 1DOZA 4E5XA 3VB8A 1MY7A 4P23D 4P5TD 1ZO8A 3L3DA 4HAWA 3PXLA 4BM7A 5CWSA 4HUVA 4CKWA 1VB9A 2HDNB 1Q1GA 1LLFA 1SJHA 5TPZD 3PNYA 4XPGL 2AI3A 3FKUS 4DESA 5KVDE 4W8HA 2P40A 4X8GA 1GZ4A 1D1PA 5EO1A 2XUPA 4FG2A 1Y89A 4DP0X 4W6XB 4ISVB 2QJOA 3C2SA 3CQ9A 4UUMA 4YP6A 3KPJA 4RD4A 5AJUA 2JXMA 2AI2A 2R86A 1LPSA 5FUQA 3VGHA 4BNKA 1IXKA 1AUPA 2J6CA 5JPMB 5KSVB 1MJHA 3MLXH 1KCVH 4PJ9B 5IHPA 1O6SB 1W4ZA 1VG0B 4ZP1A 1OHHD 1S3KL 1VA4A 2DIEA 3HYCA 4RIRA 1H9BA 1NBMA 2G60H 1CU1A 2AXQA 1A8JH 3WNLA 5I8EA 3BSZH 2OSXA 1WZCA 2FL5B 2OYSA 2XWDA 3AZQA 1I7ZA 2J6WA 1E66A 3OTTA 1VIWA 1BC5A 3BMCB 3HBJA 4DG8A 1GPOH 3FU6A 4FNLH 4L95C 4N2MA 1X9UA 2Y1FA 5KOJA 1IBMB 1RIUH 4R97B 3CF2A 4KQ6A 1XMOB 3HR5A 5E7BA 1AUOA 3DGGA 7ABPA 4BRVA 1XWFA 5DHQA 3RGWS 1KU0A 4CODB 4EKYA 1NBVL 1UMCA 1W6WA 4UAVA 1YNSA 4AYSA 4H1VA 4QKTA 4ZMZA 5ABPA 3CLEL 1T3ZA 3COSA 4AZ8A 1BYUA 4B44A 1RKRA 3SJZA 1BE6A 4PRBA 3W3AD 1BZ7B 5IVXB 1BDJA 4Y16D 2O1WA 3VSUA 1U8TA 3TO4A 2GO1A 2Q6WB 1VHWA 2IOOA 1U7OA 5KVFH 4L9WA 4OK5A 1NFIB 4K3JH 4C6RA 1ICIA 2XJLA 1TTCA 1VGKA 3FUIA 3RTQD 4KWUA 3EYVB 1WAMA 2BCMA 2V6BA 2H06A 5GGVH 1BAWA 2WDZA 4DDVA 1SY6H 2C1PA 1NFRA 2DZEA 5E6SB 3NBXX 1LC0A 3P4OB 4EUEA 2F3PA 2Q3LA 3GRAA 3E03A 2P6PA 5JQGB 3P7MA 3RT7A 1K3TA 3HVRA 2EC5A 3MRDA 4P9HH 4CUJA 1X5XA 3CNLA 2X0RA 4E11A 5KSUA 1QYRA 4Q52A 3ZV4A 4AUJA 3ND9A 4GC9A 1IQUA 1V6CA 2QKYA 4HWKA 5IS2A 1JPSL 5H16A 4FQQB 3C09C 2GSGB 3Q1SL 1FMFA 1YN7B 3GDHA 3AEXA 3NIDF 5CA0B 5I7SA 4P32A 4L6CA 3ULVC 5CX4A 1QP8A 1N2CA 3Q4GA 4E2ZA 1ZVJA 2QI9F 3U9TA 3V1KA 2IDQA 3DD5A 1DFGA 1KAHA 1WWBX 5E4AA 3IELA 2XNAA 1GZDA 2C7RA 3GMQA 3GNSA 3RTGA 3BSZL 2HMSA 3UWOA 4EI9A 5LMZA 4DK6A 3K7UA 3PL6D 1Z9NA 1LY1A 3EWIA 7REQB 3MJ9A 4PV9B 4HAUA 4QGFA 1VOTA 1P9MC 1LBIA 3COVA 4PYRA 3MB5A 4DEUA 1LO0L 1PW3A 3CVYA 5IF0A 4WEQA 5D2LF 1BH2A 4TKWA 1QD0A 1WD8A 4NBKA 1RZPA 2VWQA 2A9MH 1JEAA 4XRCA 4B6EA 1QVAA 4URWR 2E49A 1EVQA 1UASA 2HA7A 1J07A 3I6YA 1WTLA 5FBWB 3VNUA 3FPYA 1Q0QA 1G5AA 3MHTA 2J1ZA 4HC1L 2QQLL 4GI9A 4BGDA 4WCFB 4RWZA 5KG9B 3DMRA 2XGGA 4TTJA 3FCGA 3V95A 1U2ZA 3JASA 4RETB 3UX9B 2R9HC 2GPAA 5F7UA 4MQFA 2YL2A 4QWWC 1F7VA 2EDAA 4MDRA 3AJEA 5F9WC 4KHXL 5C0EB 4NULA 1ECZA 4XMLL 4LLYA 4Z3DA 1RC0A 3FYUB 4PX2A 2W0FA 4QT5B 2WT9A 3AW9A 3ZT7A 1UDAA 1G3IA 1OI3A 2I2DA 1SEQL 5JMOC 1VSBA 2A77L 3CLRC 4C7KA 1ZFNA 2I69A 4WJLA 5LOVF 1YMVA 3E8UH 4A7QA 2QPAA 4YVFA 4M7KL 4Z4GA 2NT3A 4HFMA 1H69A 2SCUB 3FVRA 3FNRA 1YK1A 4DV6B 4APQA 1YRBA 1IZ0A 1W85A 2AJUH 3ESXA 4W70A 5ID1B 4RSVA 2IXDA 4PINA 5KOMC 4XOUA 3RPIB 4OL0A 4N65A 4CFYA 3VPXA 3EGSB 1C81A 3IETB 1KLFA 1U8LA 3CPHA 1H2BA 2O1XA 1S7RA 4UXHA 2Y68A 1Q7EA 2XQKA 5CXSA 2OP4H 3GXTA 3I92A 1MQSA 3M5WA 2OMVB 4U4AA 4CG0A 4DV1B 2Y36H 3MLWH 1RH8A 4HIJB 5GGTA 2AC2A 3T4EA 5FGRA 1G5TA 5DZPA 2V2TB 2W0SA 3OIVA 2PQ6A 3BRFA 4NCXA 3TA3A 4M9UA 1HDMA 2AJZA 3KWWB 3B7SA 5DHTA 3DO3A 4G1BA 4ND1A 4H5SA 3HP1A 2GN9A 3IOEA 3KSUA 3DX4A 1WHSB 4GR5A 2IDUA 2N7BA 4O29A 4TV9B 4ISVA 3V0VA 3DR5A 1NCWH 1M7GA 1RKUA 1Z7WA 3FMOB 3LZQA 4P5MB 2Z31D 2UXVA 1WKVA 2O5ZL 4UHEA 3MI6A 3R6WA 1E3WB 2O05A 2QRVB 4XEHA 1KCBA 1C8QA 3IXTA 1OP4A 1QR1A 2H2PD 3ZDDA 1QPPA 2B4YA 2FRVA 1M3JA 2V7HB 4ZVOA 3KU1A 4EUFA 3FYUA 4RHXA 3QUZC 1YEFL 5J23A 2AK4E 3KCWA 5L6YH 4OZIA 2EDXA 3J8F7 1SCBA 3P9MB 5AICA 4IEIA 4XNYH 5T8KA 4A67A 3HE6B 2XTZA 3ILXA 3FRPA 3BREA 4KDRA 4KV7A 4W9NA 1RIVH 2VL5B 3MLRH 3D1MC 4Q9DA 1JTPA 5L88L 3IP5A 3IFOA 5KVEH 3WGYA 1IJFA 1T0BA 5DKFA 4UQ2B 1X8XA 3CU1A 3UENA 3ZQJA 4XKJA 4OCYH 1H3PH 4YMUA 4MA3B 5HUHA 4PJFA 3AHIA 4PNHA 4EK9A 1B6DA 2OTWA 3CNQS 3RVPA 1AF7A 1V8ZA 2DWPA 5LZ9A 4F91B 1MREH 1IZ7A 1NMCC 3D2BA 1A2YB 3NHYA 2QTEA 4BQEA 4EFLA 1A97A 3ECCA 5F96L 3EEFA 1DI0A 2X6VA 3RAGA 2RGXA 3LKRA 4YJHB 3T41A 1NXVA 3KPNA 1YJQA 2ORBH 3I6KB 1E6JL 3KRTA 3NMUF 2PWAA 4N3CA 1IBZA 1HRDA 3ORYA 1E5AA 2ZUVA 4GL4A 1PZ5A 1Z2OX 2GTZA 5I8CA 2OV1A 1MH5A 4KW7A 3NTLA 4WXPA 2WJGA 5IB1A 4MIYA 1AR1D 1RHJA 2V9RA 4LFCB 1RJYA 1AO7B 1NYRA 5E4FA 2FQEA 4QJ4A 4ENZA 2UZPA 2OFOA 2I6QA 2O6LA 4LPVA 2XKKA 2GB2A 2O5RA 3MMNA 1BDIA 2QPSA 3PWJA 1ATIA 4J91A 3RKSA 1BEZA 2OSWA 1KN2H 5EBGA 1YFKA 1A4JB 1OZHA 1UOEA 1TK3A 4AOFA 3E9EA 1WWCA 4EVQA 4GMTL 4RF5A 2HJSA 1ZD3A 4I4CA 3QR0A 1SUJA 4MV5A 3DX1A 4TLAA 4BGUA 1NXPA 2KLHA 4BTLA 3L18A 2YBEA 4Z3FA 4LZWA 3TBSA 1MWOA 1BFUA 5F9JB 4XPBL 4WW2C 2F00A 3FOCA 1BD2A 3RWDA 1MVFA 2ENUA 1APBA 3WIBA 1RT9A 3SJAA 1VZIA 4HQNA 2WXOA 1QO9A 1I3UA 3VSCA 2NRDA 3B36A 5DGCA 5K0ZA 1KENH 5CZKA 4R8WL 1R3LB 3W78A 2RGSA 2C9AA 3D3VA 3UL4A 1NRWA 4LO9A 1RYYA 4LZPA 3KEGA 3ENNA 4F15C 1TJIH 3ZRFC 3KL2A 3UB4A 3PL6B 3VYTB 4HRVA 1SELA 1HC7A 1H42A 4MYCA 2WKGA 4LQCA 3HFJA 3PIIA 1E79A 2A3TA 3MRQB 1GAEO 2WQXA 1WD5A 2HH9A 4QXGH 1PZFA 1QCYA 1QWUA 2O8BB 1UCBL 2R1YA 2Y69B 4AMZA 3DJTA 4BBAA 2XE4A 4BIKA 4MRPA 5KG9A 4CN9A 3K8OE 2BLFA 1HS6A 4IMKC 2V7PA 1ADJA 4ZO4A 1D6EB 4JBXA 4ONOA 1GCIA 4A04A 5KMGA 4HBCH 1QHHA 4PIMA 2GHQA 2R4RL 1KIUA 4PZUA 2RA1A 1U8QB 2F74A 3FO2B 2WU3A 5D3MB 3J7AC 4MZDA 3F1KA 4TUYA 1G7MB 3GSXA 2OSLB 3BGVA 3FB8A 4WLCA 1X92A 1VKHA 3D3QA 3AUVA 4LVCA 1ABBA 3WJMA 3OOSA 4X0NA 3Q1KA 2VRBA 2EL9A 4BVLA 2QJTA 5K0JA 3WYFA 1R00A 4R8LA 3O9WA 5GS2H 5IJ9A 3C75A 5H35B 4R5VA 2IELA 1U6AL 3UAXA 1TFRA 5CJQL 2O5XH 3U4HA 2F8TA 5B7EA 1U8PA 2WCGA 3RIKA 2UDPA 2V6FA 1OXUA 3PPEA 5D71H 3DX7B 2NU7B 1PJ2A 3GF8A 1J1OH 2X5XA 1CD5A 4GOJA 3LL7A 3MGTA 4KXLA 4LRQA 1U4EA 2JJ8A 2VA8A 1H3XA 3CZQA 4BWTA 1QSVA 4P9ML 2CLFB 2X5OA 5BORA 4FYWA 4TWZA 1HKLH 2E27H 4WNYA 1VENA 4HLJA 4CR8A 3GSUA 2AXEA 3CKLA 1KOLA 4ONGH 1KF9B 5KAQF 2R7EB 3C8KA 3AR8A 3HXMA 1NGZA 1NIEA 2JE8A 2KS0A 5FIEA 3CKKA 4RH3A 3MRBA 3T7TA 1HSOA 2BSXA 3KJNA 3ENWA 1HYHA 1VL6A 4OFWA 5K93A 1ZP6A 3QNMA 4MLDA 1I8MB 4ALLA 3N40P 4LGRB 5BUQA 2QSVA 2QN6A 3I50H 3F47A 2CGRH 3DIFA 1BKYA 4E5UA 4X6DE 3NZSA 2PGOA 2L69A 1NUSA 2K0RA 1Z15A 5EA0L 2WZDA 4HWEH 4TV8A 8LDHA 2ARJB 4XMWA 2JWGA 4TUKH 3VR3D 4L5IA 2AUMA 3G2JA 4PHFA 5KYUB 3K9NA 3C3JA 4KP7A 1WF6A 1GJWA 5I8OL 4KACA 5D86A 4LSRH 1FP5A 5AW6B 4U2CA 1KC5H 4OZIB 4PJFE 2WXMA 1P5UB 5KEZA 1R7RA 2I03A 1A1NB 2F3RA 4YE4L 3EGEA 3C4VA 3TZBA 4FXTA 4JIMA 4U1NB 2YVAA 1LO5A 1YVRA 2A6DB 3DTDA 4C83A 3CKMA 3BGFC 3EJ6A 3O8LA 1O6SA 1U8NB 5JHMA 5L3ZA 1O77A 3D4ZA 3ZH2A 1K5NA 1F6BA 3VYRB 1DG3A 1II8A 1KFBB 1QP7A 2OMZB 2F55A 3J2PA 1I9JH 2REQA 4DPMA 4J3WA 1E0SA 1YB2A 3VXUA 4YO8A 4X8MA 1W1IA 4ZCMA 3ARGC 4W7HA 2CF5A 4GSKA 1HEZB 5F9FA 3GSOA 1BFOB 1MDAA 2BNQB 2I1VB 4FIZA 2DPGA 1W0JD 4RAHA 2F5BL 1P4HA 1HCZA 1BWWA 1NIFA 5A43C 3DV0B 3U3KA 3ZL4H 2WKPA 4QRPD 4YJGB 1G7TA 1OPGH 3MXWL 4HX1A 2K8QA 4JDVA 2RI1A 1E4EA 3WY3A 4BJ5A 2HWWA 2R62A 4QGBA 4Q9NA 1HOEA 3P2TA 1AG9A 4KUCD 1EK6A 3PUWA 3D4NA 1EESA 5BUSA 1KH3A 1G7HB 1PX8A 1FVEB 3FPXA 1QW9A 1RAHA 2QIPA 1S7VB 4JLAA 1G7JB 2XVXA 3PHCA 2YAHA 5TPZA 1KP3A 1JSLA 1X5LA 4IK7A 2VWGA 4G23A 4NZUL 5ICZB 3QPKA 2AA3A 3PPVA 4ARSA 4U7SA 2PCYA 1FDTA 2B36A 5JD3A 5L40A 1ADFA 1S3RA 3OLQA 1NFAA 3ZHVA 1IC0A 1JXGA 1PBTA 2ZYAA 4HWUA 5I9QB 2XBZA 4E32A 1KXQE 1ORSA 3AU9A 4RWHA 5KTMA 4ACAA 1YQ9A 4F93B 3W0WE 1I1FA 3O3OB 4HS3A 1O94D 2IUYA 4EO5A 1T2EA 2C61A 4PN3A 5LP6C 4N3BA 5J1AA 2DHEA 3WXMA 4B3GA 5C8JB 3O8XA 3JQ9C 2ZSEA 4GP6A 4ZI5A 1K6MA 5CXXA 1HPLA 1V1RB 4TRNA 5DRXA 4WU5A 2VZUA 1WOYA 4LL1A 2AKRB 4LPYA 4ROTA 3BILA 4W6YB 3RWIA 3MBXH 4I88A 1TJNA 4QPPA 4HG4K 1FRNA 5AYUL 3HCAA 1NFDF 2IZ7A 3NBAA 2JFNA 4ZX4A 4HS8L 2AKRA 3LNIA 4E4YA 2NPLX 1VHTA 4CN4A 2EDTA 1K9SA 3IMWA 3D87B 3FCEA 4WA7A 5I7FA 3DIDA 1P2CA 2LD4A 4ZCTA 3LB6C 1JG7A 2XV0A 5IOKA 1DV1A 2BBWA 3ZE2E 4MEBA 1O96B 4NM8L 4ODTH 5FO0A 1LK2A 3K0BA 3DL4A 4I87A 5DVNA 3EXAA 1SK8A 1P4LA 4L8GA 2ZULA 4LVEA 4PRHE 3WVNA 4R3WA 1TEYA 3SOBH 5IMKB 3RVWC 2C7GA 3QQ3B 3U9UA 4M7PA 4S0SD 1Q90A 5JW4N 1AF4A 2ZG2A 4TYYA 4AQEB 4AM0A 5BSEA 4IK6A 1L5NA 1N6VA 5CNIA 1KJNA 1QYXA 3SE3A 4TTDD 4S10A 5D4QA 3ULUC 4FR0A 1A6ZA 5LB1A 3HJNA 4EDFA 1Y6RA 3C5SA 3DEZA 5JCPA 4BKQA 3RANA 5AI4A 4NXNB 2NY1B 5FA4B 3UH1A 3NUKA 2DLTA 3DMGA 1FFDA 1UK7A 2A0LD 1CUHA 1VE1A 1P1JA 5DRZB 1MOZA 3K74B 1KOGA 5CFNA 4JPSA 4NQDE 3PHSA 1WU8A 1OLSA 3GZQA 4EOWL 2XB6A 1QJ4A 1AMUA 2C7FA 1AXGA 4PCKA 1TAQA 3X1FA 1QK5A 4RL6A 1S6YA 2VNJA 4ZMBA 5GJTH 3OX8A 5EIIG 1FL5A 3FFCA 5J1SB 1IAII 1F4WL 2P4QA 5AW7B 3BZFA 4D8OA 1DC5A 4NOLA 3LRPA 1Z4KA 3NOOA 4PEEA 1WBJB 3D52A 1ZOPA 1PNDA 2C1PB 1JDPA 4JO5A 1KYDA 4BC0A 4L76A 4L05A 3RDTA 1DFIA 5FF9A 4L3ED 3LCJA 3PNQA 3AJ9A 2PV7A 3VD3A 2Q8QA 1TQTA 5JXHA 1RZJH 2RGWA 4K81B 2QD3A 4JS0A 5L45A 2RGCA 2E9IA 5FYLH 1ZN8A 4R1SA 4CVUA 2A9DA 5B39B 3GFBA 4YLYA 1A72A 1YZHA 3PXCX 3ESUF 1GH7A 3AB0B 2PGIA 2NYRA 3WEMA 4NYJR 4EJ2A 1OF2A 1BU8A 1ZBDA 5ISZE 4BB5A 3B7WA 1KDOA 1IPFA 2RGDA 4TTPA 1G7SA 3S3TA 4I4NA 1BMFA 1BXZA 4EG7A 4ZT5A 3QTLA 2LBPA 4M53A 2WNWA 1TKCA 3LQAH 4MWFA 4MRVA 4C89A 1ZK1A 4W9KC 1NULA 1KEZA 1NTDA 5F1OA 1YAIA 3ZKMC 2IYPA 5D6CA 4UQOA 5SX4I 1RWBA 2JGJA 1JBQA 5EAIA 4Q1EA 1KPUA 2VERA 3KPSB 1HHGA 4DCVA 1UDWA 1H8HD 4YR9A 2G5UA 4IO1A 3LCRA 3W06A 3ESCA 3HBPA 3VX3A 3MPUA 4N3NA 4H1UA 3HMKA 4OLJA 4IDOA 5I47A 4ZMNA 4WNQA 2ATAA 2JKZA 3QKUA 4QAMB 5DRZA 3AETB 4ANWA 1F90H 2A5GA 2CMRL 3FXIC 5BYAA 1P0FA 4OZFH 4RIIA 1DHKA 1C4KA 2ZUBA 2YEZA 3FMIA 4ZXFA 3AUFA 4O4LB 1QEWA 5GONA 2DLEA 4IHAA 4N0EA 1MLCA 4KI5F 4GIOA 1XN4A 4BNGA 4P35A 1T22A 3AETA 5TDNA 3CCCA 3DVFA 1UB6B 1Q9LA 1ZVKA 3S4YA 1ZZEA 3NSFA 5I9QC 4Q3NA 2QPDB 3R9WA 4HZIA 3O1HB 3UWMA 4NQDA 3TPUB 1DIGA 5HILA 4G5ZL 4JHAH 1VTKA 2EO1A 2BGWA 2FSEB 4J1NA 1SHKA 1WIPA 2JVUA 2QVFB 2O2IA 4KQEA 3CH8A 3QU7A 2BJHA 4G8GE 3T71A 2PP9A 2W2LA 3C3CA 3FHOA 3KL4A 1MCBA 2AR0A 3C6LB 3MCUA 3T3PB 1TXKA 2I7VA 1LW6E 2CGEA 2FUG1 3DE0X 1QOZA 1QZ3A 2ZYVX 3MVEA 2UZ0A 2DKFA 3V97A 4H0GA 1KIFA 3JARB 4PP2B 2F8IA 4BO6A 1YMHB 5FKPB 3WV5A 1LP9B 5ACLA 4P5TA 5C07B 3BCUA 2Y9RT 1ZNXA 2IXTA 1QV7A 1ZCRA 3ROLB 1B0ZA 3FTGB 4ERXA 5AIAA 5SY9A 4GQAA 3GM8A 4PR0A 3C6MA 5E1AA 4D80A 1EWVA 2Q6IA 2JANA 1DQQA 1TCBA 4YBQD 3B2VH 3HGTA 4BZXA 3ATEA 1MPAH 4KBGA 2X1HA 5ABZA 4MTMA 2P3LA 4HY3A 3U48A 4CMHA 3PQYA 3CZUB 5DFVD 2OBYA 4PYNA 3CO5A 2FO8A 4F45A 3LYRA 1X1QA 1U0SY 2ZOKA 4WU7A 1BJKA 4QOGA 5JS8A 4CIVA 2D31B 4MVYA 4NZTH 2G4VA 3EBOA 4RD2A 5ITFA 1WHSA 3F7TA 4FLMA 2EW1A 3MUNA 4OF3A 2R51A 3SIKA 2AQ3A 5LKNA 2JK5B 2VLMD 4KQMA 4EGSA 1P4RA 1ZNQO 4RVHA 3V0IA 5LPNA 3GN2A 3GUYA 3WLKX 7PAZA 1Z7BA 4H4EA 4NBYB 1MSPA 1AXRA 1CZOA 2E7ZA 4HRXA 4L78A 3Q06A 3HBZA 3Q1SH 4EAEA 4I77L 1MC8A 4JMNA 5JHDB 3IKKA 7GPBA 4N0UE 1W36B 3TURA 2XRZA 3O1IC 4V2BA 1YQEA 4XB1A 1E77A 3UQZA 4B45A 5I8KH 2XXMB 2YUIA 5EJAA 4EI5A 2GAFA 3VGFA 5JATA 1TITA 3IOMA 2Z7YA 2E5WA 1S9YB 1QI5A 2VGLM 4Q3DA 4WI4A 3WYRA 4IJWA 3LRXA 3F73A 2SECE 4DQXA 4EDWH 2A1UB 4HRAA 1NSYA 2XCIA 4I1RA 1NM4A 1HILA 3LPMA 4LFHD 1RURL 2ADFH 4ZMTA 3D6FA 4PJHB 1K3FA 3CVHH 4P31A 4MD0B 3RU8H 4ASUA 1NQOA 3MUOA 5AM5A 2VBCA 4DP8X 3ZZSA 5I4CA 4AYXA 1P9LA 1PVVA 3E2HB 1AZSC 4ELMF 3QH4A 3HMWH 3NJNA 3QU2A 5B1JA 2K6YA 3TQCA 4BYHA 1ZJ6A 2YGQA 3RVQA 4DMLA 1AMYA 1BNCA 3QG5A 3T8XA 1E9QB 3TQRA 1I5OA 1FBNA 4Z77A 1QQDA 5HPMB 3A1SA 2X2PA 2NV0A 1D2HA 5J6SA 5ERWA 3G13A 1MBZA 4IDAA 4R4FL 5I5GA 5IAJA 1GAFH 1E6WA 1MNAA 1ND5A 1SC9A 4R2GC 4ZZFA 1ONSA 2DU8A 5JQGA 2GSMB 2YUZA 2NTEA 1AC6A 4UNUA 4XMUA 2IQ9H 2YJ5A 4BLTA 2UAGA 1G9MC 2A1WL 4RESB 4CNBA 1ND0A 1DARA 4MNGB 2CQVA 3WIHL 5HHOB 3CLWA 1KJ2L 1NLFA 2YNMC 1Y6FA 1EB9A 2AJLI 5I23A 3U6XA 3RY6A 1WULS 1GU0A 5DM70 5D3QA 1SMOA 4Q24A 3KZMA 4A23A 1KO5A 3QK7A 3AG4B 4GX5A 1OYVA 2GJRA 4HUXB 1ZM3A 5EZLB 4MDIB 4HEHA 5TV2A 1N5DA 4WWID 3G0OA 2E56A 3VZQA 4D4JA 1JGLL 1CD9B 2G9HB 5CBEB 3T3EA 1S3FA 1ZA6A 3MPOA 4ITVA 2I3AA 1N25A 1VKJA 3EYAA 5FV1L 4BXOA 3GSUB 1YQUA 1OM3L 2CJ3A 2QYSA 1U30A 3ELAT 4Q4AA 4WWKB 5AHXA 9ABPA 3F83A 1PK9A 4AY3A 3H9JA 4BZ1L 1A3RL 1MQAA 2XB2A 1JALA 5T67A 2X2IA 4IDFA 1UT5A 2FMHA 2MJLA 1PIWA 3H3FA 1DIBA 2D54A 3FPGA 4J1TC 2B92A 3K1KC 1JP7A 4KO6A 4N3UA 2PX0A 2DLIA 3MX0A 2L17A 3BXOA 4LKCA 2JLRA 1SUEA 4Z3GA 2X28A 4WN9B 2NNXA 5DD5H 2ZR8A 3PNMA 1EXGA 1J8KA 2P0EA 1IVYA 3FUEA 4L3CB 3BE1L 3R7FA 2F1AA 1WSST 2QTRA 4MKHA 3DLTA 4LHWA 5EH1A 2X9NA 1U99A 2FTAA 4IJ5A 1VKXA 3OMNB 3ADOA 5COAA 1JZTA 4JGNA 2O2XA 1LJUA 1RQ5A 1UFOA 2WPDD 3L7YA 5D3MA 3OM8A 2OZEA 4EDHA 2WF5A 4V1DA 3IMTA 3HB4X 1MX1A 4UYPA 3HFGA 1URZA 3EYWA 1JPST 1II9A 2VPZA 5AOMA 3TEXA 3KHSA 4BGEA 5DX8A 2OXFA 2J6EL 3AVEA 1LWRA 3T1WA 1X7QB 1YRKA 3SJVD 2P1DA 3N53A 3RBAA 3VXRB 4LOLA 3Q15C 1J0IA 1PLGH 4CM3A 3EVBA 5LR6A 3I02A 5KSAB 3BW9B 4D99A 4PJ8D 5HI4D 1DQNA 5H3HA 4FLOA 1RJCA 4GW1A 1KJ2H 5DT1L 1N75A 4HLUA 1IM9B 4P5TB 3EHBC 1KGCE 4OQ4A 2GD1O 3C5ZB 1A8UA 1A4BA 2D62A 2BFVH 5CIYA 4IX1A 1GKEA 1RCYA 2DH5A 3F8WA 5JMRA 2XJ9A 1X3DA 5KYWB 3A4EA 1B73A 1QUEA 3ZJTA 1UADC 2ZJOA 2R69A 4LSPL 3GA7A 2OLDA 3QOWA 3QZWB 2AJZB 3AJ7A 5BWMA 2DQIH 3UMYA 4HEQA 1JPEA 1KGUA 4DP7X 4WCYL 3N6VA 2C8VA 5EJ5A 2W37A 3DVGB 4MMZA 5FPYA 3OJVC 2P4HX 4K87A 4L9SA 3CXFA 4MGIR 4Y4KC 1J97A 3VQTA 1O6CA 2X5KO 3O2WL 3V4VH 2QL7A 3VD9A 2MSNA 2NQCA 4TRPH 4UTOA 3TT1L 2FDRA 4PZ9A 1Z74A 1UODA 1AKWA 1ZESA 2G7MC 3KPSA 3QUXC 2WWHA 4ZSOB 2XYRA 3H1FA 2DD8L 1DLHA 1E5UI 4CMIB 2GUOA 2NZVG 1OTTD 4INPA 3NVKI 3RYMA 4G9DA 3IPCA 2V2XA 3E2HC 4YJZL 3EJJX 4JY6B 5B5SA 4HNQA 1YOVB 2G5BB 3P9LA 3V4VB 4KE9A 4WSOA 3C48A 2FEEI 4LSTH 5GZ3A 4F3KA 2M2DA 2I6SA 1KNQA 1NUTA 5KDDA 1NMBH 3HNRA 5K8JB 1QK4A 5DTRA 3I8SA 1I5EA 2FPRA 1TSRA 4MASA 3BG5A 2WWKO 2GHRA 4E9TA 5LAPA 1O54A 1F0NA 3PV0A 2CFCA 4GKKB 5J13B 2VYNA 3U1SH 3EA0A 5AZ2L 5GY7A 4CEIB 1TRKA 2YFOA 2FRDC 3BH0A 4PTLA 1H2EA 3P2OA 3ZCPA 1TB4A 2CFSA 1GL4B 1DAHA 3FUUA 1Z6PA 2D7PA 4P8QA 3PWPD 3W5IA 2M9MA 5C4IA 5D2LA 3GMPA 2WWMC 4HDKA 2XNDA 4JA0A 1B2WH 3OFJA 3WAKA 4Y4FD 2W6MA 3LN4B 2GJJA 3G8DA 2ZT6A 1D6MA 4J7CA 4F38A 1G0DA 1CIPA 2EEZA 3CGGA 3EQ8A 1Z0NA 1V1JA 4NDNE 3LUJA 1EVUA 3ANTA 1RTKA 5DYOA 1UJNA 4YSEA 3X2EA 1M6EX 1FYEA 4GOND 4YGAB 1GGBH 4QO8A 9PCYA 1GDTA 3RZCA 5BW7C 3H99A 4DR2B 2WPDA 3TYGH 1Y0BA 2FN7A 5EU5B 2P1YA 4YFLI 3FCCA 4IMPA 4O5AA 1Y6GA 3O2VL 5B38A 5KBNC 2HLDA 3VZRA 4F06A 4X7DC 3RROA 4BFFA 1J8RA 3KBPA 1FGVL 4X44A 2J8UE 4H25B 3R6GA 2B7CA 5J2TA 4RZKA 5EWMA 3LZLA 1FNDA 1XCPA 3OHMB 5FUOH 1BVKB 2JFFA 4HCJA 2A73B 3GRWH 5L8LB 3V0VB 5ICMA 5EKUA 5BS0A 2V5YA 4B6PA 4G3YL 2WXGA 8AT1A 4Y5XA 4BGLA 3V1UA 3VR2A 1TQHA 4DMRA 5HJGA 2QRNA 2HKAA 1GNVA 3OLVA 2ODQA 1ZU4A 4Q4HA 1KTBA 1E79D 2BVTA 5CBAB 2CHEA 3TBVB 1EFPB 4GLRH 3ABOB 2XG4A 4KIUA 4BNVA 3AF0A 2VAXA 3GMSA 2C5EA 3HCBA 1T3FB 1H4VB 1L5ZA 3DKKA 3ONNA 2A83A 4KPEC 3IFSA 2WD0A 3OM0A 5C09B 1B7GO 5KO2A 1KXTA 4CEJB 3TLBA 2VDLH 2VSKB 1ENOA 1KCUL 4J0KA 3V0GA 4PS1A 3TD6A 4Q7EA 1ZE3H 1XR8B 4MAYA 4WHMA 1KYXA 3IMKA 5ALZA 2ZJSH 4MFHA 4C55A 1L5OA 4GG6E 3VPBA 1KTCA 4OIIL 4LWQA 3T4AA 4J3FA 5AYUH 1POXA 1PRYA 4PTUB 3BVVA 3DV4A 2UUPA 4M5TA 1G38A 2EP5A 3MROB 1W5AA 3PGKA 3MREA 2KBEA 3OG6B 3DPDA 1GGKA 4PTUA 3I9PA 3HCWA 3P94A 3DFUA 2X7XA 4XOIA 1MCLA 1P0SE 4WHTA 3BKWA 3KPOA 3LEYH 4PGGA 1U1FA 3D39D 4TL6A 3U36A 3ZDWA 3RVWD 3FU7A 4XH2B 1JWAB 3P11H 4PJDB 8MHTA 2XW6A 1AHHA 2ZE5A 3PXDA 5C0RL 3D85A 1L5VA 2ZWMA 1OTUD 2MRYA 3TD2A 4M61B 1C9DB 4PQYA 1Q1AA 5KS9A 3HWX1 2XRYA 3RIYA 4X9XA 4GQQA 5ESQB 5AIBA 3TJEH 1LMIA 4LIQE 1O2DA 4TWJA 2JG3A 1J1XL 2Q3EA 4D9GA 5H83A 5JJIA 4FKBA 4D0RA 2WB7A 4J4PC 4C4XA 4U1GC 2DQ6A 5HYJD 2HT1A 1E5LA 5LOVB 3CFDB 3TNLA 2NNLD 1U9KA 5SX5H 3FUNA 1MV5A 4INJA 2X4NA 3QEBZ 3MRRB 1KA9H 2FWOA 3NDIA 1CRPA 5AVZA 3AY4A 3T2NL 2NWQA 3UJBA 5D8DA 2MPVA 3R4RA 2ZVQX 2BAGA 5G3ZA 1JWSA 3EDEA 2JIZA 2D3TA 5FBQB 5JIDA 3LKQA 5H8DA 2PTUA 1Z0DA 1JMYA 3LHFA 2GTHA 5T1MB 1R0BA 5E5LA 2WB4A 1XALA 1CF9A 1PEAA 3C6QA 2XRAH 1SHLA 3KQPA 3WLRA 1PUJA 4Z3TA 5F77A 3RBGA 1HL5A 2JFPA 3FFTA 2RD2A 3IE4A 5T1MA 4Y1RB 4FA8A 3KLPX 5ICFA 1S2IA 4PSVA 2H7CA 1H2WA 2G72A 2PP7A 3A6BL 3F3SA 2JCSA 2ITDA 1QANA 3H2GA 4LCUA 3MC1A 3FLEA 4GSDH 2JB6A 4Z2AA 4JD5A 2J3JA 2ZJ3A 4YSUA 3BSSA 4XN5A 3TL5A 1FH5L 1YCFA 3SIPA 1BX0A 2EIHA 2ZTUA 3FPKA 1AGEA 2OCJA 4GQPH 2GFBA 1JUFB 2CBPA 2YMMA 1QFJA 4JUDX 4M4RA 2J5KA 3BICA 4G0OA 2HLAB 3WGVA 3BAJA 2BFFA 1SBBA 5HW0A 1Y18B 4S2UA 3MJCA 5CDGA 1DAKA 3U36B 3STLB 3VO8A 3U6KA 2IH1B 5IH3A 2QV4A 1IBFA 1CDIA 1CPUA 3NXKA 1T5HX 2ADJB 1FL3B 1MFDH 1ZTXL 4FFBA 3DDHA 2QRVA 4HWBH 4UQCA 2J5RA 4CEIA 4DMGA 3QVAA 2QD2A 1XGYL 3HJTA 2W2NA 3CUYA 1G3RA 5LCXA 3ZV6A 1U8ZA 2W2KA 3RAEC 5HP5A 3EASA 4GRMB 4PR5A 4ZS7L 5DM1A 1EK5A 4OJTA 4F1ZA 4A0QA 2A9KA 3JQBC 3JASB 2FSGA 5FYQA 4JYPA 5KW9H 4RAUB 5SICE 2QVLA 3GHBL 4KFUA 3G5ZA 3SY0A 2I6TA 4NUGL 3DVNA 1G1MA 1ET8A 5IR1B 3N9IA 4IHQA 4W6QA 4N90D 2HR1A 3MRKA 5DO2C 5BWBA 4K9SA 3ZTNL 5FGCE 2CLZA 4L8SA 2VE6B 2VL5A 4Q7QA 3LRSB 4KUGA 4OGKA 5HY9A 4V0KA 4JP5A 4U1MB 4EO9A 3X13A 4GH5A 3DBOB 5AKLA 1DDHB 3SMQA 5ALJA 1NJSA 2WXPA 3Q8XB 1K8DB 1X74A 2L82A 1CURA 5DZAA 2A35A 4JMPA 3BGWA 3OFKA 1MI5E 2Y2TA 1G5HA 4QQFA 2ZQZA 1OZTG 5C0AE 1WUYA 2C29D 1T0OA 12E8H 1Y8QA 2D7JA 5A4FS 5CJ2A 1H2YA 1HEIA 2VYFA 2KI5A 3Q5YA 4NFBA 3N41F 2HVKB 4GOKA 4Y9EA 2BR4A 2R8RA 2W6ZA 3MYYA 5DM2A 4P7FA 1EZUA 2NT4A 5KVQA 2IDFA 5L8JB 3T5PA 4GE3A 2FUG6 5AI5A 5TPWH 2LCIA 4XBMA 2FY8A 2HP4A 3ZU5A 1CT8A 2P8SA 1LM8V 5K0BA 3ILHA 5JROA 3Q98A 3FQUB 4BXSV 4DVGA 1QIHA 3OJ0A 1S5IL 5EGSA 1VJGA 5I45A 1GZPA 1ND0B 5JZVA 5HS4A 5E2VH 3TPKA 3NFYA 3A4TA 3G88A 4LEIA 3LB6D 3O2DA 2ZUTA 5L51A 1FYWA 2JFHA 1ID5I 4TYUA 1DFHA 1N9ZA 3VFRB 1Y82A 1A1NA 2UZ3A 2OFFA 5ITBL 4LHEA 4MB0A 1OOAA 1MPAL 2ROXA 1MCZA 1K6XA 5E9DA 3C6XA 3N06B 5T3ZL 3T0EB 2HLFC 1YRYE 1U41A 4LWOA 3KOWA 4UTNA 3I73A 4J1SA 4JQIA 3IDOA 5ACMA 4FU0A 1C1XB 1R3LA 3DBXB 1TJYA 3AL8B 4D92A 2ZF9A 3L5XH 3S34H 4UVIA 5JSUA 3KBBA 5EWLB 1ISFA 1FFNA 4GAJL 5KQRA 1HT1E 2EXWC 4L16A 2VSNA 3THML 4EDXB 2BWJA 4YUAA 3IFLH 1FORL 4GPZA 3BAYA 1KN4H 2ZRFA 2YY6A 4L9LC 3CNBA 2WXIA 3GBVA 3ZKND 4OF5A 4DDUA 5C0GA 2UU9B 1A9XA 3O1LA 5E8OA 1T35A 2VN8A 2ZWOA 3LKNA 5K3FB 4Q93A 4YJFA 1TCRA 2RAMA 2KUTA 4P06A 4EN3B 2DQCL 1QAOA 5CR8A 2O7QA 3ETCA 5IJ0B 5TQJA 3KB2A 1RZRA 3QXDB 2PAAA 3AUXA 4G8GA 3PR3A 1FZKA 4YJFB 2NY2C 4CTOA 2XN9B 1UOOA 1QP4A 3SQBB 3IDZA 3IXLA 2BDTA 1G87A 1GHFH 5ANME 1SCNE 1P61B 3TLRA 3STTA 2Y2UA 4JEHA 3DYIA 3GHYA 3MJWA 2W83A 3BXHA 4LEOA 1CK0L 2BVOB 2I2WA 3PIQB 2D1FA 1KPHA 1CDOA 1THCA 1ZJ4A 4IDBA 5H35A 3CLTD 1EX6A 4BK5C 3CXHJ 1Y6KR 3MSXA 3T0AA 2ZBUA 1FQWA 3N9GL 2OY0A 3RVRA 4LCIH 2VT0A 1S5IH 2AKYA 4J16A 4C05A 2DEYX 4LLWB 4J4HA 2ZOUA 1NQXA 3VWKB 1B2RA 2HRHA 3UP1A 3MPCA 2PWEA 5F7AA 1KELL 5J12B 4GIPD 4GAGL 4E5XG 1ZL0A 4XWKA 2EH8L 2C8LA 2E48A 4YL4A 4CV2A 1ZT7A 3F7RA 2QR3A 3L2NA 4AV5A 2ZIAA 2XQVA 2VZ8A 1SHXA 4U7GA 4OBXA 2MNJB 3LQZB 2BP8B 3LKDA 1ZA3A 3FUKA 5KJRL 2XWPA 4X5OA 3S3JA 4L9LA 1A2KC 1P4UA 4J8RB 1SPDA 3EFDL 1T1XB 3O6FC 2VDNL 4LVHC 1LE9A 1U0JA 3TFWA 2X88A 4Y6PA 1ESOA 3P2EA 4GS7C 3VO2A 3VH1A 4GVXA 3MRVA 5KOJB 1QFWL 5D6CB 4MW7A 1M1YE 1G8FA 4IOFC 3L3KB 4YHYC 4RZCB 3O6FA 3AH8A 5K9JL 5E99H 2YFQA 4O02B 5EPOA 3CUTA 3OZUA 1CLEA 5I15H 3B2MA 5HOEA 3MZTA 3A0UA 1SXPA 2E55A 1KLUA 5I6NA 3THYB 2VDVE 5BO1L 3RNQB 1QH8A 3CRQA 4ZOQI 3ZKWB 2XMGA 4GRMA 1X1DA 3IQZA 3EJWA 3NJVA 3W11D 3GJXC 3PF9A 5ALQA 3I4LA 3S97C 4NJMB 4N39A 5LBGA 2L19A 1YO6A 4JZKA 2OHHA 2QVCA 3OKAA 2Z91B 2I2AA 1PI3A 1GZ3A 3QBTB 4KR2A 1NASA 4ABVA 3I37X 2R68A 2YGPA 4FFYH 2I22A 4KHZA 4S1QL 4YRBA 1Z5OA 4B0MM 2J6IA 3HKDB 5EKDA 2HK8A 3MLUL 5IPFA 2R29L 1EQWA 2B1GA 1MFVA 1XIVA 4KNWA 1GZUA 3IPFA 2X6QA 2A92A 2G3ZA 5HJBA 1H5NA 1S7WB 4CC0A 2O2DA 5IT2H 1M8FA 3JWDL 3NGXA 3ESVF 5EUOF 2HMVA 4CN1A 2PO6A 1KENL 4DLPA 2GEUA 3FFDB 3KSBC 4V38A 3RO7A 2XZZA 4POOA 2VUYA 3AK4A 2R5NA 4E22A 4WJG3 1RP8A 1YY8B 1OBFO 3LGXA 2NN3C 1RLOA 4GOMD 1BG6A 3D64A 1QRUA 2LVCA 3VQMA 1A66A 4EQ2A 2JKSA 3QFJA 2XT1B 2OPCA 1UXSA 2BNRA 4Z1OA 3BISA 5ER9A 4UI2A 3SBQA 3E81A 4A36A 1C1EL 1XMEB 5DC4B 3CC8A 4I9HA 5I6OA 2GYSA 1KFEB 5EJFA 2F19H 4EM6A 4QHLB 3AEQB 5C0DB 1BE0A 2OMTB 5CNKA 1AKJD 3VGGA 1E5CA 4A68A 4NZ9A 3O31A 4CR6A 1RM5A 3H85A 1Q15A 5C0DA 3PPSA 5KYYB 3BD8A 1UM8A 3HCOA 4Q9HA 4R0LC 5K3DA 2POCA 1F4XL 4J49A 3Q7IA 1CB0A 5BMVA 2GBIA 3OJDA 2YOGA 1S7TA 4RWYL 4M5YL 3O9VA 1T36A 4NQXB 1GUBA 2WANA 4YMIA 1F00I 3DECA 3H0CA 4JN1L 2ZCLH 3N2IA 4RJIA 3EAFA 2PKXA 2W7TA 3EAGA 3MRHB 4HB3A 4WSJA 3FONA 5AVUA 1XPRA 2WFLB 3N0RA 5FBZA 2H31A 1K6JA 2W9LA 1UT1A 3WNJA 1UB6A 4YRIA 2VWPA 1LDMA 4UCXA 1PX3A 3V4RA 5DEOA 1RU3A 1I3VA 4MWCA 1BXGA 4X1IA 4JODA 2J32A 4F1JA 4QRFA 2C98A 4EX7A 2P6RA 3PV6B 1JQBA 2OOSA 5HF5A 3IDSA 4FSDA 1YRQA 3RX7A 5LNEA 5GRYA 3T9AA 5SY6A 3ONWA 4DV7B 1CNEA 1FJ1A 4WI8A 4P93A 5EIBD 1UF9A 1CS0B 1Y7PA 4HYTB 2W9DL 5AOBA 1WS8A 1BBDL 5D1NA 3DEIA 4P9MH 4TVKA 1ULUA 4LJ6A 1HDZA 4IRZH 1DJMA 4MRSA 2NXJA 1B1CA 2IQAA 2NQDA 4Q6IC 4O02H 1Q0YL 1USQA 3GUVA 4ER3A 1XTTA 4HISA 3REQA 3IS1X 1HKHA 5KTEL 5AKJA 1LO4L 3MRPB 3W37A 3QUZD 4Z5RA 1S8DA 1RXIA 2HX1A 4NMWA 1PG0A 3UXHA 5A62A 5BXFB 2WCSA 1DQTA 2PBFA 5SZIA 1P2VA 3BE1H 2XQYG 2FT8A 1WP9A 4AJ4A 4U7WA 1FFOA 3CFBB 1KYTA 2CMDA 2F53A 4QJ4B 1DQQB 3FDWA 1CICB 5EA0H 3LUFA 1FNEA 1DX9A 1KHTA 3R5KA 4KQ4L 4X8JA 3O45A 5I16B 3TONA 4U6XA 3U16A 4RGYA 2YHIA 1U3HD 1INQB 3W9EB 3EOAI 4A7UA 4BZ2H 2I1LA 4P59L 2F9LA 4QM6A 5ITZA 4O2RA 3WB9A 2KDYA 1V7NH 3DOSA 4LXHA 1PG7X 5BSTA 1RPUA 1Q0HA 2YHIB 4H2CA 3EZYA 3HZVA 2DPHA 5CJOL 3E5RA 4U1HB 3NTVA 4YYEA 1UZAA 3HPJB 1M6WA 1X7HA 1T2DA 4XHQA 3L0BA 3T8VA 4GRLD 1MENA 4IQ4A 5DJXB 1L2TA 1EXUB 1VRSA 1ONQB 4IMJB 4C5CA 3RR2A 2GPTA 3AERB 4OZHB 3EZFA 3PL6A 1DJGA 5ALLA 3Q9QA 5HTOA 2CNWA 4FFTA 1E61A 4HGPA 1JQEA 3B1JA 3BX1A 5IN5A 2F61A 6PFKA 2VLJD 4LPKA 4Z6AT 3Q05A 4S2EA 1M6OB 4OQDA 2C3VB 4HJ1A 3UUEA 1NF2A 2YWDA 2DYPB 5KSVA 2C9OA 1F2UA 2UWEB 3SZUA 4ZODA 1U1CA 3ZIMA 1A4UA 5FO7A 1WRBA 1CFBA 2VDRH 3N91A 4J6RH 5DX0A 2WLLB 3CLSC 2FZVA 2B1HL 3EUDA 3W6OA 3UOGA 3O2WH 1UJ3C 3V4VL 1H3UA 1AURA 4GP4B 1XZQA 4G0WA 1CDCA 4F7PB 2WF6A 1ZSDA 4HG2A 3T7EA 3QWHA 4NJEB 4EIGB 4FEEA 3HG1B 4QTUB 4M9CA 2CWRA 2EVGA 5I1JL 1OB1B 2EKJA 1LLAA 4AJPA 1OZ0A 4DJEC 3BBPA 1PVDA 2JNZA 1SOQA 2EFDB 1OBOA 1LBEA 1RZGA 1DVUA 2HBYA 2P7TA 4R84A 5J5EA 3KYAA 2NZ1A 2YN3A 2P5EB 5AVQA 1FFAA 1UPAA 3OJEA 3PITA 3P40A 4OBRA 1X7QA 3QOYA 1T66D 4O00A 2ILTA 5E70A 1NANI 3RJZA 5A3JA 3MV7E 3PIQA 1JG9A 4UHCA 1A9SA 4U2EA 1MN6A 4R8SA 3ILQD 1JFHA 3FE2A 5ER6A 4OI9A 2X4IA 1UJBA 2TMDA 3MLZH 3NTCL 5CCKH 1MAUA 4X6XA 3VR2D 5ENWA 1Z0KA 4D0BB 4B6JA 1U2DC 5EEYA 5EO0A 2MPAL 1PG2A 2GETA 1DWPA 1SSLA 1MHPH 1DMRA 1K5GA 1V8PA 3V8MA 1IUZA 1FZOB 1UBRS 3HCVB 4JZOB 3QS3A 4MQTB 1J0YA 4DNXA 3QP3A 4QXAA 2DRUA 4KQFA 4PAWA 2F3SA 3OWRA 5SV2A 1SHWA 5DQJA 1XZGA 5G2NA 4DCOA 4CKBA 1FJHA 2KQMA 3ULVE 1OQOA 4QARA 3HI6A 3UICA 3D8UA 2ZB4A 4YHYB 2XGOA 3B5HA 1PTKA 1GZHB 2B7BA 4DL9A 2VCYA 1E6MA 1TL7C 3NJIA 4LNVA 5C6TL 4MSWB 4DP6X 2XOXA 1NPDA 4GZ3A 3ANMA 1U2TA 3IO3A 2V8BA 4P99A 4DNQA 4XXWA 5JARA 4WVFA 3CPSA 2VSQA 4URVR 5MENB 5F9MA 1ZHFA 1MWAA 4QY8B 3DOFA 1MTZA 3S5ZA 5DB4A 4MUXA 5IHHA 4D4KA 2ICAA 2JGFA 3TSCA 1EJBA 1DIRA 4X1KA 2DTDA 4TQHA 1CT8B 5FOJA 4KSBA 1VG8A 4LOEA 1IULA 3D18B 2WSMA 4PJAA 4QTZA 3IR6A 3PCXA 1H9DA 1EP2B 1IV8A 4PGBB 5DO8A 3SPCA 4DG5A 1T6BX 2IZ0A 4BQOA 2GM9A 4LCCB 3H3PL 3GSWB