1TYEB

Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
440
structure length
440
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-IIb
publication title Structural basis for allostery in integrins and binding to fibrinogen-mimetic therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 115
structure length 440
sequence length 440
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 1tyeB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 1tyeB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1tyeB03
4M76B 2ADFA 1MQAA 1V7PC 4A0QA 4F1JA 1PD0A 5E6SA 3BQNB 1UEXC 4G1MA 2NUPB 1FNSA 2XGGA 3OL2B 4WK4B 1BHO1 1MQ8B 3EGXB 4HQKA 1AOXA 4WK2B 1M2OA 1XDGA 5HDBB 3V4PB 3FCUB 3ZE0B 4UM9B 5E6UA 2NUTA 4CN8A 5KYXA 1DZIA 4FX5A 3RAGA 1RRKA 3Q3GE 3HXQA 4MMYA 2NUTB 5E6UB 3ZDYB 1LFAA 5KYXB 3ZDXB 3ZE1B 3OL2A 2WW8A 3AL9A 3N2NA 2X5NA 3BQMB 4MMYB 4HQFA 1FE8A 4Z7OB 1M1UA 1ZONA 3K6SA 1PCXA 1OLZA 1Q0PA 1TYEB 1MHPA 4MMZB 4HQNA 4FWWA 3EFOA 1RS0A 3T3PB 1QC5A 5KYYA 3EG9A 3HXOA 4BJ3A 3K6SB 3TW0A 4WJKB 3VI4B 4Z7NB 1DGQA 3EFOB 3ZDZB 3ZE2B 5ES4B 2UZYB 2VDKB 1QC5B 2M32A 5KYYB 2P28A 4MMXA 2ODPA 1M10A 4JDUA 3AL8A 1AO3A 1AUQA 3QA3E 4IXDA 5E6SB 4G1MB 3VI3B 1ATZA 3AL8B 1IJBA 4Z7QB 1IJKA 3NIFB 1SQ0A 2I6QA 4IHKA 1U0OC 1NA5A 2VDQB 4F1KA 3NVQA 1M1XA 3EGDA 1YVPA 3ZQKA 3EH2A 2VDNB 4O3UB 3IJEA 3NIGB 2VDMB 4O02A 1PT6A 1QCYA 2WINI 3BN3A 3E2MA 4WK0B 3F78A 3EOAI 2P26A 1M1XB 1CQPA 1T0PA 2ICAA 5KYUA 5BV8A 3IJEB 1N9ZA 2VDOB 4CN9A 3OKYB 5HGJA 5KYUB 3EG9B 4C2AA 2NVOA 1MQ9A 5E6RA 5HJ2A 1MF7A 4GZ8A 4PN7A 3OKWA 4C29A 2B2XA 1XDDA 1YUKA 4XW2A 4MMXB 4NENA 1CK4A 3T3MB 5E6RB 1U0NA 4HQLA 1JV2A 1SHYB 3PPYA 3AFCA 4K3JB 2NUPA 2O7NA 3EH1A 2IUEA 4G1EA 3F74A 1T6BY 4JX0A 1RTKA 3FCSA 1SHUX 3EOBI 3TVYA 1JEYA 3PPWA 1L5GA 3PPVA 4G1EB 1IDN1 1JEQA 1OAKA 3FCSB 3EGDB 3TXAA 1JEYB 1RD4A 4HQOA 4O02B 2VDLB 1L5GB 1BHQ1 5LN1A 2I91A 1JEQB 2QTVA 1YVRA 1XUOA 2XWJI 1JLMA 4UM9D 2I6SA 1PD1A 3PPXA 1U8CA 2VDRB 3NIDB 4WFQA 4CNBA 3K72A 2XWBF 4IGIA 4DMUB 4NEHB 4UM8B 4MMZA 4O3TB 3GXBA 1U8CB 1M2VA 2VDPB 3IBSA 3TCXB 5KYWA 3K71A 3K72B 4C2BA 4NENB 1ZOOA 1JV2B 1M2VB 1ZOPA 5KYWB 1MJNA 2ODQA 3K71B 3V4VB 2VC2B 1SHTX 3HI6A 3M6FA 1IDOA 1N3YA 5KYNA 3EGXA 1SSLA
chains in the Genus database with same CATH superfamily
4XMZA 4MULA 5F7DA 1RQ5A 3PE6A 3SDYH 3H8SA 2B4TO 1ZLUH 2VERN 2F1EA 3DF9A 4TSFD 5D7IE 4QU0A 4MXWH 3IU3B 4YRMA 3GRFA 3QMVA 1TQVA 4G5XA 1JH9A 3QUYB 4HIEA 3SOBH 2P6RA 3OCCA 2IOFA 1ID5I 4OF6A 4XAWH 5FCSH 3QLVC 2OSBA 4ZG1A 4O4LA 4R0LC 2PX2A 1O6ZA 3QO0B 4AKQA 3IB3A 4PB0H 3D3VE 5F21A 3FQTA 2BIHA 5JMWA 1WPRA 2GHZA 4EQ2A 3E18A 32C2B 3CN7A 5ITFB 3CFJB 3R6DA 1CERA 4OI1A 1R3HA 4ZOLF 1DLJA 1EUCB 3QXJA 4Y6GB 5CFAA 4IXTA 3AJAA 3U2SA 1B4RA 3ICPA 2GEKA 3F6SA 1SIBE 2ED8A 2DQEH 4XCEB 1NLDH 4TUYF 4YAGA 1DEEB 1LO3L 4AENA 3ROLA 3BAYA 3LN4B 1CGXA 1HL8A 1RHFA 1P84K 5EE9A 5GGYA 2J6IA 2HUNA 3CUYA 1M9NA 4Y0GA 1FFDA 2XRMA 3VVVA 2NPLX 2DL2A 2C4KA 3RGHA 1CUHA 4N0MA 4KGVA 4TXJA 4G97A 5I7VA 3GSNB 2BMEA 3RS3A 3S3DB 4NCNA 1WZEA 2ARJQ 2DMKA 2H0QA 4ADIA 3K05A 1YN7B 5KAQG 1TCAA 1TQCC 2H7VA 4J7RA 4M1TA 3RVWD 3TUIC 5AZEL 1SYVA 3EADA 1GRQA 1XD2A 4FTDA 1OJLA 4D5GA 4ZO9A 1Z36A 3TUJC 1MD9A 1A64A 3WHE0 1H2HA 4NC1E 4MRNA 2RGYA 3HKBB 4O2BF 4KROB 4URFA 4HCRA 3LY7A 4US1R 1UOQA 3T9EA 1CN4A 1G2OA 3EVTA 2FOIA 5I8EA 1UG9A 3CGTA 4H20H 5A2IH 3OSVA 1HHHA 3LDGA 4JFEE 1MDBA 2J2ZA 4PZDA 1TR7A 4DJMA 1T5WB 1VJGA 2HZBA 3GZTB 2LR4A 3PI7A 2FN8A 2E7LC 4JFDE 3NPSC 4B3SB 2BGNA 2VZOA 2I60L 1EVZA 1BQKA 2QP4A 4A10A 1A5FL 4GXFA 2SCUB 4I6EA 3X1KA 2FPIA 2P44B 3BMVA 1XAHA 2IDMA 3ILSA 3RX9A 4CQLA 1TKRA 1QK4A 1WZNA 4H3KB 1SXZA 4XAQA 3HI5L 2C57A 3L5XH 4IKIA 2JEOA 1EGVB 3MCWA 4EB6A 4PJ9A 2C1OB 2JJVA 1BVRA 1X94A 3WRYC 2RGNC 2ZJ2A 4MICA 4AVIA 2AV1A 4I1UA 3TBHA 4A66A 1FU4A 2GETA 5KVMC 3CH7A 3KWJA 1XH0A 4WZZA 4GSQA 5TQ0B 1HI6A 4UCQA 1XXFC 5CX4A 2IP2A 3AEUB 5DZAA 1PQUA 1VBMA 1YJDH 4FP8H 5IAJA 1TW3A 2FHFA 3TFWA 4IAOA 4LC0A 2I7SA 4MUNA 4QDJA 3VFTA 5CNIA 2JFZA 3L43A 1NQOA 1EGAA 1XQYA 4CU2A 1UFOA 4WU7A 4J4PD 4RDXA 2FEAA 2QGEA 4QRPE 3A28A 4CC1A 1DEAA 2QP3A 3CFBB 3PC2A 5CHNB 2XWSA 4P2RD 3ZZSA 1IQDB 2FEMA 2VJKA 1T8WA 1JLLA 4I18A 1G5TA 5BWBA 4MKIA 1P44A 2DDQH 2PR2A 3RTBA 2ZRCA 3MI6A 3RC2A 5I4BA 5E6RA 3T2OA 1YZTA 1AQIA 3MJDA 3T3MB 1ZVNA 1IUKA 1GPH1 1IEWA 1VSVA 1WY5A 2HJGA 2Y0CA 3UTTD 1K1EA 4DCOA 1CPUA 2IWEA 2QGCA 3NBKA 1OPGH 3FSEA 3GEBA 4LX0A 4IRJD 3NZEA 4AE1A 1ZH2A 1HDIA 3HYCA 2HHCA 5KJ1A 4PCAA 1T26A 4NKMB 4S11A 5LXTF 3ARFB 1TZKA 1V7QA 5AW4B 3I34X 1SKMA 4DVBB 3DZFA 3Q7EA 4Q1AA 2YQ5A 2G8LA 2H4HA 1IC7L 1ZE3H 2K8MA 5IB2A 1J05A 1TGYA 3O0RL 2QLFA 3BW9A 1UWGH 4PG9B 4KNTA 5DD6A 4XUEA 2A0KA 1M6YA 4HPOH 1L4MA 1OKKD 2X76A 4HHEA 3IT8D 3KR9A 3GJEA 1M83A 3AFNA 3OG9A 4NO0D 3PYLA 2Y5EA 3G0GA 1KTRL 4E41E 4M5ZH 3K5SA 1QYDA 5EFOA 2FT7A 3NYWA 3I53A 1V5JA 2CLOB 1X8KA 5D7IA 1IC4H 1CJBA 1A72A 4C5BA 3QXWA 4G1MB 1VHWA 3C48A 5BN4B 2I67A 4RE6A 1DAPA 2NR6C 4BRUA 3FNKA 5INTA 1GCYA 2BVOB 3OCJA 2VJYA 3NFSH 3IE1A 1D8AA 3AV3A 4KBPA 3ARDD 1CQPA 2J3DA 1F8YA 2XQBL 2O3RA 5ALDA 3V3TA 3Q88A 2JHFA 3D3VA 2PR7A 5CR8A 4MV4A 5D7EA 1VACB 4JYMA 1PX0A 3MKGA 5C0CE 2XUOA 3WD5H 1P75A 4CM6A 3WE7A 2GK4A 1M1NA 3QRFM 2JA2A 2OXTA 3LC2O 2IBMA 4AGOA 1AQMA 2EDXA 3IBYA 4HJIA 3QSYA 4DARA 3MO1A 3LPNA 4ZI7A 4WDIB 3OI7A 4JGJA 1ZC4A 5E2VL 4U1HA 5DEZA 5L7TA 1OX6A 4KO4S 4PVMA 4YJFA 3DBHB 1GZQB 3DF7A 2E9GA 4WL0A 1PVOA 5EZJB 5MN4A 2RHLA 3K9QO 3QEUB 1W52X 3IAS1 2E7DA 5BWNA 3OT4A 5HGHB 1HDEA 2HPTA 1G7HB 4TN9A 1U0TA 2DFTA 3EYSL 3UEZA 3N59A 4B9JA 4DUVA 3OVMA 5C0AD 2E87A 1HE2A 3ZKWA 3FMGL 2E3VA 3FWHA 4EI5B 1RPKA 3LCYA 4Z7WE 1ETA1 1W85A 1T0HB 5BSMA 5G4OA 3BPCB 2CF6A 3BM5A 2PW1B 3DJYA 1A6TA 4X1YA 2HQ1A 4FEEA 5E08H 3VPSA 4X41A 5DSZA 1YYML 3AIOA 1E9BA 3VFWA 5JI3E 4CE6A 2HAZA 4G6AD 3DMRA 1R0BA 2WP0A 1LK2A 4YL9A 3C3AA 3S9DB 3E2HB 5ICZA 3H4MA 3AWFA 4JFEA 5I82A 4HGPA 2ADJA 3PPVA 3MN1A 2PAFA 2SKCA 3OPNA 5GRJH 4AG3A 5FD8A 2XPZA 2JNWA 3RV3A 5KSVA 1PQWA 4U7PB 1O9HA 1OP9A 1IAIH 2WUVA 4OQTL 3DI3B 4J5VA 3L01A 3B9KB 1L5QA 4L50A 1LBEA 4IV5A 1D5CA 3ZBPA 1EX1A 2WBXA 3EO9H 1SVUA 3BMNB 1E3ZA 4DLPA 3EX7C 1WQVT 1W76A 4MVBC 4TSAL 4QYIB 4YUYA 3D7LA 2H1XA 3MCKA 4R8MA 3VU3A 3IV7A 3F7VB 3MLRL 1S8NA 2DFKB 4LRWA 2ASEA 3P26A 1R6XA 4BJLA 4FQQA 4JZJB 3C1TA 1ZJWA 4BU0A 2Y9PB 1Q1BA 4H7DA 4N5IX 2GBGA 3MACL 2X6BA 4PGDB 4KXWA 1F4XL 5LC1A 2J1KA 1H23A 3KT0A 2VATA 4BC0A 3ZK0A 2W8CA 4F84A 1WWWX 3NUZA 2EX4A 1B8PA 4GSXA 4ZGBA 1XRQA 2X86A 2XT9A 3SIXA 3QB7C 3W6NA 1RM0A 1GY2A 1ZGBA 1SBZA 5LUMA 5E0KB 4QRPA 4E5VA 1KEUA 1WD9A 4C88A 1JG4A 1QO3A 3NHRA 4R1UA 3FU7A 2PCPA 3GEDA 5AQEA 3AEQA 1TU0A 2Q21A 1N5RA 2AFIA 4ODIA 4WD3A 2H1FA 4HWNA 1BFDA 3A3YB 4XPAH 2PXXA 3H9JA 1MIOB 1I8KA 3ZLQC 5GGVY 3AT8A 1I3LA 4B85A 2BFPA 4QM7A 2YPVA 5EHNA 2H7WA 1I32A 1GT91 1FQJA 4ZXBB 2ZVPX 5ICYA 1RIVL 5HGBB 5KZCB 1JDSA 1Q6YA 2VF7A 2B0JA 2HF2A 3UG3A 2XWBF 5CK4A 1XZMA 2R2GA 3KQKA 2HTLC 1RUMH 3OX3A 4UE3S 1W25A 3EUWA 4RFLA 3K73O 1T10A 2HU7A 2QGZA 1VL0A 3RUGE 4G43A 1HZHH 3GTTA 4RAOA 4UQAA 1T4CA 3RD5A 4BOYA 1JZQA 2JCXA 5C7IO 1CTMA 3DURA 1LFAA 2KMWA 5E23A 3NBNA 3OE7A 4Y18A 2GJPA 1RRGA 4OHWA 3N1GC 4ZVOA 4HHWA 4ISVA 2F3SA 1N5MA 2GHQA 2HDHA 3MNVA 1TIKA 1UWFA 1H0RA 1II9A 3COPA 2A1TS 1XGQA 2Q7DA 1MGPA 4KRYA 1RHQA 4LF3B 3EFDL 1RZPA 2CA3A 3O1LA 3SBQA 3IBEA 3QDGE 1U8OA 1JN6B 2W00A 2QM0A 4X0KA 1ULTA 1VSQA 3PV0A 4FFSA 1BX1A 1PT6A 3CRQA 1PJRA 5D1QE 4PJ7E 4L8SB 4CFZA 2I7DA 1U9IC 1HQRB 3R1GL 2NTYC 5JBNA 4GMTH 4CTMA 2ECKA 1U8MA 1I85C 3VHQA 5DA0B 1Q9KA 2F64A 3DYMA 2VXTH 1LPPA 3WZLA 4H0CA 2DICA 3VAAA 1WFOA 1RIUL 1T5OA 4CMEA 3OQBA 4WI1A 2L7UA 5KVAA 4B9GA 3LX5A 3RBVA 4L37A 3JVEA 5F12A 2R6JA 4AI6A 2D31A 2YXMA 2AHIA 3TBBA 2OSLA 1E7UA 1PE0A 5DI3A 5FR3A 5IAOA 5LMZA 4CTJA 2G0NA 2CVQA 2I3AA 3HE6D 2GSDA 2BP0A 3QXDB 1SKYB 4N0QA 4J3OH 1KEKA 4OIMA 5AZ2L 5EO0A 3BT7A 4B7XA 4DT2A 1P5HA 4II7A 4M21A 3QEGL 3PUKA 1KI3A 2VSQA 2LTAA 4CXMA 5IBUB 2B1HH 3ELQA 2D73A 4ID3A 5DN6A 1CTOA 4LSVL 5EP3A 2YJLA 2WZ6A 4FTVB 2ENSA 5K93A 2D2EA 3SBEA 3U36A 5KQRA 3PHOA 1OP4A 4EZMA 5BMFL 3L4SO 1QORA 5C1DA 3E5MA 1H3NA 2HVKA 3W5IA 1W2WB 6PCYA 3HFJA 1C7SA 3TM4A 4RZQA 4P4KA 1XFPA 4QYXA 3WEXA 4EHJA 3P0YL 3KB1A 3B7SA 3HR6A 1MB2A 4O5LL 1DAHA 1Z33A 3STTA 1E4HA 3WHXA 3AAZA 4UHDA 3RIAK 5HE8A 3LKSB 2CUNA 3SC2B 1YMHB 3ZKXB 3TTWA 3T1NA 1HNGA 4Z7WA 1WCWA 3TR0A 3AIKA 5CEZE 1LEGA 4FE9A 4YC7A 4PS4H 1XQ1A 2J6CA 4XMUA 1AHMA 2VCEA 3VXRA 1T29A 4JANA 1KWKA 3RWGB 3MODL 3JATB 3OZCA 2ACEA 1EHLL 1WMFA 5FKAA 4D96A 3KJGA 3HO6A 4N76A 2ZOUA 5CIWA 1I8UA 4FGMA 5CXUA 4NQEB 4AE0A 3NUQA 4OM1L 3HUEA 3CUTA 5FPPA 4WY7H 1C14A 3E1SA 1DELA 2Y7MA 3ANLA 3AF5A 3OKPA 1RULL 1NIAA 4PI2A 4W4OA 1OWLA 1P0PA 4M7WA 4F3CA 4UQIM 4UQEA 1G1CA 1NQAO 3V1MA 1I9RH 4EMZA 3LXXA 1NVEA 2R4RH 1U0FA 4M7LT 4WN9B 4WW0A 5GJCA 1S3KL 4YMIA 2RCSL 1W93A 3KXIA 3BXGA 3RPBA 1DJHA 3KZKA 1JT9A 2BR4A 1E3JA 3KAAA 5JC8A 2WXOA 1H3GA 5FO1A 5LCVH 4KGXA 5EORL 1VL2A 4JBSA 1AZRA 5EE1A 2TSBA 4BPRA 4L2IB 3SVZA 4B9EA 1RRCA 2D4AA 4NMMA 4H1LA 4D97A 4HK4A 4X3OA 5GIRB 5DMKB 4ALAL 3EWIA 2MT9A 2W9XA 2ZUBA 3CVUA 2BFFA 1EXWA 4C6SA 5LQJA 2ZZKA 1MWAB 3WQQA 3ILDA 4X1KA 4PR0A 3J81A 1JRHH 4XE5A 3QG6B 1RCTE 5K8IA 3H97A 4O51A 3WIUA 2YJZA 5D6NA 5JV5A 4XP4L 4S0TD 2OM6A 5K0TA 4YRJA 1JQLB 1K6JA 1TCMA 3LLUA 4ZYXA 4DUZB 4P2AA 3RCBA 1ZT4A 2GYSA 4QWWC 4F57L 2WJPA 3GLVA 1VA5A 3V6FB 3VH1A 5DSCA 1KTDA 1SSLA 2CJXA 1ZHBB 2XW6A 3VYOA 3G5AA 3FN0L 3QSGA 3L1HA 2R8ZA 1BQ5A 2ICWJ 2P30A 5A16B 4HWGA 3R8CA 2QDXA 3KB8A 3Q01A 4RISL 1S2NA 5DYTA 2UY6A 4PCSA 1Q90A 1TF4A 5F7YC 2NQ3A 4FLQA 3WFBL 1RJZB 1IQRA 3LLCA 1XDTT 4YHKL 4CUKA 3R4VA 4XUDA 3SHTA 5FB3A 4REMA 3DIVA 1BG9A 3ECCA 2HV8A 3D5TA 1JGUH 1XH1A 2OBFA 3LPAA 3VYRB 1ZXLA 1BSIA 4ZVKA 4PJ6A 3ELBA 3SIKA 3QDGA 1PG0A 2DBVO 1ID8A 1H66A 1A0QH 3V48A 4P08A 2ECQA 3QVTA 3TR5A 3PAZA 5D1QA 4PJ7A 4FMFA 1IZKA 5AKXA 1VERA 3WNBA 1N70A 1V39A 1X7WB 1FLTX 4DPLA 4TNFA 4DHEA 1RWBA 7REQA 3QRLA 4HIHB 3ULUD 5NLLA 2GJ6D 3V5HA 4CF6A 1EJ2A 3FBWA 3PF8A 1VFUA 1L5RA 3SCMB 3G2QA 4HAGA 1U2EA 3H9HB 3HFFA 5TK4A 3STXA 5DRWA 3K2MC 5DRNB 5I75C 2J9ZB 3ZJ4A 1WS8A 1VFBA 3R3SA 1R6DA 1YQ2A 3ZTNL 1N2XA 3TNYA 1Z07A 4N6QA 1E66A 2QU8A 3HS9A 5A9TA 2KHAA 3LJ3A 1I4DD 1ZHFA 3LS4L 2Q8AH 4DN3L 3NKLA 5LAPA 2HWYA 4RA0C 5CJQH 4BH8A 3OJLA 2V6HA 4DSTA 2OL4A 4XNUH 4EBQH 1YEKL 4Y2SA 3L8CA 3A4EA 1YU9A 1H8EA 3U6BA 2P9BA 4ZAZA 4KI5D 1DQSA 3X1JA 2EERA 4L9AA 3ND9A 1E4XH 2VABB 3N0XA 3V1UA 4L4VD 5I71C 3FUTA 1D1QA 1T7WA 1YNOA 1GAJA 4UZSA 4YXKH 2VUOA 4PR3A 2ONYA 3VWKC 2QN2A 1MRZA 5GVRA 3ZEIA 4LRIC 5EL0A 1ET7A 3DVIA 1NHWA 3K7EA 5SWQA 1IHPA 3SQOA 2CF5A 5DMIL 5DM60 4AQ1A 5T3UA 4BQQA 1OFHA 4JJAA 2VCYA 3CLTC 1MLDA 4MNQE 3UEQA 1QSED 2NY6B 4L9LB 5HJGA 4YE0A 4GYWA 4MHOA 3I9V6 1OARL 4JLMA 1BQ4A 3QXUA 4YRCA 2ZPKH 4G8EB 3FM9A 5FNVB 4YRQA 4EG3A 1E3WA 3S0PA 1P0QA 1BP3B 4LLMA 5HXAA 2R4SH 3ARXA 3MR9A 5IQ9B 5CKGA 2K2WA 2C9CA 4TKLA 5CVUA 5CJ8A 4WKZA 4U1KA 4XA8A 4PAZA 2V9PA 5IP5A 4YYEA 3RFVA 4KFMA 1KCLA 4LKOA 4D74A 4GLBA 2DFVA 3T5BA 1FPTH 3CNQS 4HEMA 1T4BA 5DF1A 2AZUA 3T94A 2QG4A 4HSEA 4DPCX 4HDIB 3THWB 1JN0A 3L9EA 4W7IA 3QV2A 3T1OA 2REBA 3QWIA 4Q1BA 2NTSP 1XZ8A 3V4SA 3KPSB 1N1MA 4HVAA 5TC4A 3UG4A 1Q1PA 4O3MA 4G4SP 4PGFA 4MVJF 1EGMB 4EUPA 3WAJA 3IK2A 1RQ2A 2R65A 4WAFA 2PYDA 2RC6A 1EKXA 1U92B 3WKBA 2DT8A 5EXDA 3HUUA 1Q2XA 1RUQL 2UX6A 4Y2LA 4BNKA 2WT8A 4D9NA 3I9NA 2IQIA 2O6DA 1W9MA 5B12A 2XXFA 2W9EH 1GADO 3L6DA 1KGXA 1TQ6A 4HDRA 4LF6B 3QYCA 3MUGA 5DVNA 3RAJL 1CDBA 4LDCA 1PPIA 1NYQA 4YJ3B 5I19L 3LPDA 4I5FA 2LWIA 1PI3A 1G6RB 4AX3A 1R24B 3ZEAA 2H92A 5TE7H 4F1SA 3VE0A 1WZ1H 1BRTA 4WOJA 3K1AB 5F35A 3AEZA 5HQ3B 2GZMA 2L3BA 3F3YA 3VXPB 2QX9A 2VJOA 4JVSB 5AW1A 3BRCA 5D70L 3TMAA 5JZSA 5M94B 3TAUA 5E2WL 5A5FA 4BMXA 3FQNA 1PFGA 2PUVA 1A2YB 1EAMA 2ATXA 2KERA 3GXBA 3CZPA 4KYTA 5DD3H 5EZ5A 3ZHOA 4YUAA 1QBML 3V0IA 2O5VA 4QA9A 3FTWA 4ERSH 1Z9OA 1FWXA 1SUFA 5AJTA 1ABBA 3T77A 3FXIC 3ALWA 2FCAA 5DYGA 5L88L 5DTJA 4Y4FC 3VFSB 1AK2A 1MAHA 3ALPA 3H8JA 3BQ9A 5D1ZB 3JSSA 1A8IA 3CPEA 4AZ3A 3PK0A 4QTUB 2TMGA 3NYRA 4PZ9A 3ULSA 4CTOA 3R9IA 1RVFH 2JQZA 2WKWA 1IPFA 3W5AA 4UPVA 2WM0A 3JWPA 4UDUA 1IGMH 3QUKB 4DUXA 4CVUA 1LE9A 4D8YA 1ZWIB 2FPGB 4QECA 3LX9A 1LD9B 1N5KA 3EXHB 1TKCA 3LDHA 1NCHA 3PHQB 2B7LA 4M98A 4N3BA 1C9DB 3HHEA 2JLPA 4A39A 1V8ZA 5E99L 1YB4A 1C8PA 4HMCA 5K0ZA 5GP1A 1E8DA 4WZBE 2DRUA 3O4LE 5CP7B 2WP8J 4I9FA 3G0BA 3WRWA 3KJIA 5EU3B 1VFPA 1C9MA 5CFNA 3WWDA 1NF3A 4HAKA 1QO9A 4M1YA 5IKEA 3CZNA 3K5HA 4WBXC 5BSRA 3N44F 1IILE 3SP1A 2RGSA 4HMEA 6FABH 1W44A 3R8FA 3QY0A 4KAJA 1K3ZA 3FTSA 3H3KA 4UV7L 1GYAA 5DEFB 1YNLL 4G0YA 3LP8A 1RZRD 1ST3A 2AOTA 4MXVF 4C2BA 2F8VA 5AH0A 3IP3A 3NDPA 5B21A 3FVRA 4C7KA 1BD4A 1INDL 3ETBJ 1E2MA 4MIOA 3Q7IA 4AY5A 4QPJC 3GP5A 5CSZB 4JWTA 3Q6MA 2OCPA 1AR1C 2FEEL 2Y1DA 2DWDB 4FGZA 1BXUA 3EG5A 1G64A 4D0BA 3VPDA 4JJKA 3ZHQA 4KXNA 4CVXA 1K8IA 2N7BA 3NDBB 2P1RA 1QA9A 1MKYA 4PWIA 1L5SA 1VBFA 5I8CA 3WO4C 4E1VA 1MB3A 5SZJA 4AURA 3R7WA 4NRZB 4JEUA 1NT2A 1MENA 2BW5A 2K9UA 3TNNB 5MI0B 1L5HA 3UBMA 2B9VA 4PFJA 5D5MA 3PQ3A 3L1JA 3H2KA 1P7KA 3A1WA 1R0RE 1UBMS 3WIEA 2Z3FA 2OZ4H 4YP1A 3BWCA 4GKNA 1F8XA 3FUHA 5HR5A 3NJNA 4GP9A 4B2PA 4H8VA 4EJ6A 4KLZA 1I9IH 4MYCA 5JVDF 3GZJA 1PZCA 4DIFA 3OH8A 2VT3A 4NNJA 3VGFA 1WFJA 4P05A 2BXYA 3FUMA 4ARZA 1WBXA 3Q5TA 4KK3A 4Q7QA 1FYXA 5A9SB 1AZZC 4ALKA 4G3YH 3HI6L 1YRWA 4M8LA 3NP9A 1ZHNA 2WQ8A 4JQIL 1ZNZA 3UH1A 2COQA 4YSQA 4J1SA 5A2AA 1U8CB 1HCVA 2QORA 4WLNA 2WXIA 2WLSA 4NZMA 1Y4DE 5PGMA 1AQNA 5G1OA 4PHXA 2EQ5A 4N8VG 1XJCA 2R7AA 1MH1A 1CKEA 1P2GA 1F58H 3N91A 2FB4H 4BJHB 3N3BC 2FF5A 3NPZB 3RSSA 3PCRB 2EACA 5E94A 3F46A 3DSNA 3FQXA 3BICA 1EAPB 5I3ZA 4PJ9C 3U4IA 4V1DD 2WLYA 4CDHA 3GG2A 1PUIA 3K35A 4QUBA 4DIXA 3T3PB 1OFTA 1ASQA 4FIDA 1D5RA 4XZUA 4JP5A 4KRNA 3E8UL 1FZOA 4KKNA 2YNMD 4D42A 3RTQD 4IOJA 3KDMB 5JMOA 1A04A 3P2JA 3DYVA 3BUBA 1RKVA 3VNZA 2CFTA 3MERA 2RACA 4BN0A 2P1YA 3IVMA 1Q0XH 2W60A 5A4KA 1ZGLM 3ZSSA 1G4MA 1UKTA 3ZR4B 3T6QC 3RJZA 5DMJB 3LW7A 3OQPA 4CN9A 1XF3B 4RZUA 4RD0A 5EU6D 3W3AA 2IGFH 2IL1A 3U4HA 1YA4A 1Q0YH 6ABPA 1F2UB 4FRWA 4BTVA 1LF0A 4L8BA 3OF5A 5JIBA 3TIVA 3KTAB 4I18C 4FQPA 1JHKH 4JG0L 3SY6A 3OKMB 3D8RA 1OAKA 4B3MB 4RRPA 4YRDA 3FSRA 2BEKA 4ZT4A 4OP3A 5J12C 5FA4B 5EUCA 4GVXA 3FI9A 2YW2A 3C8UA 4KHXH 1YA8A 1NFKA 1KYVA 3PNPA 2JIQA 3TF5A 3U1QA 2IWKA 4JMXA 1IEHA 4P54A 4E2YA 3AR5A 1WIOA 4X5PA 1CY6A 2J08A 4ODUA 5AW7A 5JU6A 1DAGA 1RQRA 1BVNP 3VXQA 4NICA 3E2PA 4HAOA 3K09A 4HI0E 2DLCX 4HG4J 1KJ2L 1U1GA 4YEEA 2FSUA 4QELA 3OXRA 1YU6A 1KJ3L 2O2ZA 5EZLA 1UZMA 4QAQA 1DJGA 1LX6A 5JCOC 4UTAH 1H0SA 3RJTA 4JZNB 2FPPA 4X62B 2GFIA 5A04A 1UM4H 1G7MA 1WBYA 3KKQA 3FD8A 2IXDA 5E9DE 5A2KH 4J3JA 3IDGB 1B43A 1QFUH 1YBAA 2NYYD 3U2IA 2XCLA 1HRDA 2Y2TA 4CNIA 5FM8A 4F56A 4HJUA 2XXBA 1FFPA 4AIXA 1F9AA 4YWHA 3QVVA 1GJWA 3DL7A 3QUGA 4W6YB 1A4RA 1YCGA 2JH3A 3H0KA 2GPZA 1R3IH 1FVCB 1X1RA 5HDBE 1DRKA 4CM1A 4JR9H 5I9QC 4XMKL 4QTYA 3FOBA 5EU4B 4WZBA 2AEIT 3C5EA 1QBLH 1G21E 1I24A 2AGVA 3RVVD 1GQOA 3CX5J 3DEKA 4KO2S 2O5YL 4R4NC 4ALIA 4JVPA 1WCBB 3I6LD 1LC0A 4F97A 4EO4A 4H16A 4ZI2A 3U7WL 1RI4A 5HDQA 3GG9A 4XX5A 1W46A 4JXJA 2EYTA 1K9TA 3H3PL 1BZOA 5C0NC 2X23A 4FCVA 3MRLB 5CGBA 2ZR9A 3NNDA 3V4PH 4F04A 3KD3A 4BBWA 5LZ2A 3ACCA 3G89A 2ZSKA 1A4XA 2FDRA 1MB4A 4O63O 4BX9A 2OESA 3UTOA 5G4KB 2IQ5A 4PYJA 1ERNA 1FZMA 5C1PA 3BKWA 4E11A 4WW2C 3DX4A 3QK7A 4DVGA 2E7LA 5DLPA 1USQA 2ECOA 4LQCA 3S40A 5FCUH 4Y9UA 4A5OA 2R0ZL 1M1UA 1D5IH 1WCXA 4C0KA 4BFBD 4Y6SA 4C55A 2FRGP 3P9XA 3R3ZA 3KJHA 3V1LA 2VNJA 3JV6A 4KQ6A 3AGQA 5E6SB 4PO3X 1U2SA 1NVFA 3CLKA 4GLRH 5BV2P 4G72B 1WCYA 5EZ6B 3RF7A 3LQAH 2RGNA 3T09A 2JKVA 1R4XA 3QVXA 3DXXA 1SJMA 1FLDA 2VDMH 1T2QL 4ELMF 4LGPB 1N1DA 3L4EA 1XO1A 1R66A 1HL5A 4LYEA 3WSQL 5C5IA 2JFVA 1T20A 3HUTA 1XEXB 5IFKA 1IEXA 5E1AB 1ORSA 3T12A 3D7MA 4RNRB 1JALA 4Y9TA 4Z3FA 4JGIA 4WEUD 3NGLA 1QG3A 4G6MH 2X42A 1JI1A 3PWVB 2V2XB 1MUUA 4AJOA 1Q4NX 3HM9A 1FAKT 2FUQA 1M7GA 1ZOPA 3OXSA 2V1XA 1VGKB 1PUJA 2J59A 1XHFA 3GZNB 3PY9A 1OVGA 4Q4JB 3L46A 2VSFA 1VE7A 3JWOC 3SBPA 2YJ5A 3HV0A 1A1MB 4HNTA 2FX7L 2QVYX 3BRFA 1P5JA 1ZSNA 3TSAA 1CBVL 3UJ3X 4M7ZB 1MFEH 4WFIA 4O25A 1GGYA 2AZXA 4WNAB 1B9KA 2LLLA 4X83A 2PQ2A 4KTTE 2H2DA 4NMLA 4N9QA 3FUXA 1VLHA 3WLHA 1Z26A 2WGXA 4UNNA 1IHDA 4JLAA 1QGUB 1KEMH 4O2AB 2JHAA 5D1XA 4QPEA 4J07A 3MRFB 1NCAL 4F1KA 15C8H 4OKIA 2JJ1D 4X80H 1K97A 3AYXB 3QNFA 2HY7A 4DSOA 3O9WB 4WN3A 2J41A 4QGFA 3L82B 2OE2A 5ADOL 4I1SA 2XICA 2FWIA 1RUAH 3ZYOA 3DE3X 1GUBA 4EYKA 4J7XA 3C3DA 5JHDB 2R2CA 1QFXA 2X0UA 4CM5A 5F7ZA 5KVVA 1JA0A 2M26A 3FG9A 5DJDA 1WKVA 3VU9B 4CVZB 3I6ZA 4ASUA 5ALBL 5AWNL 1FFSA 2D0OB 2IZ0A 1MNUL 4ZYLA 1RC1A 3C1OA 5A4AA 3E9EA 4YFVA 4MVJM 5J43A 1IX2A 1WQ4A 1GAFL 4LN1A 4PLVA 2XUKA 2ZJ0A 3I4FA 3TP4A 2IH2A 3D4BA 4B5EA 3JZDA 5FEMA 3G0CA 4UEWA 3POHA 3TX6A 1N2OA 2FH8A 1S9HA 5BSKA 1DT5A 1KGSA 2APJA 4QUKA 1EXGA 4XSGA 1PK9A 5J06A 3EDFA 1JHOA 3CC8A 1FIEA 3PRJA 1T1YB 3MTGA 4FFZH 4R2KA 3PUHA 5MP6H 2OZEA 4BRJA 1RQGA 1NVTA 4JFPB 2PV0A 2R48A 1N2GA 3E1KA 13PKA 4ZAKB 3JTTB 4LLQB 3GEPA 2VZVA 5CD9A 4YDJA 1KEEB 3JYNA 4K94H 4TGLA 5HK8A 4KKQA 2C3VB 2XGOA 5C0FA 4BQ9A 2Z1KA 3D2AA 3PGCA 3P3TA 1AMOA 4F3YA 1DVFD 5DK2B 2PWZA 1KAEA 1XR3A 2VMJA 1A7NH 5HWSA 1J6UA 2ROQA 4DEPB 4BRSA 5DNDA 5K45A 1OD6A 2G30A 4BXVA 4PCUA 1YNKH 4HB3A 3T9DA 3FTUA 8ADHA 1RCFA 3GCWA 2KBEA 3HB7A 4MJIB 2Y76A 2JFNA 2B14A 1ACYH 2VDLB 2R1WA 3SKOB 2E21A 2QJTA 4Y6RA 4WWPA 3ULAB 3POCA 1HQ4B 2IH9A 1G21A 1TLTA 3H6JA 1LYQA 1RUPL 4CMEC 3RYHB 2NZ9C 4P4GA 3STLA 3IFOB 4JE4B 1NVVQ 4TV9F 4ZKEA 2I6GA 2BGGA 1Y0BA 2W6IA 5ANRB 2ETXA 4EEKA 3SGKC 3BJ91 3DBLB 3B1ZA 3PLYA 3MJ4A 3ZU4A 4LNRB 4HNSA 4BKOA 3TYFB 2IW1A 1XN4A 2FK7A 1AGBB 2JJSC 4IGBB 2Z8WC 3ABZA 1EZ4A 4HV8B 3S0JA 2HLDA 3HB5X 2VXUL 4GRWE 3DK0A 1NKTA 3UTPD 1JXMA 2OCYC 1N7MH 1THTA 2OMNA 3KM2A 2PLTA 4K3EH 3CVHB 1TXGA 3T4XA 5J4YA 5C08E 5CZKA 3JTSA 4OPMA 2ISCA 4BZYA 1KTLB 5FYKD 2V5TA 1NBAA 3V0DA 3ED5A 4R7DA 3GFRA 3G68A 4I3HA 5IBPA 1C7RA 3EJPA 4A7QA 2HVJA 3EH3B 3FVVA 1CQZA 4P4TA 1CGSL 1P2SA 1T0IA 3GAZA 2W8BA 1OW3B 2DAPA 4GI7A 1LEKB 2WGNB 4P4KC 4CMAA 4Q3NA 3ME0A 3U5TA 5B7QA 2Q07A 5CEYA 1QVVA 2JGAA 5TVGA 3KPLB 5L6YH 1SXAA 4A04A 5C0GA 3VXUB 3DC0A 4RKQA 3QZWB 4I9NA 1DAKA 3I5UA 3OX8A 4TRNA 1VZIA 2J0EA 4LL1A 3RWBA 2QGNA 2QXUA 4XJTA 2GWRA 5AO9A 4ZU1X 4WESA 3NIBA 2BFAA 5D3ZA 3V4VB 2O61B 2BZ0A 1J4AA 3OZEA 1S2MA 3MRDA 2AN1A 4DP4X 1H6FA 1S4IA 2QTHA 3OY2A 3F65A 1RKUA 5JNYB 2IDSA 2GYVA 3JXEA 1XYGA 4FERA 5JISA 4Q4EA 1II4E 1BNCA 2YOAA 5L2JB 2IEAA 4KQFA 2J4CA 1AURA 1SXJB 4IXWA 4J03A 5CEEA 4HS6B 2DWQA 2IUFA 4IUYA 3JQAB 3ULUF 1MEOA 2IZ6A 2F61A 1LBTA 2J4DA 2RHMA 4MB0A 4FLRA 4B4DA 4XBGB 5IUJC 2IBZY 1CWVA 1MFAL 2N59A 1Z37A 2AVFA 1XGPA 1Z56C 1XXHE 4XXHA 3T0IA 4I4WA 3TTXA 4QRSB 3PC7A 1BBJB 2R29H 4LAFA 3GPSA 1TFPA 4HLEA 1E8WA 1PZEA 4RGOL 1OFVA 2G2RA 1OZAA 3K2BA 4N5MA 2WKOF 3VXTA 1KYYA 2G0TA 4L5BA 1T2CA 3BK1A 1T0NB 1DJLA 2W48A 2GPSA 2PEZA 4KI5F 1IN4A 3T4PA 3KQLA 4ZOLB 4ITRC 2KPWA 1ODSA 3P9CA 4K3JB 5HYSG 5FO2A 3I3OA 4HTFB 1YI8A 1KYFA 2KMLA 3L1EA 3AH8A 1JFSA 2QKYA 2ZBDA 1E8NA 5JORB 3D7NA 4KTYA 5ERYA 4WO4A 4KHZA 5DYFA 1UMDB 1QYXA 3PFUA 3QA3B 4TUYB 1VZGA 4UILH 3TCXA 4FNOA 3EBIA 3VC3A 3O90A 3QAZB 4AROA 1ROCA 1M6EX 1V9LA 1CQIB 3R0QA 1RPJA 4ODWB 1ZOOA 1FFXB 3QWOB 3SDYL 4S1WA 5J59A 1H3XA 1OLUA 4GNKB 2YK1H 1AG9A 5ALUA 3E6FA 4DM4A 4A6YB 5FXCH 4YEDA 2J1ZA 4J2HA 1I85A 1UKVY 1WE2A 1SB9A 2OYPA 4L6AA 2JKJA 1UC5B 3T15A 4YC2B 3D1LA 4ZT2A 2WVVA 4AN0A 4FQIH 4ZCMA 3T3NA 3A7DA 1XSJA 1IBLB 2XPGA 1JEDA 1MVLA 1Q19A 3HC3L 2YKGA 2L4OA 3Q7QA 4E7OA 2D5CA 3SE3A 5JO5B 3ZZNA 2VDKB 1YBVA 3BMOA 4QLOA 2OSWA 1E2DA 3TINA 2O6CA 4EVNA 4PB0L 1E7WA 1QX4A 3L07A 1MY7A 3DM9B 3T4YB 3K0KA 5GGTA 2BFDB 3N3EA 3L4BA 4MDHA 1I4WA 9GPBA 3SKUD 1IU9A 4O2BB 4RA6B 3AITA 3KR2A 2HG0A 4HD5A 3SU8A 3N5AA 4S0SD 4PV8A 2LU3A 1U98A 3LT2A 4Z7QF 4LU5H 4GP4B 5FA3A 1TDJA 3NEYA 2YRXA 1OPXA 1E2KA 1SCUB 3EQ7A 2L42A 4BJ5A 4QTHA 2EDCA 5L40A 4YNYA 3I50H 3DZCA 1NLDL 4YHIB 1NJ5A 4AQZA 1VRVA 4I14A 4WWHA 2AXHA 2PZBA 4CC4A 4M7JL 3R3UA 2FJFA 1D9KB 1T9ZA 5AVYB 1IB0A 4NHCL 2Q49A 2YA1A 4KTDL 1YJ5A 1C3VA 4OL0A 4KUEA 1LO5A 4M37A 3UFXB 4FD0A 3A0RB 2CBQA 4NB7A 2RGCA 3RVUC 2UZ3A 2Z35B 3IQZA 2J3MA 3MS7A 1RU9H 3PGDA 3F7RA 3FB1A 3BHBB 4CM9D 2WB7A 3TTYA 3IKTA 2EG5A 1XJ0A 1SFDA 3O93A 1G87A 3V32A 3FCTA 4CL0A 1Q7EA 4R9HA 5C0DA 3S37H 4KC0A 3O81A 2Q1YA 3O8LA 3ZCPA 1ZH4A 4PC1A 2P9TA 1MCZA 4EUSA 3GSNH 5LIPA 2C7UB 2IC2A 1YJCA 5JPNC 4K9PA 4RBNA 4H7FA 4HC1H 3PHSA 4HJGB 43CAA 3WN5B 1GL3A 5FGSA 2X4OB 3SHOA 4Z0XA 2ZSVB 4JL6A 2JFOA 4URUR 1DLFL 1NONA 3GT0A 5GPRA 5G55A 1MX3A 3ILEA 1N4AA 4P9MH 3AQXA 2NYRA 3TBYA 4Y9RA 4Z9XA 4WNQA 3AL8A 4OGXH 3ESNA 3CLWA 2JCSA 4QPZA 2WINA 3MGCA 2J21A 2VM4A 3WLLA 2HMTA 4X5XA 2GKSA 2Z3ZA 3EOAB 1CZOA 4JKKA 2XI4A 3B9EA 1Z15A 2W6CX 3ZIDA 3HB4X 2VL4A 4QATA 3BPSA 5C08A 5AI4A 2XZLA 2BVPA 3RUHA 4Q48A 2A30A 3NHKA 2OCXA 4IFIA 3TH4T 2C7GA 4PRZA 4JD5A 1RHHB 3MLTA 4AQ1C 3G6JE 1CJVC 3HU3A 3B1WA 3BVVA 3GFTA 2V7BA 1NGWB 5CIPB 1K7FB 2AV6A 1JIXA 3RNKA 4MYWB 3L5XL 4FW9A 1KZHA 2PTGA 5GJBA 2X6UA 4R4BA 3F71A 4PGBB 1QQBA 3D7KA 2QX6A 3HW7A 3H42B 5IOPA 1TQBB 2QAGB 1AHWA 5DB4A 1T9CA 3PWUB 3KOUA 5ECDA 3UC0H 4G7SB 5E8JA 5LXTB 1QEWB 1V45E 3P9PA 3D05A 3ZKNC 4E51A 5EFIA 2QMHA 1ZJAA 5AVVA 4IFTA 3DOSA 4FP8L 4ALNA 2Q45A 1N10A 2B92A 2C98A 2FWBA 5FBVB 4ODSL 4NV3A 5TQ0H 1A9TA 4W9JC 1JBKA 3VH3A 5KVDH 3K6SA 4Y16D 1ZQ9A 1YF3A 1ORHA 2DQMA 1NL0H 4HUXA 1DBQA 4HXAL 1ZUNA 1JDCA 4FXGB 5D4QA 1U30A 5C1MB 4MCZA 5DT9A 4RK5A 1HHKA 3RWFB 1KCRH 1I2MA 2OXIA 4RSGA 4UVGA 2MSWA 3KPRB 2N3ZA 2F7QA 1M66A 3FQUB 3T8VA 5ISZB 5FV7A 2DDQL 3CSSA 4N6RB 2ZIXB 3MRNA 3M81A 2XUIA 1XXHA 3GRPA 1WDTA 2G08A 3MV01 4YRSA 4EBFA 2BKEA 2Y2WA 4BSVB 4BX8A 1ZTXL 2DYPA 4UCFA 4NT6A 1GR0A 1OPGL 4KR0A 3LY6A 3U0PB 4NOKA 4DLNA 5F9JB 1C08A 3JV7A 3NT0A 3VQLA 3F7YA 2P5YA 1J5DA 1XI2A 2B34A 5GJWC 3AHGA 5FCDA 4WUKH 2XWJI 4OFBA 3O6LH 1YS9A 1ES9A 1PWXA 3FU5A 4IRSB 1HUQA 4L7QA 5C37A 2GEUA 1LI4A 2E1RA 2HWUA 1UWGL 1SHTX 3S2UA 3IYLW 4TOYH 4HPOL 4OX9B 1OOEA 2AZDA 3B51X 5JJCA 4J76A 4ENQA 2I4OA 2RONA 2AEPL 1IAVA 3T8XA 1T04B 3WXMA 2MPVA 3JD4A 4LIPD 3CH4B 2Y1GA 4M5ZL 1TK2A 4GS7C 3OZIA 4BSJA 4MASA 4OHKA 5AP9A 1O5PA 2BIIA 3HO1A 4RMGA 1IC4L 5I76B 5F5XA 5C7ZA 3HNRA 3DG9A 1JGVL 4M60A 2BSSB 2LFGA 3DSFH 3HC4H 4D9JA 4PP1D 1EO7A 1GJRA 2XN9E 1AT1A 2E4VA 2O3QA 4KPGA 4JO2H 3H9EO 3MV8B 4JYZA 1YV9A 4G09A 4GMHA 3FW6A 4Q16A 4U33A 2ENWA 1J88A 1FNHA 1FMLA 5IWCA 1AVAA 2AN9A 3MRKA 5LD2C 2WUBL 5I6XB 5CINH 3WD5L 1YR9A 1AKPA 3ULVH 1COWA 1M34A 4NJEA 3K6RA 3NVDA 4MWFB 4ZICA 2AC0A 4XX0B 2F2TA 2MOVA 2WU0A 3EO0A 4APQA 3WGUB 1RBMA 1SD2A 4BQFA 2RGEA 4ZODA 1G20A 3WYFA 2EP5A 2GTWB 3E8MA 4DW2H 2FWRA 1CIPA 4KUHA 2XQIA 4Y4KD 4QF1A 4FZVA 4U4BA 4GOJA 1SZPA 8CGTA 4O1HA 1NQUA 1WA5A 5C5DA 5AALA 1VG0B 1YD7A 1BMFD 3QU7A 1BIIB 1GZ4A 1BIHA 2O4EA 1UOKA 1RVDA 3OMLA 2Q76B 5JG7A 5D2NC 1EQUA 2WSSA 1CFVH 4LQLA 1H9BA 4M54A 3DDHA 3ZXXA 3MJ7B 3RARA 3QW4B 1BKYA 3OEEA 5E9AA 3K6OA 2RGUA 2YX1A 4S0ZA 5LQAA 2B59A 2ATAA 3K0EA 5FF9A 3MFQA 4NRXB 1FP4A 5CF3A 5KINB 1T1SA 2ZSHA 3F2LA 5MEOB 3FE2A 5GS0H 2P62A 3FB8B 3UPCA 1PJ9A 1NMXA 4EPYA 2HFFA 4IDEA 3P9IA 4Y19E 1D5ZA 5JHGB 1XH3A 3L7EA 5E08L 3DGGA 5BCAA 5K8JB 3ZGYA 5K0BA 2RGBA 4JPWL 4M43L 3ZV7A 4LEIA 2FDBP 3UJIL 2GNPA 1X9GA 5CP3A 4L5JA 3OB0K 3GLDA 4PZEA 4KK4A 2WB2A 4G9FA 3DFKA 3OAYK 1QG4A 5GRJL 3F3SA 4M3KB 1E6WA 5IMOB 1TA4A 3ZI4A 3CK0H 2B1OA 2V2TA 3O2DL 3ARBB 4UD2A 1IAIL 2WQVA 1MOZA 2QJOA 3OKFA 3GBSA 1PQYA 3IMKA 4EO5A 3RT7A 1E6EA 1G8AA 4FA8A 1QQDB 1YRKA 2H4XA 3Q85A 1BVYF 1D1PA 1R0YA 4HAZA 1AO7D 2XWBB 3DMNA 2ZWSA 3RVOA 2FPXA 2GSGB 4PS8A 5DTEA 3PSHA 1O0CA 1F1GA 2GB2A 4C4OA 2JFCA 5DT1H 2DBLH 3SPJA 5IB4A 1VSBA 3UQZA 2O0HA 3P3UA 2WD7B 5CB8A 1TTQB 1DG3A 3L4UA 2IBGA 2GO7A 5KTOA 1W29A 4XCYA 2J67A 4DC9A 5B39A 3OKYA 3IMCA 4FZ5A 4E9RA 3UBXG 5L8VA 3L5WB 1FU8A 4IS2A 1A25A 5I6OA 1YY8B 1DCEA 3AR3A 5FOQA 4GMXA 1AO0A 4KK6C 3QIVA 2J87A 4RKRA 1T2EA 4GH5A 3QARA 4LDNA 4MJ5B 3D4PA 3SJVE 4PIVA 3OWHA 1YEIH 3OZFA 5E95A 2XB4A 1Z35A 4RTRA 4A2WA 3EXFB 1A47A 3ADOA 5DHYA 2DLEA 2CLMB 2PPCA 5BQXA 4FW8A 2B98A 3E2IA 5AW6A 2X53A 4XPAL 3MMNA 1UC6A 5B1BB 5TF1H 1TCUA 4A23A 4YAQB 3AY3A 3STZB 3BZWA 3EBHA 3UZVB 4AM0B 1OH5A 4PHCA 1VCAA 5BXYA 5JWRA 4D0RA 4L76A 3INUH 1UL1X 1R3KA 4JBNA 4JJZA 4N9WA 1RHJA 1CE6B 3O2SB 1RUML 4GMSH 2VR5A 1YEHH 4K81B 4M29A 4F7DA 1KIQB 3ME5A 5B64A 1A7PH 4UXHA 3N28A 3O3DB 1GGUA 2A73A 4LNUB 1KEGH 2IOYA 3NTRA 2BMAA 1Z25A 1XAUA 3SYNA 1ZKMA 5ALHA 3B3IB 1OI7A 5IU6A 3COSA 5DQ9B 3EGXA 3KXDA 4JHUA 4K15A 5FECA 2FVYA 2D3VA 4DE5A 2PX5A 5DO2D 4LFAB 1ATIA 1WF6A 4PY8I 2XG5A 2VLLB 3TH3T 3D12B 4V0OA 4UCWA 2NVBA 1NVVR 4G9BA 2DD8H 3DO7B 1GCGA 1Z1WA 1CQKA 2PS0A 3W2IA 1JWBB 3EDCA 4HS8H 5LU9A 2OQIA 2VQ4A 1KYIA 2GY7B 3NWPA 2QJWA 3QFJB 3O9MA 1AXTL 1V1JA 4XMWA 1SC3A 2OK0H 3K09C 1HGXA 2ZWAA 3Q4GA 1PS0A 3LIZA 3U1SH 3FLAA 1XTVA 4V1CA 1KR5A 2YARA 3PRYA 4PX9A 1S5IL 4JK3A 2WBJD 5IMKA 5DJAA 3W81A 3CHYA 4C4PA 3AR8A 3KT3A 4BEJA 4NDMA 3CA8A 2XN9A 2CJWB 3QDMD 4A7TA 3ZQ9A 1F6DA 1A6PA 4HGOA 1WHOA 2P27A 1DVYA 3RWCB 4R5MA 4ARSA 5GISL 3RWEA 2QZ9A 3ZHFA 4G89A 4F5EA 5K99A 2IYRA 3F8SA 5EYPB 5EHGA 3M46A 4RTPA 1MFMA 4XC3L 4EG6A 5M29A 1JG7A 3U7JA 2NY5H 3JASA 1J5OL 3WIIH 5IREA 2F59A 3BH9A 1UZAA 1T0UA 4QYSA 3GTNA 4NP4H 4MV6A 3LZOA 5CFMA 3B7YA 4S12A 4ZMXA 1BJKA 2COUA 3IP7A 4DP9X 3FFWA 4N4AA 4EFNA 1ZGLB 5ISMA 4ZJYA 5LM3A 2E7ZA 1IGCH 2AQ2A 1XMSA 3MDJA 2PUBA 2A78A 2F6RA 2EZ4A 4U2FA 1W36D 5JDIC 1M8FA 2GZ3A 4EUPG 3AY0A 3ISRA 1UJ2A 4UNSA 2Z8YA 1SXNA 1PTKA 1ZLXA 4AB1A 3U37A 2I55A 3T5CA 4I5GA 2JIPA 4R7VA 3PGLA 3V9CA 1KQFA 3DTXA 5U4QA 4H7VA 4NKOB 2KHZA 1CZKA 1K86A 5FBLB 3GLIE 4PCYA 4RCYA 1OTSD 5CCXA 1TX4B 2FW8A 3O31A 3ZCTA 3H9ZA 3HYSA 3CSFA 1KNXA 1G5GA 4KMMA 4MR8B 5IEKA 2B4QA 3R9KA 3CCBA 4E9TA 4FKZA 4Y19A 4PS4L 4N3CA 3KKNA 1JV5A 4N2OA 4R81A 2F9LA 4INAA 4X5OA 2BY2A 1T1RA 3DVNB 3K3QA 1LBHA 3FU8A 4M5TA 3VR6A 1UMBA 4LW8A 3QNYA 5EZOL 4WHCA 4KO8A 4LCBA 3V6ZB 4QEDA 3TLBA 3O4OB 3BP6A 2KYRA 5C9JB 2EBFX 3G3LA 1MORA 5FRDA 2XFXA 2R97A 4KI7A 3ZOAA 3VKWA 3KQNA 4ZHSA 4E9QA 3MRIB 4MJXA 1WEJL 3D0RA 4M61A 1JG6A 5D71H 4HXGA 4XTCS 3R3XA 3ZQXA 4AF6A 4RAUB 3C5ZB 6REQA 4HDQB 4RX4D 5TPZD 2XQYK 3W6PA 4RMHA 2CIKB 1R37A 2C97A 1UEXC 3HDJA 4YQZA 4CUZA 2I6XA 3RZWA 2DY1A 5KW9H 2F8XC 2P2DA 3Q6FB 1I9RL 4KQWA 3VYPA 4J8RA 5BUAA 5C9ZA 1YQTA 5BO0D 1W5BA 2AFIE 1UQUA 4GPVA 3KJEA 5JFOA 2XUQA 5C0JA 1PFOA 3ISWA 3CD4A 1FG2B 4ZDHB 4H8UA 2VR8A 2C4FT 3S88H 1V7ML 1OGIA 1X5YA 3HNVL 5TMDA 1UYWH 5ADWA 4QI3A 1FK8A 3LNEA 5F89A 6CGTA 1RYBA 3MT8A 1JILA 1BZYA 4UASA 5IDXA 4AO6A 5K8UA 4G65A 1HHJB 4IBSA 5B4MD 2A4CA 3PQ8A 4C29A 3SJVA 3DOEA 4MJJA 5D1XC 5COAA 1HOCB 5BYKA 4PRAB 1PL7A 1E62A 5JCOA 3CRZA 2CKDA 4DJJA 5FEBA 3J7TA 3KUXA 4K9LA 2GN6A 3ZL1A 5ED4A 1ZT7B 1T9BA 5E1HB 5I0VA 1NPNA 2AMUA 4AJPA 3SC3A 1J2YA 5HTKA 2EUVA 2CMDA 1YAZA 5D7BA 3HNSH 1QO0D 4JCCA 4P4SB 2GJZA 5HGDA 1O6SB 3QJGA 2V9TA 3RGVD 4UT7L 3N1FC 2Y6VA 1CI5A 4B3CA 3RL1B 5INDB 4Q0XH 4RCAA 1HEIA 3BQUD 1MVUA 2TRSB 1EDOA 1U8NA 2G3ZA 1VSTA 3A9CA 1JHVA 2F17A 1YG9A 4FWTA 3ZIAD 5AVJA 4FM9A 5DHMC 2A6KA 2H1LM 5C09E 5D7KE 3I0MA 3QPVA 1JERA 5MGNA 1P6QA 4YV7A 3T9BA 4PIPA 1FAIH 1BYOA 1NQXA 1XYVA 1A8SA 2ZSAA 1S9XA 4FFYL 3LD8B 4FPXA 5FUVA 3ZWOA 5HCIA 1GSAA 4FFPA 1CUSA 2YD9A 1NZDA 4LY3A 2FEEI 3T3GA 3ZI0A 2HB6A 5JNSA 1X5FA 2GT9B 4AQAB 2XF8A 1KG0A 5AW5A 1E2UA 1CXHA 2AX3A 1V7NH 3AJDA 1NUAA 5HYSA 3PNOA 4Y2YA 1M2EA 4WW2A 2DU8A 4F72A 2QVMA 4C56A 4AL8C 3EOBA 3AQ4A 1AS6A 2VS1A 3VR5A 4JFHD 2FEXA 1KZ7B 5AQ0A 4IBLT 5HI5D 4ZVNA 4OKNA 1HJBC 4D94A 4ISBA 3NOIA 4D8WA 3WIHH 1JQAA 2WR8A 1KMCA 2Z6VA 2HT3C 5ITVA 3FFCE 4ABYA 2KZBA 4FABH 5IYZA 1AIZA 4A1FA 4Q4HB 4G42A 2C1PA 3JVGC 3PG2A 4LSDA 4UTVA 4PEEA 3CIFA 4JFDD 2WOJA 4WEEA 3TD9A 1QVWA 2VRCA 3O1HB 3C6LC 3TQHA 1DR9A 1J8MF 4ZT7A 3KUCA 5EHIA 1T3TA 5CJQL 5D8JL 1THGA 2NPOA 1T5IA 3FI0A 3QJUB 2W80C 1VE1A 4XNUL 4EBQL 1L9QA 2WJIA 1M2OA 2PTUA 1DSYA 5JXED 4JREC 2VDWB 1BVKB 1KAMA 1FL3B 4O9HL 3IP8A 1U11A 1BZDA 2R68A 4KO5A 4XZ4A 4YXKL 2ODEA 3K2QA 5HKBA 4RM2A 3WJMB 1IOZA 4LSQH 2OYKA 3VXRE 2XQVA 1JNHB 3G2NA 3FTGA 4IBVA 2YS6A 2X4TA 4RY0A 3ML8A 1XZAA 2XQ0A 2X6QA 3QYFA 1I4FB 2LHAA 5GHWL 3QEJA 4XO9A 4EPSA 3FZYA 4R97C 4TWZA 3R4RA 3NVKI 2FSDA 1VDZA 2J3QA 4F4UA 2MIIA 1HXKA 5CLIA 5CFOA 3IJEB 3LX8A 2H18A 3TVMC 2ZPKL 4KX8A 1E5YA 4NWTH 4RJKA 3GLIA 4HJJL 3UMVA 5EF2A 3OQMA 3ZWQA 1BMZA 2W4MA 1K4CB 2QQKL 2EXWC 2ZRKA 1DBSA 4RRPG 4EK9A 1O87A 3E4CA 3FCYA 2R4SL 2YFYA 3VBEA 4M1EA 2ZSUA 4OJTA 3L4JA 2PZGA 3IETB 5IFJB 1XD0A 4OAWB 3KEHA 5E8NB 1U0BB 4PB9L 4BZPA 2DIBA 3A70A 4MWSA 1XUOA 4KDVA 4X7PA 1KVTA 3LL7A 1QAWA 4P5EA 3TBCA 4I8IA 3UO1H 1S9DA 4PD4J 5EN3A 4PVDA 1YGYA 1U90A 2VC2B 4GKSB 3SD5A 5J0BA 4H6VA 3ET4A 2QPSA 1EH5A 1MPTA 1D2MA 5B1IA 2E46A 2ZJSH 1AXEA 1QW9A 5IHBA 5GOZA 1CXKA 1I1RA 1TVHB 4OXIA 1AA6A 5IQ7H 1QQ5A 5DULA 2AK4A 2WTUA 1UXMA 4CEJA 2RI6A 1GPOH 5DYIA 2XKJE 2F53D 3LBIA 2YC1B 3NVMB 3RK1A 3VSVA 1JIVA 5EMNA 4X6DF 4IWYA 3MCYA 4C4YA 1I1AD 1V16B 3OPMA 4UEQA 2YAFA 5TRTA 2HXGA 2XNSA 1LM8V 4HUVB 4CMCA 3FHOA 1ZI6A 2W9EL 3KWVA 3VH8B 1R0WA 3V6MA 2XWEA 4E41D 1YE5A 4D9QD 3GSUA 4FQCH 2FRVA 3T7DA 3DROB 3HR5A 2UX7A 3L7FB 2Y72A 5TE7L 4U1LA 4GEIA 2AZTA 3NTVA 4MLDA 2QN8A 1A6AA 4ZQKA 1A2QA 1ZVVA 4KV9A 3AFCA 1L2TA 3IS3A 4HF7A 2RHEA 4IHOB 4QOKD 5CIQA 1G5FA 1V3MA 3CHPA 4GP7A 2IDQA 3T35A 5ILTH 3TZVA 3QW9A 4BO0A 4JL1A 4RL6A 1NAMH 3GK8H 1S9WA 3N44B 3LPLA 3O2WH 1HY3A 4FLEA 1NFIB 3CVIL 5C0CD 4ERSL 1TMQA 2YZGA 1RCYA 2PUGA 4MGEA 1WEHA 3HVRA 4BNNA 1SLWA 3PNWA 3Q1EA 2PTTA 2CZGA 4WO4C 4ZIRB 2AXGA 4IH1A 1QB8A 1U5BA 3S2FA 3KYNA 2YD2A 1PVHA 3GK3A 3QJXA 3HEAA 3VKFA 2J5KA 4RF5A 4L95C 1HSAB 3OZAA 3IOBA 3C6ZA 4MMYB 3UTTB 1A4UA 3UY4A 1AGDB 4JRXA 1OT5A 4JFQB 2WVHA 4X5LA 2HCJB 4W8HA 3E9QA 3B7PA 1RZ8A 2Y3AA 4U5QA 2AHRA 5C09A 4KPHH 2C5GA 3HUFA 1MI5A 4PBVC 4Y7OC 2JL1A 1MQKL 3GS0A 1ULBA 4P35A 4YP9A 3JAWB 3I52A 4B3HA 2B1AL 4BBJA 3SE3C 1YOVB 5KN5A 5JQ6H 4F7TB 4REQA 1AV7A 2VDOB 1Z66A 2WYHA 2LOEA 3SGKA 2Z4TA 1UKAA 4R4JA 2ZRNA 2D2OA 4L9DA 1W0JA 3P11H 2GABA 3Q12A 4MWTA 1S0UA 3L4BC 1BFOB 3PD1A 5I9NA 2G0LA 8FABA 2K78A 4BA8A 2XJLA 3DIFB 1LP9E 4DJFC 2B99A 4I3RH 2JJSA 3D4ZA 2BDTA 4DAEA 4OLVL 4ETYA 1H65A 1E9QB 2H2HA 5D7JB 5JVDB 4QC2A 4ZKDA 1F6WA 1HZZC 3CZ5A 2WM8A 3EYUH 1CLVA 3GMRB 3TPFA 3ZHBA 5GGSA 3UTSB 4DKDC 5IMMA 4IQ4A 4DYVA 4F2MB 2V03A 1TF5A 3QWQB 4CC4C 3D87B 4G0ZA 4M0KA 3B52X 3QNMA 5B1KA 5CH8A 3GSRB 3F7MA 3EQ6A 1BVOA 3FFCA 3DP9A 3I9JA 3NBYC 3TSZA 2V8BA 3UJJH 2OBNA 2VUTA 5J2UF 3ARDB 2XXGA 4DKEH 1ZMRA 2ADIB 1QKIA 2HPHA 1QDEA 4H7PA 5HHNA 3SE0A 4ED9A 1RMQA 3QEMB 1ETHA 3NNNA 4F33B 4JM2A 3K30A 1VPTA 1E3LA 4BFTA 12E8H 1E7QA 5GZOA 1WP6A 5CT6A 1FO0B 2ZUXA 3TFOA 5MENE 4ESOA 3NOXA 2DQFB 2IV3A 3DE0X 1MU0A 3KE9A 1WW2A 4JFFD 1NIPA 5FXMA 1E1NA 4LCYB 1CEQA 4NQCB 1EIWA 3GSOB 3HKDB 5L3ZA 1PBYA 4AQ7A 4XH9B 4BVBA 3A32A 2NQ2C 5J5VA 1P18A 1N12A 4FIZA 1TVBA 3C2QA 4HEME 1JV2A 2JNZA 4KY1H 4IPTA 3ELUA 1ESCA 4WNCA 4ETNA 5JXJA 3AHEA 3SBRA 4G3YL 4KYIB 1N9PA 3BUPA 3DETD 3DC7A 1KC5H 4WWKA 1GO2A 1NGPH 2ORIA 2CZQA 4KZCA 1H2RS 2PABA 2A9AA 3J07A 1KZ6A 3R0NA 3GMPA 3A2KA 1OGTA 1RPZA 5GSRA 5CEJA 2WWMD 2RB4A 2XUJA 2FB4L 4EG0A 1ZL2A 1UM8A 3B3FA 1YEFH 2DQ4A 2YQ2A 2E56A 2EEAA 1GPUA 3H0TB 3RUEA 2CGRH 2B21A 5CCGE 1K8RA 1BH6A 1F60A 3BZUA 1SA0A 4M9ZA 1RZGB 1N5YH 2IU6A 2VDVE 3JQ7A 3W6ZA 3IQHX 1G9NH 1I3GL 3LG2A 1AHWC 1DEKA 4JFVA 1UZUA 2VHEA 4DDUA 2AMLA 3KYDB 5A3JA 3A2MA 1J9RA 2XT1B 1Q94A 2P5WE 1RE1A 1IAOA 1ESMA 5J2TA 3R5XA 2YKKA 4YHML 2XQYA 1G7JB 5L0QC 3TTSA 1IGTB 4LASH 3H17A 4HVTA 4ZMQA 2OXGA 3H7LA 1ZK5A 3NS7A 1PIFA 3QEHB 2N1MA 3ELDA 2BELA 3QF4A 1XVSA 2G5GX 4AW9A 5GGVH 4W81A 3N0AA 1Q0YL 4YMGA 5JZ9A 4RZCA 1D6EB 3BZEB 2EC5A 1KGIA 3N8KA 2EYUA 2AQNA 4PJ5D 1F3DJ 3KL4A 5IROC 4D0NA 5GRZA 4BZ1L 4MCIA 1MJJA 2HBQA 5F72S 3DL0A 3VAEA 3HDQA 3IVKA 1CUGA 2YWEA 2DBYA 4AJYV 3K4ZA 5TNXA 3NX4A 3K70B 4ES6A 2WJHA 3DHPA 3FUDA 4ZMTA 1PFWA 1GZPB 4KN8A 4MIKA 1HVXA 2BIFA 4FLFA 3BL5A 1I3UA 4EY3A 1MHEA 1HH6B 1L4UA 3I3SR 1JAYA 1T8RA 2V17H 3FU0A 4ZCSA 4BCYA 5G5DA 4TM8A 4ZYYA 2DQJL 3E38A 3D09A 1C1XA 3UBXA 2HD4A 1JIBA 2BEVB 4JJGA 5L8JB 5DK0B 4JGUA 3OQOA 4UTAL 5H5JA 1OV4A 1NYLA 3H99A 1VMEA 2V0NA 1UM4L 1DBIA 2EFGA 3BSYA 3B8HA 2UYYA 5KVEE 3LWBA 2IYTA 2VXQH 4HLNA 4FLSA 3TSWA 1QFUL 4FYWA 4PJDE 3GBVA 4PJHE 4IX9A 3HNPA 2ZOTA 1KO1A 3BFWA 3BZ5A 1AD2A 1DC6A 3CU7A 1EP3B 1QQ7A 5D2NE 2QLVB 3MUUA 1MVOA 2VWEC 2B7BA 3C3MA 4BCCA 3ZKMD 2YRZA 3MW8A 5K9QI 4OU5A 1W1IA 3L4TA 3LPWA 1P9OA 4JR9L 2VFAA 3BCFA 4MD5B 5JPNA 1G6OA 2EIDA 3DX2A 4JUTA 1QBLL 5EZPA 2P9CA 5SWSD 4NBVA 1DVXA 3BH0A 1W6LA 3UF0A 4UHFA 2QJRA 3T5MA 4TOIA 4ELMB 4GXNA 3KPNB 1NCDH 3N41F 5K9JH 1NVWQ 3K4PA 4I19A 4PG5A 5ERXA 3NATA 3BWXA 3VDXA 3O45B 1GEGA 3TEZA 4DFDA 1F3JB 2PSSA 4ENZA 4NP6A 2OGTA 5FBWB 2Y4OA 5IVHA 1J9CT 3V4PL 1LP9A 1PF3A 3EHBC 1UEYA 3CLHA 1X38A 3B6IA 3CRRA 1H3UA 5D5ME 2EEPA 1ORTA 4MUXA 2WXKA 5KTTA 4YBZA 1RKRA 3KXFB 3AF4A 1G7QB 4APQC 4IJKA 4HAWA 2ZRMA 3COVA 2WZQA 1X39A 4QASA 3UAFA 5I1EH 1V3TA 4MKHA 4G81A 5KOYA 2PL9A 3PGFH 3LRHA 1HFEL 1J07A 5CAEA 2QLTA 3P4MB 2WMPA 2FETA 1D5IL 3PNMA 4D25A 1XU9A 4NCHA 2QFPA 1H9AA 3A6DA 4LVNB 3PQYD 1JYEA 1PL6A 4HPYL 4QODA 3VZSA 5KANI 2P28A 2GJ4A 4BWWA 4OFZA 2BDEA 1I7ZA 3DB1A 1SYSB 4L9RA 2QJFA 1IM9B 1SZCA 4QU8A 3LQAL 3V34A 4GB9A 2XH8A 5A40E 1Z5PA 3UANA 1AB5A 2Z09A 1AKNA 1IRAY 1EI9A 4W93A 5MENA 1KTKE 2H8PB 4HUQA 1QGYA 3C60D 3TEJA 2OECA 2BNUB 3JRXA 4B1FA 1HCZA 3NKVA 5AUNB 3P54A 3PL5A 2GEFA 4PSPA 4CT5A 4RETA 1LLCA 4A7GF 1JPFB 4HWSA 4Q1VA 4BVAA 5BMVA 3WBBA 2JIXD 1E5DA 4Z1MA 4ZTOH 4M6MH 5I8ZA 3KPQA 1XZPA 3WSTA 3RWOA 2QR3A 1X1TA 2XTLA 4UDNA 1UADA 1L7BA 1SVZA 1RZ7H 3ESXA 2BJWA 3CGWA 2EFJA 2UWEA 1T3LA 1VLLA 3QEQB 2B7CA 2HVBA 3ECVA 4IMLB 3PGJA 3R7SA 2XV2A 1AYOA 1OHZA 5ALVA 1KXHA 1RZQA 3JVVA 3AY2A 3VRJB 3X1YA 2ZSWA 1DJPA 3DX8A 1BDHA 2HJLB 4HPWA 1LV7A 3TEWA 4BAGA 3KOXA 4I46A 3TT3L 1MFEL 3Q1SH 3RYTC 2QTVB 5FBKA 3UQYS 2R6ZA 2C1XA 1N77A 2PZKA 2IIBA 5F71A 3K5PA 4TL4A 1BCRB 4QDTA 2P6OA 2L17A 2PR4H 4TV8F 3P4UA 3N9IA 4WW1B 3NETA 1CR1A 2BMWA 1BEYH 2WHRA 2VUIB 4YXFA 2WXFA 3HB1A 2JJ2A 1RM5A 4CPDA 2A4MA 3VDMA 3CCCA 3PL6D 2I6QA 2R8OA 1UK7A 3IDJA 2B4CH 3EO1B 1IGJA 5G3ZA 2YZNA 2P5WA 2WIIA 2VHCA 3OG6B 1U7XA 1U9JA 4Z5XA 2L18A 1FLNA 2B1QA 2FE1A 1A6ZA 1NC2D 1RUAL 4C14A 4L1HA 2ONCA 1A27A 2P46B 4LGCA 4PQGA 3I84A 1T5XA 1I2ZA 1E9DA 1U5CA 1YS7A 1X1QA 5H37H 2CIIA 3N0RA 1S2EA 1Q17A 3TVYA 3WSWA 3IEXA 1HK6A 3O73A 4B35A 4EH1A 4D8VA 3HRZC 2R27A 4MJ4A 2JIOA 4Q37A 4LXFA 4NQDE 3QUXD 5KJRH 4M1CD 3IRCA 2CJYA 1A7UA 1X5AA 5JE8A 3W7VA 3PFIA 4OEHA 1MR3F 2ZIVB 2PU5A 3DNFA 3HADA 3QELA 1MJGM 4S24A 1EWHA 4DV4B 1ZIOA 4FFZL 4WLCA 4TV9B 3K46A 4HMPA 4GEKA 3BAKA 3SZOA 4LGSB 5KSYA 3HJFA 4MAYC 2X6MA 2Z56A 1RLUA 3RS0A 3EXAA 4S1SH 2WCGA 2NPFA 1QI5A 1IOLA 1S6NA 1JLRA 1U7WA 3E9YA 5DS1A 4HLJA 3WYGA 2JEYA 3CKLA 1VPVA 4EVQA 4F7PA 4H31A 3OPXA 2W0LA 3EJJX 4PJDA 4PJHA 3RAFC 1OEZW 3M70A 4KJPD 1P5VB 1YNKL 2MSPA 2CK3A 4NS4A 2ZG3A 2PWHA 5D2NA 3EVDA 4IRXA 2Q7AA 3C85A 2EYQA 1HEYA 4E31A 1TMGE 2HREA 1EX0A 4NKQB 2YMXL 4KWEA 5TQ2A 3KJ4B 4MNQD 1VBNA 2WOYA 2AXNA 4D3DA 5IDQA 2QEQA 2BSED 2Z2XA 4P46C 5AOIA 3S96B 2WI8A 5J1TB 1N59A 2ITEA 2VDLH 3C7CB 4ACBA 5BQ3A 1PG7L 4FKMA 1PQZB 4KIFA 2EZUA 3TIDA 4PLJD 3P2YA 3DI2B 4DMGA 4RABA 3OPUA 4HKJA 4RX1A 1KIRB 2G88A 4IO0A 4K7FA 3O41B 4Q6IB 3AV0B 1C7ZA 3SS7X 2FMHA 4AUJA 4RESB 2PD3A 4PPNA 1U2RA 1N7ML 3N85L 1IZYA 3IELA 2GJ6B 3H11B 3K91A 3EOYG 4C3ZA 1VYVA 2J3IA 4IQFA 2X44D 5L2KB 4BFXA 1TMCB 3L5IA 1J9QA 4MK4A 3CDZA 1FS6A 3N39C 4PBRA 3DE2X 1ONPA 3LUDA 1UXOA 1GYVA 3M07A 1Y9JA 1DVQA 2VBCA 5L6YL 4F2EA 5IM7B 2VTEA 3SK0A 4MEBA 4RA3A 4PINA 4RMUA 3I6KB 3V5DA 2QSVA 4ZFOB 4L4VB 1KN4H 1JLSA 4PLWA 4ZVLA 1IN6A 1C1DA 5ECJE 4IGFA 1LWOA 2WYIA 3ANSA 1F12A 4CW1A 4QNPF 3HI4A 3V7UA 5D1XE 5CIYA 4G7YH 4AJVA 2ILLA 2GUWA 2QRQA 1LVUA 3MELA 3J2PA 1DOAA 1QSEB 5F9OH 4WHDA 2GD2A 1SH7A 3I2CH 3T0GA 3N8NA 3MBWA 2BFEB 2J8OA 2Y9RT 4G7QB 4K9SA 1N8SA 3KMDA 2NV0A 4M38A 5KHAA 4RNDB 3DX6B 4IIZA 5HPMB 2C2XA 2HRDA 4G01B 4H8WH 4F9LC 4NJMA 5HY9A 5T8IA 1VGRA 3IQXA 2GXQA 1VKJA 5JY1A 1BX2B 2W38A 2OLDA 4N25A 2I6TA 4C58B 1OXVA 2ONKA 3GLHE 3BSGA 3U26A 4PLKC 4LLUB 4EHLA 1RPNA 4JR1A 4WNJA 4HKXA 1AZCA 2GHTA 2X4PA 1XMWA 2AJVL 1D2NA 2JLBA 3X1DA 2AXFA 2QVBA 4HOZA 3BUQA 4O02H 3A1EA 3GPLA 4I85A 4I87A 2GSIA 4RXMA 4EJ0A 2J6EA 3O4LD 1UT5A 1GP2A 4LCCB 5LA6F 1I5RA 1EXUA 5D86A 1QQ6A 2R6GA 3IIEA 1E8YA 1C81A 3U39A 3WKQA 4NKIL 4K3VA 4B53A 3KHKA 2W42A 1ZPUA 3OPYI 3QEBZ 1ISIA 2O8CA 4P53A 4YJZL 3AETB 1FGVL 4Q14A 3MXWH 4NQDA 2G9UA 1O6CA 4OX9Y 1NF9A 2WIMA 3BDXA 3ZKQD 3EHEA 4KCGA 1YQVH 3QJHA 1NXSA 2RAMA 3HCBA 3QVUA 4FQIL 1KELL 4OCWH 3B2UD 4A6YH 1P8JA 4F5YA 5C8DA 1UUNA 2POQX 4TTAA 3AERA 4FUTA 2BNRE 3QR1A 4KX5A 2Z31B 3RIMA 5BV7B 2L0DA 2CXOA 1TU2B 3MKKA 1N6HA 4IK6A 1FRZA 1L7RA 5U9CA 3C5SA 4CU7A 1WHSB 3CNOA 1CY2A 2P91A 2J7KA 4EOWH 2F62A 5D5HA 3A26A 4IZIA 1G7SA 1RZKC 3EFFB 4XCCH 4G1VA 3NCHA 3I50L 3QZMA 1EGHA 4K5PA 5KWSA 2F74B 2K4AA 2V65A 3GCZA 4U6SA 3EUUA 1UZ8B 1I7RB 3PPIA 1B2YA 1V43A 5JDIA 4EITA 3AT0A 3QDJB 2FG6C 4KR7A 1C3JA 1WV1A 1BMDA 4PRLA 2BNQA 4CGUB 4M48H 4AXXA 3ETCA 2D2VA 1BGXL 5D7LA 4EZKA 1NAHA 2Z6AA 1TFHA 3S37L 3S5LG 3PHAA 2EDYA 4ACPA 2W4QA 1QK3A 4WCFB 4DCVA 5F98A 4OGAD 4L5AA 4N90E 2G9NA 1RZJC 1E0SA 3LX4A 5B39G 1IAII 4P33A 5EJ7A 1N0LA 2FT8A 1UJ4A 3DV4A 3DAPA 3WLJA 4HVCA 4QOEA 1J2RA 1DT3A 5SY6A 3VB8A 3FXAA 3ES6B 3KE8A 2VXSL 2QVCA 4JDUA 4BFZA 4U05A 5DJCA 2PV7A 2FUG1 3GINA 1LUAA 4UBKA 1KPRA 1FUUA 2V7HA 4D56A 4ZVSA 5A4DA 1F17A 3SX2A 3HU1A 4NCKA 4Z18A 2H7XA 1HE4A 5EC8A 3GOQA 3G08B 4P2QD 3ZDEA 5E5UB 3TZBA 2D7TH 2HJFB 3RDTD 1ESZA 4EYEA 3QIWA 2AP2A 4PRDB 4HZGA 2G7MC 3W78A 1SKQA 4B9CA 4UYQA 1MUJA 3HVIA 3LIUA 4Z76B 2J1LA 1L9MA 3MJ9L 5TVKA 1INEH 5GAJA 4C4RA 3OR7A 2WG0A 1SCIA 3SHVA 4C4AA 3DPBB 1RV6X 1FXWF 3EJYC 1JEQB 2QR5A 4QUGA 3SKJL 2EKLA 2OO5C 2G9KA 4MDIB 2PGIA 3BT0A 3TO4B 5INCA 1EDZA 1NLFA 5LP6F 5FP0A 1CTQA 1PJWA 1VIDA 5EG6C 2A8YA 3ICOA 1DZ0A 2NR6D 4KKBC 2UY7B 3WBDA 2Y99A 3HGQA 3R4CA 5EVCA 3M4JA 4P3DA 4BUGA 3FK3A 3DXAE 1E1RA 1UKCA 5FOVA 4HOMA 2Q3EA 1X9RA 1GZVA 1Z9LA 2ANCA 2YFNA 4YH6A 4X9GA 4Z5RA 4UC0A 1NL0L 5HJ3B 1DOZA 3QOYA 3ND5A 1KOGA 3HXOA 4C0SA 3MAJA 1G1MA 2FJ0A 3BESR 5DW0A 5IW8A 2IOQA 5CLJA 1SK8A 4MIEA 3HG2A 3O8NA 1XCQB 4J12A 1FOEB 3KOZA 3ETBF 1SWVA 1TTHA 1KB5H 1HO3A 2VQFB 5JXGA 4M8RA 4GIOA 1HESA 3GT3A 2IADA 5F9WC 3EZJB 4L8YA 5FO7B 3EZ9A 5E9DD 3GLHA 4AQOA 3LT4A 1NC1A 2DM3A 4XO4A 5JW5B 1P9LA 1UFQA 3AUYA 2Z6UA 5CKAA 5LQCA 4PIBA 2JFBA 5CG2A 2XUDA 4GPTA 1IGYA 3L8DA 1RZUA 1Y6RA 4H0FA 5ANME 4WUKL 5IKPA 3L1VA 3O6LL 1Z7BA 3MBEB 5GIOE 3J7AC 2Y22A 3HP4A 2WV9A 5GRUL 5F6HJ 3AX6A 4AS3A 4DMUB 3W8DA 5L8KB 4U1JA 3FSGA 1YR2A 4BQIA 2EXSA 1EFRA 2PVCA 4IDAA 2PN5A 3R0VA 3DBRB 2AN4A 3TZVC 2QT6A 1LY1A 4JI7B 1KETA 3JYCA 4KK8C 1G66A 5AQ1A 4I3FA 2FZVA 3DHWC 2AG8A 5EU6B 2VR4A 3UHFA 3ZU2A 2NY1B 2XA3A 2IFGA 5A7FA 1FW8A 3AXSA 2X3UA 4B3IA 3VQMA 3GRWH 2QTCA 5IHZB 3CVCA 2WP3O 4ZTPH 4HAFA 2VAWA 1O97C 5FLUA 4M62L 2NZWA 3D4IA 4NE9A 4BQEA 1QZNA 3M33A 2FP3A 1URZA 1EJOL 1U3FA 2P9JA 2HF9A 1ZVJA 5L3QA 2HHAA 4RJ2A 3JVGA 1EA9C 1NC3A 4PHHA 1ZLDA 2WWNA 2G5BA 2XAAA 2VF8A 2BNRA 3EIEA 2ENYA 5KSAB 2EQDA 5JW4N 4M2LA 5I16B 1TZ8A 3R06A 1NVXQ 1VRWA 1H6EA 3K0YA 3C6LA 5FUMA 1P7BA 4GH7B 1G19A 4ICIA 5IEBA 4MZRA 4IJMA 3TNJA 4MV7A 3T3IA 5CINL 4CN1A 1U6AH 3ULVL 4MVBD 3S4SB 1ETZB 4KE6A 4GVPA 2EXYC 5L6MB 3EUDA 2R84A 3WO0A 3QMWA 1DCMA 1F0KA 2PKEA 4RAQA 3QPBA 3QLUC 4LAJH 2QR0A 1GGEA 1PEAA 4DADA 1A7BA 4YHNB 4J2XA 1E4OA 3UMCA 1WG8A 4QDOA 3ECBA 1BV8A 4JENA 4FU0A 4XQEA 4M8VA 4BUQA 4NQXA 1M0SA 3GGDA 1D7DA 5F3BB 5EMKA 5JEDA 3AJ8A 4EENA 4UTCA 4C6TB 4E6PA 5EWJB 4OFQA 4HEA6 3GMQA 1QCCA 1ZP6A 3HE7B 3QUMA 2BHUA 2FFQA 3PCTA 1E5UI 1CNFA 1ZSHA 2MMGA 2QS9A 4AMXA 1FY2A 1X5MA 2CM6A 4NC9A 1Y6QA 2XVAA 4JT2A 4GBXA 4KWHA 3HFMH 3NCWA 3AG3B 3ZBMA 3TX2A 3TVMA 3T6WA 3TFBA 4CF4A 4FKHA 4R1SA 3DMPA 1YSOA 1MCNA 4F2GA 1QP0A 5TTRA 1RR6A 1FJ1A 2AN3A 3K6NA 4IKPA 2XYQA 4Z4QA 1GS6X 3PYXA 4MQUA 3MMSA 2Y5TB 3NCYS 3OWXA 3NTXA 2Y6UA 3ZDZB 3BH8B 1KLUA 1Z9BA 5FA6A 5GS0L 3COZA 4BNUA 3SZUA 2X6VA 3Q41A 4JBYA 2XXAB 4JM2C 4AULA 4RQQB 3ASZA 5GZOC 4B95C 2HTLD 4YDIH 1AF4A 3FUCA 1IG3A 5FGCE 3MJSA 1Y3HA 4QHNA 4DTGH 4FI6A 2FUCA 2CXQA 2RAFA 3CN4A 4MEJA 4P4RB 4GRAA 4Z77A 2XX0A 1BAWA 4FBMA 3PRKE 1GM5A 4O2FA 4JMLA 1OY1A 1I6WA 4AY3A 3AXHA 4EF5A 2DWTA 3FCSB 3S1LA 1BD2D 5FLVA 5TS3A 1O5DT 2ZRPA 5KNDD 1RUKL 3VJ6B 3TL2A 4WQMA 2R79A 3WL5A 1TTAA 2HH0H 4RVSA 1TJMA 3GAFA 2IWGA 5JXAH 1RDFA 3QZNA 1GC1H 5JUEL 2DTSA 1MAWA 1IE3A 3FB7A 4WWKC 2WF6A 2P7IA 4QKTA 4AUMA 3MCLH 4QYMA 2ZX7A 4N41A 4G8GB 1P0SE 3ZY4A 2BVYA 4K4KA 4IRZA 5HTOA 1AY1L 1KPUB 5DUPH 2NU7A 1C30B 3DXAA 3QM1A 1RLTA 2QQFA 3DULA 5GONA 3BD8A 1XF9A 2XOXA 4UQ3A 3V8EA 2UZYB 4HALA 2A0YA 3NA9L 3AUVA 3D9AH 3VBCA 1R3LB 2WXHA 3KPOB 1XV5A 1NQBA 2CCLA 2GI0A 4QHMB 4TKUB 3FLEA 4KFTA 4KNSA 3IUQA 4E2ZA 1YEIL 2YN3A 4F5WA 4E5XG 4MW0A 3WR5A 4EW3A 1SXSA 3S5YA 1YUHB 2BY1A 2XQKA 2KZWA 5T3ZH 1I3RB 1XZ0B 2X0VA 1R9MA 1C12A 4RPKA 1CXEA 1C8VB 2M6LA 2FWUA 5TF1L 2I9LB 3VRLE 2XYCA 1S7GA 3H16A 1XMIA 2JI2A 3C39A 3QY9A 1P0MA 3REVA 4RGNC 1SHYB 1D4FA 3LZPA 2YO3A 3W5NA 3I85A 4L1TA 4M93B 2ORYA