1TYEB

Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
440
structure length
440
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Integrin alpha-IIb
publication title Structural basis for allostery in integrins and binding to fibrinogen-mimetic therapeutics
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 440
sequence length 440
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 1tyeB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 1tyeB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1tyeB03
1RTKA 4HQNA 4CN9A 3K72B 4BJ3A 4JX0A 4UM9B 5KYUA 4O3TB 3NIGB 4O3UB 3EH2A 3M6FA 2X5NA 1ZONA 1ZOOA 3N2NA 3ZDZB 4NEHB 2I6SA 1M1XB 4JDUA 3EG9A 3EGDA 1AUQA 3PPXA 1MQ8B 3E2MA 1LFAA 3OKWA 5E6SA 1M2OA 2VDNB 3OKYB 1N9ZA 3V4PB 4NENB 4MMYB 1SHYB 1V7PC 4CN8A 5KYYB 4C2AA 2NUTB 2M32A 5HDBB 3AL8A 3EGXB 5HGJA 3T3MB 3ZE2B 3EFOB 4MMZB 4HQFA 1CQPA 1PT6A 3F78A 1PCXA 5HJ2A 1XDGA 4G1MA 1QC5B 1AO3A 2VC2B 3IJEA 2B2XA 4F1JA 3FCUB 4WJKB 1XUOA 3EH1A 4O02B 3OL2A 1T6BY 3T3PB 3BQNB 1MF7A 1U8CA 1ZOPA 3PPWA 2VDPB 5E6UB 1L5GB 3F74A 1JEQB 4Z7NB 3AFCA 1MQAA 1M2VB 1QCYA 3TW0A 4IGIA 1CK4A 2ADFA 5E6RA 3BN3A 3K71B 3K6SB 4CNBA 5KYNA 4G1EB 1SHUX 2I91A 2P28A 4HQLA 1M10A 5KYYA 2NUPB 4NENA 4Z7QB 4Z7OB 1PD0A 1DZIA 2VDLB 1M1UA 5KYXA 3GXBA 1JV2B 4WFQA 3HXOA 3EFOA 3TXAA 1JEYA 4FWWA 2WINI 5KYWA 4FX5A 2WW8A 4WK2B 1IJBA 2UZYB 4IHKA 1RD4A 3ZE0B 3IBSA 4A0QA 4DMUB 4MMXA 2VDQB 4K3JB 2I6QA 3ZDYB 3EG9B 3EGDB 3K72A 2ICAA 1IDN1 3VI4B 1OLZA 4IXDA 2P26A 4GZ8A 5E6SB 3FCSB 3TVYA 1PD1A 1SHTX 3NVQA 3Q3GE 4M76B 4C2BA 1M1XA 1U0OC 4WK4B 3ZE1B 4WK0B 3AL8B 2O7NA 4F1KA 1MHPA 4HQKA 4HQOA 3V4VB 1RS0A 2QTVA 2XGGA 4G1MB 1AOXA 1UEXC 2NVOA 1XDDA 4MMYA 3EOAI 1YVRA 1RRKA 4C29A 4UM8B 2VDMB 1U0NA 3ZDXB 2NUTA 3IJEB 3EGXA 3NIDB 4MMZA 3NIFB 2VDRB 1TYEB 3OL2B 1QC5A 5KYUB 1U8CB 3AL9A 3PPVA 3BQMB 1NA5A 3PPYA 3QA3E 1BHQ1 1MJNA 1MQ9A 2VDKB 2XWBF 2XWJI 1YUKA 1OAKA 3ZQKA 4O02A 5E6RB 1ATZA 3RAGA 1DGQA 1SQ0A 5ES4B 1N3YA 5LN1A 3EOBI 5E6UA 1L5GA 1JEQA 3FCSA 1FE8A 1JLMA 2ODPA 1M2VA 1YVPA 1SSLA 1T0PA 3VI3B 5KYXB 3K71A 5BV8A 3K6SA 4UM9D 1IDOA 4XW2A 1JEYB 5KYWB 2IUEA 4G1EA 4PN7A 3TCXB 1Q0PA 2NUPA 1IJKA 3HXQA 2VDOB 2ODQA 1BHO1 1FNSA 3HI6A 1JV2A 4MMXB
chains in the Genus database with same CATH superfamily
1FRGH 3NPSB 3CXFA 1KK1A 2AEOA 4NC1C 1DWPA 5LSAA 2VDLL 4MQEB 3ARBB 5I51A 3ECWA 1NGYA 3SDXB 1KN4L 2NZWA 3R3XA 3D12B 2QVFB 4EB6B 4AUUA 5EU3B 4A68A 3RSOA 4FFRA 3QE0A 5DUBB 1BGWA 2H54A 2VLKD 3H19A 1NAIA 4YL9A 4Y2DA 2CCGA 5C0CD 3S4SA 1BG1A 3ZN6A 5I0YA 3EBPA 3KFXA 4W1PA 2HK8A 3DTNA 2NCEA 1H4TA 4HHAA 1MG3C 1DZ3A 3H85A 1VB5A 4FOMA 4KU4A 3QBTB 1JK9B 4WWKB 4BFIB 1QE3A 5SV2A 1DBBH 3FQXA 2NU9B 1FDIA 1N5RA 4BQFA 2UXGA 1RWQA 4OGLA 1OAQL 2A94A 3NSXA 4IFTA 4XPFH 1XD2A 4X6DE 4B32A 4CM5A 2WINA 3ULSA 1E1CA 5I30H 4OF4A 5DFVD 2I8AA 2R7MA 5LCVH 1V8PA 4EKNB 1RZRA 3R7AA 1MFAL 1W80A 2RFXB 2ZUCA 3QW4B 1QR4A 2HLFD 3I1FA 3W2HA 3DZJA 1L3IA 5ISZB 2CHNA 1E3LA 1VLZA 1QEWA 4AG3A 2VLIA 4U3XA 3OZDA 3GTNA 4JODA 2RJMA 1K9TA 4B5KA 3QV2A 2JFQA 1XV5A 4IHBA 1JW9B 4CMHB 3O1LA 2FJ0A 3T35A 1WZCA 2Q6WB 4G7YL 1ZJBA 1PUIA 2BBOA 3UAOA 3BGOS 2F43B 1NLUA 4Y1RB 2NUPA 3FIJA 1X5FA 1GZ5A 2DPHA 2WK1A 3LRHA 3BMXA 3IMUA 1XTMA 2IPUG 4HJXA 3FO0H 4U1IA 3UH0A 1QK4A 2OO5C 4BHUA 4CDMA 4J3FA 4AL8C 3AP3A 3W5VA 3PHSA 1JMYA 4BPBA 3E5MA 4I50F 3KVNA 1MAWA 1YEJL 3OECA 1Z9LA 5KS9E 4DLWA 3DLIA 4B48A 4JJFA 5EI5A 1DLIA 3Q85A 3REWB 3OOWA 5D5QA 3T2QA 3IPBA 4UXHA 2UY7B 2HSWA 2H3KA 1E2GA 1ZOXA 1EX6A 4JM2A 3W0WB 2NZ8A 4Q58C 5EU6D 2JGRA 3WADA 4FYSA 3RIHA 5AW3B 4M99A 1CTMA 5K39A 3MHTA 1NIPA 3IXAB 4BNYA 4JS0A 1A97A 4F21A 3CQ9A 4TM9A 1LD9B 5DGTA 3ZY3A 5EPOA 1JHRA 1T03H 1MEEA 1INDL 2CGEA 2WHQA 2MINA 2Y0DA 2BNRE 2XHNA 1Y9JA 4WOBA 4DAEA 2Y06H 4KNSA 3PQ4A 1JEJA 4WI7A 1OTTC 3JSSA 1U2TA 3GJFA 2DR2A 2P9ZA 1PD6A 1VZ3A 4FLQA 1SC9A 1BDYA 4WD3A 3T3MF 4G0OA 4DP0X 5GS0L 5EZLA 2FWSA 3VVWA 3JD3A 1UCBL 2I3BA 3UCFA 2J6WA 5KQMA 1QSEB 1CT9A 4OGKA 2PMEA 3CEMA 3QHAA 1L5HA 4EDXB 3OP1A 4EOWL 5F3BB 2EZ4A 4HL6A 5EORH 3UKJA 1N8ZA 3TTSA 1BX0A 4LVEA 4LPVA 1AQYA 3TN7A 2ZVJA 4WKPA 4FMDF 4NOBA 1VRCA 4GX5A 4OXKA 4EFDA 3CCFA 5HW0A 4M8IA 3ND6A 2HZ7A 4ECAA 2GO7A 3EFBA 3KE9A 2GRJA 2Z7ZA 3AQIA 3VSAA 5F76A 3JV4A 3OKKB 3E18A 3DAHA 3TBWA 4YX2L 1WMBA 2HYDA 1VMEA 3Q1SH 5DIFA 3V8VA 4N8VG 4LYEA 1C1XA 3KOMA 4Z8FL 1DVZA 4BIKA 1KO8A 1TETH 2FKAA 4ZX5A 2EDHA 4Y2XA 4G25A 2IIBA 3WMSA 1UKBA 1NAMH 2J8UF 1JG6A 2F53A 4X84A 1RUKH 1NEZG 1QFUL 2FZCA 2BNQB 3SKNA 2HU5A 3CH4B 1OU0A 1JA9A 2VDWA 4BVLA 1R3JB 3QX8A 4E51A 1DXQA 1JE1A 3D6MA 2QD1A 4D42A 4OFIA 5B1JC 3KYIB 16PKA 5F96H 5T5FL 5E7IA 2CJPA 2COQA 5CUQA 3O2DL 4H08A 4TWAA 3LX6A 4UTRA 4C7BA 4GW4B 1FQ9C 2WVVB 1KH3A 2CUKA 2QTTA 1LK0A 1TZIB 1MCWM 2VK2A 4JRYE 3CB4A 7ADHA 2Q6VA 3AHHA 4QU9A 3UEOA 2TSAA 1SYVA 5C7XH 5D70L 2LE0A 4J0GA 1FE8H 3LZFH 5EHXA 3TGLA 5C18A 2NPOA 3PS6A 3AYXB 1QZ3A 2VZVA 3LRLA 3IRUA 3AR7A 3DCNA 2BGUA 4IOFC 1NLBL 5F7LB 2R4RL 3MLXH 2IF0A 2YWFA 2BWJA 4MI1A 4XDZA 5DYYA 5CDFE 3VO2A 3SC4A 2CLHB 2FB4L 1KJZA 3QIBD 5BWMA 5D86A 1YMMB 1G2IA 2W2OA 3H5VA 4XC3H 1O7VA 4MLPA 4XMXA 2OSLB 1IM9D 3DKIA 1QX1A 4AUMA 1CYWA 4WCDA 5E8DL 1C3LA 2BGTA 1E1DA 2E4XA 1XZAA 4XAKE 2VJMA 3O9WA 3GAMA 4RHYA 2ZRHA 1IOZA 1N0HA 5I26A 1QBML 4G6FB 3MGTA 3C08H 4OJYA 5F88B 3Q05A 4E94A 2BIFA 5H1YA 3PGFL 3U7QA 5B1SA 5IFHH 1P91A 3PVCA 2IYVA 2DPGA 2NRDA 3C5ZD 3EIEA 1K5DA 1QIKA 4JVUA 1EWHA 3U7YL 4Y2DC 2IYTA 2SKCA 2QJWA 1BVOA 1A9QA 1XVIA 3LTVA 5HI5C 4XNQB 2XVMA 1O6VA 3O83A 1AK2A 5T5FA 2DFLA 1LTQA 3O2DA 3MDJA 1A14H 3KL0A 5GGYA 4UEKA 5SYNA 1Z6GA 2WJVA 3NBKA 2BC9A 2NZ2A 2GKIA 1SB9A 4JUAA 4BSVA 2AE1A 3WO1A 3ALPA 2VL5B 1AGDA 4BVFA 4BZ1A 2QUAA 4OCXH 1VL1A 5CYFA 4OD1L 4JREB 4H60A 4DV2B 1HYHA 2DFNA 3AXIA 3GFOA 3BGAA 4MWGA 2XDYA 3QFGA 3Q1KA 1W1IA 2NYYD 2JGDB 2J9YB 2AJZA 4QASA 1RK0A 5JZ7D 1KGJA 1RPNA 2APSA 5AJYA 4GPIB 1Q0LA 4TXJA 4AO6A 2A9JA 3UK1A 3MRQB 5F2FA 4ZARA 1N6KA 1G17A 4IS2A 3TB4A 4JG0H 3HJ0A 4UUNA 4JLRB 1E79A 3V4VA 3RU9A 3OQNA 1TJ3A 2OHOA 4RVHA 2FBRA 1AGFB 1KC5H 4LIQE 4P9ML 4DANA 4UB0H 4IBQA 2FPSA 3IKMB 4KXVA 1OW3B 1B41A 2IH3A 1I7ZB 4DERA 3KZXA 2H2DA 1XKQA 3ZWKA 3NABH 2Q1EA 4PWGA 4JUIA 1R8SA 1RYDA 3P9KA 3SPJA 1XO8A 4JFED 4W9CC 3R06A 1U1FA 2PG3A 3E22B 4JZJA 5AVRA 1A1MA 4JM2C 2FD6H 3AK4A 3QEOA 5EC2A 5K9KA 4P36A 4OIMA 5BQ7B 5M5BA 2QT1A 5CFZA 2NX5B 3CDGB 2Z92A 1LPMA 3PC2A 1WCWA 5CB4A 2HUHA 1OREA 2HQRA 2QP3A 2DH2A 4M4SA 2FF7A 4YS6A 2M26A 2D0OB 4Y2HA 2EDXA 4UM7A 2P5YA 5J2TB 4RTKA 5ER6A 3N86A 2R6ZA 5BT8A 1JKMA 5EZJB 2X23A 3FJYA 3TRDA 4JFQA 3ONEA 5FOJA 3STBA 5IKPA 4HO1X 3KPRE 3OOEA 3C5JA 4AQZA 3SYNA 5AAPA 8OHMA 1MHHB 4RGMC 4OZIA 4XWOD 3GVPA 3EGDA 3H1TA 4W9EC 4MGYR 4EHBA 2J6EH 4O2FA 1NE7A 2D7TH 4XOUA 4TYYA 2BFDA 3N85L 3UIYA 1EVEA 4FVTA 1WG3A 1JP7A 2WAAA 3FZGA 3CRRA 3BD5A 5K5YA 3OZFA 4ZCRA 1LVGA 2LV4A 2JJVA 3HKDB 4PLKD 4BWFB 1ILSA 2VHQA 3ETLA 1A6PA 2BMKA 2V7HA 4NHOA 3TQCA 4Q6KA 3IM1A 5KWIA 4JOQA 3GX1A 5KYNA 3VR2A 5IH7A 1HDZA 5CJ8A 3PXJA 1SG0A 3FZEA 3F01A 4LVNB 1P7QB 1LWHA 1PJRA 3CHOA 4A0QA 4YPVA 3JQ6A 1PSKL 2K3HA 1EBBA 1XV8A 1UM9B 2V9PA 3DO8A 3ZHLA 4HIPA 1UDWA 3U40A 5IGXH 4HWKA 1E2QA 3RNOA 3D50A 5H4HA 3PLRA 1Z39A 2NP7A 3D0RA 4WFFE 3A31A 2OMVA 1ZLUK 3G0DA 4C06A 2DHEA 1A5AB 3VH2A 3U4BL 1LE9B 1RWOA 1FX1A 5DWQA 2WY3B 4JFFE 2OVBA 2BNUB 1NV9A 2Q6TA 4RVOA 2W4MA 1RXSA 5GS0C 1WA0X 1IOWA 2CMRL 2PRJA 1WZ2A 1KEML 3MFFB 1YNKH 1QIHA 1K1EA 2QDVA 3IAQA 1V8DA 5JG7A 2VOEA 2GUOB 3WCYA 1X3DA 3R3VA 4O2AF 1WQ3A 4G8EB 4A39A 3H5LA 3OWEA 4PWZA 5FBZA 3IKVA 4N8UA 4Q19A 5JATA 4HBCL 3AACA 3STZA 2Q6OA 1L4FA 1M71A 4W93A 4LU5L 5DT1H 4G1CA 1Z6QA 5E4IA 3TYGH 4BO9A 2OSWA 2ORED 3MRXA 3IILA 1OLSA 3GFPA 2ZJ3A 4E1AA 3WA6A 3DO7B 3BG5A 3DC0A 3HHRB 2O7VA 5DMGD 3II3A 3QQDB 4X4ZA 3EQ2A 1QAWA 2VR7A 3RAFC 1AS8A 4L8DB 5HP5A 1HO3A 1AHIA 1N0LB 1N7IA 3O9WC 1CFTA 1XMWA 5GRVL 4G1UC 1SJ9A 2CV2A 1QBLH 1GUBA 1U93A 2E5LB 2AN3A 4P4KA 2XWRA 1DRUA 5GGUA 1WE5A 4XLZA 5FL3A 4LSSL 2QXTA 2AJDA 5COBA 3NTCH 3FFBA 2YA2A 2P5EB 4ZUSB 3QBEA 4M7LT 43CAA 3QDJD 1KK2A 1YU6A 2I29A 4LKOA 1K8DB 4TTIA 3FZQA 2XR1A 3I8SA 4E5PA 6CGTA 1LD3A 2YLHA 4D43A 1SGKA 2RBGA 4Y9GA 5LJLA 1FL5B 1GSHA 3IDOA 1C3EA 4MVBC 2O07A 3CGGA 3ZKSD 4LXTA 1W7AA 5EUOF 3MIZA 4UBDD 3WGZA 2PL9A 1OM9A 1BVKB 1P77A 1C5KA 2AFHB 2FJHB 3LBYA 3LGSA 1DHKA 4KMOA 3LZCA 1TZGH 1EI9A 5I1CH 2Z8YA 2FR4B 3H53A 4ONFL 4RLSA 1VERA 1YD7A 2Z4QB 1MAHA 1AD0A 5K9ZA 1C4KA 3QWIA 3FWKA 3RC7A 2XCRB 5MHSD 2V9CA 3GBDA 3WOVA 1WD5A 4NC0B 1LDNA 2ZB8A 1JPTL 4OI7A 2PSDA 4ZOLA 2YA1A 1NUTA 4F2HA 2X1PA 1H1DA 3UJPA 3II6X 3MJ8A 4JGGA 3EZJB 1SC1A 1J8SA 2OX5A 3HNTH 4LMPA 3VXUA 4CQNA 2J3MA 4OFYA 2QZZA 3ABLB 2WI8A 2WB2A 2ZW9A 1T20B 2FZ5A 3B9VA 2PIAA 3FT0A 5DJ6A 3QFFA 4HUWA 3DJRA 3JD0A 5EZIL 3EXHB 4UTVA 4AWBA 4DN4L 3B51X 3MRKA 3Q3HA 3G17A 4PC1A 4OLBA 3AY6A 1T1EA 3QPDA 2BUBA 5LDSA 1COWD 3B4NA 2EEDA 2ZT6A 2JJTA 1KBKA 1NGPL 5K8LA 1Y63A 3HZVA 1QGUA 1CF4A 4UEJA 4JZJC 1GJUA 5IF9A 4B3IA 2R0WL 3C45A 3KJNA 3AHCA 4WFEE 4NUGL 1V11A 4XJTA 3E9QA 4H4NA 3UTQA 3EBLA 5EJ5A 1E98A 3A3NA 3LHFA 3MCVA 5AZEH 5E2VH 4Y2PA 4QELA 5JLZA 4AKSA 4O51B 4JHXA 4UFPA 1OEZW 1MO2A 2OO3A 3FWHA 3LWBA 5L0QB 3H0TA 1C8VB 1CJCA 2VZEA 2WT8A 2FPRA 2NT0A 1GNPA 3UJCA 1ZEAL 1F42A 1JXGA 5HFNA 1XGYL 3LZLA 5HGJA 3KW8A 3H11A 3GNLA 5MEQA 1A6TA 2XSZA 2X0IA 2YHIB 2EIHA 5T3ZE 4DEPC 2C3HA 4HJ0C 3RC9A 5CJQL 2DQGL 3IHKA 3QVVA 4UAGA 2UYOA 4Q9DA 3IJHB 5KU1A 4MR8B 4OCWH 4AYSA 5BUAA 3HG1A 3AWIA 2UZXB 1N5IA 4AJ2A 3IU3A 2JLWA 5JQ6L 4CSPA 4PCUA 4WI0A 3BMCA 3ET4A 1P31A 1QJ4A 2VP5A 1J12A 5CVDA 4YUVA 1NMAL 2AEJA 4D92A 3OQ3B 4L4VE 2QX8A 2IC2A 3C5HA 3KWWA 4PVDA 1M75A 5AW1A 2HA1A 3P0IA 2AKRB 1U3YA 5HDBF 4FEEA 3DEFA 4BKPA 1DDOA 4HN4B 2QAJA 2W90A 2GK6A 4PZDA 3MREB 3FB6A 4U49A 3UTSA 3OY7A 4BQEA 2MQ3A 4H0FA 1FHNA 1AX9A 1Z08A 1WS7A 4E42A 4BB9A 1OQXA 4I4CA 4G81A 1Z7WA 2PXYD 4X7CC 1H3PL 1J1UA 1EFHA 4U2BA 2XUAA 3DVAA 1SVOA 2NY0B 2XYHA 4F46A 4Y4KA 1Z73A 3V1NA 4GPZA 4I4TF 1KTVA 1HT0A 4ADGA 5KYUA 8AT1A 4XRCB 5DVLA 1OFTA 4X8MA 2YHUA 3FDWA 2JSFA 4ZAVA 5JPCA 1ITZA 2R6GA 3CFYA 3JWEA 3FPEA 2ZX6A 5ALFA 3W9DB 5DOVA 2CSUA 3CLUC 1HH6A 4HOYA 1IBMB 4P2OA 5FFLA 4OQYA 4CVWA 2PCLA 1K8IA 4DTGL 2WLSA 5T6MA 5BV7B 4N8VA 4ZAKD 3JR3A 3W3AD 2H4FA 3KPPA 4IQ0A 2VMFA 1OAZL 3UK2A 3D02A 2WWFA 5U9CA 4AVYA 4TKLA 2C1PB 4GDFA 1NEZA 3D6UA 4FLSA 4PQXA 1TIUA 2IYOA 1IC6A 3HS0A 2II6A 1TQDA 1GT91 2B7LA 4NBVA 4QPDA 3MRFB 1TTFA 1QF9A 1ETZB 1F1AA 1AQUA 1Z6JT 2VNJA 2Q2NA 1JERA 2JJ1A 1TKWA 4CTNA 3L5HA 1BD4A 3PREA 4Q9BA 3I2CL 4LHEA 4ABYA 3HNRA 4WBNB 5CD5D 3L7LA 3ESUF 3TQHA 1I8LA 2WYVA 2Z35A 3B2QA 1NUDA 4IK7A 1X9HA 4WTZG 1FVEA 4MHHG 4N8PA 1XTKA 2I1VB 4Q4JB 1XMVA 4NV1A 2Q07A 5AR1A 1B8PA 4LDLB 4PJ9D 4P4KC 3OZXA 1IGCL 2ZK7A 2ZSHA 2XCSB 5HDOA 1Q9WA 4G41A 2Q27A 3KFLA 5THKA 5AIAA 2OVFA 5ALOA 4MW0A 3CFBB 4JXJA 4WXEA 3NPZB 4ON9A 5D2LF 3SFVA 3KD2A 1E2IA 2J9FB 1ACJA 4R3NA 2X8LA 3FMPB 1R16A 3CLFH 1USWA 1KARA 3ES6B 2CM6A 5KTOA 3N40F 1NL3A 1F5SA 4OCYL 2YD1A 3CNOA 4NH0A 4HKBB 1NFIA 4Q5IA 3PHGA 1G8HA 1VFMA 3NBMA 1BMFA 3PZRA 4XCEA 1JTFA 5CZRA 3UOWA 4XWAA 4MQFB 2DYKA 1XZFA 1VKNA 4N40A 3RGGA 1QQ7A 4QWWD 3QM1A 2WIAA 3QVWA 1DZIA 3LG2A 4C2TA 1W46A 1F6LL 4U7SA 1R0SA 3WLOA 3VC2A 4XCXA 1W9HA 4XUCA 2DBVO 1QDEA 3EMDA 2LAGB 3TRHA 1F7UA 2QRVB 4XGRA 4KUZH 1DT3A 2YCLA 3CMCO 4HQOA 1SEBA 5JCOA 1R17A 5CLIA 4XPBH 1RM3A 1NXOA 4JI6B 4BTVA 2LVCA 5LB1A 3KBPA 5IB2B 3RX8A 4A5SA 1QFWM 4CFZA 2CO2A 4V3BA 2PH5A 1EGHA 4CDGA 4LPSA 5L4IA 1RJDA 3U9TA 3I5XA 2QTWB 2K7ZA 2C7UB 3IDSA 4NK4A 3W5DA 1JK8B 4OAOA 1EFDN 5AAMA 2X0WA 3JASA 2JJTC 4GW5B 2PH7A 2HFKA 5H2BA 3G5ZA 4O5AA 3HR8A 2IV3A 5T7BA 2BM3A 1WIPA 1GGHA 1B2YA 1MW2A 2VHUA 1R4MA 3WLPA 2HTLD 3UKDA 3VPDA 3POHA 5JZBA 1OJLA 3COJA 3QOYA 1RP8A 5I76A 3CXRA 2JBAA 1CJUC 3N74A 5HGGS 2NW3B 1G8YA 2GJRA 5CUSH 2JHGA 1EHCA 4KKLD 5HPOA 4DQVA 1I7DA 4QRRB 5LUAA 3BMOB 1SXJA 1VGQA 2R44A 5TJ9A 5M3BA 1K27A 4KC0A 4HWBH 5ECGA 5C0AB 3NDIA 3K8YA 4KZEL 3ECVA 1KI1A 1ISRA 1T9GR 4UQ2B 3GLIA 4K5OA 3KWXA 1MREL 1OQAA 1AJ7L 3IO3A 5IT0A 3ULAB 2BP7B 5B6PA 3Q3IA 1CT8A 2SECE 3T4EA 4G6AD 1LI7A 1IXRC 2ECKA 1QC5A 3MS7A 1WT5A 1AGRA 4TWRA 4BQQA 3KFVA 4R54A 3OT1A 4HUTA 1MNUL 1FNDA 4I8IA 5BWNA 4QGAA 3QW9A 2VQ4A 1SSLA 3E9MA 3HNOA 2FNBA 1IZZA 3W3BA 2ZIVB 2NW2A 1CLOL 4OJFH 4RK7A 4MMXB 1Q2UA 4FINA 1K72A 6FABL 3BZUA 4RWZA 2I25N 4YHLL 4DPRA 4AB1A 1QRRA 1QFMA 3WV0A 4JC4A 1IY8A 3CNBA 3EUWA 3P77A 2FN9A 4P53A 1DOAA 4IDBA 1EEQA 2P4UA 2P6PA 5EHNA 2BTEA 4I55F 1EEUA 3WMFA 3GSOA 3ZIAD 4QEDA 2GK4A 2OFWA 3HB3B 3MXVH 5C0RL 4WZAE 3ML9A 1GXEA 2OAAA 4LSVL 3C5VA 4EDWH 1KLUB 3EPRA 1D9KD 4O4HA 2GZDA 5JD3A 1ODAA 3A6KA 3HN6A 5COAA 1A9BA 5L95A 4MRBA 4RESA 3IJYA 1ZXKA 4AY6A 1HC1A 3GELA 4LEOA 2FXVA 3ML8A 4AG5A 2QSZA 2ZI5A 4BCYA 2B1QA 4P2OC 2WXRA 3GI9L 5IAJA 2WBKA 1BF5A 1IBDA 2A9DA 4GAGL 3WI9A 3N0AA 4J2QA 1XTZA 5CG2A 4ERXA 4KNQA 3OJFA 3GB9A 5EV7A 2R3SA 3MV7A 2KLBA 4DPMA 1EQUA 2HIGA 1X7XB 1PS9A 2GCNA 3HS0C 1V3TA 1N18A 4Y2OB 3CSTA 2ZXEA 4GMTH 4PGEA 3TW4A 3D69B 4M6NH 3FT2A 5KYXB 2H1PL 1A2KC 1SQ5A 4ZD3H 5BOJA 1P6WA 1PJ3A 4P2QD 4L5BA 1WP4A 4C7XA 2GSIB 2XETA 3OLEA 1SLVA 1SHJA 1I8LC 3LKVA 1A9OA 3KJXA 4GBED 2IXBA 6PCYA 4JPKH 3JAWB 1A3RL 1X86B 4NAJA 2QTLA 4AP9A 4N41A 3DBLB 3SOTA 2MPVA 4HEA6 4FSHA 3F47A 1U33A 2Y9PB 3OHPA 5AOIA 1GY1A 3STVA 3C7AA 2ZE8A 3ZTYA 3E05A 4FWBA 4YQEA 3DZBA 4BE5A 1THTA 4RDXA 2QV4A 4GBMA 5SX4I 2EYTA 1QUNB 1UD3A 2AK4E 3Q43A 4PJ7F 5JZSA 2WSDA 2WG0A 2DV6A 4QRPE 1RZGA 3T3PE 3PWNB 1KTDA 4GGOA 4QYWA 3D3VE 1F11A 2R29H 5F6IB 2V6FA 1RPKA 4JHWL 2OESA 2CLRB 3LB6C 3IS1X 2C34A 3OM0A 4IDPA 4YMGA 4D8PA 5DCUA 3H8SA 5JSZA 2G5TA 4PWJA 3BPCB 3SIXA 1GCGA 3H7BA 2RK4A 2QL5A 4HH0A 3ISRA 4NZJA 2I65A 2UUOA 2HLAA 2HJWA 4PE5B 2GTWA 4RBNA 3TP4A 1ST2A 3SODB 3GSQA 4MXVF 4LSRL 1TCUA 1ZVYA 1BE8A 1YNSA 4RS3A 3WLIA 3CH7A 5CX1A 4OHYA 1PFGA 2LCIA 5AI5A 2RCYA 2OEPA 2YQ4A 4EEXA 4BFZA 1K5NB 3CHYA 2VB5A 4I0PD 4NQXB 1E32A 2FR8A 1T5WB 5CJXA 4MBOA 1NCUA 3X12A 1IDOA 1I8KA 5JCOC 1ILEA 4C7JA 5DGCA 1HOXA 2B4TO 1UJTA 3ZKMC 1JYWA 1A7PH 3F46A 4Z7WE 1S7RB 2C1OA 3KPSE 1RZIB 3T0GA 4TL6A 1WSAA 2UAGA 4DIDA 1NUQA 2NY1B 3RJQB 3TA3B 4CDGC 2X19A 4JFSA 2EE6A 5IVXA 2VXSL 3GJEA 1XK6A 3KBFA 4K8RH 2H2AA 4QEZA 4A0HA 1IBLB 3P3RA 2KJQA 2GKOA 4XP5L 1C7RA 1GGVA 3QUHA 4Z86A 5AAMC 3CO5A 2BLLA 4PGCA 2IVFA 2WO4A 1T4WA 1XL1A 2XVBA 3QRGL 3OQMA 4Q6WA 1M8KA 4CLXA 2KDGA 4F4HA 3GPLA 3DP9A 1NIDA 4FXLA 2L0XA 1Y7VA 4MDYA 4PHXA 2XEDA 3CX6A 1TYCA 3OF6A 2FG5A 3HI5H 2GEEA 3QPQC 4P7GA 3TVDA 2XYRA 5A5DA 1E2UA 5IB3A 4MJ3A 3VQ2C 1M8GA 3GPIA 3RBAA 1O58A 3FQ1A 1P7HL 3F7RA 3LN4B 3K9HA 3WL9B 2GYUA 2ARKA 4CKEA 1UACL 2FW1A 4GUPA 2QROA 3MJSA 1EJFA 2V5YA 1HE8B 1VLXA 1SXJC 2ZVQX 3SR4A 4D9IA 5C32A 1VGRA 1H0SA 4H88L 5ECGC 1F2TA 3K80A 5CJJA 1U7OA 3CW8X 1Z17A 3PRZA 4IZIA 2RAPA 1P9NA 2FIKB 4YRBA 5JI3E 2DRIA 1EUYA 4BCDA 1TZKA 4X91A 2E21A 1TMQA 3CC5A 4KWHA 3SE8L 5FYJU 2BMDA 2BZSA 2MQ0A 2IOQA 1L7RA 4LQFH 5C3IA 1XTTA 3T2NH 3GYGA 1I1YA 1LPNA 1UA3A 4LGRB 4PAZA 3M8KA 4NENB 4HAVA 4AKGA 3KCPB 3MU3A 1CE1H 1JJUA 3H97A 3PENA 2DY2A 4X1KA 5DTFA 2MJWA 1MWAB 1SF5A 1S7TA 2K2QB 1E5TA 3NJ4A 4MAYB 1QYGH 3RJOA 2I24N 1ISJA 2HH9A 2YS4A 4I9WD 4RPJA 2XNKA 2J71A 4ZTPH 5TPZD 3RWFA 3NHWA 2RFLA 2FFQA 1AS6A 1M7IA 4ZUWB 3FFCA 1OAAA 2NQ2C 3O6FA 1A50B 2X3UA 2VZ0A 4PPGA 4ZZ2A 1AK9A 2HH0H 1E1YA 1L4BA 4PRKA 4RVNA 2IYQA 4N2CA 3RWCB 2A9KA 2VLJE 3MWEB 3GK8L 1E50A 5HTSA 5IS2A 4P84A 1MHPA 4P59H 2DYRB 3H8WA 2WXMA 2AJXL 5C8YB 1DVQA 4UANA 1FFAA 2D7MA 5EWIH 1HH4A 3ZBTA 5GGRB 4R71A 1ONOA 2SODB 1D5BA 4MV8A 1G84A 5B1BB 1XN1A 3QWHA 4PJIA 3WTTA 4Z7NF 4J94A 5EWLA 5IHUH 4RZ3A 4EQ6A 1F0LA 1R9FA 3EYOA 2GAOA 4XM2A 4HS3A 3ZOZA 4QDGA 1JQDA 3ZHDA 2VR4A 3TJZA 3NIDF 3GMTA 2XUWA 1DCKA 3R9XA 5J4KA 3RU7A 4YPGA 3VFSA 1L5VA 2XTJA 1OCZB 2QX9A 4QDOA 4N0DA 2ZDGA 3CVDA 1R5WB 2ADIB 1CUXA 3DB1A 3OLIA 4QJ4A 1BEXA 5HIJA 1UM5H 1KOLA 2VF4X 2FMUA 2C3WA 2ZUYA 3W78A 4KHXH 4JUSA 4U63A 3RUCA 5G4KB 5GJTH 4PPNA 4EHJA 4NSKA 3D85A 3LXMA 1DRJA 4KXAA 5IHZB 1EFXA 1CXZA 4EA7A 2GT9A 4M8RA 4YO7A 4EQ2A 2ECQA 1XCQB 1QWSA 3S8FB 1WDWB 4FXTA 1XVUA 3N7UA 4XQ9A 3S96A 4TTGA 1NW7A 1JZGA 1J0EA 3VJLA 2ARJB 1YYLH 1RXCA 4B79A 5A4AA 1X77A 4BWYA 4EVRA 4K8RD 1W2KT 4PCTA 5E51A 3SYKA 1MTOA 1BBDL 2HT3C 3GO1L 4AX4A 4DKXA 3O6LH 1GZHA 4FNOA 1BTOA 4R9RA 1NC4D 1CU4H 2QPFA 2DFPA 1UKQA 2WILA 3K4HA 4CTKA 2YWRA 1F6AA 1J9TA 3FHOA 4MYUA 1JWUB 2RMNA 5AVTB 3ZWBA 4AKEA 1E8WA 2WFLB 3TUZC 4WTZA 5I1GH 4NQDB 3MQFA 1A6VL 5C0JB 3WP0A 2E85A 4YCLA 4XWWA 3NT4A 5BYKA 5TQ2B 3STTA 4HLEA 2Y0PA 2ZJ6A 4N26A 2EJVA 3QYAA 4E9XA 3KWVA 1KJ2H 1N0VC 1K6QH 5SY6A 5HHMB 1OE0A 4GRLD 2FR8C 5CJXC 1DO8A 2X10A 3HN3A 4KAQH 1GTJ1 1X5KA 1UPCA 1M7DB 1LPOA 3FTDA 4R4ND 3LX8A 1UT6A 4CR7A 2X4OB 4Z0HO 2JFHA 4WNIA 3CPLB 2QHRH 1TM5E 3A7EA 3FHLA 3TI7A 4ZS6D 1GNLA 3RPIB 3OF5A 1FO0L 3FZYA 4G1EB 3HJRA 3U9UB 3VX3A 3UHOA 5KG9B 1M5RA 4DSYA 2PP7A 1GCUA 3JRNA 3RVTC 5EXPA 4A7PA 4JKIA 2CLVA 1GQ2A 4ZRGA 5T3XD 2HDNB 1QOPB 2IVFC 4ZQKB 2C1XA 2QMHA 2I5PO 4MRMB 1K08A 3NT0A 3NTOA 1FYVA 3DHVA 1SD5A 3CUYA 5KN5A 4MMYA 3NCEB 3WLFA 3DVFA 3QYCA 4EOGA 5C08B 1DX9A 1VI6A 3KZCA 5KSAA 3EULA 3A4YA 1CL7I 2H6PB 4JFDB 4CV2A 2DPLA 4AQEA 4XH2A 2QTBA 3RYHB 1A0QL 3V1UA 4XX5A 5D1ZD 3WIFA 2HT2C 5I1KL 1DKPA 2NNLD 2Q8AH 2OBFA 1FMLA 3S99A 4GI5A 1L9KA 3N06B 2EX0A 5H59A 2ZI7A 1FTYA 4KTGA 4D6XA 3PL1A 1MOSA 3IJRA 2HT4C 3SNKA 3QDME 4TTQA 4FFYL 4P2RE 1U3HD 2KHAA 1NOJA 5ILQA 1N12A 2YICA 5FYJH 4PB0H 3BGMA 1YS4A 3F6YA 4RELA 3FDZA 3M8OH 4JDVA 3GLRA 3QUZB 2AEFA 2YXMA 4MIKA 2BDTA 1BQHB 1KYWA 3C85A 1PLGH 5DEFB 2P24B 2BHNA 1UFGA 1FO0A 4GMSL 3V8CA 3LZQA 1CZ8H 2ZS8A 4QKTA 3KLPX 5BYJA 1A8SA 1E9RA 4WK6A 3TCKA 4PTZA 2LDXA 1YEWA 4ZG1A 4JQIA 4H8WL 4K8OA 3US0A 1SBCA 2PZFA 2ICEB 3Q9SA 4DMRA 4HV8A 1F8GA 4C7OB 1GO2A 1SZDA 3TASA 4BZPA 5CU9A 1H65A 2FW9A 3BSGA 4IDDA 3C7CB 5BVJB 2OGZA 3SAJA 1SUPA 4NQED 2E9WA 3AY2A 3BQUD 1JZQA 2BGKA 3O6FC 5ER9A 3QZWG 3G5UA 3ZCVA 2A0LD 2OTUB 4TRMA 3WYAA 1AXEA 5B2EA 2OZVA 3AH8A 3D8MA 5KHOC 4JVPA 3CE6A 3DPBB 3AEQB 3ACDA 1US8A 1NBVL 3ULUF 1QDLB 4FFYA 4YDRA 3ZJUA 2WLYA 1UBRS 2AXGB 3T7JA 3X14B 5IC6A 1N3NA 4OQ4A 1YKGA 1A2QA 4CI9A 3CIFA 4MVJE 3FPJA 4IBYA 2RCNA 1AGPA 4B3DA 1YE8A 3WTSA 5D1NA 3N53A 4NONA 1S9XA 1T7YA 2I3AA 2AXJA 4ODHH 1H8HD 2OV6A 4PNHA 4AWAA 2I87A 2HCFA 3LRSA 4ZVPA 4Y6OA 4BC0A 1R5IB 3K2BA 1SEVA 2XTJC 2JAXA 3OKFA 5F23A 3MB5A 4TQGA 1OT4A 3PQ8A 2VQ1A 2BH0A 4R84A 3P4OA 3NFSL 2PX6A 4GKZB 1PS3A 3EYUL 4ZX6A 1V25A 1NP7A 3HJNA 3BZ4A 3REVB 2F4NA 3ULVL 2JKSA 4UUQA 5CM9C 2JLAA 3IRPX 4EVIA 2PYEB 3WSQH 4GBXB 2XBZA 2VT3A 4DGWC 1TEXA 2VYQA 5FBQB 1YEFH 3L9RA 3L8EA 1AKVA 2EFCB 5JAQA 3DG9A 4QU0A 4P57B 1BD2D 4PGHA 5EFZA 1YNTA 3RTDA 1GRRA 2SKEA 1IC7H 4DC0A 4LARL 1WZ1H 4RIGA 2IYWA 1D8TA 3HE3A 1BA3A 1OROA 2QG9A 3OF2A 4A7GF 2ZJ5A 1T36B 2RH4A 1AE6L 4HSCX 1GZHC 4YFLI 5E95B 5L88L 1SXBA 4XPZA 1HCVA 1BQLL 4JC8A 2FL5B 1SKYB 1X5MA 5FO9B 5GGTH 1BXRB 4JKPL 4XNYH 3PHLA 4QYIA 4QXGH 1PHRA 1XF3A 2BK8A 1VE1A 3HS3A 3V4PB 1Q9OA 4AJHA 2Q7YB 1EO8L 4Y4FA 4RAUA 2PO6A 1ABEA 1XT5A 3V32A 3G9UA 1MLBB 1OFUX 4IOLA 5C7LO 3EIHA 2KB0A 1Z4IA 5CILL 1QG2A 4MW1A 4P9HL 4AQDA 1QBAA 3MWYW 1F2DA 5DYTA 4CM7A 1H0DB 4JFRA 5FPPA 4XPIA 4P3WA 5CMAB 1TZCA 1RFDL 2J5BA 4OKDA 5EUBA 4OFZA 3T5GA 1XF5B 2HSIA 5AYVA 2JTDA 2QLFA 4WFQA 5IQNA 5HNKA 4N7RA 3ELAT 4DV5B 3NOIA 5KVGE 2PYZA 3BH9A 4WK2B 5FYJD 3SF8B 4ARUA 1WWAX 4QD2E 2JIDA 5IFLA 3DX3A 2VXQA 3IIIA 4K6CA 4FXOA 1UM6H 5FECB 2MSEB 1TR7A 2EIZB 4PGDA 3GW8A 1SCAA 2PLRA 3FB5B 4EHLA 2K45A 2F54B 1IMJA 4JA0A 2WD9A 2N46A 4KKBC 5EMJA 2C8JA 2D3NA 1AO7A 2XVLA 3EDKA 2CLIB 5FWXB 1J0KA 3HI6L 3NS7A 1ZK0A 2OBMA 3LUFA 2ZR8A 2YS6A 1UURA 2XTNA 5JY6A 4FYPA 4MNGA 1C7TA 3ZI7A 4G37A 2IALB 1RUQL 3IDMA 1Y6ZA 1ZT7B 4KRPD 1J99A 2FV8A 5TGBB 1L6PA 1EUQA 3VA7A 2AVDA 3QEQD 1Z66A 1MCRA 3UA3A 4D4GA 1DDHA 4BMDA 5KSAC 5J58A 5FBRB 4QOKE 4XMTA 1PS0A 4ARVA 1DARA 3GHYA 2Q5FA 5LPNA 1MRCL 5A4KA 1AKMA 2VM9A 2CDNA 5HD8C 3E2PA 4FSDA 2ANBA 4TZ6A 3CC8A 1Z9NA 1LBTA 2H3NA 4FE9A 3FT4B 5EWMA 3EEYA 3P4XA 3PC3A 4M0DA 4R7DA 4HWRA 6ADHA 1NINA 2C2GA 4M7ZB 4W7IA 4G8GA 3BXGA 4JPVH 2VXUH 3K6SB 4NDMA 5INTA 5FUOH 4GAYA 1CP3A 4Y6GB 5L2KE 5T1DL 3EWIA 4EZBA 1WD7A 4DC1A 1D5XA 5DLLA 1P2CA 4YDLB 3RU8L 1OBFO 3U19A 5DHVA 3IERA 4MYHA 3RWHA 1Q0XH 1YAIA 2WSYB 1G4RA 4ENWA 4NAHA 4L4TE 4QRUB 4PLVA 4O0MA 1WBXA 4ZD6A 4X83A 1WSDA 2X14A 3PWUB 1P5ZB 3TCLA 1XBTA 2F74B 5CYPA 4OUUA 3HDHA 5C8JA 3ARFB 2C78A 3EYFA 2AL7A 1RHMA 3WRVA 5DN6D 5K0LA 1L7TH 3U2SA 3GUFA 2X38A 3V6BR 3CIOA 1MFMA 2YBRA 4B73A 4DABA 2RALA 3AR4A 2RJOA 2Z5GA 4FG4A 4L6AA 5FYLH 3P96A 3GLSA 4C4XA 1Q21A 5KWSA 3CDZA 3DJ9A 4ZQBA 1T2JA 3HI1A 3AONB 3K1AA 4TQ8A 4LE0A 1X7WA 1KXTB 3BSHA 4Y2RA 2PWYA 5HDLA 2G2PA 4MRAA 3RFUA 1U9YA 4YQXH 4IHJA 1NMXA 4BUCA 2WSBA 2W6MA 1IKOP 2M32A 2QSVA 3G2HA 1UZGA 3RPKA 2Z93A 1RXIA 4XARA 1I7PA 1JRLA 2OXGA 5I6LA 2WXLA 5IW1A 1YMUA 1NOKA 2JTYA 1CZKA 4OBXA 4BP9A 2HU8A 4DSAA 3EUEA 3E6AA 4PIBA 3LI2A 1UKZA 3OD1A 2DWDA 2ZAYA 4HFNA 1A9XB 4PG9B 3VRHA 3PDOB 2AV6A 3LKRA 4LRQA 2UX7A 3HMQA 3MBEB 3TO2B 2DWXA 2WWKO 4RFEA 1HC7A 2K4WA 2I6QA 1Y0LA 3JTTA 3GEIA 1G7MB 4FNRA 4EIGB 1DQDL 3DOSB 1SUBA 3P0YL 3TVYA 3QQXA 1FFRA 3ZU6A 3IRVA 4QKXB 1OGAE 2CKBB 5EDSA 2WMOB 1D7DA 3S5JA 2H57A 4F9EA 1C5DA 1TVCA 1DQJB 4R1SA 1GGBH 1WAAF 1KZYA 1G8MA 3PP4H 4GFDA 3V7WA 2MQGA 3KNBA 3FG9A 1NW8A 1UG9A 4F5CA 5ES4B 4ZCPA 3VKHA 2XCUA 1BZ7A 2DYPD 3TMKA 2JZOA 1S8FA 1N59A 3FF1A 1OAUH 4DARA 1Z0AA 3SZMA 4G5AA 5E9QA 3B1ZA 1TLFA 2GIMA 4AEFA 3VTZA 5IM4A 3PKZA 1UFRA 1Y3DE 2JAHA 4PLWA 3G7TA 3K35A 4GL4A 3BSYA 1BOGB 4WLOA 3IDXL 1UFKA 5YASA 1E1LA 2RH0A 1JR3A 5ESVB 2GSMB 2YV3A 1PCXA 1M7BA 4R1PA 3HPRA 1VFPA 2Q0ZX 2XKNA 3QKIA 1U3TA 1Z5VA 1HINL 2IHJA 2VDPB 3S1AA 4YHPA 4NU0A 2Y7LA 1ITCA 4RAVA 2NUAA 3DUFB 4WO4A 2JB9A 3VFGL 1KRXA 3TBVA 2YWJA 1Z15A 3HE6A 1NBYB 1CD0A 2MHAA 4Y4FC 5HM6A 2PO6C 1A8JH 4NQCB 1MCCA 1I3KA 3WLBA 4PJDA 3GG9A 4AUJA 2R1TB 2EWWA 1FB5A 4QM6A 2ZWPA 2X4LA 4F9GA 4AL8L 4PHCA 4EARA 5LZ4A 1YCGA 4GM4A 3WFHB 3ZDFA 4L57A 1H5UA 3IQZA 3SGEH 1K3UB 2EH8L 1LW6E 4K40A 3PHQA 5GGQH 4OB5H 4DP5X 1KI4A 5C70A 1OOWA 1M7HA 4Z3TA 3MT7A 4IAOA 5FW6A 1NVBA 2A9RA 2Q5EA 3GGJA 1R9JA 1Y5MA 2KDYA 5I1EL 3TVMD 1UKCA 4KVNH 2G8LA 3UC0L 5FJJA 4GEIA 2W6IA 4GS5A 3NSCA 2VXVH 3QUGA 5AALA 4WXRA 3DLQR 1F8UA 2V7UA 3HEAA 1WEHA 2C94A 3FB8B 1RU3A 1IC1A 4ZI7F 1DQSA 1NIAA 4WZBE 4YONB 2AV1A 1PE0A 5EKTA 3ZE2E 5B36A 5HHPA 2R51A 4O58L 4UNTA 1D5WA 3QJTB 2I2WA 2FQDA 3N2KB 4AV4A 2DWTA 4K9KA 5SWSA 2EYRA 2V96A 2XOKA 4G24A 2WHXA 1MFUA 1LLAA 3FUHA 3FO1A 1LF5A 1AGBA 3RJ5A 3WA7A 2XE8A 4FN4A 4Z2YA 3MG9A 2CB9A 5FYLD 4BH7B 4I9XA 4YE4H 4MV9A 4XB6B 2M1KA 1GNRA 5GIPE 2YWDA 2ZS9A 4K23H 5EBLA 5IQ7H 3FRJA 1N3LA 2BINA 4M4RB 4M8KA 5HYSG 1C30A 5EHIA 2DY1A 5LXTB 1ZWIB 3TNDA 1WUNT 2FQXA 3QO0A 3IAUA 1V39A 3RFZB 2NY4C 3D6JA 1T5IA 4P98A 4EN3D 3VGFA 1K06A 2VT6A 4AF7A 5K59F 5EPEA 4PGFA 2WKGA 4JANA 1XDDA 5F0PB 1X5XA 1VHDA 3GQFA 4OZGA 2QB5A 3O0RL 4KROC 1TDJA 4IJQA 3ZL1A 1EK6A 5IT2H 1KB5B 3FNRA 4YHNB 1ZHBB 4Q3EA 4M5ZL 2N0KA 1SURA 1OA1A 3OQJA 4MCZA 3V4UH 4HZLA 1JWMA 3NHBA 1SYSA 3ZCSA 4I1VA 3CFEB 4QT5B 1MB3A 4TWBA 5KZMB 1WV7T 4PG4A 1G94A 3NETA 3IS3A 5LGYA 4JL2A 2C59A 3O8DA 4I1YA 5DP1A 1SGWA 3W4KA 2POCA 5THQA 2EECA 2GW5A 3CHRA 1NOAA 4RF2A 4OHRA 4HT1H 3T8XA 3I02B 1BYIA 4A23A 5IDYA 2VJ0A 1XROA 1N5OX 2JL1A 3ZJTA 4XIJA 4JI0B 3RS3A 3R40A 1XLWA 1S7UA 5IB5B 3EJUA 3IMBA 2H1LA 5CEYB 3T4XA 2GK0A 5K93A 3ANSA 4D3XA 3FULA 2C9SA 4KG7A 3NALA 2WXJA 4ZFGL 3DMMA 1TMOA 2C4FT 2DQUH 2VP0A 4PV1C 1NWPA 3PL6B 3KYDB 5E70A 1SOKA 25C8L 1QNZL 3KBEA 3RRNA 2HWUA 1ZE3C 4JLBA 5KKAA 1ZGCA 4C4ZA 3FCSB 1DVFA 3QZPA 4N6OA 5GVSA 1NNEA 4TOIA 1A64A 1GYVA 4E5YA 2V7QA 1XXDC 2ZXGA 3QA9A 1MFNA 3DYPA 5F7DB 3V34A 4LRSB 2E7CA 3OJVC 2H32H 4KJZA 3ZT5A 3G88A 4G85A 4NZNA 2Q3BA 3QZWA 4EGCB 4LKCB 1N9PA 4OLJA 3LPAA 1KO5A 1NG1A 1AG0A 3EXEB 2IYYA 1M1ZA 1HDMB 4INPA 3UGKA 1RRFA 1JV5A 4UARA 4P1ZA 2DS4A 3QQ5A 4JM4L 5G1NA 3SZ6A 1EP2B 1KZYC 5E0KB 4YXKL 1Y5IA 4B87A 2FIRT 2JI8A 4ZPTB 4NHCH 3FF7A 2NU7A 3VI4A 1ELOA 2ZWNA 2XT0A 2O0HA 5H81A 3T8VA 5CX4A 2Q2QA 4XN7A 3IMKA 2V0AA 1E2KA 3TTUA 4BO6A 1E7WA 3KQPA 1IZ8A 4GMFA 4BBWA 1MCHA 1F3LA 1L0QA 4KQEA 4AECA 3U0TA 2ASEA 1OPOA 4HBZA 4ARIA 1H6BA 4FQ5A 4TULH 4P46D 4PN3A 2CIKB 4JW3A 3VI3A 1JTTA 9ABPA 5IESH 3LKOA 5AW5A 3HCWA 2K9UA 4L8LA 4N0FA 3H1ZA 1XZ8A 1N70A 2GCYB 5JOEA 1U1GA 1KRWA 1IZJA 1NFFA 3W9BA 5EN3A 2O48X 3JWNG 3OHXB 3BQ9A 1A88A 1YQ2A 1EVKA 1EK2A 5BMFH 3P9NA 4KNTA 4WO4C 1VCHA 3O7MA 3UJTL 2WOYA 2R8SL 2B1HL 1UJ4A 2IBBA 2QRGA 3W11C 3DFUA 1QP8A 3HE6C 3X2FA 3ZYCA 1AKYA 3GN2A 3DBVO 3OKEA 1AQ8A 4KK3A 4OIFA 3HGMA 3MA7B 4JUFA 1JTVA 3LSTA 5FX3A 4NNYA 4AQ8A 1V7QA 3F0TA 4Z0PA 2XBLA 4XJXA 4JFPA 5IQ9B 2ADMA 1N7GA 1RM0A 3JARB 2Q3LA 1F8YA 2NZ9D 1V5WA 3QLJA 4MQUA 4EMTA 4IINA 4IU3B 5CINH 2C4TA 3L4XA 4O2CA 3CWCA 4OGXL 1U2GC 1W5SA 1YHPA 2Y1VA 3A1CA 5AVYB 3VJRA 2V4MA 1MLCA 1M1XB 2EL9A 3ZKNC 1X0VA 3OTOB 4RM3A 2NY3D 5IVDA 2NQTA 4Y19E 4LDPA 1YCSA 1AYRA 2ZAOA 1NMYA 1II8A 2XDQA 2QVZX 1VYUA 2OFXA 4KRLB 2EDAA 1WBZA 3GNMH 2FJSA 2A1WL 3LNIA 1X14A 1CEXA 3UGEA 1XF4B 1WSWA 4WKGA 1DTSA 4JJ4A 5BR1A 4XM1A 4AUKA 1YE5A 3ABRB 4N9QA 2I27N 2IPTL 4Y7OC 4GH7B 3QCVH 3PXAA 2BUCA 2GM3A 3ND8A 3TYXA 2I1WA 3PABB 4ZGWA 3FQ4A 3R0MA 3CUKA 2N1KA 1C5BH 2AJTA 4DMGA 1JXJA 2PT9A 12E8L 3COZA 4P3YA 3OTQA 1FDLL 4BFRA 2BI4A 4W63A 2A6KA 2UXDB 1GG8A 2MU1A 1U4SA 1U7WA 4C56D 1UC6A 3VG9C 3SSOA 2VLJB 3MLBA 5K3AA 2QQ0A 2DEYX 2ZJAA 2QENA 2FE4A 3LL4A 2AVNA 3T9BA 3LS4H 1TM2A 2AN4A 2FWBA 4UHBA 4JVOA 4HRAA 1HUQA 4MXQD 1G9MH 2VO5A 4UT9H 2R7AA 3RBGA 3VYOA 2XZPA 2FA9A 4UINL 2QQGA 3WHE0 2IPNA 3NRJA 3RHZA 2B5VA 2C84A 5DHRA 2V58A 4J3OD 1T1ZB 1EDQA 4TSFD 1H3GA 4OLUH 2N75A 2O7QA 3B2DC 3LQRA 1N2CA 2JKXA 3B36A 3GFFA 3SCZA 2H52A 1VPOH 3KTAA 1UQSA 1QK5A 2I71A 3VXRA 4ANKA 5E2AA 2JLQA 4Z76B 2VRQA 5HGBA 1FY2A 2RQEA 4I3RL 1EDOA 4L6CA 3P2MA 4LLDA 4PWEA 3CQQA 1NCJA 1MRFL 1HSOA 2AZTA 5LOVA 4MLSA 2CFRA 1PK8A 4NN5C 4TPRH 2BVOA 1NCCL 2W0PA 3SPGA 5D3ZA 4OY9A 1N6RA 4X5QA 3W2DL 3HEMA 4JVLA 3KE8A 3AT0A 4XNXL 4HEPG 4QBIA 3MBOA 2VTEA 4JM0A 5HYQA 1Y6MR 4WNSA 2ITCB 3NBXX 3GHBL 3L3OA 4H26B 3DMMC 4DKTA 4G1MB 3ROXA 1M1YA 5JJCA 1KZQA 3N6YA 4J8RA 2C54A 5IJ0A 4FD3A 3WNBA 3ANLA 1PL0A 1OXSC 4FMCB 1RU9H 3HFGA 5I8EB 1W1WA 2NXNA 3DQZA 3NPAA 5B7PA 3OJDA 2BCKA 5IX8A 3K0KA 2FCBA 3OR7A 4EATA 1DVFC 1ZLXA 5HQTA 3UB3A 2J0VA 1XRMA 2IDMA 4MS1B 1TJPB 5AOMA 2HSZA 1MIEL 1QLFB 3H9YA 2OMBA 2WWIA 9ATCA 4A2FA 5T1JA 4HAIA 5C1DA 3EZFA 1PAZA 4HS8H 2FLWA 1U8TA 1I8AA 5A2KH 1DFGA 1S9YB 5DSZA 3I62A 2X9WA 4X7MA 3N44F 4BVBA 4B8WA 4BN0A 3R0VA 2QGNA 4Y16D 4OW6A 4PZLA 3QG7L 4WGWB 1AY1H 4LGYA 3GLDA 4WVLA 1DUYB 2J9ZB 4MB1A 5TGZA 4OJDH 4NRXB 2YAMA 1TKCA 2QIOA 1R10A 1E5XA 5K3BA 1CR9L 1V7CA 4EY3A 5TS3A 4FG2A 3M70A 1ICEA 4L02A 1UL1X 4P0QB 5IF0B 4I13B 1U1CA 1MX1A 4E41E 4XI9A 1YWGO 4AYXA 4KV7A 2YWBA 4BZ1L 5NULA 1Z62A 1J8DA 2PUFA 1U3JA 1X7HA 2IANA 2FECL 2NVOA 4KEAA 1GG5A 1QUEA 4EZEA 3G2JA 4QI3A 3NM5A 4J29A 2BFAA 2J09A 5D93C 1OWWA 4R96B 3F65A 3MV8A 4BMVA 5C1MB 5KQPA 2HSEA 4BP8A 2F15A 1L5YA 2DP4E 1ZAGA 2X86A 1CDBA 5ID0B 1SAYA 2VA8A 1FZJB 3CONA 4X8HA 3SQDA 1X6LA 5JOPD 3SQNA 1PFOA 1T2AA 4YCSA 2CMFA 1JQKA 3B8YA 2X0EA 2GHZA 3V4VL 2PWAA 3UUFA 4M9OA 3C6QA 2Q1YA 3CUEF 4HGYA 4AQ8C 1NFDA 2C4KA 1SXGA 2TMDA 3BWDD 3LPPA 4P2RB 4A73A 721PA 2ZCHL 2HG0A 4OIIL 2JELL 1C7ZA 4ERSL 5E9DA 1YOVB 2DLDA 2BCJQ 4ATTA 1BZ9A 2OZPA 3NTVA 3ZY4A 1Q44A 2GHQA 2GWRA 3HKBB 2RCSH 1IBCA 3TQQA 5GADl 2BBWA 1YQVH 4WI3A 4X0NA 2BFNA 4M61B 2XQBL 3D31A 4CM9D 3DJSA 4YHHB 4KAFA 1KGSA 3W2FA 2OHFA 3UTPD 1HE5A 3RK1A 3VFDA 3DFMA 1NQAO 4GEKA 5HMMA 2X9YA 4TQPA 1H3UA 4PREA 5DJCA 2X2UA 4HDAA 3B9RA 5GOZA 9MHTA 2IWRA 1FPQA 1K8RA 1TRHA 2HSDA 2VWPA 4HPYH 5J4YA 3MT8A 4KNYA 1EEZB 1QP4A 3WGNA 3BD8A 1A5FH 1E9OA 4ZTEA 4NYJQ 4BB6A 4DHWA 4TTJA 1TJHL 4GKVA 1Y89A 2DQDH 5IAEA 4ZVOA 3Q9LA 4UM8B 4NKRA 2HOQA 2Q1TA 3RTBA 5TIIA 4ZQFA 4DDUA 4ZMSA 5JS1A 2C1EA 2DF3A 1U8CB 3ML1A 4HDIB 3K1DA 1Y4DE 3W2TA 4NFLA 3FTQA 4UMGA 1QKZL 3KXDA 2PJDA 4XYMA 3G1TA 1NGWA 2QMKA 1Z9PA 3MRHA 4PJHA 4N9OB 3CMOH 4RZ2A 2I80A 2FSGA 4GYJA 2ZKMX 2BEJA 5C5EA 1XGUB 2HWZL 2OFPA 2E89A 2VDML 1OF2B 4EZJA 3OUZA 4L07A 3BIXA 1JXQA 4HB4A 2W0KA 2X4SB 4MB4A 1UWEL 1VMDA 3Q8WA 3CF6R 1JFHA 1Z0SA 2IH1B 1K3ZA 3T1YB 4ZVMA 3GS4A 2JGEA 2AMLA 4PHFA 4OLVL 4E3WA 2FFRA 1PAMA 2A2ZA 1L3CA 1JDBC 1T6BY 1S9WB 1RSFA 5FORA 2VDRL 3MRIB 3A0UA 2I78A 1QWOA 2QSYA 4B40A 1QZNA 5C0FA 3DBIA 3ZE0E 1TT7A 1XQ6A 5K1JA 3GRYA 5HYSA 4AJ9A 3Q8MA 4D82A 3FDXA 5FKAB 2YAHA 1RMFL 1DEEB 4A04A 2YMXH 3KLKA 3QUYB 4H7HA 4ZYTA 3KV3O 2IO5A 1JKIA 2BWQA 2D7DA 1VRWA 3NZ8B 3LIUA 3IIJA 4DWJA 3HXMA 1TVHB 4HNGA 3WGIA 3TL3A 2ZPKH 3IDJA 2OPHA 2ZBVA 3FU8A 1R8QA 5EZYA 2IXQB 3Q6IA 2FEXA 1VEMA 3RIEA 4EGSA 3KPJA 4BFKA 4FLRA 4YR7A 4KXFB 2GZHA 4JD5A 4N5MA 4MWEA 3RSFA 2DPYA 2IADB 5C92A 4H25A 3I09A 4EG3A 3L3OC 4OFBA 1IAQA 2IQ5A 4XW2A 2F64A 5EB9A 1WBBA 3EZNA 3S55A 5L4NA 4N2BA 4WUUA 1ZHFA 2NU6B 1TC2A 1X3SA 2NMSA 2XPGB 4IZOA 5GGVY 3O93A 2ALWA 4DSZA 5FNVA 1NVMB 4Q0XL 3TIEB 5CH8A 3DVQX 1JIVA 5BUQA 1J7KA 2CV1A 5CA1F 1ZKDA 2XT6A 2WDPA 3C2AL 4EI5A 1MW1A 1YC2A 3JS5A 3TT1L 1DXOA 3HO1A 4JB8A 2AF2A 4M2LA 3EHBD 4RF5A 2BKAA 1SRDA 3PFIA 1WCV1 2GVNA 5D7LA 3PXHA 3HR6A 2UUCB 5IBUB 4HZUA 2BTQB 4DDTA 3FS9A 3E70C 2BGRA 4N86A 2CBTA 3F4LA 5K99A 5IYZF 4N82A 1KQOA 1GPLA 4NZRH 1PLBA 4HWPA 5B3JF 5GZ3A 2PLWA 1RS0A 2YNMA 3IIEA 4XMLL 4YUAA 4X99A 4ONGH 1G7LA 3AVPA 2NT1A 1BMGA 4FGZA 3C24A 4DVRL 5GGXA 5LBVA 2HVKB 1P7CA 2P91A 5ALCL 3T77A 1JHQA 2XQJA 3QQ9D 1RI8A 4FZRA 4HCRH 2A9NH 3A27A 2DL2A 1K66A 3G2PA 1CZNA 4Q4AB 3AM5A 2FPUA 3ENEA 3UUEA 4UE3S 1C3OB 4MWDA 3UJIL 2AQSA 1IB6A 1JTPA 1MU0A 3OSVA 2WNIA 3ZDZB 4JDZB 2D2XA 2XMBA 2AWNA 1YZGA 1S7SB 4D1YA 1Y7TA 1M3IA 4YH1A 3IUEA 3EJCA 2WBJB 4QOKB 2IDKA 3N8DA 1AT1A 3QDGE 3VFMB 3D0AA 1RR6A 5ITBH 5CCGE 3WBKA 1A4RA 4Z7VF 4HWZA 2QJFA 1T5BA 4C4KO 3UVEA 2OXHA 1R15A 1V5FA 4PJAE 1MCEA 2DQJH 4DN3L 1O03A 2G5CA 1U92A 1F41A 1A04A 3DX9B 4BQNA 5HX7A 5KYYA 5FOSA 2IEGA 4DREA 2D2EA 2G0KA 2WYTA 1P4SA 1GNSA 3UWKA 3O1HB 4OV5A 1HYQA 3VAZA 5KVDL 2WJ6A 4ADIA 1AS0A 2FWOA 4QHKJ 2RJ3A 2Y25A 5AVWB 2BI7A 1HYRC 3BVWA 2BHYA 1FRZA 1WFOA 4MI9A 4F4UA 1RZJL 4ODIA 3UO1H 4QTTB 4H1LH 2Q7OE 4BE4A 3UN1A 4MVJI 4HEJA 4ZEMA 3U46A 3BFKA 3K4QA 5DC9B 3W3AH 4IMPA 4LY6A 4RISL 4BRUA 5D7SH 1XGPA 4ZSOE 1RKVA 1YY8A 4X3CA 3B6IA 4B5LA 4L0CA 2BP8B 4A27A 5CFHA 2O2SA 2BSRA 4GKOA 1FRQA 4TZTA 4D5EA 5JALA 3HHSB 3KYOB 1THAA 5J12B 3UYOD 1NATA 5DHYA 3K96A 3TIDB 2NAPA 3IWUA 1NE2A 4EF4A 4PR0A 5MDHA 1LQUA 3LGXA 3AI1A 3ESMA 3IESA 4G5XA 2C9QA 3BGDA 2HLNA 4UZSA 2Z56A 1T0IA 1M7UA 4XPAL 1H3NA 4MVJP 1Z7YA 3FO9A 4LHUG 2R7NA 3LKPB 5J06A 1LJUA 1RCFA 3TD6A 4V0MA 3DTXA 3OZWA 2VG8A 4KWUA 5DURB 1EEHA 4C0XA 3K20A 1JF1A 2CCVA 3KYMB 4FN5A 3QVAA 2WUBH 2VHWA 3IVKB 3OU6A 2AMGA 2DLIA 5I75C 1QVOA 5C2JB 1FFNA 3NP9A 4IUYA 1D5ZA 2V8BA 8ABPA 1T9AA 2YQBA 3SE4A 5A4FS 1MVUA 3MQ4A 2Q3XA 2D0PB 3OFVA 3D9AH 4NE7A 1XTIA 2YD8A 5HBRA 4BX8A 1L1RA 2G7MC 3R0JA 2V17L 4X92A 3Q06A 5D5PA 3C97A 1IK6A 5BJTA 1BM3L 4R7VA 4NCC1 1Z2NX 1Z8NA 2ZD0A 4PRAA 2MCPH 1F4XL 2VERN 4KW7A 1QG4A 2Z30A 4PO8A 1NDQA 1B6SA 3V0FA 3SEZA 3V0IA 1FV1A 4AS2A 1T0PA 1W0JA 2P9YA 5B5SA 1U9IA 4QJ5A 3BAWA 3LNHA 5DK2A 1VIAA 4GR5A 2WKPA 1HI9A 3UPUA 1H3VA 3UZEA 3UXYA 1ZMYA 1LEKA 5KVEH 1SVNA 3CLEH 4KKAC 4U7WA 1GTFA 5I0ZA 3ARGD 3FMGA 4N2FA 4Z0BH 1N7ML 1LDPL 5EGNA 2HG5A 3OKWA 1JP5A 1P1RA 2HHJA 4MASA 5IJXA 3ZHSA 1YJQA 1NJFA 4PRIB 4B6SA 2EJ1A 3QUXA 4XX1E 5DO8A 4KPUB 4LDEB 2QLJA 1W6WA 4UATA 2YYAA 2KH2B 2EU8A 2NO7A 3S6CA 1R3HA 3PQYD 3TGPA 3HSSA 5EU5A 2CUNA 3NN8A 2XRAL 4MNQA 4KQ3H 1JZ2A 2QLLA 4H1WA 4MHSA 5I8CA 4FQCH 4IDJL 1CLUA 4F72A 2X89A 5AZ2L 5C5CA 3M2TA 3AILA 4C4PA 4KGJA 4EI5C 1VACB 5A2GA 2XZQL 4HEPA 2OMTB 1FG2A 2YZGA 2OP1A 3DQPA 4HCFA 4NK5A 2VH5H 5MP6H 2XU9A 4TTPA 2CO6A 3BTUA 4GFTB 3I3OA 3DXAA 4E1BA 4IIQB 3RASA 5LQUA 3TEXA 2XCTB 5C0OE 1J5EB 3O45B 2RBKA 3ZE8A 3ZHNA 2VYVD 1AOZA 1PKQA 4LBYA 3PV6A 1WCBA 3EJZD 4PLNC 1NHWA 2RGXA 5L6YH 4IIHA 2XZAL 4L9LB 3I2JA 4CQMD 1NYTA 4Y9FA 1G4MA 4KK9C 5DNWA 2GHTA 4TKMA 1G98A 4IHAA 3N5AA 3Q2LA 3AHFA 2YNMC 4JITA 5LQSA 3MROB 1UJ6A 3DZFA 4IDLA 3C5EA 2IGTA 2GZMA 4I3SL 3A9CA 1WE2A 2XHEA 2R56L 4XNMA 4LF3B 1QRUA 3QVUA 4UPEA 2FEEL 3ZE2B 3VH4A 3RGVD 3AT9A 2ZYHA 4S1RL 2VJYA 2YSSB 1HDEA 2NXCA 4B6ZA 4OR1A 4TRRA 4YPOA 2QVCA 4E9RA 4MCHA 1OAXL 4BV2A 2QQLL 1HTBA 1MX9A 3GFGA 4JAMA 5CNJA 4LCWD 3GB7B 1CJBA 4NB7A 1RYNA 1KZ6A 4HWUA 3KYBA 4D2IA 4JCWA 4A2LA 2EVGA 3DDUA 4QWMA 1DJXA 4P4SA 2FN7A 1ZVSA 1PV2A 1BJKA 1MR3F 3IP5A 1G0OA 4FNSA 3AP1A 4R1NA 3TAXA 3OURA 1JGVL 1HKFA 3RSQA 3DDGA 4ZMAT 3K5WA 1ODCA 1AHHA 4G6ZA 1DJQA 1ZGZA 4Q4EA 2HGZA 2VT7A 4JLDA 4DLXA 3QVJA 2GLUA 4GMHA 1NX9A 3V3TA 3QY0A 3ERXA 2WM2A 1KK0A 2A73B 5ICCA 4P22A 1F4WL 4OUDA 1A6WH 3RFFA 1PEKE 1W36C 5FB8A 3PNWB 3JWNC 3IVAA 5F7NC 4X9HA 1FBNA 2I9LB 5GRUL 1EVYA 3R24A 3OTHA 5DNCA 1WFNA 2AOUA 3C6YA 2B5WA 4M7PA 3WBFA 4RABA 2HK6A 2G75A 5J59A 1F90L 2VJ8A 5BS0D 4EUKA 3TWCL 1NN1A 3EXFA 1U8AA 3O3BA 1NVGA 3RWMB 4TT3A 2O8NA 3F6LA 3NX4A 1G7HA 1EJ6A 2VN5A 1NM4A 2XITA 2VSQA 3AU1A 1RSZA 4QBTA 4U2DA 4RZCB 3F7TA 3M6DA 3E7JA 3NIBA 1IAVA 2Z8SA 4MQ5A 3HUTA 2HMUA 1KSRA 2EX4A 1ONNA 5A5EA 3HZMA 2A9AA 5AWNL 2PWZA 2R69H 3OJMB 1O7SA 3WDJA 4FQJH 1GCIA 1NUHA 2P68A 1DUZB 3QXSA 5EMNA 3AF4A 3F2LA 4KMTH 2JQMA 1QHHA 4JP8A 4A2CA 1I3VA 1LPPA 5FTNA 5G40A 1LV8A 4P8QA 2W37A 4NI3A 4XVSH 5KSVA 5D7IA 3LMKA 1U2ZA 1A9EB 2NAFA 4KFCA 3MINA 5SWQA 2FQYA 4V2IA 4L37A 1NJSA 4RTSA 2L04A 4RX4A 2FWNA 1RIFA 4GOOD 1NUUA 3ZWVA 3WJJA 2BDUA 4ZPXA 4OBBA 2ZU6A 4M0FA 3FFOA 4PCKA 1I8UA 4PRYA 3SM3A 1YOBA 2HA3A 4KY1L 1MJ8L 3G6JE 1HZJA 3H83A 5KTMA 3SE4C 1Y8AA 4AJNA 2MTAA 4PI2A 3K6DA 3VNSA 4NOLA 3W9UA 1RZJC 3Q7PA 3JQ7B 3NVMB 3KUKA 3UABA 4LQCA 4WA8A 3V10A 2AQ2A 3SJVE 3F67A 1Z6TA 4TN1A 5KYWB 4FOPA 3N2EA 2NMVA 1IIIA 4L1DA 4IOSA 2V2TB 5K09A 4XAWL 3WI7A 4QDUA 4JI2B 1JNLH 3B56A 4PYGA 3WIBA 4DGVH 3SYOA 1ORSA 4RA9B 4U6HB 1RABA 3MVSA 1O95A 4MYTA 4Y0GA 2R39A 2ZRPA 1M2OA 4P54A 5AIBA 1U9IC 2D03H 5HJ2A 2MCMA 3L4JA 4PY7B 5CHYA 2FDRA 3W04A 4KL8S 5MFZA 3UZEC 5I17A 3B1VA 1DJMA 1U8NA 4FA8A 4FYWA 3MJ9L 1Q16A 3E9NA 3P97A 3PJDA 4MV4A 2WYUA 3IJSA 1T6ZA 4YSPA 3VXQB 2ZSWB 3W2GA 2VWEE 4IV5A 4R9VA 3PTZA 2HT1A 1G43A 5D4JA 4YUYA 1KP9A 2PL3A 3QUXC 4R9HA 2ZE5A 4HDCA 3CUTA 5ALEA 4KOCA 4ALAH 4O9HH 3FXIC 6REQA 3D39E 4NN7B 1XIWD 3FN9A 1JT2A 4K3VA 1T80A 1JR6A 1RJYA 3B7WA 2OJZL 1IBYA 3AUYA 2HPVA 2J3QA 4L8GA 1MCZA 9CGTA 3X13B 4PCYA 1E3WB 2PRZA 3WO4C 1PNVA 2P43B 2ZQZA 3AJ7A 1YZVA 1F9AA 1Y5RA 2UV8A 4CV3A 1AMUA 3EFFA 1JLRA 1QI5A 2B6HA 4FXKA 2W0FB 5FI3A 4W5JA 1KQPA 4W1SA 1L4LA 1W0KA 2WD7A 2AHRA 5TQJA 1N36B 3GPEA 1QUFA 1M0WA 2GH1A 2NQ8A 3PRJA 2A1UB 5CM8B 2B16A 2AQTA 4TRPH 4KE6A 5LUMA 1KIUB 2XQVA 4PC3A 4CSZA 4Y5XA 2VUSA 2OCGA 1X42A 1J8HA 1EJOL 4Z4FA 4N65A 4G59C 1ZOOA 2NYUA 3PNYA 4OGYL 5A03A 3PX7A 5FUQA 4MA4A 2CLLB 2PX3A 1PF7E 3AI2A 5DZAA 5E2UH 4LOUC 3MJ9A 4HAWA 4CM1A 3T65B 2ATKA 1GIGH 1OM3H 2IIQA 4PG2A 4ND5A 2ZB4A 4X6DB 2YOFA 5J2TF 2Q49A 4IGEA 3ILQC 2BBSA 2PKXA 3LYHA 4ZMVA 4UUOA 1PYOA 2FOLA 4J8QA 3TX4A 5E94B 4YLGA 2BM9A 1Q92A 3TEMA 2KLTA 3MJDA 4XPTH 3T4YB 1AIFB 3D09A 4W5TA 2X0KA 2DF8A 3MTGA 1PEWA 5DCWA 4ERNA 4QOGA 4D9MA 3GLTA 3ZZLA 3JWPA 1Q7GA 3V5KB 2HP4A 1PJLA 2ID7A 2IBGA 4NBRA 1W6LA 3SR0A 2CBGA 1ZYUA 4GPAA 4JE0A 4YMHA 2C5SA 2FMIA 2WMYA 1P0FA 3LBIA 4Y9CA 5JAMA 2WLNA 2UZ4A 1OLXA 1ZY9A 5E1MA 4UHEA 4J0JA 2EABA 1QIDA 3T5MA 4TLEA 4JY6B 4G42B 4FLMA 2I2FA 2WHVA 4YDNA 3VDAA 4KWEA 3CH1A 3V7YA 1VPTA 5E4OA 3VFTB 5KS9B 5E00B 4PPFA 5FDWB 1I8IB 5H37G 5BRZD 1AGNA 5I8OH 1NKOA 5EZSA 4F7TB 4KXLA 3DE7X 1G9EA 4KR9A 4WFHD 2A57A 4B75A 2W59A 4M1DL 5J9PA 5CAEB 3B9QA 3WMRA 1YTLA 2OB1A 4UOEA 5T1LA 2VGLM 3FIUA 3S2ZA 4MWTA 2COVD 3FQNB 4DIKA 1X7YB 3WG7B 4ISCA 2GEVA 4WJZA 4QAWA 5HGHA 1KBZA 5D6NA 2BNRB 3GZOA 4D3YA 1AMOA 3HUDA 4NO5A 5EIXA 4JN1H 1WXGA 4PJFE 2V8LA 1KENH 5ITZA 4FFVD 1XOIA 4YRRA 4L1BA 3EMVA 2BT4A 3P9ZA 3KELA 3WBDA 4HYYA 4P4UA 2WTPA 4JDEB 1BJ1J 4PG7A 5T4FA 2IEBA 1N77A 1ZTMA 4DY6A 3P02A 1DO0A 5I4IA 5C09A 3KLAB 2WANA 2YWYA 5IARA 4PGBB 3KTFA 2JLLA 1E65A 3ED1A 3ZQXA 3N58A 3OZIA 3WJJC 4ZJUA 4PH8A 4GU5A 2QW1A 3TBKA 3HP1A 4KH0A 4KODA 4KXBA 3VV3A 4IRSA 5H0IA 3TW8B 3UNXA 4DKDC 2YPVL 1SM4A 2EJUA 2QYSA 1YECH 3SJ7A 4BEJA 1L4EA 3LEYH 3DMPA 3KETA 2WTRB 4W4NA 3KYKL 2XBTA 1FTQA 4EFMA 1ILWA 1N2XA 3B3IA 1M5TA 1OB1A 4PUBL 1UZLA 3O9VA 4LHUA 1LJMA 5BSMA 5E8RA 4MRRA 4UASA 4M7KL 3GLHA 1QX4A 5BO5A 3BC1A 2V6BA 2Y6VA 1L0YA 3QJXA 2H2SD 4I5BB 2GXSA 3EEQA 2P48B 2C7OA 1QMUA 1RJZA 4IIXA 4CGYA 4TKVA 1XUOA 3W6PA 4JT9A 1S78D 5EQTA 3OAUH 4UZEA 5MGNA 1V0JA 4I1PA 1A7RH 2A0UA 3ROOB 2FEAA 1EPUA 1O95C 3B3JA 1OSZB 1C08B 4MPJA 5KX5B 5G3YA 1MHPL 1W29A 3RFXA 4AM0A 4AG4H 2XQIA 2A1TR 2Y1FA 1C9YA 1VFAA 3QFJA 1B0UA 3STXA 1R5BA 4PSRA 1UEJA 3FUUA 3OLZA 1BVLA 3SBEA 1EIBA 3GQBA 3FUFA 3VA2C 3EC1A 4L0YA 1FYDA 1E9DA 4JRYB 1F3DJ 1XZIA 32C2A 4HIEB 3L4BA 1SHZA 1OC4A 5C0GB 1JHOA 1PZCA 4LHXA 4BCCA 3A9WA 5KVFE 2O2IA 3UGUA 4GVLA 2OM6A 4B27A 2WU1A 4NLLA 4JLPA 1KYXA 1Z2DA 2ZONA 1P29A 3LQYA 4LLYA 1J1XL 3EJSA 3VVBA 4LFCB 1QBBA 5CVUA 3H42H 5HYJA 4EMSA 1G2QA 5T3XH 3FTZA 2ZSFA 1G2PA 5CFRA 4UNSA 2YPVA 1TQ2A 3U0BA 1WZUA 3UMFA 4XNUL 5IJ9A 3T7DA 4IU2B 1J24A 2X53A 5EOCH 1H42A 4BVKA 5FDFA 1R4ZA 1TGYA 4AIZA 4FXKC 2YJGA 1QYWA 1UJ3A 3ETNA 1A71A 2UVFA 1Z56C 2VNCA 1L9RA 3A05A 4C76A 4JQZA 5JWHA 1U31A 4Y5XC 4ZI8A 1D5IL 4D0BA 2QMUA 4R26H 5AVKA 4JPWH 4XQCA 3UB2A 2D0HA 3LOPA 1FVFA 2BW4A 1Q9KB 2VLME 1B9ZA 4E32A 1TMKA 2W6JD 4WNAA 4HK0A 3U1SH 4DFDA 1O96A 4BQIA 3BRQA 3BEWA 3IMRA 4KK5C 3UATA 1YJDH 3WB9A 1FXWF 4PG2C 4J6IA 3CFCH 1MCQA 3EZ8A 1A4UA 4LB8A 4HXEB 5A5VA 2W2MA 1WY5A 2I26N 4AF6A 2IOOA 4G65A 3SDCC 3K5HA 3RC8A 2CKMA 1A1SA 4C59B 2YVLA 4OATA 4XIYA 5DLMH 1HSAB 1A5SB 1HI6B 3D1MC 2H6EA 1G7QB 5ALBL 2BVNA 1KYOK 2YC1B 3TOZA 3FSEA 5FPYA 3QG1A 3NIFE 3P4NA 3ETDA 1I7UA 5IHWA 5EQDA 2P1ZA 4QGTA 2B2XH 3K1KC 3I23A 1WJ3A 3WV4A 2OORA 1FNGA 5EO9B 1V95A 2QGDA 4YN3A 1BHGA 1QH1A 3RUGE 2FGKA 2YZNA 2ZT7A 4KQ6A 3KL3A 4Q1DA 3ESQA 3K9LA 1RXYA 4CG0A 1Z29A 2A6PA 4UTBH 1L7XA 4DW2H 1KBQA 1FAIH 5BQ3A 1HKLH 4LPWA 1IM3B 3NA9L 4UWQB 2JCWA 2QPUA 2V2XA 3IO5A 1QFJA 4LLVB 1H2FA 1LSJA 4ZV9A 1J1OH 1HHIB 5CU7A 1DFXA 1VJ0A 5BN3A 5G0UA 2QT6A 3AR6A 1FFCA 1QA9B 5G41A 1EAMA 1L9SA 1RCTE 1E1RA 4FDMA 4Q9CA 2W4QA 1TTTA 3LQMA 2FPLA 3ZE0B 3PGJA 4P7BA 1WLYA 3WXWL 4JB9H 2IYRA 4LLUB 3PXBA 1DKQA 1AB5A 2PL1A 3I9FA 1CQKA 4PBWD 3NGLA 3DURA 2BM0A 5AB0A 2DDQL 1S3IA 3BP4B 3FU7A 2ZJ0A 2WNWA 3NU1A 3OKNA 4PR3A 4XVUA 2EACA 2MPAH 1MJJA 2DQFB 3ZCPA 1IBSA 3JTBA 4OHPA 1G2OA 2AXQA 3F9CA 5CYGA 4PYNA 5KYKA 2XC8A 3KPRB 4FQQA 1SEQL 4P32A 5CR9A 1L5GA 3VDNB 3WNOA 3ASZA 2Z1DA 2OKMA 3E81A 4I0KA 2Y1GA 1Y3CE 5AYUL 3N2YA 1OX6A 4HDRA 3GSRB 1CF8L 1E92A 4GPTA 1TLKA 2XNDD 3HNVH 5IMMA 2DX7A 4H31A 2UYCA 3QO1A 5MENE 4I50A 2QWXA 3GBMH 1OILA 3HCOA 4IRSC 2AEQH 1HQDA 5DBEX 1M76A 5GV7A 2OQVA 4WBNF 2BDNL 4JZOA 4JQIL 2ZYAA 4HPWA 4EY4A 1MBZA 1QRTA 1GYQA 2HVJA 4WKOA 2HLDA 5E5MA 3ZGLA 1EZLA 2NTJA 1HQKA 2AMYA 4F58H 1P2TA 1Q95A 4NJ9H 2BS8A 1TUBB 4JYMA 4D9EA 5D1XA 2F1IA 2CBQA 3O6MH 1UYWL 1TJGL 3W6ZA 3MLYH 5BNWA 3BMQB 1P4BL 4FX5A 5C8DA 1X13A 5E6IB 4QTIH 4FUQA 2QPTA 5TRTA 2EH7H 5F7JA 4QLWA 2JKWA 3SICE 1ESMA 2V3DA 4BLPA 3AJ9A 5I9NA 1PSWA 1IN8A 4ZMPA 4JFFB 4Z95H 3AUJB 4J3UA 1SH7A 4HIHB 4GM0A 4I3HA 1YO4A 4XJVA 4F8OA 2NU8A 2OMYB 3A5VA 4WL0A 3IFPB 1QR1B 4QXRA 1UENA 2IPMA 2WWXA 1CO1A 1A2YB 1HHGA 3Q4GA 3OMIB 3EZYA 2ZE7A 3L4BC 1NCTA 2I60H 2O2XA 3ITDA 3K9BA 2A1IA 4OQTA 3QKSB 3ZXIA 5JXHA 1D5MB 1QW9A 2F00A 4DAOA 4PY8I 3KHKA 4FKBA 3MNMA 2XNSA 3ZXUB 2W91A 5UKDA 3NSYA 3RYCA 4KTYA 3L6RA 1NIEA 2Q4RA 2GQ0A 4MUYA 2DG2A 4GKJB 2HCRA 4ETNA 1YFZA 4NMLA 5GSVA 3WK7A 1ZOIA 2WJJA 1JPVA 1WMFA 3PIIA 4N8CL 4EPVA 3KWJA 4LDAA 4BNUA 1VGEL 2IUYA 2QUZA 4NTZA 1G38A 3RX9A 1IKFH 4OTXH 4MTMA 3SJAA 1UPBA 5H4YA 1UJ3C 4YJ3B 2CYAA 2CJUL 2NXYC 4PJAB 4X66B 5J40A 1PD0A 3S2UA 2BEKA 1M2KA 1QG3A 4A15A 2AF4C 2J8UA 1GARA 5GY7A 2B20A 3HA2A 4O8CA 1ZIAA 5D8JL 4A0SA 3GD5A 2BJVA 3I30X 4BV1A 1DQQA 3H9HB 5CBEB 1OGJA 3CUVA 3WUWB 2YOCA 1QRND 4KHPB 1L5SA 4B4OA 1EMTL 1HZHL 5DMJB 2NUTA 4HXGA 1ZRUA 4JCLA 4EKIA 1S7XB 4OEHA 3N2JA 1JZ7A 4FP8L 3RV4A 3GOHA 3KS9A 4FYMA 3D3JA 2GCGA 2FX9L 3EK2A 4Q1BA 3QXHA 1JZTA 4CLHA 3LHKA 3QCUL 2GZRA 2WXOA 1ZHNA 4QDZA 3WO3B 4KX8A 5CFOA 3OJWA 4F9LA 4WVFA 3JYOA 2A6DA 1SN5A 4D9HA 3VSUA 1C9EA 2YFQA 5B7MA 1W0VA 2R15A 4NIMA 2OL3H 1PDVA 1WW3A 3OQIB 4OYLA 4HGWB 4YWHA 3GSVA 2FDXA 2BVTA 1XP8A 2WLLA 2V0CA 1WKCA 3PXLA 1J56A 5E2WL 5FB3A 1KZHA 1DFHA 1HH9A 2JCYA 1RI3A 2OORC 3BUSA 3X2EA 4XWTA 1T5HX 2VXCA 1R66A 2P5WD 4A8HA 4HXBH 3A4VA 2VXQL 5CEZL 3UKOA 4ECEA 3V48A 3V0WL 2NY7L 4JJKA 3LIIA 3F58H 4LYGA 1HVXA 2EO9A 3VRJB 4P0PB 5K8IA 5BXFA 3OQ1A 1XVSA 2I4TA 3MUGA 2LVBA 3MUZ1 1YUBA 5AW6A 7FABH 1WLSA 2GJ6A 1G5HA 3UK6A 4P3PA 3IETB 3K8QA 3WJMB 1Z06A 4QHNA 2AFVA 5JW5B 3W06A 1ZSNA 5KUKA 1EXNA 1DIHA 3QQ4A 3N5KA 3GMRB 3ZPDA 1GNTA 4UUPA 2V54A 2ZIAA 4MCAA 1SVBA 3KQWA 4XSHA 2P9CA 4XE5A 3USZA 2VOJA 3HKCB 1V2GA 1T6YA 3PDDA 2HY7A 3HC2A 3ICOA 4GOXA 3SQWA 2VPTA 3NWBA 1ONQA 3BDXA 3Q7EA 3FSZA 3KSRA 3MVEA 4WI1A 5IHBA 3QAZC 5JIKA 4I88A 3GLEA 2WWKT 4XVUC 2B4RO 5JPMB 4P0TA 5D85A 2ZQKA 1NLDH 4FQXB 2BH2A 1RVFL 3FB1A 3C41J 3VU2A 1CIJA 2NZYA