1TYEB

Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
440
structure length
440
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for allostery in integrins and binding to fibrinogen-mimetic therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-IIb
total genus 115
structure length 440
sequence length 440
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 1tyeB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 1tyeB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1tyeB03
1SHTX 1M1XB 2O7NA 5KYUA 1M2VB 2VDPB 3E2MA 1YVRA 3EFOA 4IXDA 4F1JA 5E6RB 1JEQA 5HDBB 1RD4A 1U8CA 4FX5A 1Q0PA 2VDKB 4WFQA 4BJ3A 3T3MB 1SSLA 2ADFA 3BQMB 3IBSA 1M1UA 4HQLA 2I6QA 3TW0A 3ZDYB 4Z7NB 3OKWA 1JEYA 1AOXA 3VI3B 3EGDA 1YUKA 1IDOA 1ZONA 4HQOA 1JV2B 1OAKA 3F74A 1SHYB 3NVQA 1L5GA 3HI6A 1TYEB 4WK4B 3VI4B 3EOAI 3Q3GE 1NA5A 4Z7OB 1FNSA 1U8CB 4WK0B 1IJBA 1M2OA 1JEQB 5KYYA 5HGJA 3K6SB 1ATZA 2ODPA 3EFOB 3NIGB 1XDGA 4IHKA 1FE8A 1V7PC 1MHPA 4MMYA 3FCSA 3EGDB 3PPVA 4XW2A 3HXQA 4CN9A 4MMXA 1QCYA 1AO3A 1SHUX 3F78A 4PN7A 3NIFB 3V4VB 4WJKB 3T3PB 2ICAA 2P28A 1PD0A 4O02B 4O3TB 1N3YA 1MJNA 1RTKA 4HQKA 4JDUA 5E6SA 1BHO1 1QC5A 1M1XA 4DMUB 5KYWB 4G1EA 1CK4A 4M76B 1LFAA 1RRKA 3PPYA 4MMXB 4NENB 3ZE2B 1IJKA 1MQ8B 3AL8B 2WW8A 3FCSB 4UM8B 4K3JB 3EG9A 2I6SA 2VDMB 3EGXA 1DGQA 4GZ8A 3M6FA 5BV8A 3ZE0B 4MMZB 1MF7A 4JX0A 3V4PB 4UM9D 1U0OC 5E6UA 2M32A 3K72A 3IJEB 2B2XA 1T6BY 2VDRB 2VDNB 2I91A 2QTVA 1L5GB 3K71A 4UM9B 1BHQ1 2WINI 2VDQB 1JV2A 1SQ0A 3PPXA 1YVPA 3FCUB 3ZDXB 3EG9B 3EOBI 1M2VA 1PT6A 2IUEA 2VC2B 3AFCA 1T0PA 2ODQA 2NUPB 4A0QA 2UZYB 3TCXB 5KYNA 1MQAA 1AUQA 4Z7QB 5HJ2A 3GXBA 2XGGA 4C29A 5E6RA 4CN8A 5KYWA 3K71B 2NUPA 4O02A 5KYUB 3HXOA 5KYXA 1CQPA 3EH2A 4NENA 3ZE1B 1RS0A 5LN1A 2X5NA 4G1EB 2P26A 1M10A 1UEXC 5E6SB 3OL2A 1XDDA 4HQFA 2NUTA 3OKYB 4MMYB 4O3UB 1DZIA 3EH1A 1OLZA 1PCXA 3TVYA 3K6SA 2NVOA 3NIDB 5ES4B 4IGIA 2XWBF 3PPWA 3IJEA 5KYYB 3EGXB 4G1MB 3K72B 1MQ9A 3ZDZB 3AL9A 5E6UB 4NEHB 4C2AA 4F1KA 3ZQKA 1U0NA 4FWWA 4MMZA 4G1MA 1ZOOA 3TXAA 2VDLB 4WK2B 1N9ZA 4HQNA 2XWJI 1QC5B 5KYXB 1JEYB 1IDN1 3QA3E 2VDOB 3OL2B 3RAGA 2NUTB 3AL8A 3BN3A 4CNBA 1ZOPA 1JLMA 3N2NA 4C2BA 1PD1A 1XUOA 3BQNB
chains in the Genus database with same CATH superfamily
3VX3A 1QV9A 1HINH 3PU6A 1W5AA 3V1UA 3OIVA 2J9RA 2OV8A 3AMVA 4XQ9A 1R5WA 3H7BB 3IFLL 5BQ5A 5DMGC 1CS0A 1V95A 2PPDA 4MBOA 3KKOA 1AO0A 3KPTA 3DYOA 821PA 4RCZA 5AKRA 1RVFH 2P0EA 4J4PD 1JZ5A 5GISH 2YN3A 1A6UH 1H8EA 2MCPL 4IRSB 3BD4A 4KYUA 1B73A 1HHIA 1JG2A 3KJGA 3FQ2A 2OC9A 5E7BA 4TVKA 1ZX1A 1I9JH 1ZU5A 3ZZUA 4OM1H 3IXTB 3OX4A 4OD2A 3KLBA 5K3OA 2WINI 1SQ0A 5I0VA 5INCB 1UD6A 1TJHL 1LO0H 2C7FA 3PABB 2R65A 2NSMA 3B9QA 3T3ME 3AI3A 5IW1A 2O59A 3CFCL 1F8TL 4BBPA 5C09D 4M5SA 1DSSG 4OFYD 4OZHF 3OB8A 3UJJL 1LEHA 3OQRA 1XA4A 3EE6A 1Z73A 4ZXBD 1IBBA 4F4IA 2V54A 2BRRH 4ZYLA 3AWGA 3Q85A 5F7DB 3WVNA 4BBAA 4GMKA 5JDIA 2I99A 5C7XL 1FP6A 2JHFA 3O82A 2WWWA 3RSCA 4PXYA 3F6CA 3E2HC 4WI2A 3WGOA 3FKQA 1ORWA 5FXCH 5ALGA 3OAUL 4FT4A 1JFQL 4XARA 3DMFA 4M87A 5KTPA 2AITA 3QI9A 2C8KA 2YR0A 2DQJH 2D1TA 5CFOA 3WMQA 2OGUA 2BVUA 5J1SC 3CZCA 1UK9A 4AW4A 2R29A 2FCBA 1CLCA 4MNHA 1X7GA 4HQKA 3AXHA 3GXTA 1KB5L 4DTGL 4LXGA 4ZW6A 4BYMA 4CKEA 4X97A 4Q1AA 1UD5A 3ZUGA 5HHME 5HJBA 1IC7H 4F8QA 1BGVA 2EIKB 3BWZA 5JLJA 43C9B 5EE9A 3WLSA 5I76A 3NCHA 2Q3XA 4RESA 3NOOA 1GG8A 5B58T 3FPGA 4X8MA 1AU9A 1VB5A 1XD9A 2DRUA 1K8RA 4L78A 3VFVA 3ELAT 4DG5A 4UBDC 3GTNA 1KJ9A 3U7EB 2PMZA 2C20A 3B3IA 5D8JL 1KYFA 4ER5A 1RZKC 2NSXA 5GGUB 5CJ8A 3ZGLA 2WXQA 4WUTA 4U7FA 3ZWAA 4ORGA 4PJAB 2DPKA 2WXHA 4QD3A 2WUCH 2A9JA 2IVFC 1EA5A 4YDNA 4R1LA 3R4CA 3O3BA 4U1LB 3A25A 1N7MH 1KSHA 2NU7B 5FBZA 2XTZA 5J12B 2JIDA 5FUVA 4MS3A 1MW8X 1QYVA 4G2TA 4BLWA 5TMPA 4JDEA 5T1KD 4J3NA 2XUIA 1JB1A 3ICOA 2FLRT 4KE7A 5LUMA 1NYLA 4Q39A 1CUHA 2YPVL 1XZEA 2YC2C 3DDOA 2CBOA 2Q5IA 3ZT7A 4OSUL 1A7UA 1DVZA 3QPKA 2WKRA 2VF5X 2VAAB 5A16B 3WIHA 3CB2A 3PQ2A 4K7PX 4HIHA 3A22A 2ZIGA 1TJGL 1Y5MA 1CT8B 1QBMH 3R75A 4TMZA 4HSAC 4M00A 1SVIA 1EXVA 3QORD 4O9HL 1ESDA 2Q4DA 4Z7VE 3BCSA 1XB2A 4BXVA 3C8DA 5BMFL 3SHFA 4IBWA 4HUUB 1N5AB 3DSNA 3DUUA 3DX6B 3N2ZB 3QAZB 3MUHL 3K8OE 2XXAB 2RIRA 4NYJQ 3S6JA 1W0VB 3NYIA 3BGWA 2Y1YA 4N0MA 2YBGA 4W8HA 3ZVMA 4AYGA 4DQVA 2P41A 4ZOBA 4CF6A 5A3RA 3PQ5A 1U1FA 2BFDA 4HH0A 1G5HA 3BXFA 1E7MA 4J27A 2VSQA 3WL9A 1X92A 1LV7A 1ZTXL 4D0NA 2IANA 4HLJA 3BJ91 3QLUA 2C29D 3IVMA 1O94D 3KAJA 4PV1C 3ULSB 1CUBA 1H4TA 4TLTA 1P9RA 4PN6A 3RVBA 1NDGB 3W8RA 3TBKA 2CM5A 2NR6C 3ZKND 1WISA 2Q3LA 3L3IB 1M6VA 3DMGA 1T9DA 4KK5D 3PFHA 2OXIA 2H7WA 4DILA 3LBYA 1A2OA 2I4TA 4XMPL 4G3YH 2WAHA 5KSYA 4OHBA 3QU4A 4MLIA 2J57A 4B6RA 4NJOA 5BOSA 1UOPA 2W38A 1HHJA 4ZCQA 5KEIA 4WESA 3X12B 4HAFA 3LT0A 4OIAA 2F3QA 5GGSA 1XH0A 3TA3A 2OLKA 3O2WH 1LDPH 4GIOA 3L0PA 1PYDA 4DIUA 2ADIB 4PGJA 2QTHA 1TKCA 1M5TA 3SQRA 3ETCA 3VQLA 3MNVA 1D8AA 1GSAA 5IAOA 3Q12A 5E3HA 3GMPA 2GHQA 4WCYL 4UQ3B 1W2KT 5BSTA 3VGGA 3EC2A 1UPXA 1HZZC 4MDFA 2BFVL 2AHOA 1A6TB 2WB1A 3U9PL 5IGXH 4LJLA 4WKNA 1NCCH 3OWRA 3PFNA 3A9WA 4BV1A 4ZTUB 4CETA 2ODQA 3B5TA 3V0VA 2WHXA 4A0QA 4I4TF 4L0ZA 3NSDA 4IFTA 4IIQC 1U2EA 3S7TA 2X4NA 2ZAGA 3A36A 3DX8B 4FR0A 4C04A 2QX8A 1V39A 5LQJA 2O6LA 2DVMA 1AZZC 1JDPA 1L9MA 1WT5C 3LGXA 3POCA 3ZWWA 1P5UC 1SPXA 4XQEA 2C5LA 3MRBA 4YXHL 1TQ8A 3ZLUA 3I42A 1EV2E 3QBDA 3EEIA 3TTYA 4MVYA 5KNDA 1GCFA 2QR5A 4I7ZC 1S8DB 4MAAA 1EFRA 3A1FA 1N5RA 3TPUA 3UM9A 5DQJB 2BM0A 4LCIH 4GSKA 2RQ8A 1Y0LB 4PRDA 3NKFA 1P31A 2V3VA 1Z3RA 2FECL 1H1DA 5J1SB 4QCIB 2X0FA 3GRBA 3O21A 4YDVB 4FHKA 3QVKA 2ZUDA 5T4FA 2YD6A 3OF6A 3UJHA 5EUMA 3LFTA 4MDIA 1J49A 1KVTA 3ET9F 3WG7B 2LKCA 1HI6A 1MIMH 2YA2A 1JDNA 1E6JH 1MW3A 2XUQA 2GJPA 5JOEA 4JYMA 4MASA 5B4TA 4OGYH 2X4UB 1Z2OX 5LPNA 3QYCA 3I9NA 5SYNA 1OL0A 1A5FL 1Y9ZA 3TBSA 3GCGA 5E9QA 4I08A 2IUYA 4A1OA 1A7RL 4AVYA 2PWFA 2SKEA 1DI0A 4R54A 3OURA 2EGUA 1CFSB 1ACMA 1RP7A 5BQFA 1T0PA 2H51A 1FFPB 3A3OA 1MC8A 2XT1B 2FQFA 3ZCPA 5HHVH 1DC6A 3KQVA 1X5MA 4QHYA 2QHLA 2FG6C 5HP5A 7AT1A 1O5IA 4I4WB 3LPAA 3M8OL 1P4LB 5E8EA 4HUWB 4KK8D 1UM5H 4JIGA 2YRWA 5I66A 2EG9A 2EZUA 4OAQA 3PDOA 5BRJA 1OPOA 3B8EA 2GPSA 2OBMA 5L7TA 3KEQA 2VAAA 5A16A 5F5NA 2NZ2A 2LE0A 1SXJB 2R6R1 1OSZB 3E2MA 1CHNA 3DXXA 3MYRA 4I5DA 3WBKA 1WPXA 1XBRA 3LQ1A 4QDUA 3ZV3A 3V1KA 2B3TA 2FPWA 5M3BA 2I7VA 4FNGA 4KZKA 2PRIA 4MVJD 4EHIA 4Y3UA 4X50A 1WM1A 4US0R 3BT2L 2ROXA 4V0NA 3VKWA 1XDSA 3LYAA 4ETNA 5JJBA 4U0KA 1UXIA 3L92A 3MS2A 2XECA 1C0LA 1HOTA 3HABA 1KJ2A 2CNYA 4PRHA 4AU1A 2J3EA 4AW7A 2AQ2A 4IKPA 5H0IA 1SELA 4XN5A 1QV7A 5J56B 2PYFB 4XNQB 1DKPA 2RHOA 1ZAYA 2CIIA 2B4QA 3NSFA 4R16A 1GGFA 3BDBA 3OFJA 3B9EA 4BZYA 3LUGA 1BMDA 2OZLA 3C75A 4JRFA 3GGWA 4JJOA 4KN8A 1PS0A 1VPOH 3VR6A 4P23C 1N0HA 2QNRA 1FFGA 5LUBA 2ALAA 3P20A 4D57A 3LZRA 2H7YA 4J3FA 3MJDA 4P81A 5GS2D 2RHGB 4BGVA 1OE3A 4OKSA 4KO6A 1KL7A 1IONA 1SQMA 4A8JB 3STZB 1U93A 5EFOA 5FA8A 3Q11A 3U3DA 2Z8YA 4Q2ZB 4TYQA 2MSLA 4BKMA 1WXQA 1QRND 1F90L 3YASA 2P1ZA 4GJTB 2AQRA 3D8BA 1AGBB 1HZHL 4JS7A 1M54A 4XYEA 1IO4C 4RFVA 5I1GH 2CW5A 1QGAA 1MCWM 3DW3X 1QHIA 1NLZA 2EUZA 3RYCA 4YMUA 3OU2A 2I34A 2Q0XA 3Q7TA 2DQDH 4GHWA 2OMZB 3WYRA 1WEJH 4RWYH 3QWRA 1K8ZB 3UB2A 3UG7A 1K4DB 2EYSB 2DBVO 8ATCA 2JJSC 3HCAA 5KNCH 3RU7A 2V3EA 5HHTA 4KTTE 3ZNNA 4BVLA 3AZOA 1MO6A 5B1DA 1UBFA 4QRDA 4HS9A 4C58B 4EI5D 1BPLB 2PO6C 4KKCC 2Z3WA 3FUCA 2A77L 5JBQA 1DG9A 1PT7A 4WI9A 3B2NA 1VA4A 2JLCA 2C98A 3FU6A 1JZIA 3NNNA 1SQ2N 1CRQA 1FFBA 2X41A 2VPYA 5CNIA 3CHQA 4WY2A 3SDCA 1WA2X 1MJJB 2B36A 4XTRD 1Y5NA 4CTNA 3CVHH 4C05A 1OIOA 2C4UA 2P7TA 4HEME 1BEZA 1S3IA 4JELA 2ZSVB 2IODA 3ZHFA 3MW8A 4MNQA 2EHDA 4B0OA 4LEXL 1RDFA 3R6LA 3UOWA 3NG5A 3OZ9H 1ADWA 4D4LA 2RHHA 4QBFA 2AJSL 3QDMD 4QXUH 1R6UA 5GV8A 1FEZA 1YQXA 4UBMA 3R06A 3UF0A 2OY0A 2DF8A 2WAAA 1MHEA 1PUXA 3SP1A 2J67A 2Q5FA 3OGCB 5B1SA 2E59A 2M6KA 3IHWA 2PBRA 4TYPA 3ETLA 3TZVB 5KJRL 4DSYA 5EJIA 4EJ0A 3I50H 2AC4A 2IH1B 2NUAA 1JNHA 2CYBA 4YSAA 3FT9A 4KQWA 4HUQB 2NXZB 3LHPL 4G5ZL 3ICCA 3K15A 5KVEH 2H31A 1P5FA 4EGJA 1FNDA 1XGTB 2DBZA 4TXLA 1R5WB 4S2SA 5J13C 3N75A 3THWB 4ZARA 5JRDS 5JSFA 4J6FA 3MUNA 2IH2A 2ARJB 1VGRA 4YDKH 5CLQA 4Z95L 3LVBA 4U00A 5T5FA 4B9FA 4DRXB 3P4OB 2VATA 3NVKI 3D50A 1PQWA 2PUDA 2F54B 3WD5H 5IVIA 3TC9A 1QF6A 2FW7A 3KXLA 4DJFC 3IDGA 5D71H 3KLQA 2C9DA 2FMHA 4JY6B 3SGLA 4ONFH 4HAGA 1KAMA 2YDYA 3GGOA 3H0EA 4WLNA 3GRRA 1II4E 3R5XA 5EZJA 3T2PA 4AGOA 2FN8A 2BZCA 4LBAA 1AUQA 3DDSA 2R9VA 3U4MA 1CLZH 1KF9B 2REBA 4P84A 2GJ8A 3WMGA 1BMZA 4R8WH 5BYJA 1G43A 3L4EA 3GFTA 3MJ8A 2EW1A 1UFUA 4DRXA 1RRCA 4K6OA 2CV2A 1XZPA 3ZVRA 1J7VR 4MMZC 4XRRA 3AEKB 3C3MA 5K3FA 1RU9L 4HAOA 3D6AA 4MS4A 4HYTB 2ECKA 2CMKA 1CR0A 1BJTA 1VL2A 2GBFA 4TMFA 3VNSA 2FK9A 3NA9H 5AW4B 1AGNA 1WWKA 4S0HA 1GS6X 2NUAB 1M1XB 4RNRA 2C7UA 4AL8H 1ZR4A 3QFDA 2A92A 3P54A 1KELH 2ZI7A 1P7VA 3NTXA 4R3SA 2BY3A 3FTCA 3MF4A 4CUZA 1WAAE 1NGWA 1LEIA 1C8VB 3B7RL 1NXWA 2WSDA 3M17B 1T2JA 5AOIA 4DTGH 4Q7KA 1IATA 2YMMA 5C9ZA 3EPKA 1W8NA 4BX9A 2WD7A 1AAJA 3DBSA 4I4IA 2E87A 4DC1A 2WW8A 2XG5B 1VL6A 3CLRC 2AOTA 3FAWA 4KPUB 2XI4A 3E7WA 4DEXA 3TJRA 3L54A 3RPIA 2HF9A 3IJEB 1ZBQA 4FNLL 1XR9B 1HEZA 5AKZA 1JA0A 4PLCA 1CPYA 2BZ7A 3OX8B 1Z1WA 4JPVH 2O26U 1GUBA 3SQOH 1ZJYA 4I6EA 4QUIA 2BGGA 3Q9SA 1R5BA 2JFOA 1L7MA 2XKJE 4ICWA 3EBGA 5HR5A 5BP7A 3A4VA 1CLYH 1TE2A 1VKOA 2AWNA 2HSIA 3B56A 1JX6A 3MTJA 2WYOA 3U26A 3SBQA 3ZE2F 5L2JB 5FADA 1CD1B 1SBCA 1KOGA 4EA9A 2X0RA 5EO1B 1KO4A 4WXPA 3BDXA 4JJ4A 2N3JA 2ICWB 3DUSB 3MOQA 4D0CB 4MQ7A 4BUGA 1IYZA 1G7MA 1PDOA 1B0RA 3WD5L 1SU4A 2AI1A 4UMGA 2NO0A 3E9MA 3EFBA 4A04A 1WDWB 1ZP6A 2ZLBA 2QW1A 2GI7A 1B76A 4NFBA 1ENYA 1YEDA 5BQDA 4OZFB 4XP1L 3QAZC 4APQB 3WO4B 4TTAA 2H1RA 1FS4A 2QJRA 1MG5A 2E86A 4ODUA 1QFWH 3NAAL 3AG6A 4J0EA 2XWBB 5DD3L 2IV3A 2O5RA 2GH1A 3H9SD 1WZAA 4XPTL 3C45A 1QWSA 1CGWA 2CL5A 5IFHL 4B7ZA 2FRDC 5TLSA 1BDYA 4XMWA 3LNTA 6REQB 3BO8A 4JEIA 2Z9CA 1X7ZA 1EDDA 3TKLA 2VJQA 2P5ED 4IRSD 2FBJH 1YA6A 1PU0A 5D7BA 4OF7A 1FFCA 1GA2A 3JUZA 4AX4A 1EGAA 2L2QA 2J5WA 1SXBA 2VPWA 2Z1PA 3ZGVA 2CCKA 4DOHE 3OA0A 1D5IH 4RETA 4WMLA 1RQNA 5ACMA 4AWBA 3CW9A 3RLIA 2FFRA 2BOBB 3DVQX 1FDLH 1XNRB 3L7FB 2AF2A 3EHDA 3WYAA 5JT1A 2V4UA 1L7XA 3RK0A 1LZLA 5IROC 2ZX9A 4NO0B 2Y67A 3SDYH 2FLVA 4EVSA 3WGHA 5JANA 3P9LA 2W37A 1HSBB 2ADOA 2HYDA 5E9JA 3K8KA 1KCUH 5J57B 2ZCHL 4IIUA 4ZV9A 1MFEL 2WTMA 2ZKHL 1GWNA 3RWEB 3QFRA 5KX5B 2CC2A 5CVTA 5CP3A 4L9RA 5BMVA 4N6GA 5DS1A 2ZUXA 5TDPB 3QVGA 5KVFL 1FQ9C 2Q76B 3GVCA 4PGCA 3V6OE 4DUGD 4Z1OA 4NO0A 1BW9A 4WDRA 5FA5A 1ZANL 2WVVA 4O4HA 2PUHA 5FLYA 5KTMA 4TWJA 1TCRA 2WJYA 5GXBB 1HURA 2G40A 2OBBA 5CVCA 1N75A 1TQSA 5ICFA 4GGMX 5KUTA 1ZHLA 1Y07A 4Q1EA 4XWGL 3HZOA 3PWKA 4Z2AA 1QF9A 4B32A 1F3JB 3MLXH 5CNKA 2YBRB 5F2OA 2IYQA 3TBYA 1D7FA 4MJ5B 3GSXA 3ZYZA 1YR7A 1Z9SA 2V5AA 2L0XA 3ONEA 4ZJYA 3X1DA 3HXMA 2HLFC 3BL5A 5FOTA 4NM4L 1NFDB 3TW4A 5L3QB 4U3JB 2R6ZA 1VPLA 2LUOA 4PZAA 1E4KA 5IKCB 1GT91 4BCBA 5C0AB 2HHAA 4Z4HA 2OI9C 3IBFA 3O3DB 4TLCA 1SHWA 4YH1A 3I5UA 2JAPA 5DI8B 1BQ5A 3LDBC 2O7QA 3FT0A 1JN0A 1YEEH 4FXLA 3HKZA 4QGFA 4I5BB 5HGHA 4WVRA 4XMKL 1OXBB 1NVMB 4HG2A 3DC7A 2WQVA 3UFBA 4F85A 4FI6A 2W5PA 4LPXA 3FW6A 4HRVA 1Y1DA 3GARA 3WIHH 3OT4A 3PF9A 1CFQA 2XVBA 3IGAB 1VJTA 4X94A 4N28A 4LNUA 2GCIA 1IWOA 1H8HA 1X5IA 3H2PA 1MDFA 3BVNB 1HI9A 1QFJA 5DD6B 4WJLA 4TUJB 5G1OA 4LXQA 4TUOA 1NAML 1Z83A 4TXJA 1XTIA 3QQ3A 5TQ0H 4PJCE 5IDWA 2WWMC 1A6WH 4KE9A 2Y7NA 1R3IH 4O2EB 3KPYA 3CXDL 3FHOA 4BQNA 1OHZA 3BP4B 5HP4A 1KIUA 3Q7RA 4NCHA 5EHFA 3FYEB 1QUFA 3TLRA 5I4KA 2XB2A 3RANA 1WE2A 3SKUD 1DBBH 3E7DA 4P23A 3UAJC 3QQ4A 4QT5A 1M0TA 3NANA 4P4RA 3VD5A 4HMCA 4XBMA 3F5WA 5BR7A 3F58L 3ESUF 1PJTA 4GKZA 4EG5A 1UT8A 4TQGA 4X1IA 3QX9A 3TI9A 5CJXA 4KQXA 3GZTB 2B8NA 4P48A 1YMMD 3B8SA 1QA9B 2JGJA 3IURA 3U7WL 3BAEL 4PJCF 1W88B 2JI8A 2QJFA 5IFKA 1QLRA 4I3RL 4RK4A 5IQ7H 1JIBA 5IEBA 4GMSL 1UJ6A 1IEAA 2IW1A 3V0DA 1XU4A 4X6FA 3TKAA 4APQC 5GGRY 3OKNA 3D7KA 5TQJA 3MQ4A 1WCBA 2EF1A 1ZG3A 2QN6A 1CY0A 3QORB 4XB7A 4KO3S 4RZSA 1E3DA 2P7IA 2HMID 3AYZB 4E42B 3EDRA 2F1BA 4YSPA 1C2YA 4NMWA 5FNVB 5C5DA 3HCBA 3K4DA 4KRPC 1KEPA 2UWEA 2ODPA 1RKRA 2RHRA 3ZE0E 4X7PA 4XDZA 2C9BA 2WJ6A 3VFRA 3E9DA 2EABA 3K1KC 3TNMA 2MWCA 4R8SA 1QE0A 2VQ3A 3NHPA 3R5FA 3PX3A 4ETIA 3ZV6A 2J31A 4QUOA 3AETA 4LAQH 2XTMA 1ILUA 2K4AA 3JV4B 4Q74A 3CW8X 4B9GA 1OFVA 2QLBA 1VZ2A 1G0XA 1W72B 4D3SA 5IJCC 2Z56A 3W9UA 3MACH 1KCVH 1BQHG 3FSGA 3UJ7A 2QZ5A 3CCBA 5SWQA 4MCYB 3AU1A 1WE5A 2WG1A 2XWTA 1KI7A 5DEFA 3MV7A 4C4UA 4NCKA 1F7UA 2N1BA 2YJ3A 2XXGA 2HQOA 4OU4A 2V7BA 2O0KA 4LX8A 2HR1A 4JSRA 1RQXA 4FQCL 4LCJA 4RSVA 1ZJZA 3I1IA 1PTKA 2CMGA 2PCLA 1DHRA 3GNSA 3ZKXB 5AW9A 1P4RA 3V8RA 5HHPA 4LB8A 5ALCL 4M29A 3PHHA 4ZYTA 3MRPA 3C7AA 5JXHA 1PVOA 3GQVA 3BEDA 5K8JB 1KMGA 2VTEA 1JILA 3C6EA 3G2PA 4JRYD 2J5QA 3TN0A 1INEH 2VN5A 2ON6A 1ZSVA 3KCPB 4BO1A 1S2OA 3FCCA 1NGYA 4JN1H 5TH2B 4MCNA 3MYJB 2CCVA 2ZONA 5C6TH 1M34A 4JFQA 2JJ2A 1WULS 5DD6A 1OBVA 4V0OA 5EV7A 4N6OA 5EO0B 2ZWVA 1NCGA 2PQ0A 1XT6A 1QIHA 4OLVH 1DWOA 4GM1A 4AS2A 1UAGA 1WCQA 5EMJA 4C6TB 1UYWL 2GN4A 3Q0HA 1UP7A 4B75A 1XF5B 5A71A 4GEGA 3TJEH 4RD3A 5CXPA 5EIVA 3LKRB 3SXUA 4DLKA 3ZLTA 5FYJD 4FG4A 1HZZA 3W57A 2E4WA 2J09A 4H8WL 3LBAA 5FHBL 1NVGA 3TI7A 1HFUA 1Q9LA 2WGXA 4O2BA 1JF1B 1JLRA 1RAAA 3FIUA 1RC8A 2FT7A 3RVTC 3T4YA 1QRRA 4UIMA 5IF3A 3EQ8A 1I7RB 3EUFA 2E9SA 1R88A 1PG7W 1TQWA 1O6FA 3THSA 3SMVA 1Z07A 2WXOA 4DNQA 1CQJB 1FRNA 2VT2A 2W91A 4ESOA 1VKRA 5LB2A 3L02A 1TLMA 4V0SA 3OWHA 4M1QA 5JSHA 3N1GC 4TQUS 3K2KA 1B4TA 2P3OA 4MJ7A 3U3MA 5LNGA 1N2BA 3K4HA 4FFLA 3T1HB 3HBGA 5CFPA 1XGPA 1EBFA 1YJAA 3KOMA 3H9SB 4WFKA 5KKCA 3HCCA 5EZIH 1YU6A 2WIBA 5IANA 3ZX5A 1RUAH 4EUPG 4XAWH 1YECH 3O6KH 2AXPA 4C7KA 5K0TA 1VFAA 2E4UA 3IUSA 3PNSA 5DTFA 5K69A 2FPUA 1NGZB 3MA7B 1MCRA 5A6SB 2JLXA 1T1WB 3WLOA 1LUAA 4YMWA 3NM6B 4PTYA 1YAZA 1RZIB 4GYYA 3FTGA 3BWDD 3SYKA 2XQIA 4F92B 4OQ4A 1FL6B 5FGRA 1ORDA 4GBGA 4ZYWA 3C7DB 2PT5A 4PINA 1RI1A 4FTWA 5E3IA 3BRSA 3TCNA 1MA0A 3GS4A 2O2EA 5CLFA 1JNXX 3Q87B 2WHYA 5ED0A 4CMEA 3JTTB 4GLFA 1O5TA 2HT4D 1S3RA 2HJFB 5FDFA 3EGVA 4Y6RA 3OKPA 2XE4A 1DBML 4W9NC 5DTMA 4OMFG 4D56A 2LLNA 1X1CA 4BNWA 2A67A 4A6XA 2HJLB 5IBCA 4H18A 1I3RA 3H75A 4F9LC 4KQEA 3CWCA 2IV7A 3FR8A 1KPVB 2XA1A 3QPXH 5GSRB 2PTVA 4RHTA 2Q2WA 3O75A 4YCCA 4OUUA 3NHMA 4OJMX 4ONOA 4RETB 1UDRA 1YJDH 2RGAA 3I9KA 4O6VA 3QP3A 2W2PA 4UINH 1IPFA 5JLZA 2X89A 4G6KL 4LQDA 1L4IA 5LOVB 1WWAX 4RULA 3L07A 2LVEA 4XASA 3HI6A 3U3JA 1ZK5A 2WV3A 4DIBA 3IDAA 3Q7JA 2IVFA 3OOWA 3I85A 1R37A 4Q9QH 3RWHA 1S3FA 1ZCJA 1TUBB 2VHXA 3VD1A 1U5AA 5I8EB 3X14B 2ZSEA 4K07A 4NBLA 4QUHA 2X10A 5E8NB 2ZYGA 3ELUA 4J1QA 2R84A 4FYSA 3U2SA 3ZE2B 5E8OA 3Q72A 3WE1A 1PJLA 1AXGA 1H1TA 3TWOA 2VT0A 1B90A 4EI7A 2NU9B 1JZ2A 3OR7A 3CSYB 3B6IA 4OF6A 4Q4LA 5LKRA 5HYIA 1OFTA 5EU6B 4F6LA 1KIQB 3GRKA 2HHLA 4K6GA 3GZNA 4UOW1 3H65A 1BFOA 1VMAA 3TQCA 4IHJA 4CKBB 1YEWA 1L6PA 5AHWA 5DSCA 4CMAA 2RDMA 1V5WA 4IXNA 4K3EH 2WQRA 1L5SA 1HHGA 2FSEB 1ZA3A 3B5EA 5CEFA 5A05A 1GCYA 1WBZA 5ALBL 5BN3B 4ZA2A 4K7PH 2XYVA 1F0KA 4NDAA 2VQUA 5CDUA 5TK4A 4C14A 5BSFA 1Z3GH 3CUVA 4RA6B 2XA3A 2BP8B 2H92A 2OR9H 3OPZH 2ZT6A 4XI9A 1TZBA 1Y0LA 2DQCL 3ARDA 3EJSA 2AC7A 4AWAA 2MQ0A 4O5OA 1E5YA 3Q8AA 4P2RE 1X70A 1XUOA 4DG9A 1IMOA 1Y6ZA 2AA3A 4NUPA 1AD9A 4ZAKA 5JQGA 2HMUA 2HN7B 1BWPA 2ORVA 4E9VA 3LLSA 3B7TA 3ER6A 1RXIA 4GQPH 3R6WA 1A6TA 4L95C 3K6OA 1WZ1H 2E6PA 2WZ5A 3ND5A 1OF2B 1UF9A 2CCJA 5DWQA 4QHKI 3HTLX 3GUFA 3HMKA 3RILA 4JT2A 1OTSC 3PE3A 5GS0D 1QCYA 5CDFE 2ATVA 3IJ7A 1ENZA 2GBPA 4LMPA 4NKIH 1OVGA 4CHGA 2HRHA 4QO7A 2XYQA 3DC0A 1RKQA 4FFWC 5IS2A 3BMCA 4FKZA 5IUKC 4F9EA 1ZDMA 3HDJA 3Q6GL 4N2KA 4B43A 1DVFB 3QARA 4ZN6A 1G9EA 1P4AA 2H45A 4XM0A 3LS5L 4A03A 5ISZD 4Z9FA 4XC1L 3G5LA 1DBAH 4PHGA 3PRJA 3WGLA 4A7VA 1JMZA 3LV3A 3R0IA 2X5OA 4TSFD 4JB9H 4TS9A 5D3KA 2H5EA 3BEOA 5E5LA 4HYTA 2I8CA 2XGSA 1BPVA 1U63A 4CJ0A 4M1EA 3DO3A 3NBXX 4OAOA 3T0VA 2WY3B 4ZRNA 1FH5L 4LCCA 3K6IA 1A4XA 3ULSA 4Z9XA 3B1YA 1GGEA 1PV1A 1ZSDA 2EDDA 1KBVA 3FTNA 4OJQA 2CRYA 1ZXBA 4V2UA 1ZGLP 1XMSA 1I9RH 4A2FA 1V3JA 2Y6SD 4LLQB 4XZUA 2X4IA 1RQGA 2GUGA 2DKSA 4NU5A 3VTTA 3EZ8A 1KK0A 2BS71 4LRSB 1Z47A 1B6GA 3OZRA 4Y16D 4BNTA 2Y07L 2C0CA 1YRBA 3MWYW 3MV9D 3R6DA 5IMKA 5DMKB 1KI8A 2HPVA 2JKNA 2O3UA 2O2DA 1CICA 5BY2A 4BM7A 1NMBH 4C4TA 1JCVA 4R9SA 2CLOB 2XQBL 4J07A 3G8CA 4JJ6A 4UEJA 1VMEA 3RS9A 2A14A 4FG2A 5D1QB 2Q8AL 4FD3A 3VO0A 1M7XA 2BNQA 2O4CA 3QI2A 3WZ2A 4W93A 1YVUA 1HKFA 4G8AC 1PKEA 2WM9B 4JGJA 1QRUA 5E7JA 4L8DB 3EFHA 1U2SA 4A6YL 1IMHC 4HQRA 3ETSA 3PV6B 3D2UA 4EG3A 1LLFA 2YWFA 3G68A 1Z16A 4M7ZB 4MGYR 1QRAA 1YL5A 1H6UA 4FCVA 3UCEA 3QS2A 4TQHA 4F3NA 3TR0A 4BFJA 3UAZA 4P57B 1Q7GA 2XWBF 3O74A 1NMQA 1OCEA 2FZKA 3UMVA 3CFBA 1P5UA 5DT1L 2VWGA 3UMBA 4Z9AA 1AK1A 1DNPA 3ZIYA 2VH2A 4ER7A 1UVQA 1FDTA 5HUQA 3I3EA 1YO6A 3DHJA 4QE3A 2CNZA 5IU6A 2D2IA 4LPWA 1CE8A 1ZVQA 4UHJA 3CHYA 1D9XA 5CG1A 3VFVB 1EFXD 2O93L 4LNVA 3LGSA 1L4FA 2GC7C 1IFHL 3MIIA 1WTCA 5I6XB 1XALA 3Q3GA 4F86A 2ODIA 1FU7A 3REQB 4AJVA 3S70A 3SPVA 2VZUA 5ISZE 2BSXA 4XX1G 1XEAA 2X38A 3DOOA 3IRVA 1I1HA 2WP8J 4KGJA 1T35A 2DWYA 4X7BA 4RY8A 1NCBL 1NBOA 1YVDA 1GC1L 1PZHA 1KFJB 3ESDA 2GBLA 1B6SA 2GZ1A 1U3HB 2IP1A 5A3SA 2K6YA 2J3MA 5AVZB 3U9UA 3WLRA 1N32B 4G8GA 4FFPA 4WZAB 3VMFA 4N9GA 3PC3A 4BN0A 3GO1L 3A1WA 5BUZA 4BLPA 4O2AB 3DE3X 2X6RA 3P1JA 3B1WA 4YXFA 2NIPA 3G2NA 3PHOA 1Q74A 4QREA 1AD9B 3JWEA 1AE1A 4YUAA 3KPMB 5CNMA 3GSVB 2BMKB 3NWEA 3OMAB 4IDJH 3EJYC 1ZPUA 1XSOA 4B6JA 4YRGA 4K6MA 1AY1L 3V33A 4LDEB 3NESA 1T2AA 3ZK0A 1XIWC 4HATA 1IBSA 3VFUA 2IUTA 3P3SA 1C9KA 3S97C 1B8UA 2P9EA 4NIMA 1ACYL 3GPIA 4P2OC 1J7KA 4YRLA 5DUBB 4LZOA 2YC1B 2NYYC 3OC5A 1SK9A 5IMSA 3CPSA 2JJWA 2HK8A 1FUUA 1JSXA 3NIWA 3N0XA 3L8FA 1YZQA 1J8YF 3BFQG 1JD9A 2V2WA 1HWYA 2ZRPA 4TM7A 4MZIA 2G1PA 1QHPA 2GXAA 3AI7A 3FBGA 1T20B 1OX4A 4W5RA 1D2RA 3BPOC 4A1RA 1ATZA 3QIUA 1JMKC 4ZFGL 1DG3A 3D9AL 2FGJA 4FR2A 4UNSA 2HRDA 5IX8A 1NPNA 4BLVA 3CH6A 5CX1A 4JOSA 2P9TA 4L8LA 1BHO1 5E8OB 4PLJD 4NPYB 2UX7A 3UJDA 3S3PA 3AVTA 4RMBA 4QNNA 3HI1A 1QIDA 1C1YA 4RMNA 5TT1A 1SJEB 5F98A 2ITDB 1AGFB 3MJ7B 4JKPH 1TTUA 1UWVA 5JYEA 3OFNA 1LEGA 1KMIY 2WUEA 4OFQA 4KW7A 3DO8A 2H06A 3MCLL 2YN0A 3MAWA 3ZDZF 3L7NA 4LYHA 4G0OA 4EEEA 1VHDA 1RZPA 3C4VA 1XZHA 3ARUA 2XQKA 1A8IA 1BROA 1N0LB 5HHXH 1JHAA 3MLTB 3FFCA 1QX1A 5JCXA 4HDMB 4K05A 1E8YA 2GUOB 1KY7A 4A6DA 5F3BB 3A4NA 3BHNA 1L7DA 4FB4A 2RBGA 3ZQJA 4POZD 1BHGA 1W0YT 3P2TA 4HDKB 3AUKA 1ZD9A 2HRQA 1QTQA 5H9WA 4G65A 4PXAA 5EPUA 4ODVL 4RPLA 3O5AA 1IJ9A 2FKNA 1EH9A 2XKSA 3WHXB 4LYDA 3SDXF 1SUHA 3CC8A 4FNSA 1H5NA 2N46A 4LAQL 3VA2C 3WSQH 2JTDA 1XNJA 2R0WH 1J2JA 4EARA 2X05A 2UUOA 3IVCA 4A0SA 3DUFA 3TX2A 3PFQA 1OI2A 4KGZA 2V6IA 4M0EA 1MCPH 1GZ5A 3LFHA 1KTJA 2AEEA 1ZM9A 2OCGA 2ZBUA 2BSQA 3L18A 3E1KA 5KANG 4XXWA 3U4QA 2OESA 4IHOB 1BD2E 3HN7A 1MHPL 4C0SA 4DN4H 1ZA1A 4BNUA 4ME6A 3L4ZA 3WNBA 3DZGA 1T7ZA 2Y4OA 2YFYA 3QNXA 4DEVA 4WW0A 4HKZB 3PB3A 3V7FA 4JKIA 2GCEA 4JZKA 1E4OA 5EN4A 2Z2YA 1IZZA 2DIBA 1JPGB 3V7AE 3LS5H 4PGEB 4QTIH 1HXMA 3JARB 4WHYH 3WRYA 1PDKA 1ORRA 1X74A 1BX3A 2YZ8A 4GC5A 3ASVA 4XO8A 2IBSA 3NX4A 4BUCA 1YMUA 1XGRB 2YPLA 4KGVA 4PU2A 4JPSA 5H4GA 4YJFB 2X5KO 2VLKD 1JH8A 4GDMA 4GL2A 4Z7WE 5F1PA 4WRLA 1H4VB 4B5LA 1B88A 3I5MA 1UCBL 3NO4A 4JBWA 5I9SA 3UL4A 1MPAH 1PZXA 2G5RA 4LSPH 4KX3A 4AZSA 1PLGL 2E27H 2P26A 12E8L 5DD1L 3PZRA 3BWSA 4P4UA 4P3KA 3ZJYA 5JDIC 5JNRA 1ZIDA 4XNYH 1NICA 5JWOA 1U95A 5D7IE 1RWXA 4MKZA 3KCWA 1LD9A 4L4JA 4OI1A 4UQEA 4JFRA 3MPCA 1DOZA 2MNWA 5HYFA 1Z36A 4MJHA 4F56A 5IVPA 3KWFA 5F9FA 2GBTA 5D1ZA 5ALHA 4ORZC 2GZDA 4FJ1A 3S1SA 1JZ8A 3X1JA 3WAGA 2DQCH 4L07A 3IK2A 5I6XC 4PY2A 3C09C 4U05A 3USCS 1G9MC 2NYZA 2H1FA 1KIPB 3VVLA 4E0RB 1KYTA 4B3GA 1G8KA 3S3SA 4LESA 1OCWH 2W65A 1O6CA 1RVDA 3QIBD 3EDFA 43CAB 2DFTA 4DPLA 1P3Y1 4P46C 2CDGB 2GO7A 3L4KA 3UMTA 1CFTB 3T77B 4I77L 2JB6B 5K3AA 5HVWA 1TNMA 2PV0A 1YI1A 3UWDA 1LFAA 4KX8A 2GM9A 5LXTA 4GQIA 3LSYA 3NB0A 3ND6A 4BMZA 2PRKA 4JEMA 2P5EA 2I2FA 3QG7L 3E6FA 4BAGA 4X4ME 2BCMA 4NJAH 3KU4A 4BP8A 1IC0A 4U2BA 1IKFH 4JKMA 3OSVA 1CRZA 5A1AA 3AF4A 3FUDA 2DFVA 4LCBA 3TX4A 2NY3D 3P8ZA 3ZXUB 4NWTH 2WKQA 3W11C 1GVNB 1FDWA 4BFSA 4A91A 4A7QA 5CLLA 4HWBL 4NQRA 3I9IA 2ZUTA 2QKIB 2APFA 1ZM3A 2UVQA 4NSNA 4NNPA 4GL4A 4MZ2A 3E9CA 1XHEA 1M0WA 5MEND 5EHNA 3SGKA 1AC0A 5B39A 2FF5A 1XMWA 1BF8A 3AM3A 3NJMA 4HV8B 4KWEA 1I7ZB 2DHDA 2NXYC 5LWYH 5TSDA 1Q2XA 4M1GL 3DTXA 1IVYA 5ICYA 3U4KA 2ZR0A 4BIMA 1NOIA 4HLUA 3WLNA 4N1CA 4P2RD 1BQ4A 3VXQB 3H9SE 2ESVD 3VI3B 4NB7A 4YFLI 4EH1A 4YXWA 1A9ZA 5FCSH 2C3PA 4KY2A 1O6ZA 4X2UA 3LKDA 2VR8A 1YCFA 3SNKA 4RMTA 4QY8B 5I16A 3TFKD 3GEWB 1W34A 3D6FA 3GLUA 3P0FA 3RRXA 3IP8A 4O02B 1KQFA 1SXAA 4QBGB 4FKEA 4FZEH 4X8OA 4JDUA 4M49A 3FU5A 2I3DA 1ZHKA 1G7QA 3DWEX 1S4IA 2UZPA 3P4MB 1L0BA 1F86A 4UUNA 1U28A 3WKAA 5ILTL 1G63A 5J40A 1JSLA 4UOW0 1B0IA 3PHAA 3KPNB 4WJZA 4P9MH 4R5HA 4U1NB 3QGVA 3ZMRA 5LDHA 3E80A 3MN1A 3KLHC 5HX7A 2IJ0C 1JHPA 1Y1UA 1H3UA 4MR9A 4F9FA 3KG5A 3RG2A 4RJIA 2ATAA 3VR4D 2O5YH 3C2QA 3SICE 1HYSD 3B9PA 5EDSA 3O8BA 3FQUB 4OJEH 1ZLEA 2J3HA 1XCTA 4BIKA 1NXOA 3KWWB 2QAGA 4P36A 3MNWA 1XWFA 1QH8A 2RGNC 3S2ZA 5GQBA 4C5CA 4ZFOB 4U63A 2E7ZA 4JGBA 4UPEA 3WNCA 3RK1A 3FRHA 2CUIA 2DTMH 2I3BA 1HCFX 3MLWL 3RY5A 2QTCA 3D0OA 1WZKA 4ZFZB 3MLVL 3FWNA 2ZJ1A 2SBTA 4FI8A 3NFNB 2ADFA 3ENVA 2HJKB 3KWLA 3PPEA 3EXJA 3HHPA 2Q9AA 1HC7A 5D72L 1XBDA 4MJ6A 1SY6A 2Y7QA 3PGMA 3FO1B 1V8PA 1M83A 4QXMA 4PV8A 5LYJB 1A5TA 2WTRB 1GGJA 1S7CA 4XIGS 2WP3O 2QYOA 2NZ9D 4FQQB 2VG8A 5GZNC 4ZHQB 3AI2A 3L43A 4KXMA 4D9NA 4H4DA 3CBQA 1E2FA 4IJ3C 4F5DA 3Q2IA 2CXRA 2AJYL 4E4RA 2H0AA 4XVRA 2I7XA 3BB1A 2C77A 5GGSY 4IQ4A 3LK6A 2CUTA 3OMNB 4KRGA 3ROPA 1JN6B 3PNVA 1A9OA 2EH8L 3BZBA 1E6JL 2WDPA 3D2UB 3GBLA 3ZKSD 4Q3BA 2CUMA 1JGVH 3GFUA 1P6UA 4HAYA 4NEQA 3BE6A 3MJRA 4MQFB 1DEEB 4G5OA 4PN3A 1ONOA 3COYA 5DK2A 4XX0B 1CLYL 2YVAA 4BYHA 1RQ5A 4D74A 4MHHI 3RTDA 1QGUA 1T9CA 4WV3A 5TE4H 1JZJA 4I1VA 4M5ZH 1TKAA 5L7XH 4PSPA 1ZHNB 4Y9EA 1BA2A 2Q1TA 4OZGB 1MVFA 1GL7A 3VSEA 3SVTA 4M7JH 2CALA 1VG9B 3EWSA 4R83A 3OR7B 2MJLA 3Q1SL 3HCPA 4PS4H 4IYRA 4O4JF 4BNLA 4ALKA 3V0WH 1Y1PA 2X44D 4OTXL 1H6EA 4HHAA 4KV5F 1ACLA 3WGQA 3DX4A 1EEQA 2BY0A 2Z93A 4HUNB 3OX2A 1CIUA 4R90H 4PFKA 5EWMA 1I9CA 3LY5A 2Y6TE 3CUYA 5ADPH 4L8GA 2B82A 1EM8A 2D0IA 1EZLA 1YRQA 4ZTZB 1T4CA 2MTPA 2ORYA 5JW4N 3RFVA 2AC0A 5IBTH 5JQGF 4YHHB 3KEHA 5E00A 3PJFA 2J30A 3CUTA 3DRQA 4K5LA 5HQTA 1P0IA 5AI5A 1IUNA 3AT9A 4KN5A 1TTRA 3GJFA 3DURB 3GT7A 2Y0DA 4BCZA 2ZTLA 1ZSDB 3F3HA 3LQKA 3NHYA 4Z7AA 2CKBH 3RTEA 4Q01A 3ZDEA 3C5XA 2N4IA 3ASUA 3MV9B 2DY2A 5D3ZA 3QELA 4JJHA 4E08A 4GBJA 1QIEA 1UADA 2PW1B 4DV4B 2I6SA 1DQVA 1JPTH 2R11A 3UH1A 1SC1A 4ZW8A 3QVOA 5HMLA 4BKQA 3RU8L 4MD5A 1T0JB 3MSXA 2QLNA 2H2WA 2CKDA 4XMLL 4MXWH 5JXEC 1XVAA 3ZTYA 3LZFH 2WT8A 4QKQA 1ZAKA 1L4YA 4B46A 4X62B 3JWDC 2EDRA 2X4LA 3RWEA 1UFKA 1UC9A 2OTCA 5AESA 2QGZA 3HJAA 5LWQA 4RBNA 4B9AA 2BLLA 3ZJTA 2ESRA 2BAGA 1U7HA 5KOIA 1EAJA 3HG1A 2FZCA 4QMEA 5LMUB 1T0MB 1I8KA 3KLSA 4YHOL 2P9CA 3DHYA 2V7QA 4MQUA 1PG7L 1Q44A 1JKXA 2ECQA 3JZ7A 2F7PA 3SDXA 1DQQA 3SU8A 4PJEF 1I3LA 2KPWA 4Z49A 4F2HA 1KT2B 3TDMA 2LDBA 3HJUA 4BQSA 1CVSC 3BPOB 4HUCA 3MQIA 2VL7A 1PIFA 2F3PA 1HEHC 4ACAA 1GA1A 2P77A 3PKJA 4DNPA 2WXFA 3IF1A 3A1CA 1PFGA 3QCVL 3ILQD 4JFHE 2EC9T 1MRFL 5F9WC 2GJ6D 5F76A 1XIWB 5L88L 5IULC 4KN9S 1UWGL 5C0GA 1U6AL 2QN3A 3RBAA 1EJ8A 3QDAA 1AKNA 1NM5A 4XDYA 1CUEA 3AREC 3QVTA 1GRNA 4MZDA 5IOPB 3C60A 4JBSA 1A6AA 1R3DA 2VVTA 5REQB 4AGNA 1ATIA 4K6HA 1P74A 421PA 5K33A 5THXA 2RKBA 2C5EA 3CSYA 5CM1A 3RVPA 3ME0A 4BS9A 5FUQA 4UFOA 4UASA 3FO0H 2HJHA 3QFJE 1AGPA 4XR8C 4AN4A 1QEXA 4HPXB 3CUUA 4W4NA 2E37A 4J76A 1HT3A 4D9EA 3DUSA 4OMCA 2IEBA 3UMMA 4HCGA 4WADA 3DAYA 3ECBB 4WKXA 4FIZA 4H0NA 1I5OA 4JOQA 3H4HA 1T03H 1UKAA 2FFHA 3FPCA 3AVOA 1CE6A 1DLJA 3SAJA 1GTFA 1R4AA 3GEIA 4BLRA 2HXAA 4QZVA 3GSUA 4YE4H 3MV7D 1E4EA 2EW8A 4TKLA 1JF1A 2R62A 1ZVSA 2A9ML 3NP4A 1FZOB 3QJFA 3HHMA 4BC1A 1U5BA 3D8NA 1T9GR 3NGBB 4O25A 1K5DA 1NYQA 3R9WA 4OSEA 2Y24A 5BVPL 3ZY5A 5TE6H 4L5IA 2Z64C 3QS3A 2EDCA 3LTVA 5EVCA 3Q3GE 1MXFA 4P54A 1LILA 1XL6A 4AYSA 4URZR 2CJWB 4QPCA 1PL6A 3HJRA 2OO3A 1BDJA 1GXSB 4MXDA 3K0AB 2F55A 4O3TB 3GBDA 5BZWA 4HT1H 1Z6QA 3MUEA 2PYEB 1YEHH 3HC3H 3K5WA 1JPFB 3C3BA 2Z31C 1JS4A 2EFDB 3DHVA 2X4SA 5BVGA 3KQUA 5C35A 4FFBB 3L6FA 5LP1A 3BJRA 1BH6A 3WGVA 3CFIC 2X76A 2ZBRA 3U40A 1UXJA 1DFHA 2XLLA 1CQWA 4ZCLA 3DRTB 3TNDA 1V35A 4YJ3F 3QFDB 2BSAA 5C0GB 3VXSD 3F6RA 1YYLH 4YHLH 2QQFA 4K4KA 3APCA 3OQOA 4GR5A 5DYNA 3EXIA 3QWFA 3Q0IA 4XCNA 1EB9A 1I9RL 4F21A 4FQ2H 3LNFA 4CR6A 2DH2A 1YRAA 2X40A 3JV4A 1V9CA 1TJMA 5G3ZA 1T66D 3EIEA 4K0KB 2BFCB 1OAJA 3GQBB 3SC3A 2OL3B 1CICB 3EUAA 4L3CA 4EIBA 4HDAA 4L3EB 1PJCA 2IZ5A 1ZHOA 1KGXA 5SWQB 3Q48A 5I9BA 3BA1A 1TPYA 2EDKA 2W94A 2A4EA 1E1QD 3L4VA 4QHUA 1G6VK 2Z8YM 3HUEA 4JNXA 5K0NA 3GC3A 3T4PA 1JHZA 5LHDA 2AJBA 4U7TB 2W70A 1XL4A 3BGAA 3MCZA 2Z34A 5CB4A 3L17A 4NQZA 2F8OA 4RZIA 5CN2A 1P44A 3QVJA 2CBXA 1TMQA 2GK2A 4HIPA 1RJ9B 3I61A 2MINA 5L8VA 1K8XB 1Z0UA 3HR7A 4R41A 3DAFA 3NIFB 4R8VA 1W581 2XMQA 5C5IA 5E6IC 4BEJA 3RDTC 2EWWA 2J88H 1MQ8A 3QIAA 4NC1C 4G7VH 1OALA 2H1SA 4UIMB 5KSUA 3DVNA 1OAYH 1L6ZA 3UG4A 1FOEB 1QIMA 1LM8V 2DPMA 4ZEVA 4M7LT 5K6TA 5CU5A 3CHRA 1BXZA 2OP0A 4PX5A 1ZS2A 5AUQA 2WSPA 2QQNH 4CLOA 5HYEA 2HVBA 2CNDA 3SYCA 5AOZA 2DFNA 3VFSA 3FOMA 4HD8A 1F9EA 1F4XL 4EJ2A 1YJBA 3ADDA 1AO7D 5HM8A 5FO8A 4TVOA 3BP6B 4KIUA 4EFNA 1MO4A 4D8XA 4N24A 4BPRA 3BD9A 1SXSA 4KRXA 1UB5A 2E4YA 1K7YA 5LCVL 1EVJA 4QRIA 3V8NA 3S3DB 5AVSA 1T4CB 3VI3F 3JQ9A 2X3BA 5IMMB 4XCCL 4EEKA 1RFGE 4FFSA 1YDHA 4CDRA 2VW7A 4J3UA 1KEEB 1JHKL 4JLWA 1X8XA 2EZ9A 4D3ZA 3D6TB 3OE1A 1FMJA 1XEXB 5TXGA 3T1YB 1BQLH 3BERA 2AGJH 3MJWA 4UD2A 4PP1D 1TCCA 4ODTH 1KYVA 1MWOA 2IAAC 2ZUEA 1KDPA 1QGYA 2I7TA 1UQSB 2GYUA 3EJUA 4HZIA 3F83A 3MWEA 2R1YB 1Y3DE 5CS7A 5DTRA 4E94A 2YRLA 3GVIA 4GH5A 4ADGA 3IP7A 3GA7A 3P0RA 3U9LA 2AHIA 3MV7B 1VL1A 5KHAA 5LBIA 2E4XA 3BBLA 4IH4A 4UEQA 1W9MA 1Y3HA 2WZDA 1NM9A 1EO5A 4M4SA 1B23P 3CZ9A 4BQFA 4B0MM 4YT4A 3U7JA 4J3OC 4JR2A 4N41A 3R0VA 1OTUC 4K5OA 5KQGA 2A6DA 3LOWA 4Q4JA 1AQHA 1LB1B 2P5WE 1T2XA 4GW4A 1BFOB 3KZVA 3RRQA 4X6CF 4J7XA 3BDYL 2VRAA 4YACA 3JQFC 1JQLB 4ZTOL 3EZGA 4R5TA 1LP9E 2WAYA 4YBQC 4YHMH 3OCXA 3AS2A 1BXVA 1KN2L 1U8NA 1XTLA 2QXUA 5CVVA 6CGTA 4CQMB 1TVHA 3QHFL 4KU1A 4ZTOH 4ZOEA 2ZIFA 5CM2Z 5MDHA 5DWVA 1SF3A 4NXNB 3AG2B 3BAXA 1UWYA 1ESZA 2HREA 1E9VA 2WJIA 1XTVA 2ZWLT 3N85H 4X20A 4UTOA 3HI5H 1HYBA 3VFNB 3S0JA 5DA0B 1G1MA 4KK9D 2CHQA 3LSOB 3ZV5A 2P8PB 1HM5A 4DV5B 1JWSA 3QJHA 2YAPA 3IEMA 3EBOA 2FPMA 2UY7A 4TTQA 5KSUB 1N6LA 4PBRA 3D0LB 1GQRA 4E21A 2MIIA 3RGVD 3ZWYA 2CJSA 3CH1A 4W9MC 4JL6A 4PNEA 4XD7A 4CVZB 1XJ5A 4MQMA 2B99A 2YJGA 4D4HA 3E8UH 4PIMA 2AABH 1DE4A 2VXVH 3MR9B 2HEIA 1GDDA 2P9HA 4MRPA 2GEDA 2DECA 2YW9A 2FJFA 1FA9A 4YV2A 1AG0A 1EUTA 4AJ2A 1N77A 2HPOA 4Q21A 2ERJC 2VO5A 5ITFA 5CK5A 1Q83A 1D5MA 2WIKA 2ESVA 5DNVA 4M3KB 2ATKB 1KH2A 3H84A 1TFUA 3T5CA 3WJLC 1U2PA 2MYUA 4W7SA 2ZK7A 1NUGA 3JALA 5HUJA 3PL6D 3T9EA 3KYKL 2X1PA 4ZUVA 2RC5A 4E33A 5C2JB 1GGIH 3ZW9A 3VH2A 3F7VA 4JO1H 4J1TA 5GADl 2QV4A 1SY6H 3OEYA 1FAKT 3V9FA 3FGOA 2CDEB 3HUJB 5ESRA 3QIWC 4CKBA 1R0BA 1JZ4A 3T7CA 3AWEA 4PGMA 4ZAKC 1DAFA 1E1QA 3P71T 4EOGA 3ZHLA 3CZ5A 4OHOA 5EOTA 4Y6QA 4H2DA 1XF3B 4OVVA 4DH2A 1A8PA 2VZLA 4WLCA 3ARGB 5CA0F 1JPFA 5EJ8A 3WUZA 4KI5F 3RC9A 4Z9BA 3TBSB 3P7MA 3GU3A 3AY3A 1R4NA 1EJOL 3VHLB 2JDIA 3RRJA 4P4NA 3DKPA 3BXGA 3PGCB 5C7IO 3CMGA 4GRWE 4N2EA 2ZXWB 4GZ5A 4PC7A 1B9KA 4IJWA 1G0NA 3PWPB 2RARA 3R76A 1YPZE 4GOND 1X1QA 5AVXB 1HE7A 3IDIA 1G6HA 1ZC3A 3WIHL 3OFKA 4UHCA 3V9PA 3RCBA 3HL4A 5BUSA 1QOQB 3C5EA 3ESZA 2YIVX 2DQZA 1NMXA 1J1ZA 4QUDA 1I51A 4DCQB 2AJ8A 4MXQD 3RWIA 3ZCRA 3LKRA 4EO4A 5LC1A 3TPUB 4EUPH 1DC5A 3IQDB 5EO1A 4EG8A 4BWYA 3ZY4A 5IIEB 5CGZA 4D3DA 4RYLA 3JQBA 4LJAA 1OE1A 1OQAA 1IUPA 2R1TA 2WK2A 4QUEA 4Y4HA 3AL9A 1OB5A 3ON5A 2VYND 3GFFA 5ANMB 4LZAA 4LCEA 4XMUA 3N53A 4TLBA 2LCQA 3OE5A 5KYXB 2NXNA 1P62B 1YYLL 4O2FA 2WMPA 1LVGA 3KJ6L 5BW4A 5GWXA 1PNOA 2G4GA 3MT8A 4BB6A 3QVVA 5D1QD 5AWFC 2ESVB 1UDBA 4AIZA 3FNBA 1U30A 2RHMA 1KTKE 4HHWA 4MJJA 3ND9A 3U7GA 2CGEA 3PC2A 2NY3B 4EDXA 2JQZA 4IIXA 4GI9A 4BK8A 2OYCA 1OWNA 2ORBH 1MREL 3RX8A 3JD4A 1K86A 1TF2A 5C3UA 1EHLH 1C3OB 3IHKA 3N9IA 4PR0A 4LVOB 4X7RA 3BGFC 3PP4H 1J2UA 4UQOA 2YYAA 1EVQA 5K3DA 4L75A 4OHZA 1E2VA 1CXFA 3E84A 3FD8A 2J8UA 3CIOA 4L4TE 3IBCA 1IB0A 4EGAA 3EMVA 4IDLA 1RNLA 2WYHA 1X0XA 4IJTA 3D8HA 1U8EA 4E2YA 4YVNA 5EMNA 3A9RA 3CY6A 4NNYA 1U8KA 3K0WA 2H1IA 3E9ZA 1C4XA 3OJWA 1EFXB 3QJUB 2O30A 4Q34A 1GAFH 3FYDA 3GRWH 1TD1A 1KGDA 5EC1B 1Y0BA 3G5XA 3LC7O 1JL3A 5EEYA 4HAWA 4NDMA 4JB9L 1A9BB 4QATA 3GSRB 3B5HA 2Z7ZA 2XOKD 1YQGA 2O07A 1Q38A 3FRUA 1VPEA 2NTJA 2BI8A 4HQ0A 1NP3A 2CEKA 2A9NL 3ZEIA 4UMFA 3P5SA 4GX1A 4GMHA 4XP5L 1H5QA 4OQYA 3WZMA 5HVHC 4PY8J 2BWJA 3HZHA 1WB4A 3VO9A 5B3KA 1BTOA 4BMDA 1E90A 4OBSA 2GQ0A 2GKOA 4S10A 4LEOA 5FYLE 5K3BA 1R0KA 1QG2A 4GRLC 1SBNE 4F11A 1EX9A 1G20E 3E1F1 3CLSC 3I6KB 2CGRH 2B0SL 1SCJA 1MZPA 3DNKA 4HUUA 1M33A 3A6EA 5AB2A 1ZI8A 4G1VA 2BEUB 1BBDH 3IILA 1QQDA 4ZK6A 1QFWI 1OLOA 1CT8A 4Q4CA 1RC0A 1VYHA 1QC5A 4OI9A 4LY3A 4JLNA 3TLCA 4EB0A 4KL8S 3DKIA 5SY9A 4GF5A 4DPMA 1M0SA 2F7QA 2X2HA 4KLZA 2HKHL 3TD6A 4LP8A 4MEJA 4Q7MB 1C7JA 1HMYA 3VQMA 3KCPA 1GA6A 3NTRA 4GW1B 1UZNA 3GLFE 1VRWA 4QRRA 4E5MA 4J12A 2R86A 4LRNL 4HPWA 4II2A 4S35A 4X60A 1NFFA 2Q3CA 2RHWA 4M98A 4QJIA 2IT1A 5E4YA 2QNBA 4Z6AT 1EMDA 1NRWA 1TYCA 2AH5A 3VWJC 1OC4A 5JVDA 2Z4QA 4WIQA 3LG2A 3QYNA 1LGYA 4D97A 4GS7B 3KOYA 5K0EA 1NKSA 1NC3A 2XFXA 3NV7A 1GP2A 4B0PA 1KY5A 2EWMA 4L50A 2PETA 2OECA 4OXNA 4F8LA 3P2DA 3ECCA 4KXBA 4LOKA 3B9KB 4DGUA 4WBNB 2AI0H 2XDYA 4M9UA 3ZXYA 1N4XL 1U0EA 1FUIA 2J1ZA 4PCYA 4Q6IB 3MLZL 2EDLA 3CZLA 1YC7A 4WW2C 1N2OA 4FTVD 1N5YL 1JI1A 3ROGA 1MORA 3RU8H 2KH2B 4XNUL 2YOFA 5CD9A 2OMZA 2XG4B 3V80A 4PNHA 4RESB 1RCUA 2VE6B 4UF7C 1CYDA 3BPLC 4RDQG 4Z4QA 4NERA 4NDNE 4PLFA 2OZPA 3PAUA 3ILVA 4LI3X 4R0NA 5KVFE 4R8LA 3Q6FB 4YAOA 1N0IA 4OHUA 1A9XA 3UYPB 3CD4A 4Y2JA 4FQQA 2Y1ZA 2ZKYA 2DUWA 5FTLA 3TYGH 3WS6A 3OEED 3HRHA 4NFDA 1U2GC 5I75C 2CXGA 2B5IB 1GD1O 1ORSB 4A8JA 4DLNA 5JPNC 5KJEA 5I1AB 1JEAA 1ZD4A 1E1LA 2R4RL 2V8OA 3IXQA 1T2QL 4GW5B 4MJ5A 5A06A 1RQ2A 3QWIA 4IMKA 5AVJA 2YMOA 1EFAA 2Y1CA 3L6DA 2E49A 5E6IB 1H2AS 2WFLA 2CBMA 1XEUA 4Y4KB 2FN7A 3FCBA 2YKKA 5KDDA 1R50A 5IV2B 3ULUH 4PRNA 1WBDA 1T26A 4LKRA 3TQRA 1F1GA 2D4AA 2CDNA 1CERA 1X7QB 1IN5A 3CZSA 4ENVA 4NBWA 4LCCC 4M53A 4XYGA 4L5AA 1HUQA 2J8UB 2VBFA 5DZSA 3WS3A 5LZ5A 5JSQA 1OH7A 2XWEA 2RQEA 1JUDA 3CDGA 2AS5M 3HKBB 1U65A 5D1XB 3OKWA 4ZVMA 2E46A 4IXWA 1Z9BA 1UUNA 2JC3A 3H7LA 1OLSB 1GGNA 1M2OA 4O59O 5DHVB 4P57A 4KWCA 3VDXA 4GIAA 2DQSA 1SLUA 4QA9A 4HL6A 4JYAB 5I1LB 1D7AA 4XB2A 2FZWA 5CZKA 1KKLA 5EJGA 1M8PA 4B4VA 1GHFL 3A24A 1I75A 3L46A 4RBPK 1MRSA 4HUVA 1HYGA 3HP4A 5DMIH 1P4LA 3A58B 1SXHA 2VHUA 2PUBA 1IU1A 3BKJL 3BRFA 3PQ4A 3GEEA 5C0DA 1QBML 1G1KA 4K94C 2DHCA 5IVXB 3HUUA 4B6OA 3UAJA 4O3FA 1JJIA 3M4XA 1FXUA 2APXA 1QH1A 2PGIA 5IBPA 4N0UA 1N19A 4PI0A 2JLAA 3STTA 3DO4A 3ZGIA 3NJXA 2BCJQ 4YUEH 4Q3KA 3K0HA 5IT9A 1Z29A 4F37K 1YR8A 4OJFH 4WTOA 1WHTB 3N43F 3IDSA 3KJIA 2WUGA 4FMDF 9MHTA 4Y8VA 3W5HA 3QEAZ 1BKDR 3CWZA 1FRGH 1IM9D 3L3OC 2F2TA 3DV2A 3OLVA 1MJ8H 3A6ZA 4PGFA 2GM4A 2P6PA 2DICA 5FFNA 4MVXA 4C0AC 2FGWH 4AJ0A 1NNSA 1UMDA 1H8LA 4IEIA 3RJMA 1UBOS 3S8MA 4RU1A 3V1MA 4ZI2A 3OJOA 4G0PA 2HVJA 1E2DA 3B5JA 1VKXA 1AOXA 3RFTA 1CP3A 1YWGO 3WGJA 1W8EA 5ILTH 4MB5A 1KH3A 4AENB 3D4CA 1DVUA 2CHFA 5IHWA 5HD8C 3MBWB 5JAMA 4MJ4A 3RZCB 2JLWA 3M1BB 5J1AB 1KBOA 4BTLA 3RI5F 4HGPA 4YAWA 4YMIA 3PGDB 3CQPA 2WPDA 2L7QA 4Z8FL 4NKMB 1HDMB 4EAEA 5EZOH 1U8LB 3F73A 2NO9A 1IAKA 4WFHD 2BMAA 1Q3KA 2GOYA 1ETZB 3EWIA 4X0NA 1YKGA 2GVZC 1XV5A 4KACA 3HE6A 4P5DA 5FUCE 1RZ7H 1E9FA 4QUJA 2QLMA 5B4UA 2LAAA 4E3WA 4CGZA 3HPJA 2X5NA 3BIXA 4MWCA 2HMYB 5DZVA 2IXTA 1OTYA 3BC1A 1JFQH 4WOKA 4N3CA 3JYBA 3MLSH 1GR1A 2ZYAA 3LQZA 1F1DA 5DCWA 4N3NA 3MINB 4AM0B 2GN9A 4N26A 1U3HC 1JL8A 3C85A 3NCFB 4AJNA 5LJYH 1NSNL 1W4AA 5DWUL 1BWSA 2FX8L 4W63A 1I30A 5EBWB 5EAIA 1ZIBA 2H5UA 4Y7CA 1RZGB 4KI5C 2CIKB 2BONA 5JHLA 4UOQA 1UB6A 4C0HA 4BGDA 3G6KA 4ENWA 2Q86A 4HUWA 3CJTA 1NRJB 4J1SA 5IB5A 4RPIA 3VE0A 3QUXA 3QIVA 2XNCA 5D71L 2IKSA 3KXIA 5JEEA 1H3TA 1VGKB 3O03A 5ANRB 3D0VA 1H3XA 2REXB 3D1JA 3U5TA 1FNEB 2WC7A 1H42A 3F3SA 3MOAL 2DOCA 5EU6A 3PWUB 1TVHB 3D6NB 4PRKA 4DIOA 3A67H 4Y6GB 4UU7A 3D6GA 4JB8A 4I5IA 3TEXA 3E3OA 1AN9A 4YVFA 1DEKA 2XVMA 2GASA 5JALA 3E3QC 4NX0A 4R2GB 3K3QA 4E5VA 2WHQA 3N91A 2AF3C 2DKUA 1EMTL 1MVUA 1KWKA 3OZXA 3OPYI 1COZA 1ZS8B 4JDPA 3IGFA 5IKMA 3FRPA 2TYSB 1XCJA 4DT1B 5LN1A 3H85A 3I64A 2WEKA 5FK9A 4D0CA 2R83A 5J4VA 2YUWA 4I5FA 4YK4C 3A6BH 4KQHA 4LXUA 1FBIH 2PYIA 3TF5A 1YY9D 2BZSA 3TZCA 1RHMA 5DHVH 4KNUA 5K0SA 3PJNA 5E08L 2NX5D 4GAEA 5C0OE 1A6VL 2J4CA 3RVWD 4MMXC 1T8TA 1DDOA 1FRVA 3VNRA 3A21A 4L37B 1THTA 1ECFA 3DPBB 4FGZA 1JBQA 4KTYA 3LCUA 4FT2A 2VISA 3AGWA 4FLMA 4ZC1A 2FRGP 2GZAA 1NAMA 4LF5B 3T94A 3IP3A 3LUAA 4CUKA 1GSKA 1CUGA 1KY3A 3DBLA 3EIUA 4X6DB 4F6RB 3VQ2C 5IBUB 5DU7A 3MGKA 4ID9A 1XQVA 1CT9A 1VFPA 3EDMA 4XVCA 2CXUA 4CM4B 3H5LA 1WXHA 4NV0A 4GLBA 2HJFA 4RMUA 3X1NA 5INDA 1NUAA 3MV8B 4Z7VA 4KDTA 3M1LA 2FFQA 1II8A 3EO1B 2DKOA 3DUHA 2OCJA 3J7TA 3QXCA 3C7TA 5LJIA 2WYVA 3BHBB 6CHYA 3WRWA 4WD3A 5C2BL 1MCPL 4D0BB 2B77A 2WQSA 3NTQA 5LN4A 1OH5A 3V34A 1SG0A 5PCYA 5I0DA 4M8QA 1A2KC 2W0LA 2C3GA 4YEEA 4UQ3A 3I9LA 2QSUA 1HDMA 4CN8A 4I87A 1ULAA 3B2DC 4KE8A 2HNKA 4P22A 3ZN2A 1YB6A 1PG5A 3E23A 2QLJA 4D9KA 2EAEA 1R75A 1FDVA 2WKGA 3FUIA 4G25A 3T3DA 4DZZA 5DRNB 4BSVA 4JDVA 4MA7H 4MYRA 4X4MA 5DYTA 5HOQA 1I33A 2VO8A 2EF0A 2PPLA 1YR9A 1NC4B 2WZ6A 2ZTHA 3UJTL 2XUOA 3F7NA 1K85A 1MDTA 3KJ4B 2MT9A 1SBBA 2NPIA 2X2EA 4ZQGA 4YZWA 3KV3O 4KTGA 2HJWA 1ZT1A 3QRBA 3BVWA 3QUKB 4BA8A 1NG1A 4GI7A 2ICEA 1ZRHA 1N26A 3WFCL 3HE7D 3S96B 5TGZA 4A68A 2QMEA 4Y2GA 3KQOA 4D9RD 3S1AA 1OV6A 4RA9A 1WTGT 5DDHA 3SODB 1YRKA 4KYTA 1J5EB 3OJDA 3DYBA 5DHPA 2CRMA 3KCNA 4QLBA 2X0EA 1ULSA 3QQ9D 4FHZA 1D2NA 3X1ZA 2FB4L 2WD0A 1BHJA 2BW0A 4QHLB 5AP9A 2OSBA 2VIIA 2H2PC 1P7HL 4ZMQA 1U93B 1V3VA 3E0QA 5F7HA 3NDYE 4P3WA 5LQUA 5DISB 2PCJA 1FFHA 2CLRA 2R8OA 4I2XE 2H2SC 1UWKA 1Z6XA 2H9GA 4DKXA 2JEZA 5B37A 4URTB 1RJYA 15C8L 4MUHA 3VM6A 3WKQA 2YZ1A 3TZVA 5T67A 1TU2B 1GKYA 5HJ3A 2WMNB 1E3WB 4MRMA 2Z91A 3MHZA 2PZFA 3LX4A 3LNEA 3OL2A 4IRMA 1QRSA 3I37X 2E0IA 2HGZA 5K0FA 4WTWA 1A1OB 1G5IA 4LVEA 2DBJA 4XCYA 1OX5A 3RIYA 4MCJA 2FMKA 1H05A 1QP7A 3KKEA 4JRXD 4PRZA 1P5HA 2OTWA 2AVNA 4K9KA 1O96B 2ID7A 1ZIAA 1OD6A 2JFBA 1JEOA 5KOMC 5D1NA 3O3AA 2HLAA 3N40P 1DXHA 1RAFA 3UJPA 1LSUA 4R96A 5EQFA 2E9IA 1QO0A 1RZ3A 1Q90A 3RJQB 3ZVLA 2Z2KA 4MJ3A 2ZJ7A 3NCTA 2YN4A 1BQ3A 5IQMA 4GS7C 4PVNA 3IVKB 3B5GA 4WOCA 4F58L 2GFQA 5I66B 5DE3A 2NADA 4UNUA 5IMKB 2X7LA 1LRJA 4U39A 4NQUA 1IPEA 4G9FB 5J23A 1WQVT 5KUMA 3B38A 4O2CA 2KB0A 1Y42X 1J9CT 3NI2A 4O3MA 3X1KA 2CDGA 4N5IX 3MJFA 3K72A 1F11A 3MWLA 5JHGB 5GJBA 5H3LA 4MWOA 4NZ8A 3CLEH 4XGKA 2OM6A 1VGQA 2GK4A 5KCZA 3R8CA 1PT9A 1Z32X 4L4VA 3P9NA 4PRYA 4WUUB 2XUAA 4WBSA 2K9UA 1OTXA 3IRUA 3CVOA 4YJGA 4UVEA 2YWEA 2Y1OA 2FEAA 3GJ0A 4FE3A 4DXHA 4F2GA 3T0EE 1FK8A 4G6AC 4LGPB 2A9BA 3AIOA 2VERN 1KOAA 4LCWD 2O0LA 6FABH 4M7OA 4QHNA 4LHYA 1A6AB 1R18A 4NQXB 3WLAA 3CUSA 1XVIA 1J0IA 2X4TB 4GSXA 2XLCA 4EF3A 1PF3A 4MW9A 4JM0A 3V2AR 5D3MA 1IX2A 2QBYB 1E4KC 4BQQA 3TVMD 1LO4L 2K70A 4EA6A 4HNVA 1UEIA 1M9WA 4JITA 3N8GA 1RZGA 2O6FA 2QZ9A 4X45A 4O51A 3JV0A 5DHUA 4C7MA 2XOXA 1PEDA 4KKPA 1JIQA 3N42B 4Z9KB 3W0WB 4WOJA 4NBVA 2HU2A 4BZXA 2XVGA 4ZUUB 3KZ8A 4ZT6A 1GVHA 1JJFA 2P79A 3A2NA 4H8VA 4WDQA 5CEYB 4PQFA 1I3UA 4WWKA 3Q8FA 1Q0XL 5HHMD 2GAAA 4L48A 1BMTA 1XR8A 2M1XA 4PJ5D 2I22A 1BZEA 3HCRA 1PCSA 1GPAA 1HH9A 1JK9B 4ZOLA 4DPKA 5BWMA 1CWUA 1NOAA 2QGDA 3SJVE 2GCOB 1JPUA 1I4TD 3WJ7A 1QZ1A 2HVKB 3GLFA 5E0KB 2NY2C 1KEML 2JFZA 4Q3AA 2J0UB 3LRSA 4JCLA 4RWEA 1N2RB 1QDEA 5TT0A 2ZOWA 5DXAA 3IMVA 4PG9B 4R8WL 3SKYA 3K70C 5E6RA 2WJ3A 5J3HD 1NSYA 4JNCA 4X44A 2OR8A 3WGKA 1A1VA 5KAMA 1AC5A 2IPTL 3AP2A 5J6HA 2NY6D 3BZWA 1C9JA 4YHPA 1DANU 4ZYXA 2Z9DA 2ILVA 1XP8A 1HE4A 3UHOA 4CM3A 3ANNA 2EH8H 3WO3B 2C58A 2AN1A 3S3TA 2BOCA 1W6LA 3VFPA 5HCUA 1TKWA 4PGZA 3G5UA 1R46A 2EXWC 2Y3IA 4I3RH 3X17A 5FTWA 3D1VA 5A40E 4XP4H 4HWZA 4L8SC 5KS9A 1DUZA 4QTTB 4YGVA 5FFFA 3D39A 3ZHKA 1WU8A 3GXMA 5IRCD 3Q8KA 1QX4A 3VI4B 3ONVA 1N67A 4NKDB 5JJLA 3TMYA 4UT7H 5BURA 4N0QA 2OVFA 1LV8A 4TNFA 2RGGA 1LEGB 2FGZA 2Y7LA 1NOFA 5KOYA 1YU9A 4XJVA 2EP7A 4P5TB 1GNRA 1P5ZB 5FYDA 3EWAA 5FFOA 1MVUB 2GAZA 1Y5LA 3GBML 1A9BA 4GKNA 3SD5A 1RAGA 3DLBA 2FUQA 1G1OA 4KQ3L 3LY8A 5ANHA 3B70A 3WJLA 4D45A 5KZCD 2I1LA 1EQUA 2ZUBA 1W85B 4P83A 1QO3B 2OCCB 1LNSA 4P35A 3OKEB 2HFEB 2AOUA 4AVKA 1BXGA 4XVUC 4GG8A 2D4DA 4XCEA 4QUGA 2HLDD 1ULTA 5H59A 4AV4A 1P2DA 1J11A 3MGGA 2X3UA 5JA9A 5IB4A 5HI5C 3PHSA 1JFRA 4IU2A 2H16A 3OC6A 5J4LA 4EN2A 2ZD0A 4IV8A 2GLXA 4ZX4A 3BH7A 5IN4A 1TU4A 3UAEA 4K9DA 5JQIB 1CUXA 4M6AA 2C4KA 4JS0A 2VWEC 4KSYA 4G1MA 4YT8A 3LKQA 5E1BA 4EB6B 5F0LB 4WFGD 5D70L 5ITFB 1GPOL 5DZAA 3T09A 5HK9A 4PYHA 4RFNB 5T8IA 3N8DA 5IAJA 1U8CA 3V8OA 1Q0PA 1ZD6A 3PQDA 1AB6A 2HDWA 1NLYA 3GJZA 2X1OA 2UWEF 3EJJX 5JNVA 2XTJC 4C0XA 3PNWB 4Y4FA 1YSOA 4LYYA 3BW9B 3C1AA 5TQ0A 3AUTA 1JXJA 3U61B 4ZOLB 2Q4OA 3CFEA 5C3TA 2I87A 3EF0A 4O63O 3OOHA 4H1LA 2PABA 5FYKD 1OGJA 3UK2A 4ZVPA 3A8TA 3WWZA 1D3CA 4HF5H 4R7DB 4W5NA 4ALMA 1MX1A 1XRNA 3KKLA 4XP9H 2VRNA 2R27A 3L1KA 4CQMD 3BK1A 4GI3A 1Z37A 4QOIA 4ZUUA 2J3SA 4KJWD 3BUQA 2HKAA 2ORBL 2UXVA 4ZOAA 4BNNA 4MV4A 1NIEA 2VXTL 4LV5B 4LZNA 1MWAB 5ADUS 2DWEA 4HADA 1Z7YA 2PR2A 2QADB 4TRJA 2ODBA 2HUPA 4CIAA 2QBYA 1GY1A 2YAFA 3VPSA 1JHMA 1SYSB 1YPZB 4AJLA 3U4EB 3RS4A 4ACBA 3ELYA 4MQXD 4RZ3A 2DMGA 4G37A 4QHNB 4H6PA 1U2QA 4PG5A 3IMWA 3PEFA 2YDXA 3UEOA 4RQQB 3WV5A 4CKEB 4AJKA 5L7YA 4MMZA 1Q1EA 2A9QA 1WS6A 4I9NA 3FMFA 4OQMA 3Q6FA 5HJEA 2Q3HA 3PUHA 4OLYH 1IE5A 4DCOA 4OB6A 1ZHKB 4XLTA 3NHJA 2Y0SA 1DKRA 4WU7A 4PPNA 1D9KA 3KZCA 3QKSB 3HUJA 5C86A 1S9WB 1PG0A 4FMCB 2JCGA 4EI8A 1SC6A 1EK2A 1AHPA 1O9WA 4R2LA 1G7HA 4G9FA 4OA5A 1I5EA 2WQXA 3IOMA 4B76A 5D1QA 2DQEL 2I1WA 4PLKD 1E5QA 4CF4A 5KWIA 5JA8B 1UQSA 1CKEA 5JD5A 5FKPB 1MCKA 1H3WM 3HXLA 4GZMA 2HB6A 1IZ0A 3AL0C 4YJHB 1QNFA 1RVFL 1MQKL 4HEHA 5LNDA 2CA4A 4ZOCA 3W3AH 2HJVA 4YLQT 3V52H 1AZCA 4FFYH 4KXUA 4DNFA 5LZ2A 4F7WA 2O8CA 4D9FA 4Z0XA 4Z76B 5ALRA 4IOMA 3ASWA 4ZAFA 2Z7WA 5DX1A 2I2CA 3RUGF 1IE4A 1CF1A 2BNQE 4BHUA 3ACBA 2EDFA 3U4IA 1GKIA 1AHWC 3BZFB 5DRXB 1WKVA 3IHTA 4X1OA 5TVKA 3ZE8A 1KFGA 4L9LA 3K4PA 3DAGA 1DBKL 2LABA 4FLHA 4XBGA 4LLWB 1BQHB 4P58A 3A6CH 5B22A 1W1IA 5CEXB 1KFAL 1JYFA 3Q06A 3QDHA 4P93A 1RJLB 2J20A 1ZH8A 2MSDB 4Y0NA 2JSFA 5CNHA 2X2FA 3VM7A 1CGUA 3UG3A 2EWVA 4PLYA 2E4FA 3PUUA 1OGPA 1W1WA 3TO5A 1TVBA 3CXFA 4P1ZA 3CK0H 3U1SL 4MCIA 2GEQA 1QHSA 2POCA 3RU2A 5IM7A 2Q5LA 1X8KA 2QR3A 3E38A 5J59A 1M7BA 1P2TA 1FVCB 4QQKA 4PJFF 4DGQA 4R0VA 2CVOA 2A4KA 3DBIA 4KAAA 4JYBA 4YUWA 1P6QA 5ITBL 5FC9A 2QYSA 4TRPH 3E6HB 3VPFA 1QRNB 1G3QA 3LZFL 3QUYA 3AHCA 1Q50A 1HL5A 1BVKB 3P4NB 3IFPA 2AJLI 3CR7A 5BV2P 4YXHH 4Y1AA 1V48A 5M2QA 4JX9A 3ZWOA 3SKJH 3I3DA 4GBXA 3UBXA 4ELDA 4X9IA 2I3AA 5ICGA 2AYYA 2XG4A 2I33A 5AZ2H 2XGJA 2ZSDA 3INUH 3BF7A 4C56B 1O0BA 2LXNA 1VFBB 2JVUA 3HYLA 3PP8A 5IQ9B 2ARJA 3T9WA 2DDQH 5BT8A 2Y72A 1XCBA 2ALJA 5EFIA 4KJQD 3TV8A 1BFSA 4CCYA 3OKYB 3EH1A 5GHWH 2HXYA 3GB7B 2Z8XA 3V6LA 5F7DA 1PDKB 3IGLA 1ISRA 2QE6A 2PGXA 3CO0S 4IJKA 3TOXA 5C09E 1EANA 1KBPA 5AXCA 4MWSA 3FE2A 3PXDA 4WQOA 3ZZTA 1U94A 5BZDB 4NBKA 4P4RB 3U6XA 3NA9L 3OZVA 1NIFA 2Y3AA 1Y1SA 1ICIA 1I9GA 2QMJA 4AG3A 4Y88A 2FX7H 4WO4A 3TB6A 1E9PA 1TAQA 4HJ0D 1Z0FA 2C3VA 2NZIA 3I2FA 3A5VA 1QORA 5E95A 4L9AA 1OBFO 4DO6A 6ADHA 3ET4A 1TC1A 1QMGA 3CEMA 2EKPA 1CLZL 1KC5L 1FMTA 5A62A 4RIRB 5DLML 4OGFA 4ODTL 4RD6A 3C6LC 5JG7A 3T6QC 2G04A 3RYFA 2ZWKA 2OZEA 1XGUB 6GPBA 2JAXA 4G85A 3Q88A 1XZLA 2X4OA 2VRCA 4E1VA 4JJ8A 4HH8A 3HFMH 4U2CA 1EFKA 3IGAA 3E2PA 2AZMA 3IAS1 1QABA 5IH7A 1GADO 2HKFL 1NINA 3HWSA 2YOCA 1G87A 4FOTA 2CUKA 3V0HA 1QG4A 1D6SA 1RLOA 1TM2A 2R6HA 1V8OA 5DTEA 3IDXL 3PUKA 1J09A 3A27A 1CFZA 3A3YA 3FFCB 5DNCA 4CMKA 2VKXA 1ADCA 3PJGA 3QR1A 3S1LA 2NO5A 3CN2A 2PIAA 3CGWA 2F59A 3GPBA 1S2NA 2H6PB 1I1YB 4J0CA 2O5CA 2ZRHA 4IHAA 1LNUA 2ZXFA 3BGFB 3U25A 4X99B 1XZFA 1FFXA 1QWNA 1ECJA 5IJ0B 3VD2A 4HZLA 5D5ME 1A4IA 2UZXA 3CHPA 5B7FA 1DX6A 2VLMD 5BSMA 1QSFB 3D0RA 1R4NB 2E7LC 1TEHA 4R7ZA 4PEVA 1HGXA 1O95D 1UANA 1KAEA 1EBUA 2JHGA 2EKSA 1AIZA 3KJHA 4BFVA 4JP1A 3FHQA 1A02N 5A0TA 1PWZA 2BR3A 1V9LA 5F7OA 2J5LB 2AJUH 5EOCH 3N1FC 1IK6A 2OW7A 4XAKD 3WRYC 4L3CB 4P3YA 2FEEL 3IXMA 3G1UA 1ZUD1 4LMBA 5D7LE 2VSOA 3KSDO 5EZLA 1T20A 4G9BA 5TE7H 1CULC 3U3ZA 1P2CA 4P5TD 2Y1XA 3PDIB 5CEZH 1X1TA 3PYMA 3HCWA 3WLWD 1DN2A 1KPGA 2WAQA 2IDFA 3QUXB 2MCFA 5HF9A 5IB5B 2J7KA 3NJIA 1P8JA 1T1SA 1KJWA 4MIYA 3IN0A 4BGEA 4D4MA 2WNXA 3RP1A 1DE0A 2QLFA 4J6RL 5BV0A 1RPAA 4I5EA 3LVQE 4K55A 1C4WA 2WBJA 3ZUNC 3GG9A 2X22A 1J9SA 1J0YA 2EU8A 1AS0A 5LQKA 1B14A 3N74A 2GNAA 2J8HA 3FRIA 5JXEA 1UH4A 3MCYA 4E36A 1MH1A 2X89D 4QXQA 5IBRA