1TYEB

Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
440
structure length
440
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for allostery in integrins and binding to fibrinogen-mimetic therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-IIb
total genus 115
structure length 440
sequence length 440
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 1tyeB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 1tyeB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1tyeB03
1NA5A 3T3MB 3ZE1B 4WK4B 3ZDXB 2XWBF 3EG9B 3FCUB 4JDUA 4UM9D 4M76B 3OKWA 3AL9A 1CK4A 1PD1A 3IBSA 1DZIA 1M1XA 1IJKA 3M6FA 4A0QA 1SQ0A 3EOAI 1M10A 4NEHB 4WJKB 1T6BY 3K72A 3GXBA 2O7NA 3BN3A 2XGGA 3F78A 1U0NA 4F1KA 1Q0PA 4MMZB 1IDN1 1ATZA 3F74A 2M32A 1IDOA 2UZYB 1JEYB 4MMXA 1FE8A 1JEQB 2XWJI 4C2BA 4IXDA 4HQLA 1MHPA 4CN8A 4O02A 3ZDYB 1M2VB 2I6SA 4IGIA 3EH2A 3ZDZB 1XUOA 1JLMA 5E6UA 5HJ2A 2VDPB 1IJBA 1AUQA 2I91A 3PPVA 1BHO1 3AFCA 1V7PC 5KYUA 1AO3A 3EOBI 3PPYA 1N3YA 2P28A 5E6UB 3FCSB 4HQFA 1RD4A 4UM8B 2IUEA 4O02B 1PD0A 1OLZA 4MMXB 1JEQA 1JEYA 3AL8B 2NUPB 4O3UB 2VDLB 1ZOPA 4MMZA 5HDBB 1N9ZA 3ZQKA 3K71A 1JV2B 2VDKB 4UM9B 1FNSA 1L5GA 5KYYB 2VDMB 3NIGB 1AOXA 4K3JB 4NENA 5KYXB 2ICAA 1M2OA 3BQNB 3K6SB 4Z7QB 3OL2B 2X5NA 3EGXB 1DGQA 2VC2B 1OAKA 3EG9A 3RAGA 1TYEB 1MQ9A 1U8CB 1QC5B 2B2XA 3EGDA 3QA3E 3V4PB 5KYYA 1JV2A 2VDNB 4G1MA 3VI3B 1RTKA 4MMYB 2QTVA 4FX5A 4C29A 3IJEA 5KYWA 2VDQB 4G1EB 2WINI 5E6SA 4Z7NB 3NIFB 2NUTB 4PN7A 4HQKA 1M1UA 5LN1A 4CN9A 4IHKA 1MQAA 2NVOA 1QC5A 1RS0A 3BQMB 3E2MA 3HXQA 2WW8A 4WK2B 4Z7OB 2VDOB 1ZOOA 3EGXA 2NUTA 4O3TB 3K6SA 3OL2A 5E6SB 3HXOA 3PPWA 4WFQA 1SHTX 4NENB 5E6RA 5HGJA 5KYXA 4DMUB 5KYWB 2I6QA 4HQOA 3TW0A 1SSLA 4WK0B 3TVYA 1L5GB 4MMYA 1YUKA 3EFOB 4HQNA 4G1MB 1YVPA 1XDDA 5BV8A 3EGDB 1ZONA 1LFAA 1PCXA 3EH1A 4BJ3A 3Q3GE 3K72B 3ZE2B 1MQ8B 5E6RB 4GZ8A 3TXAA 1BHQ1 1MJNA 1PT6A 5KYNA 1MF7A 4C2AA 2P26A 3TCXB 5KYUB 3VI4B 4JX0A 3K71B 1U0OC 1SHUX 1M1XB 1YVRA 2VDRB 4G1EA 2ODPA 1RRKA 3EFOA 1QCYA 3IJEB 3PPXA 1M2VA 3NVQA 3AL8A 2ADFA 2NUPA 4F1JA 4XW2A 4FWWA 1XDGA 3T3PB 1UEXC 3HI6A 4CNBA 1T0PA 3FCSA 3N2NA 1U8CA 3NIDB 5ES4B 1SHYB 2ODQA 1CQPA 3OKYB 3ZE0B 3V4VB
chains in the Genus database with same CATH superfamily
1XEXA 2MCFA 3SE3C 4PB0L 1B6DA 4X45A 4OZHB 2GCYA 5JLAA 3LKPB 4PY2A 1RPTA 3B9AA 4IJUA 1SBYA 4DJMA 3AKYA 5ALDA 4A4DA 3UBTA 5MEQB 4M8QA 1I4EB 5JNSA 1OVMA 4WKNA 4M7PA 3UK1A 3HY4A 4GQIA 1RUQH 3DDZX 4G5RA 1JW9B 3IVXA 3FROA 2IYSA 1NDGA 3FYUA 4GQ9L 5EYPB 5G0SA 3QMMA 4ES6A 2ATAA 4KH9A 4O3UB 4PRIE 3BP6B 1Y5NA 2GZRA 1TM3E 2NZJA 2BGWA 5HDBE 1NQXA 5BW7C 4N5LA 3R1GH 3X12A 1H0DA 2BD0A 2QQQA 2EDRA 3DHVA 5C3TA 4GH5A 4Q4CA 1QRRA 1OILA 3INOA 2EEBA 2B9EA 4YPVA 2IBBA 1IZYA 3BPLB 4RMVA 5HYJD 2PGIA 1U90A 5T1DH 1NW7A 1H3PH 3LH2H 4CSPA 2MIIA 2X9QA 3BFPA 3U7AA 3CX8A 4L9LC 3CPUA 1E69A 2D5LA 2PR4L 3BGFC 2FSSA 5FBZA 3OJWA 7REQB 4YAUA 2O59A 4C8XA 2F48A 4P3WA 4YMIA 4FOMA 1IIBA 1KFGA 1SA0B 4PQFA 5CXQA 5INDB 4K3JH 5IMKB 3L3HA 5IK3A 1KJ8A 4JNKA 4XWTA 2F64A 3EHEA 2ZJ1A 3GRVA 2YUVA 3QRLA 4B31A 4Q1CA 2FPKA 3RUPA 5CNIA 1IO4C 2CO6B 2WY3B 4OU3A 4UNNA 4KI0A 1CY1A 3FB6B 3ERCA 1ZLEA 4R4BA 1AX9A 3BISA 1M71B 1J5OL 3P27A 1G7HA 3WK5A 2HU5A 1GU1A 3C6KA 2P6UA 2N56A 3JPYA 3KXKA 2KL6A 4DLVA 1T20B 1RXWA 4FIDA 1MRZA 3TSAA 4UOZA 3JTMA 4YUVA 5K4GA 1YMVA 3CNQS 4OB5H 2M98A 3R6LA 4BELD 4K6CA 1AVTA 4FI3C 2P9EA 1M9WA 3PPYA 5I75C 4HDKA 3ZKMC 3NHFA 3QVKA 4POOA 2YJ6A 5A04A 3MRSA 4DM4A 2O5CA 1ZJYA 5JO5B 1U2PA 2PCLA 1V5FA 5TPWB 5IEHA 1HX7A 1NR7A 5ALRA 1KCBA 1SG0A 4F7MB 3OAUH 1VBFA 1U9IC 4NAHA 5EMJA 3SOZA 4JZJC 2QENA 2YZ2A 4BNGA 2D3TA 4P2RA 1SUEA 3F9IA 4E5MA 3HI6L 2E21A 4BO7A 1N0WA 5D6DC 2GPZA 2ODAA 4Q4HA 3W9DB 1ASQA 2Q86B 3MC1A 1GGCL 4E9XA 4QREA 4DV2B 1XFAA 5B53A 3FH8A 8LDHA 3F5SA 1D5WA 2VZSA 4OOEA 2PWEA 2ZKMX 3UJ6A 4MS8C 3NKLA 5AVQB 3B6SB 4LQCA 3D3VB 1P1HA 3KT0A 1BOGB 4NBRA 1NOJA 3IB3A 4JFWA 1VESA 1P1JA 4FXLA 5L4JA 3EFFB 1T0PA 1S2IA 3EN0A 1DPFA 3K1AA 2FZ3A 4GVXA 3OKWA 2R44A 3NHLA 1RYNA 5EG5A 1QPGA 3FOLB 3EOAI 2C9ZA 2OYSA 3DAOA 4LSQH 2CLEB 3U9PH 1KMCA 4JC5A 4TUYF 4XIYA 1QFWH 4P22A 4AO8A 1F3JA 2YV4A 1B8NA 3QI2A 4QQKA 1QTYT 1Q94B 3SODB 5F1IB 5KJ4A 1OW3B 3LV8A 3LXRA 3DWTA 3FXAA 4XRRA 3NR2A 4XNQA 1ZIOA 4L8FA 3CVXA 1ZH6A 3LUJA 1BZYA 2R23A 1XTPA 3NYWA 2J1LA 4L6AA 1TJ3A 1YA8A 4NQQA 4KHXH 1SMOA 4JLUA 1UOWA 1RPKA 2YD2A 2ADFH 3BK2A 1BSIA 2QPTA 3ORYA 3RFCA 5JNLA 3VU9B 5AAMA 4JKIA 4DN4L 4ZUUB 4PGJA 3TNFA 4G9FE 2FLVA 4URZR 2UVPB 2UWEB 4ZQGA 2XT0A 5DJAB 5FA5A 2PMFA 1GJUA 4P5DA 1ZRSA 4KU1A 4K71B 4HZUB 4RZ3A 2BC4A 4S1RL 4L2LA 3RK4A 2J21A 1HC7A 1QBML 3VCLB 3V0WH 3HI1B 4EKIA 4QOEA 5DM1A 2I66A 3GJEA 1FIEA 3NPAA 2XGSA 2P8MB 1OLUA 3I6MA 2ZBGA 2BHYA 2DTXA 1I8IB 3AHHA 1MEJA 4P5RA 5C8JA 3UV6A 3FG9A 4U0JA 4XWWA 2XTLA 3Q3CA 3GJZA 2Z7ZA 4D4IA 5CNHA 4NESA 5TMDA 3TFBA 2AGJH 4D98A 3O73A 4CMIA 3CVIL 1UYWL 2HTLD 3NDZE 3M2PA 1S3GA 3RAJH 5DBEX 1Y0LB 1JEQB 5I1DB 2VW4A 4GKLA 3VMMA 1WVMA 1CIPA 5AJXA 3LQKA 3BAEL 3DKKA 4B2PA 1EZ4A 1SUAA 1ULZA 1A1NB 3GL9A 3ROLA 1ZI6A 3OPZH 1H15A 5EMYA 2G4CA 5EJ6A 4EF5A 3O3UN 2WWKT 3ZLUA 1JN0A 3AR7A 1QHEA 2CXRA 1V3VA 3W06A 1ACXA 1NMBL 3HAEA 4M6WB 2G3ZA 1T1XA 3OG4B 3WI7A 2FL5A 4JL5A 2BW0A 2O52A 3RQ3A 1T0HB 1URZA 3UTTA 2GZHA 5MHTA 1JEDA 3A3NA 4M1CC 2CCLA 3SE6A 5LMCA 3BIBX 1BCRA 1AV6A 2QLBA 4D9QD 4DSYA 4I2NA 4PJEB 2J4CA 3ZL4H 1I75A 3T35A 5DSCB 1LKZA 3SSGA 3H86A 1SLUA 3GCGA 2J0UA 1JA1A 2IQIA 3EHBB 4Y4HD 3OLDA 1YYML 4YHMH 1S1CA 2KX7A 1MW9X 2AK4D 4K6OA 5AB1A 1TVBA 5HJEA 2IV8A 4WBNA 4DFHA 1MW1A 4UHCA 1JIKA 4DCQA 1CYEA 3OPVA 3PAUA 5TPWA 4R54A 2OKGA 2AN3A 1J8HE 4KVPA 1E9AA 1R8QA 3IOYA 4XFJA 4EPYA 2EDKA 4N0FB 2IF2A 3RS2A 5HSGA 2MCG1 4WHYH 5DDHB 1EO5A 4FBLA 3N2NA 4HUXA 4GMTL 3DX0A 1SO8A 2ZJOA 5AK0A 4UKDA 3QDMD 2GMWA 5C0JB 3QHFH 5JHLA 3CDZA 1BHSA 3VTMA 3W2IA 1I4FB 2X88A 4RA6B 2QBYA 3MHTA 2WB1A 1EGVB 2X8LA 4EO5A 4UNUA 1BHO1 5FTKA 2P6PA 2BFCB 4PAQA 2DI7A 4WHMA 4Z0XA 4JLWA 4OCYH 2HA7A 1G0OA 1PJCA 4RZSA 2WSMA 3VD9A 4O4IB 3PFNA 4HDMB 2CR3A 4DEYA 4CU8A 2GD0A 1QNLA 1EVTC 2KS0A 1JGEB 3NO4A 5FYLL 3LH9A 4Q9IA 5E6IB 3BBPA 4ZT7A 3Q01A 4H7EA 4C58B 3SZLA 1KHTA 1O6CA 3N86A 2EXYC 4GXUN 1G94A 1IEBA 521PA 1V37A 3P19A 2PX2A 4HNAB 4ZYVA 3T9AA 2WVGA 4KVNH 2ZCZA 4L0ZA 4UJ3A 4N8VB 1SCJA 4M5TA 3RG1C 1W0YT 5F1IA 5TDOA 3LM8A 3GXIA 1E5TA 4HNAA 2IAMB 5IROD 1HLDA 2M83A 4DR4B 2VHZA 5CKGA 4YV0A 2VLRB 4N18A 1NJ2A 2Z58A 1XTJA 3AADB 3FCEA 1UEMA 4CNIA 2E49A 3LTNC 1JAXA 2FWOB 1XMXA 3WHXA 4Q6KA 4OCSL 3GBPA 3TF4A 3L7JA 3TCXB 1N1EA 3KWWB 2DYKA 5AI9A 2F5AL 4WKPA 1TQ2A 1MOSA 1U4FA 2OB1A 2ZTBA 3B52X 3MV9E 1MB3A 1A9ZA 1FNEA 1YB7A 4X6EB 1BE6A 3DFIA 4TWZA 4DV5B 5AW1A 2EDYA 3VFNB 4OK6A 1U91A 4X7SL 3GBVA 1OF0A 3GXBA 1NVUQ 1T5OA 2IGFH 4YUZA 4ORGA 1FC1A 5GRZA 4L8LA 3V2UA 2DHDA 3IVAA 4DZZA 5JNRA 5CO1A 1UKEA 4BKUA 2HYIC 4D6PA 5JY6A 1IQPA 4R1SA 4A8JC 1WQ1R 1Y0LA 3VB9A 2NY3C 4QT5B 2V0CA 3K71A 3L3JA 1W96A 3W5DA 5DK6A 5IANA 3WY4A 1AURA 1FLAA 2X42A 5I66B 4AB1A 4INPA 5C97A 1YEGL 3JU3A 3CONA 1HL4A 3PHCA 4Z4QA 4L48A 4G5ZH 2YO3A 1G5IA 4CGTA 3SBXA 4XBEL 3VFSB 5J13B 4FFDA 1HFUA 4AGOA 5KYWA 1DQVA 3Q12A 1TYAE 2PQ2A 5CDFE 2PZLA 4L4VE 5C0RL 2O50A 3HNSH 1O97D 1WR8A 3MRIB 4FOLA 4O4HB 1FO0L 3OB8A 1NXTA 1OP5H 2QLLA 1FMCA 5FOUA 3KRTA 4CL7A 1K6QH 3ROQA 3QHTC 3KBHE 3ECCA 4NZPA 4LCWA 3QMVA 4C7OA 1Y8QA 3F62A 4IKNA 1K6IA 1TM4E 3TJMA 2EACA 1Y6KR 4XXWA 1KG0B 3AI7A 2CKBL 1TETL 4M1OA 4EMZA 1OAYL 1MCKA 5F0LB 1BH2A 2HXAA 1UQUA 5TMBA 5GS2D 1AMYA 4OLZH 3L7EA 4R5TA 5J2TA 2BJML 3I2JA 1BF8A 5CCXA 1KBWA 2XPCA 5AFSA 3QBDA 4OIIH 3DHEA 1BGXT 3CZAA 1V8DA 4LOHA 3LY9A 4PUBL 5TX7A 3AG3B 3QJGA 5KVAA 2Y3IA 4KKLC 1WPCA 4O02A 3EH4B 2NSQA 2PRIA 3U4CA 2FX9H 3E70C 3X1ZA 3IRPX 2G71A 1BJ1J 1NBME 2DPHA 4YMUA 2HR1A 1PNQA 1YBVA 4X1OA 4R4JA 4N5UA 4R2JA 3ARFD 5K0LA 4O02B 2OP0A 1A96A 4RGYA 4AYDC 1PL0A 2WAAA 1FP5A 3RJDA 4DMKA 2G5TA 3HBZA 4R0NA 3CUVA 3PXEA 4JQVC 2AQIA 4UBJA 3VA2C 4EKEA 2I78A 3QUTA 5JIPA 3HMXL 2PP7A 3T09A 2PTTA 3OF6D 2BEWA 1JE1A 4PIBA 1F11B 2EZ9A 1NUQA 4D9LH 2HF7A 1E4KA 1XFPA 1E2GA 3N43F 1WF3A 1R5WB 3ULVE 4MDEA 4MZDA 2NY0D 1SD1A 1Z7JA 3CFBB 1BNCA 5DNWA 4AJHA 3T7EA 4NBVA 2IS1A 3HC0A 4MP3A 4BX2A 4TPRH 1Z2AA 2XZPA 5CFHA 1K06A 4DN3L 3FWNA 3ICCA 3TCLA 4DAOA 5ALOA 3AUTA 3EVEA 1I7PA 4DK3A 1YQWA 4RKEA 5HHOE 3IQHX 4WQMA 3SZGA 1YGYA 4Y9GA 4YEDA 4AZWA 4PTZA 4QM7A 3HE7A 1A3ZA 1RL1A 4UDTB 4TNGA 1U2TA 1LNZA 1X3LA 1QRKA 2VJDA 1MF2L 1GGFA 1N6IA 3BZFB 4WDQA 1GFIA 2QAGA 3X43A 5A1JA 3JQ6A 2ZR9A 1E5QA 4D3CL 1JS1X 3CUSA 2L82A 4D9QE 4XVSH 1WEKA 3E5NA 5DKFA 3ZK0A 2J5QA 4IOLA 5IC5A 2DB8A 1MFNA 4N2AA 3SGJA 3HJAA 1R3KB 3WICA 5AK5A 2CB9A 3WKAA 4M7KH 1S9YA 2VDOL 5ESAA 4ORGB 4BLSA 3HNSL 4FBMA 3RK0A 4AYWA 2RHOA 2ENYA 3FDXA 5KYKA 1EO8H 4ZREA 5A5DA 4GZ6A 3STUA 1NP7A 3LZOA 1A7QL 2JLYA 1Q0YL 3PPEA 3V0DA 1FP6A 1SWWA 1ZA1A 5AVJA 3QZWA 4D0DA 1K9TA 2NTVA 4ZT2A 2GLTA 3WHKA 1W0WA 1KARA 3RVOA 4M0PA 4QTFA 5JZ7C 3N44F 2MCPL 3E9DA 2CPUA 1MWAB 4JOCA 4RHUA 5JIBA 4EE2A 4XB1A 4HDMA 4CMCA 2XN9B 2HRPH 4IZIA 3IQIX 1JPFA 1QHYA 4H0LC 4YC2C 1NGZA 1DVSA 1GKOA 1DLFL 2QSUA 3FB5A 1JN6B 1ORHA 3MNFA 4F7EB 3G8CA 1ODFA 3K0AA 4RIFA 3TVDA 5CFZA 3RVJA 3KTOA 3OAAD 4IGBC 1FYWA 1EV2E 1YJQA 4TMKA 2CLLB 5SWSE 3SOBL 1LO5B 1K27A 1M57B 3F58L 4HNVA 2AXGB 3DUUA 5K0TA 3NP9A 4REMA 2G9HB 2Y4SA 3BA6A 3BWCA 4U7TB 2WK2A 1FX0A 5HVGB 4HK3J 2D5IA 1WP6A 1K2WA 4AG5A 5I24A 2C3GA 4OK5A 4D92A 2ON6A 4A7GF 2ZRDA 3WFBH 5HX7A 1CZRA 1AGRA 1AXSB 1P9LA 1PN3A 4D02A 2Z9CA 1L7DA 5ANME 1VL6A 1J0XO 5IIEB 3IJYA 2R48A 2F7SA 2Q2VA 4P0DA 5HGDB 2Q7NA 1NZRA 2HQRA 2IPOA 1RZPA 1YYMH 4YHML 3L7EB 5J2TB 1SDAB 3IPLA 4WXHA 4TS9A 6FABH 4D25A 1DQLL 1EFTA 1PLAA 1DJPA 1AVAA 4RFEB 5IJVA 3UFIA 2XACC 3HC4L 3C4QA 1AO7E 3KXPA 2ZUEA 1J86A 2PTTB 2OAAA 2AMJA 5IOKA 1VMKA 1BEUB 5E4TA 3O2VL 1A95A 4MVJA 3GEPA 4EIZC 2OULB 1JGUH 2F53E 1NEZA 1IFXA 1J07A 1NXVA 5LP1A 5CVUA 1MJJB 4NZZA 2VITB 3DGDA 5DM0A 3Q7IA 2FGWH 4B35A 1ZXXA 4FZ8L 3H5VA 3TBYA 4M0EA 4KJPD 1UFOA 4ZXFA 3S96B 3WLFA 1K5HA 4W1TA 3MV9A 3KG2A 2I2CA 3B2UC 3QZLA 2D06A 1PJZA 4F60A 2GD6A 5JQ6L 4YAQB 5C7OO 4R81A 1V1JA 3QFGA 2JGNA 2AJVH 2B4YA 5KVVA 1CRPA 2Y68A 2Q41A 4W1PA 3W6UA 2EC8A 5BOPA 1GQYA 4OQNA 1INEH 1XTQA 1CO1A 2R0KH 1MCSA 4Y1SA 1BROA 4J7CA 1XWFA 4GOSA 1YEEH 3EBLA 4PQRA 1F90L 2PGJA 4NQCD 3FHEA 1PQUA 3UJHA 3TZVD 3F85A 1II4E 2G4VA 3S2IA 3VCLA 4H17A 4QPDA 2OTCA 4EBQL 3AKCA 4IIXA 4F4DA 4XVJL 2WJYA 3NIWA 5FO7A 4NU6A 1LF5A 5GIRB 4MWEA 3TD6A 4JZOB 3PXUA 3K72B 4CIBA 3QVAA 4JHAH 3L45A 2OQJA 4RRPM 1GZHB 3BXHA 3ND8A 4MS1B 2DLEA 4RTOA 4AWJC 4HFNA 5ELIA 4P2QA 4KMTL 1G9XA 1UM6H 3KPLB 1T1SA 1QH0A 3ZY4A 1PSDA 1SIBE 4TUUA 3QFSA 3K1TA 1RHHA 1U9KA 2A3TA 1NVGA 1S2MA 4US2R 4X9GA 4WO4A 3UA4A 2EF1A 3CWQA 2XG5A 2RBKA 1DQNA 2I85A 3M1AA 2W2MA 2G4GA 5KANI 2QSCH 1NQ5A 1B42A 1QHOA 1IEHA 1ISJA 3B1ZA 3IH5A 4G59C 1ZITA 1N5AA 2B59B 1F5NA 4M22A 3CFMA 4WW1B 4KPHH 4Y88A 4TZ0A 1RLBA 4ZU6X 2VDUE 4AL8H 5B6JA 2BP0B 1RUQL 2TAAA 4RRPG 1V9CA 3KZOA 3QE3A 4ZOLB 4IY1A 2GAAA 2O1SA 2WO3B 1ZH2A 3I9V6 1EK2A 5E1AB 3KALA 3KYDA 2BO0A 4KNTA 2Q5QA 4NC2B 3KOXA 1DG1G 3NXSA 3UG6A 4J3SA 3NT5A 4KKAC 4QOKB 2JFGA 2RGNC 4TQHA 1N4XL 1CGSL 1PCXA 3L4KA 2ZK7A 1CF1A 4IGBA 1KY6A 1TYCA 1KH1A 1GTMA 4AP6A 5DGQA 3O3AA 1DJWA 2WYWA 3RE0A 3FI0A 4LXXA 4JI4B 5HGDA 3SJUA 4UIMB 3QH3A 5A2IH 2AF4C 2G5RA 1E1KA 1E8MA 5K8CA 1SJHA 2C9OA 3Q2KA 1NKRA 5LP6A 1JXQA 2E9SA 2NW6A 2HJLB 2N7AA 3GZPA 1AN9A 4K5PA 1U2CA 2I7TA 4ER5A 1CLOL 1SFDA 5KMGB 2UZIL 2WUVA 1ZFNA 4PAOA 3ZDAA 3X11A 1JGTA 1NKOA 1PW3A 2H5EA 4A5OA 3MAAC 3REFA 1E2IA 4KRMB 4WW2B 3UJ7A 4MR9B 2C95A 2QN8A 1ID8A 3PJSB 3KPPB 3AG2B 1X13A 4BQPA 5HTSA 1ZIBA 2X1LA 3HSYA 3OT1A 3QPXH 3EDMA 2M6KA 3OX8A 3BSZH 3BHJA 4NRZB 1UOQA 5TT1A 3RL2A 3G5MA 1KAGA 3TOSA 1R5OA 3T0WA 5HQJA 2MMCA 1GAJA 1F13A 5FOQA 4OMFG 5BSUA 1LTXA 3RIKA 4QXUH 1DQJB 4MKXA 3B1UA 4ZP1A 5G3YA 2C98A 1NINA 1A4CA 3C5ZC 4P34A 3QJXA 5LSAA 2DF8A 5HHVH 1EDOA 3OLIA 3HN8A 3ETGA 3IJYB 4JFZH 5LIRA 3E4CA 1FFHA 1MRCH 5L8JB 4KQ3H 1EFVA 4D3SA 1KIAA 3GFBA 3T6VA 2ZU6A 1A4AA 3E3AA 5HDWA 5DF1A 1XXLA 2HA2A 4U5XA 3WKQA 4CXMA 3GPLA 3AY7A 3CDGA 1I32A 2ZRIA 2YDXA 4UUJB 2R5WA 3ZQKA 3SHTA 4CM4A 1MOQA 1L7IH 2IEAA 1EVZA 2PT5A 1GM5A 4DDVA 2IG2H 3E9YA 3OZ9L 2YHIA 4WTZA 1N0XL 5JDSB 5CB0A 1SCQA 4Y5XA 2VMDA 1OWRM 5EE3A 3KAQA 4ZQFA 2WD8A 1UPAA 2WA2A 1A9QA 4FAAB 2GBFA 1JZIA 1HYBA 4RKYA 4UYQA 2F17A 1MFZA 5C6PB 3FF1A 3A1SA 1FZMB 4NC1E 5DBHX 1LWHA 5ICEA 2FLWA 4C4KO 2NP6A 3EC1A 4J0IA 1ZHFA 2ZIEA 3ATDA 2UY7B 4AU1A 4IGKA 4JO4H 1U6IA 3C3XA 4M87A 3TKLA 3OTQA 4YCSA 4GY4A 2MEJB 2GN4A 1XH1A 2FZ3B 3FOWA 2CJWA 3H56A 3NQKA 1MTOA 2QN1A 4ZQKA 3M6DA 1MDBA 3L4BC 3GZOA 5FH9A 3WFHB 1U1FA 1VL0A 4BFRA 4GRLB 3L84A 4M98A 2WLLB 2Z8WC 5DJCB 3LKNA 2IYRA 1KDYA 5K0SA 4WHDA 1TTHA 4MVBD 2CXKA 2AYXA 1MH5B 5IJ0B 4YVUA 3IAPA 3VUFA 3GN1A 2PN5A 3KVRA 1D9KD 1TPXB 1HWGB 3K6DA 2PBZA 3TR0A 3PXXA 4LIQE 5EKTA 1LNSA 5NLLA 5CAYB 2VMFA 1BJMA 2GOYA 4NQEB 1OP3H 3KPVA 4LJ4A 1N6QH 1HYSD 1BBJB 2HAEA 3SM3A 5ETUA 2Z3VA 3WWYA 3NZHL 1NMQA 3GS0A 1W1WA 3LP6A 3OZGA 4WA7A 4BP3A 4YT5A 5E7IA 4JHAL 4MAUL 4U8HA 5H35A 4ALAC 4B3JA 4EW2A 2H1LM 3N6XA 4XB8A 3KBPA 3LN4B 3HHEA 2IDFA 2UZYB 2DF3A 1BEEA 1T9ZA 1DCFA 3ZKSD 4U2ZA 1RZQA 4LGPB 2YOHA 1W6LA 3GK8L 2WMDA 3MA9L 4PW3A 2PA0A 5WRFA 4EO4A 2ORWA 3HI1A 3BSGA 2X28A 1HDIA 2HJWA 3EVBA 3VNQA 1CXIA 4PRIA 1TVDA 4WKXA 3QCTL 2KJQA 4F3TA 2AOTA 1NU6A 1P19A 2ZYTX 1JV2B 2A5YB 2AXPA 5KBLA 1YV9A 2A0LD 3FCYA 3W3AD 2WT8A 3FSEA 4HKJB 3GP8A 4OAWA 4A68A 2PNJA 5I7VA 2CCWA 3FTZA 2APVA 3GEWB 4ZCSA 2QYOA 1WB5A 3OHSX 5IG7A 3FPYA 5K0NA 3EYAA 1RC0A 4P54A 1J0IA 2VXYA 1ZK1A 2CLIB 4HDIB 3N1MC 1X2EA 4W5JA 2VAXA 5CJQL 5BURA 5LQDA 2JATA 4MSUA 4OLYH 2CR6A 4PGDB 4E5SA 1C9KA 1VPTA 3H4HA 4OQFA 1F48A 3ALPA 2GBCA 5LP6C 1S7QA 1ZUHA 3QPQC 1A4IA 4YC2B 4Q3OA 4XVRA 4JGGA 2VUKA 5D2LB 1EDYA 1G8MA 1GDDA 1VLJA 1L3NA 3BZ4A 2C2KA 4FKEA 4IRSC 2IYTA 1R0AH 1I7ZA 1HYHA 1Y6QA 1BXZA 3LIZH 2WJ3A 4S0TD 5EE5B 2XZAH 3NKVA 4HDKB 4APQA 2GHWB 1KGDA 4X6YA 1ISPA 3N7AA 2M9MA 3MBOA 2OQ2A 1RI2A 2X4QA 5HHXH 1RQ5A 4HOZA 4XN5A 1RLMA 2SKEA 1X5MA 1YS7A 3IBFA 3S7ZA 5M29A 3ZYIA 4F5CE 1LBEA 2RI6A 4X8JB 5FBHA 2R79A 5ACLA 4KUCD 2Z5GA 3SYMA 5ALVA 2OZ4H 1VM6A 3F12B 5CR8A 3I6BA 2R1YB 1XGTA 5JH7F 4IOSD 1W0WB 2CV1A 4CDGC 1A66A 2A9NH 1H1LA 2P9CA 3BHIA 3CSFA 3RSHA 4QLOA 1SVKA 3DVNB 1BJ8A 2VS1A 5LYJA 3KSBC 3HXOA 1P4RA 2C9SA 1KNOB 2B6NA 5JNVA 2CLVB 1EK1A 3HKFA 3M8OH 1C1EH 1WY5A 3ZQ4A 2OV1A 5FECB 4NX0A 1UQSB 1JGEA 2HV8A 2W0FB 4F5EA 3U4QA 4C5CA 2X0KA 3EFOA 4X3PA 4G8FA 4XGIA 1FLTX 1O08A 4CG0A 3LU1A 2XWCA 4UDUA 1H9BA 4D9EA 4C3UA 1XSEA 1UH4A 5HHVL 4BZ1H 4MB2A 2CRIA 3G5VA 3IR7A 1POWA 1TEGA 3HE7D 3PXLA 3EF0A 3L4XA 3LXMA 2FMXA 4HR7A 5E7QA 3KW8A 4CEHB 4UDTA 3F78A 3B2VL 4BFVA 3A6BL 4X8CA 5T3XE 2QTEA 1FE8A 4EFLA 1UXSA 3Q8MA 1IY8A 2YCBA 1N64L 3QVGA 1IV8A 4LP4A 4IDDA 4JE4B 3EA4A 4E31A 3FPHA 4HPXB 3V1UA 1NUSA 3TVMA 1N0VC 4MCYB 1CDGA 3MJ8B 4NFSA 5CM8B 4LLYB 3PDOA 1E2EA 3QZMA 1SVWA 1RXIA 1BX0A 1WZ2A 1KJNA 2A77H 3HB4X 1YVUA 4G82A 3P5SA 1YS6A 5HYQA 1TPYA 4ODXA 3MC0A 4NQDA 4ZFGH 4J0HA 4REQA 1AI1L 3A4IA 1EHLH 4ISCA 3AM5A 1SQSA 3G04B 4MVXA 3EDFA 3BE1L 1CXHA 3GHEL 3MCWA 1XMEB 1KEMH 5FV2A 3VZCA 3IRCA 4W9IC 2JI3A 3A22A 4V39A 1T5XA 4LHWA 3II3A 4WKOA 1EXGA 2N59A 3IA2A 1P60A 2XU9A 2JJ1D 2YRFA 1DE0A 1F86A 1LRJA 2X5OA 1SJMA 4D0CB 4MPPA 1Y4SA 2H52A 4Q9RH 1WPRA 2WQRA 2WBJD 4C4OA 5GJSH 5T5FL 3GC3A 1YT5A 2PT6A 2HLAB 1O57A 2Q9UA 4KV9A 2BF4A 1PS8A 2QTWB 3MLZL 5IC4A 5KTTA 1H15B 3DLIA 5MFPA 1BN7A 1AO7A 1URLA 2FECL 1II8B 4NSKB 4K3JL 1R3LA 5EMLA 4IQ8A 3ASOB 2H32B 4AICA 4ZMXA 1U65A 2W22A 1XZGA 4P99A 5IARA 3MWKA 3TLZA 3I5UA 4XZUB 2V7GA 3ZQ6A 4PH8A 3TQHA 1Q7GA 2DPKA 3PFHA 1MNQA 5ALBH 1AKVA 3QUGA 4HIHA 1TT6A 4CMMB 2DQCL 4Z78B 3CMCO 3KVQA 3OZBA 4MMZA 2JI9A 3G9QA 3W3ZB 3H5NA 4MUEA 3EBHA 4HCJA 4K3JB 4N90E 4BLUA 1NCTA 2NU7B 5JQ6H 2ZIXB 1AXRA 4X41A 4UUJA 3CTPA 4LN1A 4NC0B 3DYIA 4U6VH 4G6JL 1ST3A 5KS2A 3LWZA 5E6ZA 3MLBA 1MPAL 3SP1A 5EO1B 3U7JA 1GYRA 4LSSL 4FABH 3BOSA 3DJFA 1X7WB 3Q2IA 4X6CA 2D03L 3W1WA 1TZKA 4P48A 5BV8A 3D7KA 4UNVA 3KJQA 2J1ZA 1YDPB 1JVOA 5KVDL 1KL7A 5I18L 5IDXA 1N36B 4LYEA 5AL8A 1VG0B 4JELA 2PXYC 1MAUA 1E7UA 2PL9A 3GC6A 3GJQA 2OJZH 3V5DB 4EFMA 3RS5A 5MEOA 3LXUX 4IRZH 1Z32X 4O25A 1CEYA 2QRVB 3BMQA 3QY9A 4N76A 1DHKA 2DM6A 4Z0PA 2D59A 4GS5A 4HPJB 2XYVA 1OGAB 3L7LA 1AGFA 1R5JA 4P4SB 3PHSA 1XXHA 3F8UB 4BVFA 1R16A 1NP6A 4RJLA 2Z31B 1N0IA 3WE1A 1UUFA 3WIFB 1CRLA 3LH2L 4EHDA 5CUSL 3AXLA 2W4MA 2GWRA 2IAMA 1JZ3A 1CD9B 3BWZA 5FDFA 5EL0A 3KH3A 2BRRH 1DTEA 4BKPA 3ZK7A 2FE1A 1YNKH 1QUFA 1LBSA 1SHZA 4OG2A 4YAJA 4B7ZA 3UG7A 4Z6AT 2WK1A 2YWEA 1R8SA 1L9TA 5F44A 1JHQA 2YEQA 4XVUD 4X7PA 5EV7A 5A16B 3ZHUA 2SKCA 4NQDB 5KVGL 2FQGA 4QHTA 4KJPC 4ZX6A 4QUKA 5AUOB 4F7MA 3NZHH 5KHAA 1VBMA 2OCYC 5DM4A 4OZIE 2ZXUA 4EG7A 4UILL 4C4UA 4FXOA 4N6OA 3TW8A 4NH4A 4UT6L 3UQYS 4D9CA 3ST7A 4L4RA 4DN4H 2LKCA 3N2IA 2AEOA 4KKQA 4R90L 3S35X 2YVLA 3EZ9A 4OJFL 1NPUA 1H2ZA 2V8OA 3WMEA 4L4TD 3DGFC 1Y7VA 2PQ6A 5I7FA 4Z5RB 4W82A 4DUZB 2VJ8A 2XVXA 2J5RA 1I8MA 1B9KA 3P77B 2H41A 5F1NB 4DGUA 2Z4TA 1SC1A 5EBWA 3T0GA 3EBPA 5GMOA 4NM4L 1W5TA 4UAGA 3PEEA 1ADFA 2X8JB 1VPEA 4UNQA 1A9BB 2X4NB 2PX8A 2HA4A 1X1CA 1TTUA 1MAML 3HRHA 2C9VA 3WFHA 3ZXIA 2GSGA 2OMXB 2OTWA 3MXVH 3GBDA 4Y4HB 1TAGA 3S8MA 4JJ6A 3PXJA 1AFVL 1PTJC 4MAZA 1AR1D 5JNTA 2VABB 5JE8A 3HE6C 3VGGA 3T99A 5DURB 3PZRA 4G7VH 3TGLA 1VJDA 2FO8A 4XP5H 1ZVQA 3HADA 4K6KA 5E2TH 2JK0A 3A6DA 3K2QA 4TXNA 3CR7A 4UDOA 4I85A 5KWYC 2VL7A 4TZKA 2B37A 4BBPA 3O3NB 2KPWA 1IKOP 4B8ZA 2OC4A 4QHMB 4FDWA 4JVNA 3KYDB 2MFNA 4BCDA 2A77L 1NE2A 4U1JA 4BJLA 2Q7AA 5CITA 1D5BB 1VLMA 2HO5A 4RD6A 5BN3A 4HKXB 2XQYK 5AH0A 4LQDA 3QDGD 3KYOA 7PAZA 2PO7A 4A6EA 4QJ3A 3B3IA 4GP4B 3QK0A 3BPOB 2IZ0A 4KJQD 5K20A 3ZTWA 2B8EA 3RS0A 4ODHL 2C83A 3A32A 5ED4A 2PQ0A 1B00A 4DP2X 4YXWA 4QBIA 5L3ZA 4DEVA 5D7LD 1H2AS 4FG6D 3TTTA 3QIBD 5BNZA 2HJLA 4LZLA 2LU4A 4J4HA 4EARA 3NIDF 4D8OA 3CPLA 2F1KA 4IL5A 2IWEA 2P8MA 1OLUB 5J2UA 4MUAA 1HX0A 5T1LB 1FL6A 5F89B 5EKUA 4JFFB 4U6YA 1CETA 4KGDA 3PDUA 1HXKA 3WG9A 3ZO9A 2WQZA 4HGWB 1SUHA 2PD6A 4DNOA 4ZAYA 4X5XA 5C31A 5BSKA 2W9DL 4JHWL 3ZGXA 3GMSA 2C0PA 2HK9A 2XVGA 2Z1KA 5AW9A 2X9YA 4AL4A 2E1PA 1F18A 3CFKB 3QYJA 1A5BB 2Q3EA 5D1ZI 1T9KA 4K9QA 1XEAA 2VNSA 4G42A 3VQLA 5FPSA 2CFCA 5FCUH 3H2QA 1IWPB 4XWOD 2O5VA 4RGOL 4FTVA 3ZGYA 1U2DC 4ID9A 3GVCA 3FYUC 4EUPH 4JBYA 2NT0A 2VTFA 2NYUA 3ADBA 1CV2A 3ARXA 2NU9A 1D4AA 4EHAA 3MN8A 4J3WA 4NN7B 4EN3B 5KS9B 4JLRA 5FRDA 3H1BA 1B73A 1IVTA 2R59A 1RXCA 5KTSA 2NTEA 3SQXA 3P0VL 3HS0A 1WP4A 2B4RO 5F2FA 3W9YA 3NIDB 5DGHA 2WSSD 4IO0A 1UUSA 2C5BA 3OIVA 1JFTA 3TJEL 4I55B 3D7NA 2ZXGA 3TYFB 5AG8A 1WW8A 2AW3A 4M8IA 1KAMA 5K3CA 2CHGA 1FLDA 2WAYA 4N6RA 4H0FA 2IHJA 4ZT1A 1LDEA 4KLNA 2XLLA 3ID6C 4HK3N 1WAEA 2Y3AA 3W79A 2FMTA 2PMDA 4ZMLA 1N1DA 5T3XL 2ZYAA 3TS8A 4NQXB 2VXSH 1BC5A 1EQ2A 1VHWA 3LK7A 1PJBA 2NXJA 4DFIA 4DKJA 2F4VB 4HY3A 2N7BA 1LO4H 3LO5A 2DWXA 4V2BA 4ECNA 2YHAA 1MO5A 4G0YA 2LR4A 1BDMA 5FORA 4EJ6A 1JJUA 1M72A 4G41A 1SEQL 1YCHA 1WS6A 3IIJA 5MGBA 1E96A 3Q6MA 3S3BB 3V6OA 2WKSA 4JSRA 1D9KA 2FN9A 2R2GA 1I3UA 1EM8B 4XUDA 1QLFA 1FYFA 3TQRA 1P0CA 1CB4A 2AXJA 3TFKC 1W2HA 4JY4A 5KSBB 1SK8A 4FLMA 4JYZA 3FMFA 4I18A 3O4LB 4Z7QF 3HI5L 3HU5A 1HWWA 3KYNB 3T4PA 5EZJA 4KNQA 3C6MA 4ZZ3A 4YPJA 2QRNA 4ZK8A 4CU6A 3KFLA 2VR7A 3PCTA 3QU5A 5GZ6A 1UXSB 3UXHA 4X6CE 2EFDB 3JQ8A 1UT2A 4Q0XL 1TTFA 4KBYA 1UDXA 2KHZA 1QHSA 4DKEL 1BVNT 3KDAA 3MO1A 3QQ4A 2FO4B 1DRVA 2N1BA 1L5SA 1FGVH 2ZJSH 1ORVA 5CCKH 5AK6A 4KQEA 4JL2A 4E2XA 1A2YB 1EUDA 4K81B 1NC4D 1ONPA 3OWXA 3QPVA 4QRTB 2IPKA 1THCA 4LDLB 3ROPA 3DPSA 1E6OL 4AV4A 4EATA 3D34A 2Q3BA 3H9JA 4BX9A 3H9QA 3SGJC 3NYKA 4PB9H 3HCCA 2CHDA 4CRPA 3QPCA 3LG2A 3DMPA 5KTKA 2Y66A 5D84A 2SEBB 3MPUA 2COQA 3C6QA 3G0OA 4DLXA 1D6VH 4WGGA 4UT9L 1RAHA 3T8MA 4D8UA 3FUEA 3C3AA 4X7DC 4HH3C 1PGQA 1WW3A 5F9WC 3QE0A 3W4KA 2BHTA 4RZUA 3KVVA 1D6SA 2Q5EA 3R3WA 4U1RA 3AM3A 3RT1A 4B9IA 5KSAA 4DBLE 3OC5A 2G4EA 2ISSD 4HJRA 3QMWA 3KAAA 3WLBA 3VI3F 3V7NA 2DDQH 4LECA 2CLDX 2GABA 2RGXA 4YTEA 2F1IA 1G9ML 3WLJA 5I6MA 1ZM7A 4BNXA 1ZLDA 1SC9A 3T2LA 1KTLA 3P9QA 3MXTA 3CKMA 4N2MA 1V26A 1P6XA 2VDWA 2DQJL 3A2NA 4OH2A 4TV8A 2LDXA 3K8LA 3D8NA 3JZIA 1HYEA 1YEGH 3T5CA 5GGQH 1L3IA 2XBLA 3F71A 5FYKD 3PJNA 1AIZA 4JGIA 5J3HC 1XRLA 3SN6A 5DRWA 4BOYA 5CD5D 4X1KB 4Y2XA 4F4UA 4NZFA 1Z45A 4K40A 4AYTA 5BSVA 4LC9A 2OCLA 4A1OA 1ZGJA 5BRPA 2XQJA 2EABA 4XX5A 4B47A 4Z0HO 3FMGH 4RY9A 1TKWA 2OXHB 3OIWA 5EHIA 1XZ0A 2R1YA 3RP1A 4PRDA 2ZX6A 5D2LF 4ZHQB 4DPBX 1IRIA 4NNOA 5CVJA 1KLGB 1I2ZA 1SVCP 3K32A 1BOGA 2W8BA 4IILA 4ILEA 3BPSA 3ELDA 3OU6A 2Q1YA 2IV2X 4AZSA 4D4KA 4Q4IA 1RV6X 4OLUH 4EOWL 4ARUA 1FDUA 2OTPA 1O2DA 2VH5R 1OF2B 3VU0A 4WIAA 1QUEA 2HF8A 2NO6A 1MO3A 5G4NA 3I04M 4LZNA 2ITDB 5J3HD 1NMZA 1NBQA 4JMLA 1NGWA 2E9GA 3I34X 4G7RB 5KKCA 5HM8A 2OSLB 4ZODA 4QUOA 1DI0A 2GEUA 1TOXA 4C07A 1XXHB 3HKDB 1N6KA 3VZDA 2EKLA 2ISCA 4PJAA 1KB5H 3C2AH 2Y3NA 2ATVA 3PGFH 3IS3A 4M62L 4NS0A 1MAWA 3IMGA 3BZFA 1PLLA 1HNFA 4LI3X 5IHZA 3QNFA 3LNEA 2HU2A 1JRHL 3NFSH 1WQ3A 2QS9A 2YCLA 3FPKA 3IT8D 3R06A 4TNEA 1B2RA 2RAPA 4Y5VB 4NKIL 1DKLA 2G2RA 5D93B 3EDYA 4QRAA 3VM6A 3AEUA 4GPTA 2XUJA 2A7BA 3HMXH 2CR0A 5TDPA 1S7WB 3T0AA 4OGXL 2JA2A 4TYNA 1I2CA 4Y5VA 1WSAA 3C5SB 2HHHB 4JQXA 2NVWA 3FYDA 5KUMA 3UIEA 4D41A 1Q1JH 3UXMA 2GO1A 4XKJA 4OLHA 4ZFOB 3V2AR 1UKYA 4LSMA 2EW1A 2OO5C 3L5OA 5C35A 4G0MA 1E1MA 3M89A 4L6CA 1VCMA 2D7NA 5CZVL 3SMQA 3VXSE 4I08A 2JJSA 4L4VD 5C34B 2JD2A 4MGKR 2JBHA 5ADPL 4XHJD 3P3TA 1JIBA 2DEXX 3IN2A 2ZZMA 1ONQA 4F9LC 4EY7A 1XD8A 2P5WE 1FTYA 5F78A 1R0XA 2CD7A 4R4FL 2H26B 1JKJA 3GBML 3O38A 2UYOA 4RIHA 1I3NA 3NEEA 1LE9A 4U6VL 3GP5A 1OWMA 1QGAA 4F9LA 2ZRLA 1D1TA 3MRDA 2AR0A 4KZDL 4PHZA 5KOMC 1ZH8A 1HWHB 3CW8X 3US9A 3COWA 1XVTA 4JFTA 1KJQA 5M2QA 2RE8A 1V41E 1TM7E 3A9UA 3O8OA 1FDOA 2FJPA 6PAZA 4ZYTA 3EW3B 1WA2X 3G5YB 4QTXA 2GRUA 3DO3A 2AQ1A 4F2MB 4WU7B 3UAEA 1R19A 2VC2H 4HVAA 1NF8A 1CP2A 3U1BA 1TLLA 3JYOA 2UYCA 1AO7B 3JAWA 4GZ5A 4E0BA 4Y4HA 4ARVA 1X15A 4KYVA 1K8IA 2O8CB 4IU3B 3EIWA 3T7KA 2XY1A 1SIOA 3LHPH 1C08A 3U6XA 2IBMA 1MRFL 1AGCB 1P1ZA 2QR3A 2FN7A 3N6RA 3V6OE 4NFLA 3NDRA 3CBQA 3CR8A 2I9TB 1F4LA 1ACMA 3QUYB 3C1UA 4KYTA 5CCKL 3NYIA 4HU2A 1EWKA 1ND0A 3AJAA 2GD2A 4P07A 5ABZA 4AM8A 5JCOC 5FDWA 4RFOL 2O2HA 3Q41A 1FQKA 1SJVA 4L1BA 4A1RA 4BRZA 4P2RB 2C9MA 3DDGA 2R7EB 1A5FH 1FDRA 2VM3A 2VWEC 3U4GA 3NOXA 4YXFA 1KULA 1HNZB 3PGDA 5KDOA 3DE6X 3MCVA 1I82A 4X9HA 3GEMA 1A9VA 1FQJA 2HB0A 5KTYA 4L8SA 2XY4A 4BECA 2VATA 3MYJA 4HN4B 1SCAA 2DQUH 1RULL 1PJWA 3HJRA 3OKAA 3LXXA 1EFLA 3BXNB 2DL9A 1NM5C 3VHXA 4GR5A 2PKXA 4MO2A 4GI7A 1S8AA 3O82A 4K1XA 1GAFL 1ZOXA 3OKOA 4PEVA 4XYBA 3REWA 4AS2A 4Y9BA 1HNXB 2QQGA 1AKQA 2J56A 5ICXA 1C0IA 2IP1A 4P9NA 3RL1A 2O61B 1CDJA 2EZ0C 2WMOB 1JALA 5TDHA 3P3YA 3RODA 1LQBC 5ES4B 1XQ9A 3F7VB 2IX9A 5JWHA 2EYTA 3M8KA 1BXGB 5T1KB 4NDAA 2VXSL 4YHZL 1BXKA 1YIOA 3C8DA 3P0YL 4C30A 1MB4A 1RU3A 4JDPA 2F3SA 1AZBA 3QFTA 1JIUA 1QH1B 3VRIA 1VHQA 2ID9A 4TWAA 1QG4A 2EXTA 4XXCC 5P8WA 3TKAA 2EKPA 4H8QA 1NGYB 2ITCB 5ESQB 1F2TA 2NYKA 2BKUA 3D4BA 2B9BA 1UQSA 3PAZA 4IBZA 1EWQA 5GGTA 4MSWB 2YWCA 1AH2A 3E5HA 2VZ9A 2AC7A 2JAUA 1KDVA 3W81A 2FZWA 1N6UA 1MUUA 4A7SA 2V7XA 3AFLA 3PHLA 4J7AA 4JREC 4FFRA 2AXQA 3PT9A 2D7MA 4WNQA 3L6FA 4ZFNA 1XZJA 2ICWA 1YY8B 3T65A 1KBKA 4B6JA 4BNMA 3JW8A 1FFYA 1RZKH 2ED7A 5JPMA 3WXWL 1YVDA 5HM6A 1KIMA 2JLCA 4OYYA 3STWA 5CYGA 4RAVA 3HZZA 3T77B 3N3BC 5LN1A 1J0BA 4PCLA 3EGXA 3C3EA 3BLBA 1Q7BA 4UTBL 1J8DA 1H8SA 2W5UA 2VH5H 1Z8NA 1A1OB 3TX4A 4ZV4A 4NZYA 4ZRGA 4G1FA 2C7RA 4F45A 3APFA 4W6WB 1YJDH 4YDIL 5BN1A 2FWUA 3GH3A 1Q6YA 2FEXA 2WTAA 4EN3C 4HB3A 2FMUA 5H4HA 4NONA 1BP3B 4OZ4A 3TC9A 4JZNB 4WI5A 2A5GA 4X54A 2ID4A 3LHPL 2WPDD 1CKEA 5LB4A 4BLPA 5FYKE 1PG2A 4X4ZA 2CVZA 3U48A 2D8AA 4FKMA 4BFNA 3HVDA 1MGOA 4N9GB 1P6QA 3VYTB 4BD4A 1U8IB 4ENVA 4KQGA 1X4YA 3GLVA 3IKMB 3KVYA 4WKZA 2WTBA 1E9SA 1T6NA 1WABA 2VLME 1WULS 4CF3A 5A7EA 1CZ8H 1SDYA 1NXQA 1O03A 1ETA1 2IH4A 3V5NA 2IP2A 4AZ3B 4XP4H 3KZ1E 1GYCA 5E08H 2PV0A 4RM3A 4U6NA 4XRCB 2WDZA 5TFSH 3B1TA 3QJZA 2VWPA 1RHKA 3RVLA 3VX1A 1SOUA 4P06A 2V96A 4RCVA 2R2BB 5E8JA 2VLJB 3L3OA 4DZ8A 3OZCA 5H7XA 4PCKA 2YXPX 3D3KA 3QQ3A 2BTOA 3OQBA 5IH3A 1II8A 5DHVB 2IBGA 1UA7A 5CWSA 2X2JA 3ESRA 4K6FA 3MBEC 5ECYA 5K3BA 4UEOA 1IM8A 5EZ5A 3HKCA 3R24A 3PQ2A 3GSVB 4GE3A 1QOZA 4XWAA 2BJWA 4FCWA 1ZK3A 4IIDA 4L3OA 1EB9A 5I1CH 3LSYA 1OGTB 3FQ4A 3QIUD 1P7CA 4F3FA 3X3GL 4F7PA 2B1GA 1ODUA 1SM3H 5EFIA 3VXMA 4GUQA 1RRFA 1F14A 1A7UA 3U39A 1XDTT 4OLVL 2WLMA 2ZYVX 5JR3A 3H0CA 3QAZC 2JBAB 1R6UA 4JRWA 4YIQA 4TL6A 4IINA 1HMPA 4UASA 3GSXA 5H3LA 5HG0A 3TO2B 1NW6A 3VFTB 1HSOA 3FNEA 4JFZL 3BTSA 2PUCA 2O8BB 1R9NA 1U28C 5GIPE 3RHWF 3ITNA 3MGCA 1J9CT 5E9WA 3VRLE 4ARAA 2YV3A 1A4RA 1I1CA 4R98A 3U2JA 3LQYA 3ARDB 3C60D 4JM0A 5FF6B 2V17L 3V6MA 4O58H 4PO8A 3RVWD 4BQ8A 3SR0A 4CL0A 3Q3HA 4G6FB 3TDKA 1WBZA 2JRCA 2BZ0A 4NFBA 4N3NA 3MJEA 2XX3A 4V1CB 2QTRA 1YZVA 4IOMA 2A1UB 4OM0L 2R6DA 5J6GA 3ZJ4A 2CWWA 3HB0A 5HJDA 4GMDA 3CXDL 5KMGA 3GZQA 3T1YB 3SE0A 3L05A 4G3YL 1NCUA 4BJHB 2MYPA 4JB9H 4RWZA 1T21A 2EYTB 1WA5A 4QZVA 5DHAA 2OCFD 2WXNA 6ABPA 1JIXA 4LMQE 4R4BB 2QMUA 1XSJA 2NZ9C 1GAWA 1TECE 4FG4A 2WD7B 4B5EA 4I50B 3AVTA 4ZQKB 1GC1H 4BA0A 2BZ1A 1DV1A 5ALWA 2MYTA 1P1VA 5D71L 4O4LA 2HSJA 3LQAL 4HV8A 5T8IA 1WW2A 2NOAA 3Q7JA 1SZJG 1LZLA 1UADC 4CEJA 1QU2A 3IDYC 5K45A 3CLSD 3PIDA 3A1DA 3IF1B 3KPSD 4QHLA 5D70L 2ICES 5L4LA 2NMSA 3D25A 3I2CL 3S2GA 3AU1B 4D96A 4PXAA 5F0MB 3B9KA 1BZ8A 3VG0H 3HJGA 5T33H 4A36A 3LK6A 1SRDA 3WFEL 2CDBA 1NP3A 3K5WA 4MS6A 4BJ6A 1KQPA 1FXSA 4MW7A 3DLTA 4OQTL 1XZNA 2BGLA 1YK0A 4XCVA 2AK1L 4F8OA 2EC9U 3S34L 1WZLA 4EDFA 1C9DB 3RWMB 1G7LA 4OJFH 1XELA 4UAJA 3A1NA 4R51A 4KQFA 3JALA 1Y48E 2NOYA 3ZHSA 4QYWA 4ZXPA 4ZPTA 3PL1A 1JEYA 3VTFA 3U46B 3BCUA 4I0KA 3WY9A 4MV1A 3S5LG 2WF9A 2QHLA 3HRPA 2W59A 4CWAA 3G6WA 4OSOA 4BK5C 1C12B 1TX4B 1C1EL 4G36A 5C7XH 1HKFA 1CI5A 3IOCA 1GEEA 3IEIA 1T4DA 2YAMA 3X2QB 3V1MA 1V1RA 4MNQE 5CCBA 4EA8A 2X4NA 2AYYA 5D86A 1TZOA 3D4CA 5B1DA 2O8DA 1ND5A 1A47A 1SBCA 4XNBA 1V1RB 3OB0K 3PS9A 5C0NC 2TMKA 1JSCA 4OZFA 4CODB 3KZKA 3L7FB 4XE5A 4C55A 2TRHA 3GH1A 2IVZA 1PFOA 1UYWH 3ONDA 4WIQA 2WUBL 4PJ6A 2I2WA 4PXYA 1QMUA 2SHKA 3OOHA 3A6BH 4BEJA 1TCMA 1INQA 1HOXA 7ADHA 4FGUA 4H1LH 4DVJA 1T7VA 5EXPA 2KB0A 4QY8B 4PRPD 2VK1A 2QHXA 1CF8H 4HWBA 1GNSA 4HMEA 5C08D 3CMOL 4CIAA 2V7QD 1UB6B 3U4KA 5FUOL 3LHAA 3BQVA 1R6AA 2FZ4A 1ZOIA 3UWKA 1F51E 3ZQUA 3GRBA 2VIRA 4L4YA 3LQ1A 3UG3A 3GSXB 5EOVA 5FOWA 4IIZA 4LARH 4LHVA 4M9SA 4L02A 4Q47A 4RK0A 5CCJA 4JFHE 2FSPA 4JB9L 1DXQA 4LHZA 5FTNA 1I85A 1H6UA 4U6HB 2YAEA 1KY2A 4PLFA 3B6KA 1WAPA 1A5FL 1BRMA 5DHSA 5EUMA 2O6EA 1WLYA 4U7DA 3UFXB 3W04A 5E8PA 1N9ZA 2BXZA 1KV7A 2V3DA 3UIZA 3KWJA 4Y5YA 3W39B 4JCMA 4J4BA 3T34A 5BOSA 3NEJA 3LNIA 1CZ8L 1M2OA 5FS5A 3HZOA 1SVMA 1N10A 5DJDB 3VFTA 5DGTA 4HWBH 1WPQA 3I0ZA 1D5RA 3QIWD 1UAAA 3D6VA 4X5QA 2X3CA 4X1IA 1F11A 1MCEA 3MOBL 1DEAA 4BNVA 1MJJA 4YHKL 5GADl 5KBNC 3LECA 4U02A 2G82A 3GFTA 1BYOA 4F8LA 1XGUB 2Y77A 5EVJA 2A6IA 1PZSA 2ZYHA 1FFAA 2R7NA 2CLFB 1M5RA 4AGMA 3JV5A 4JY5H 1JXMA 1M1YA 1DTWB 3JRXA 3QAZB 1B9ZA 5AKGA 1HEYA 3GXOA 2O8EA 4FQ2H 3AM8C 4QGBA 3I6YA 1SCUA 3ZUPA 4KKCC 4XBMA 2UYGA 4FT4A 3BDBA 2VLJD 4ZUWB 2XPGA 4GRLD 1A9YA 4HAWA 1HJBC 3NYQA 4PO3X 4WECA 1HI9A 4FI7A 2Z93B 1NFQA 3CPJB 3MA9H 4LF4B 5HVFB 1KP3A 3EXIB 3M1CA 4NSKA 3K1KC 3KDMA 2G2RB 3FCGA 3GSQA 1OU4A 2WGNB 3OPXA 2X4RB 1QBMH 1FNGA 5HPMA 1IGJB 1OXBB 1RUKL 4M1KA 1T83A 4X5WB 2ZJ5A 3IU3A 3RDJA 1T4CB 1U4OA 5KBMA 5EJAA 5LOVB 1R4MA 3GO1L 4AJYV 4CMBA 4RANA 1GPYA 1A9XB 2QF7A 2NYYC 1YN6A 2TS1A 3WL9A 3TQSA 1JCKA 4FEYA 4ZMWA 2YRWA 3HI6H 3BO8A 1SQGA 4EVNB 3PQ5A 3GRUA 3DOCA 3ASUA 1NXWA 3TFOA 4K9JA 3KKZA 2G3XA 1ZD2P 4TV3A 2JLPA 5FB8A 4Y1TA 3WNBA 4AMZA 1U3YA 1UXMA 5D5MF 4FFSA 2L7JA 4EW1A 3S2FA 2GKIA 1BKYA 3VO1A 2VAAB 3QPUA 1K6JA 4PJIF 1FZOA 3OFJA 4HJJL 5DUBA 4EI0A 3SK0A 2NQ3A 1A7RL 4N0EA 4HGNA 1T5BA 3B6SA 2PCPB 3QWFA 2XB6A 3AYZB 1ZHKA 2XN9A 3U2SB 5E7FA 4AURA 1T8PA 3CXUA 3HVUA 3ME5A 5CAEB 4KTDL 1FBNA 3MA7A 4P0QB 2FPGA 3UXYA 2WXKA 3EYSH 3HA5A 3A23A 1L6PA 4M1GL 1VENA 2C3OA 3WGIA 1XIVA 3P9ZA 4CTNA 1PJAA 5JCOA 3QWHA 3FTFA 2UY7A 1SELA 2ZSVA 4HVCA 4XP4L 1WBBA 4A27A 2X6UA 3ENQA 1M42A 1FDLH 3KQWA 4YNBA 1I7QB 2BM9A 3L4UA 3DT6A 5DMXA 1Z5YD 3WGKA 1EUUA 5E1OA 4M76B 4EY5A 1A4UA 5JAPA 3IMEA 1EWHA 4UM9A 5KSVB 3RX7A 1RXSA 3G1UA 5AT1A 1JK8A 4GT7A 4E42B 3FJOA 1IBYA 4PGBA 2JFCA 3PFBA 2PR9A 1G8FA 3TRIA 4AMBA 2ZJFA 4EHLA 2NY1C 3EOBI 1ZMRA 2CFIA 2QX9A 5ELMA 4YDJB 5BMFL 2XA2A 4L22A 4PGBB 5KVEE 4RVNA 1K08A 2FPSA 2IIPA 3FT3B 3QXSA 1J39A 4R8LA 1NCCL 4LKCB 5IBLC 2HLDA 3RVNA 2H9AA 3JTTB 4G37A 3FUDA 3WE6A 4S1NA 3OKDB 2QTAA 3PGDB 1GKEA 1XT6A 3F4BA 4OSEA 3VVLA 2XUKA 4GW5B 2C82A 3Q40A 3M3DA 4TMPA 2O4CA 2GTQA 2IU4A 3L8YA 1YECL 3T0ED 3JV6A 1VA4A 4AO6A 3NZSA 1EP1B 1PVDA 5HCIA 1F02I 4X4XA 3F5MA 5AW6B 2WN2A 3T7JA 2XWSA 3ECQA 1B23P 3LF2A 1HHGA 1L4BA 4GKOA 5HUHA 2X9NA 3HGQA 1TQVA 2ODPA 4WNAB 2FB9A 5DS2A 4WCFC 2DQEL 1N64H 3SKNB 4CADB 1SVUA 3SYQA 1H2HA 5DCUA 3CE1A 4RQBA 4XDYA 4DM7A 3WBJA 1JVNA 4QAWA 1JTOA 3BN9C 4PBWD 3Q1SL 5GJVC 4WCFA 3M34A 1X7XB 2Q21A 3TIIA 4M1EA 1HXHA 3FTNA 2QTNA 3UHFA 5JVDA 3D6TB 4HEMA 3JATA 5FUCC 1WIWA 5BSEA 2VO5A 3OJEA 3PWLB 5E2TL 1QVVA 1A50B 3EYFA 5FHRA 2GTZB 4JG1L 4P49A 1YL5A 2NZ1A 2A88A 4EG4A 1LO2L 4CUJA 1IVSA 2AEEA 3T5AA 1YB5A 2R29H 5IY5B 3TTXA 2ID5A 5AVSB 3QA3B 3BUTA 2X9XA 3WLHA 4PJEA 3UYPA 2CZGA 4OFZA 1UZMA 4R0MA 3BUIA 3FFCE 3WENA 2IH1B 4IDCA 1WWBX 1VMIA 3THSA 4GB9A 3EHBC 3RTLA 4H6XA 1NNSA 1VFPA 3ZVNA 1OXMA 4ADGA 2E7MA 1L6IA 2AQ3A 4AFNA 4PJ9B 4KRPC 5EZSA 1YO4A 4Z7VE 1AMNA 1FN4A 3DMTA 4TTPA 1XWIA 5CB6A 4EM6A 2GIMA 3FT4B 2DBRA 3HDHA 5LQBL 1XU9A 1FTWA 4H8UA 2Z6QA 3FX2A 3SGLA 4PRNB 5E8OA 2ZE0A 3PP3H 2H29A 1WDLA 1NQAO 2GEFA 2NADA 3MOSA 5F4ZA 4EOWH 2XEXA 1AF7A 3E3LA 1D2HA 4MRSA 5HY9A 5IAKA 4JY7A 2AMLA 4RF2A 3MZGB 3BERA 1HORA 3AY4A 2R86A 2F62A 3V8BA 1DC3A 3U0WH 3KNBA 3E6FB 3ETBJ 4DLBA 4B9CA 1PQZB 1A6AB 1LO3H 2HPOA 2EYRB 5DP2A 4JMNA 4B9EA 2OYRA 1JXDA 1RAIA 4Q74A 1Z7EA 3DKIA 5IUJC 1NMCC 4O1HA 1E4XI 1PL7A 2OSLA 1SK9A 4Y16D 1DKUA 4YDVA 1ZKMA 1ILSA 1Q95A 1RZ8A 2D73A 3IAQA 5AW0B 3FHJA 4JBHA 3ZV4A 1GCFA 2AZMA 2CIIB 1OI2A 1KYFA 2XVAA 3NCXA 4ZS7L 2MYUA 3E0GA 2BTQA 2AK4B 1B43A 4GO1A 4WHTA 5IFKA 5DZSA 4NKIH 4UTPA 1MJGM 1E3XA 5C0IB 1KORA 3VRJA 1TADA 1I7UA 3ZV3A 5J5EA 1YJDC 1UZNA 4JVSB 1Z88A 1USWA 4EIGB 4MZIA 4HGMA 3OUZA 3V9FA 3RAPR 2KLBA 3BTOA 3C5ZD 1IM2A 5JXEA 3ZXAC 3ZGZA 5DYYA 2XYPA 1NFFA 4Y5XC 2A57A 3H9SB 5CLZA 1V45E 2ZB3A 1D5BA 3M6IA 5EWJB 2G0KA 3PYCA 1NFDB 4FN5A 1WG3A 4R2WA 4MYWB 1QFMA 5DJ6B 3GIZH 1HPLA 1Z3IX 1ACLA 2AFHA 2XKJE 1DO0A 1ZQ9A 4KKCD 3GCWA 3P9SA 4CETA 4UZFA 3U3ZA 2G1PA 4N0RA 3PC7A 1KXHA 1FE8H 5T3XH 2FMHA 4D4HA 3LBHA 1N34B 1QJ4A 2Y5TA 4HJ0C 2VLKE 1S7XA 1YEIH 4X7FC 2RK6A 5HHQA 5EJMA 5CEEA 4WV1B 1P39A 3O9WC 1V3LA 5BW7A 4MUIA 5GRJH 2WUFA 1LI5A 5A6SB 2VTEA 3X1JA 2X8JA 3TOVA 4Y19D 2B0CA 1N8NA 3K16A 1ZV9A 3MHZA 3FW6A 2DKNA 5A2QA 3U3RA 1T0BA 1RXYA 1FXWA 2ESRA 5D2NB 4R3SB 3O4LE 3OJMB 5BPPA 5BZZA 4UQOA 5EHXA 1RC1A 4EX6A 1I30A 1P1IA 2O0HA 1BW9A 4Y6QA 4DIXA 2XI4A 3D12B 2WWMD 2HMTA 3TXXA 5B64A 2LLLA 2C99A 5B21A 3VMPA 4MWCA 3BZ4B 1RVDA 1BDHA 3HDJA 3ADPA 5EWIL 1NYTA 3FL7A 1XBTA 3QUXB 1I1AD 2UX7A 1N59B 5LG6A 2F3UA 3BJ91 3NTVA 1Z0NA 2VCYA 3B6JA 3GI9L 2GSWA 3I8OA 3L4CA 2RTTA 3OP4A 1PR5A 5DTJA 1D9KC 5BYJA 1IL0A 4WZAE 3VKWA 3O4OC 1E60A 2GJ8A 4OYRA 4S0SD 3BIWA 1SKYE 4O2FB 5AG9A 3FWYA 5J6HA 3PWNB 2QZZA 3OQHA 5G3ZA 4EZKA 3KQTA 2DBQA 2YN2A 1MCPL 4L5YA 5FK9A 3IEMA 1VADB 3WRXC 2B4QA 2WF5A 2R1ZA 2OMZB 1G7LB 3Q87B 2WU3A 3K72A 5CJXC 4JM2C 1QEWA 3HZHA 5F21B 3FDZA 2WLZA 1PZ3A 2BFDB 3EXFA 4ZMSA 2FPIB 2F3QA 1Z9LA 4FEIA 2PYIA 3VJLA 2I29A 4YJHB 2F0CA 1BPVA 1KJVB 4DQXA 2R8RA 2RH0A 2ZNWA 3T1VA 4HJJH 4ZW5A 4FU0A 3MROB 3W77A 1OT3A 1E9VA 4X7TA 3UTTE 4M3KB 1V5IA 2W9LA 4EF3A 2DWPA 3O4LD 3TMYA 2NUAA 2WI8A 3GCXA 5GS0D 4ZFZA 3L4VA 2QZ4A 4KKXB 4Z3DA 3S2YA 1K7SN 4I89A 2XVYA 1EGAA 2C1ZA 2QTZA 3SMVA 4MRBA 1KYOK 3K4PA 3UDWC 2JWHA 5E6IA 5EXTA 4AQAB 2XITA 1A21A 1XH3A 4NZUH 5DZNA 1FF9A 2IW3A 3L6CA 5FR3A 2W6ZA 2ID8A 2R69H 4UXIA 2Z35B 3P69A 2WIAA 4BFCA 1IZ8A 5TVGA 3CSGA 4B71A 5YASA 4WMLA 4FLFA 1QFWL 1ZOSA 1DQQB 3EQ6A 3HV2A 4LVNC 3OM1A 1MEXL 4MNQA 4EA6A 3WLSA 2JIXD 2BR3A 5TR9A 1PYWA 3ROEA 4QJ4A 4XPTL 2H9GB 1U0NA 2C0CA 3MT8A 1K88A 5ADHA 3FTDA 4JFSA 5ABDE 3WIOA 1SKAA 5CINL 4KW7A 5CCHE 1LVHA 4MAYB 3SKMA 2H5LA 3K2MC 4OXQA 3ILQD 3SZ6A 1T7WA 1BE1A 4I19A 4IWNA 2AN1A 4LWZA 2HLPA 3G5LA 1VCBC 2H2IA 3VSDA 2MSPA 4F1ZA 6CGTA 4EUPG 4P4RA 3DIVA 3M81A 4MJ6A 4AVJA 1R6DA 4EN2A 3WLWD 1UXWA 3JCZA 3AEKA 1G6HA 1UXOA 2I3GA 3FVTA 2CCJA 5A4MS 4GG1A 3ZS8A 1OV6A 3ZW7A 4XDHA 2GCNA 1KPIA 3K1AB 3X13A 5A62A 5ID1B 1UOVA 1MAVA 4D5GA 5BO1L 1YDGA 3MCKA 1HS6A 3RFRA 4JFYA 3WXVH 5CD3B 1UZAA 3QIAA 1D3AA 4QI3A 3V10A 4WXRA 2I4TA 3WEXB 4M7ZC 4JYMA 4DIOA 1D2CA 4JFRA 1EJ6A 1TQCB 4KCGA 1I3OA 3F58H 4OCMC 3H2GA 3EO0B 4PBSA 5CWSB 2FY8A 1JR3A 1Z25A 1RXLA 2X4GA 5KYNA 1JFLA 1XB3A 2D7DA 2AXGA 4KQKA 1CVIA 4BJ5A 3OICA 3KTDA 2VDLL 2FVYA 2ZUDA 2Q5FA 2BKEA 1XDGA 1PYOA 1UBRS 1Y63A 4QPNA 1BS9A 2C5HA 1Z39A 2I6FA 4XNYL 5E1GA 4IIBA 3IODA 2BX5A 2ODTX 3G7SA 1W88B 3GHBH 1DJXA 2ZIVB 2UVEA 5GONB 1O9VA 2XDHA 2DDQL 4XSHA 3OAZK 4IIQA 4KY1H 5FWNA 1LPMA 2EKSB 1I4TD 3CZMA 2YAFA 2QR5A 2DWEA 3NCYS 3MR9B 4GBXC 4ZFGL 4PJDA 3MWFA 5BWBA 5GJCA 1NNEA 3MCLL 3EJYC 3R3HA 4FG2A 1X7WA 2QUBA 1UZGA 2Q1SA 2UWEA 2YUWA 3VFNA 4FQXD 5SX4I 4YV2A 4E12A 3GSNL 4ANXA 5IQNA 1OYVA 3RJOA 3WV0A 2XQYA 5AXCA 3RJTA 4Z95H 2X8WA 3ZXSA 1Z3GL 2IRWA 3ZE2E 1S6YA 1NZDA 2O6FA 4QBGB 2PVPA 2ETVA 2VUHB 3WB9A 5JJKA 3A26A 4I5DA 3QUHA 2JVIA 3QG6B 2FDCA 4QYSA 1IUNA 3QYCA 2VQDA 3WMXA 4HUVA 3BWUF 2PZMA 2JCVA 1MF7A 2H4HA 2IBZX 2EKJA 1OV8A 1N8KA 2QRUA 1IXRC 3BWVA 4PV8A 3KPQB 4K3GA 3WNDA 2JGLA 5AQ0A 5B8CC 4P3CH 4R84A 4GKBA 4CZ2A 5JU6A 3UK6A 4UHDA 4FS8A 1PNRA 4EW3A 5C0BD 1TK9A 3PIRA 4TRPH 3UGTA 4Y1AB 1Y3DE 2DKFA 2QSVA 2XGGA 5GXBB 5KOJA 4Z86A 4KK8C 2ADJA 2HXYA 2R0KL 1U93B 2VN8A 5ESXA 3AEZA 2XN1A 5AP9A 3FB1A 5FLUA 2DFVA 3TNDA 2P2DA 3ZIMA 1ZDMA 2GJ6E 2BGRA 4A6YL 3CN9A 5BUGA 1D0VA 1GPJA 1CXZA 3H3JA 4KPUA 3PGCB 5I23A 2CE7A 5KTEL 1KTIA 1E4EA 4LQ1A 5A16A 4LYDA 5CLJA 1DDGA 5D7JB 3WKCA 2LVEA 2UUPA 3NNDA 4S04A 3N8GA 3K96A 4KBPA 1NSNL 3HE7C 3AM1A 2DZDA 4GBMA 1E1QD 4IO1A 5MGNA 1HC1A 4OXRA 4LOLA 3PFGA 4MW6A 4XMWA 3DKRA 4HMPA 3LMKA 5AOKA 2PYEA 3PHOB 1Y37A 3BMVA 2JBWA 4RTLA 5HVHC 3B6ZA 5DTIA 4HX9A 1AGDA 4ZALA 3M4JA 3EC2A 4DKFH 2JV6A 2R56H 3P20A 3MJCA 2VMJA 2J12B 1UJ3C 3T2NH 3RRYA 4PBXA 1AQIA 1EZSA 4NLHA 2Y76A 1J8YF 4E3WA 4YSRA 3TN7A 4YMTA 1K7XB 1A1MA 4PJ5A 1U3DA 4B48A 2DY2A 5HGAB 3N8IA 4W6ZA 3NJHA 3TH3T 3NJ4A 4NU0A 1UVQB 1XTLA 1W85A 2PUJA 4YZFF 4S3MA 2G6BA 1YKGA 2HJRA 4YDRA 4QU9A 3RVXC 1JXGA 1AZNA 5A2AA 3S37X 4NNYA 2IEIA 4DYVA 4GG6E 5C2BL 5HK8A 5BSMA 2GCYB 1HNYA 1TUBB 5K8IA 4AK9A 1INLA 1KB3A 3AUVA 4I14A 1CZHA 2CMDA 1TXKA 4L23A 1PZXA 1CF8L 1N3YA 2DLTA 2X2OA 5F7WC 5GS0L 1S9WA 3CCHB 3NUQA 4N0QA 3O4LA 5FFMA 2AJSL 3MJSA 2X70A 4XIJA 3QJOA 1FNSA 2Q9CA 4GP8B 1N2ZA 1XA0A 3I02A 2IDZA 3U3KA 1A8IA 1G1YA 2PJDA 3SKJL 3ASWA 1P3JA 3II1A 2MNWA 4HQQH 2DC1A 4QCIB 4IV0A 5HHOB 2I55A 4E5XB 4F2HA 2XD9A 2Y07L 1Y9EA 3D0RA 4ZO6A 2HREA 4BNIA 3M83A 1W0JD 1FPTH 3EF3A 5FI1B 3RWDA 2EDOA 1V2GA 3BSSA 1TTQB 4DESA 1OH5A 1U8HB 2H7XA 1O97C 1QYGL 2WCGA 1WEHA 4HD9A 1XMWA 2AA3A 3TNNA 3B53X 5ECDA 3DGCR 4KO9A 2YXDA 3F05A 5LVEA 12E8H 4LYHA 1CB7A 2YJNA 3A6ZA 3CNBA 1ZWKA 3FJTA 2IHKA 2SEBA 1C4OA 4XIIA 3CFEB 3LOWA 2HVJB 3LRKA 1QVRA 3DUSB 2IH8A 1Z0MA 2NT3A 3NAMA 2AOTB 5JW4R 1H69A 2Z6UA 1L4KA 3DJYA 4F3YA 2AFIE 2BGNA 4Y9FA 4MD5A 4X5OA 3MV7B 5JLZB 4JY5L 1QLEH 4GAJL 1EFKA 2DM3A 1OGAA 3N8KA 2C2YA 1L5RA 4MV8A 3P3RA 3GW8A 3CVDA 3PAYA 3P9MA 3SDCD 5DI3B 5FYLD 3MTBA 2YJ3A 3DBVO 4TXJA 4F4CA 2D7PA 5LJIA 5FTWA 2JI2A 1Z5OA 2ZRFA 3DV2A 3F6RA 3SE8H 3B48A 4J43A 4EGAA 5LQSA 1UDRA 4DWVA 3REVB 3WL3A 1M7BA 3P0YH 3G8AA 3IFOB 4HAYA 5IH7A 2VR6A 1E5AA 3DO5A 2GBTA 1QLRB 3TN0D 1LLFA 4BFFA 1MIOB 2CSUA 3OKEA 4PAZA 4N2CA 3FLBA 2OYLA 1B6RA 2E55A 1BDIA 1NOAA 3V7AE 5JIDA 3PU6A 2XDWA 4ZMPA 4KQ6A 4R9RA 3PGCA 2IPLA 3SCMC 3OJFA 5DYWA 4BNLA 4OLVH 2GT9A 1QC5A 3OE5A 2CM5A 2XWXA 5K03A 4CR7A 4OFBA 1UATA 1RHQA 4UQIM 4DGIL 1UBLS 2RIPA 4B3CA 1P80A 1YU6A 2GY7B 2NSHA 2C1XA 4R05A 1A1OA 4TTGA 1RZJC 1P81A 3WRWA 1U8KA 4DQAA 4A9AA 4NO5A 2RJNA 1WBYB 4AY5A 2VXQH 3S8GB 5AOZA 4YQYA 3FNFA 4J3OF 4IMLA 1GRWA 2WF8A 1PZ5B 1E20A 1G7RA 1AKEA 5I5RA 3K0FB 3ULVD 4IQHA 4GAAA 1QZ3A 1M7IB 1TAQA 2K2WA 4RZIA 1NG1A 2B9AA 3MRMB 4KTDH 2QPDB 1H3VA 3UZEA 1OZ0A 3IAAA 3D2UB 3Q8LA 4IR7A 1JHRA 4XNUL 1E8XA 4A2WA 3UCXA 3N2LA 1HBJA 4UTZA 1M7DA 2FZEA 5HDQA 5E4FA 1QFUL 1ECLA 4UVHA 5DZLA 1AS7A 5M5BA 2P2GA 5FA8A 5B1EA 1Z2EA 2X7LB 3ZE2F 2VPQA 2F8XC 1E2HA 2EJVA 1T8SA 3GKWH 2GFBA 2A9FA 2C9BA 5K3EA 2HDNB 3OOYA 3H9CA 3MUJA 5I9SA 4NYJR 2W81C 1TVMA 2YMOA 1YACA 1R34A 4IS3A 2ZZUT 4PHTA 2Y6SD 2RGRA 4HFJA 4I2XB 1TM5E 2OE2A 3L6UA 4R8VA 1P69B 3WWZA 5DM70 2XSKA 4BQBA 2BY0A 2H92A 5D3MB 3CLFH 4PN7A 1QW8A 4RVBA 1UJ3A 4NR0A 1JLSA 4ENSA 4R8RA 5ALLA 3CIAA 3N3EA 1QAQA 2DETA 2JCXA 3VVWA 1CS4C 5CTJA 3EW9A 1I3KA 1Q9OB 2QW8A 1VPLA 3DE7X 1JNXX 4JLBA 1LF0A 3O4JA 2E3JA 2FF5A 2L18A 4NCKA 3TOXA 4U2GA 5DS8B 3FSRA 2FPLA 4UTVA 2YA2A 4LF9B 4HWTA 1ZLUK 3MS2A 3GGPA 4GAGL 3PCYA 4MTCA 2OVFA 1Z5LA 1R75A 3SE8L 3TNMB 3S68A 5JZOA 4LZPA 2EH7L 3QT2A 1SM3L 4NO2B 5BZXA 2CHUA 4N1HB 1Z5LB 5DHDA 4PZUA 2AJTA 1JPUA 1EGJA 2RAVA 5M34A 2AVDA 1IN6A 4PONA 1D7FA 5JZMA 1P0FA 3H8WA 2I34A 3HJUA 2JLBA 1OCCB 4YRFA 4RAOA 4UM8B 5A2BA 2P9HA 4ZPVA 3IRUA 2ALAA 5CFQA 1H19A 5DT1L 4AT6A 1NBEA 5L4SA 2IZ6A 2Z4RA 4FYKA 3QELA 2RK4A 3TINA 2IHZA 3CU5A 1KYIA 3H53A 4FKBA 3JD4A 1T2CA 4U3XA 2G0TA 3HYNA 3C6XA 4PWJA 5F1OB 2BCMA 1KYUA 2JKVA 4I0PB 2GSGB 3DQPA 1RBMA 3LQ2A 4QYXA 1ZXKA 1DKOA 1OIOA 1JTEA 2C57A 3AHEA 2Z1DA 4QLWA 1E1CB 5TJWK 4L1HA 1PT9A 3CTMA 1WXWA 1IOVA 5DUMH 3V52L 1JBEA 4UDYX 3OXSB 4R4NC 4M48L 3OBBA 2P9RA 2OORC 3CFCL 3H11A 2DSNA 1NQOA 3NIDE 4LLDA 1E7WA 4OUDA 2XDQB 4WY8A 1ENPA 1EHLL 4ZI7F 1KYZA 3QIWC 4Y2DC 1JXAA 4I1SA 3SDXA 4B9ZA 1KEML 4CCAA 2EADA 3RFUA 4AYEC 2EKSA 5AXAA 1JHVA 5MI0B 4MCHA 1RZJL 3TBBA 1TA0A 2DKSA 3DPBA 3HZKA 1B0UA 3KTAB 4XE0A 2BNUA 2R4RH 4EB8A 2ZKHH 1HDZA 5IJ9B 4NDZA 2YIJA 2VDKH 1PFQA 3U3OA 4HN9A 2C2BA 3DLHA 3GKWL 3CT6A 1DC6A 1WSWA 5EIIG 1VE9A 1AZCA 1M7IA 4CKCB 3KDSE 4GOMD 2FLBT 4LPYA 4CSTA 2D4FA 4DVBB 4DRZA 3UGEA 3G6KA 1YNKL 3KGRA 1XUOA 3PUCA 2XCLA 3BMXA 5FYQA 1DOHA 2INGX 1F90H 1DQIA 2VRWA 3WN6A 2D7OA 1PWHA 3DXYA 1WY7A 1GKUB 1YF3A 1DE4B 4GICA 3SS7X 3NWOA 1OBVA 3DGEC 2ZUCA 5C8YB 1S2OA 1OPRA 4OHZA 1ZWIB 2EVFA 3K6SB 5TS2A 4MJLA 4KPYA 3U3MA 1SPBS 2CWRA 2WTMA 4WI6A 3G79A 1A8UA 2EBUA 4J6RH 1HTBA 4IMPA 2WINI 2ZWZA 3ZWWA 4E6PA 3PYLA 5I0DA 2AV1B 5JHDB 4OZFH 2BWIA 3SIXA 4P4SA 4MPTA 3CZUB 5TF1H 5C3LD 1E9CA 2J08A 3VU1A 1XPRA 5LB2A 1E9QA 5D1ZC 5AMXA 1YEFL 3IV6A 2AZAA 5EH1A 4JVWA 4XODA 4KR7A 5DVNA 2WQSA 4AIXA 1RP1A 4HTAA 1E7VA 1H8ED 3V5HA 2VUSA 3JQ8B 5K9JL 4RH4A 3W5HA 3DX9B 3SZ3A 4FFYA 1CTQA 2NNWB 4KTVE 4W9EC 2EICA 3BQ9A 2R751 4HH4A 5H2BB 3UEZA 4WJG3 1Q2XA 2D1QA 5ALCH 3VFUA 3BZUA 2BY1A 2R0LL 3S6CA 3HS0B 3IURA 2C07A 3SG0A 3GIZL 2XB4A 2OHIA 2H1LA 4KXMA 2X1PA 5ETUB 4PFSA 2OJZL 3QV1A 4E13A 3PHIA 3DA8A 3BXEA 2HYMA 4HJGA 4QTHA 1AXEA 5HPYB 3H9HA 1PRYA 2BISA 2ZG6A 2OSYA 2TMDA 4JNCA 3P9KA 4UPEA 4J8PA 1C1DA 3QKRA 1XCXA 3SHVA 4ED9A 3F90A 3TQCA 2C94A 4R7NA 3OURA 2VUUA 4GI2A 2YA0A 5F5XA 1WRFA 3UCQA 4DDWA 3M4NA 5L4FA 3D2TA 5TC4A 1MRDH 3TJZA 4OY9A 1Q0XL 2R6R1 3RUIA 4BGLA 4WZBB 3DYPA 1GCAA 4GPBA 3VO2A 1XNQB 3NB0A 3VHLB 3L17A 5K1ZA 2J7LA 2AV7A 2GW5A 1FTGA 3D2BA 3BXGA 5IZ4A 4TTAA 2XMRA 3VD0A 5AM2A 3R4RA 1AZTA 2FP4B 1DBQA 1EBAA 3EGWA 3VR2A 5JDIC 1PEYA 1DRUA 3U7RA 3A2KA 2BVPB 1TG8A 3MTGA 1KOFA 4DABA 2OTWB 3TA3A 2JRLA 1JJ7A 3RY6A 8OHMA 4HS6B 3PV6A 3G1TA 5ENZA 3MRQB 3TBWB 1P5JA 2FPMA 1JZ2A 4RYDA 2IS6A 3M5PA 2ZJ4A 5KVGH 1XGYL 2QADB 4P5KA 1PD1A 3IDNB 4IDPA 4NBWA 4PZZA 1DZ0A 1UMCB 4M36A 2NW3B 1ZHBA 3B7UX 5KN5A 5BMVB 5JI3E 1RAEA 2GBUA 2NVUA 3HWRA 1YJBA 3Q8FA 1IN1A 5IASA 3PHAA 5DRXB 1QWSA 3T3ME 2FOLA 3PPVA 4O2FA 1YUMA 2PXHA 1FO0B 2O3SA 4Y6OA 2JARA 4ZMRA 4GMGA 3LC0A 2JI7A 1YEWA 3D2AA 2HSWA 1SVBA 4URHA 3MYJB 1YECH 4NLLA 5EUKB 4FOTA 1KDPA 2ZTMA 2HRLA 5AM1A 4Z9FA 4CU5A 2JIXA 3TBTA 1UEJA 4TQGA 4YCCA 4IBUA 1Y6ZA 3DAGA 2ERXA 4QYMA 3PP8A 4I88A 1P72A 4DUGD 4UBOA 3N1UA 1Y5IA 5B3SB 1TA4A 5T8KC 5FTMA 5JIKA 1Y7IA 2HJSA 1KZ4A 1U2ZA 4UIMA 1T1YA 2BGMA 3RYTC 4G9FA 1XGTB 1HQKA 4KVFA 3DDNA 4DKTA 1S0UA 1ZSNA 4QM6A 2KE5A 1QH1A 1DVRA 5TARA 4AT6B 2OSXA 3D1JA 1DO8A 1KJMA 3OTIA 2LGNA 4C4BA 2QV4A 3NTLA 4NRZA 1V4NA 1OIWA 1D9KB 2AJ8A 4MUMA 5FLEX 1KMHA 1R9FA 1OXVA 1U2GA 2DKOA 3HFJA 2NIPA 3GAAA 4HXFB 3SQNA 2VQSA 3CZ9A 4KBGA 3PJRA 3FSGA 2W0FA 2P62A 3U4QB 4B0PA 1RYZA 3M70A 1JZ7A 3MVSA 1JD9A 3GLRA 4EEZA 4YFVA 1FVCB 3EWAA 4RVUA 2F1OA 4XP6L 3HFMH 2FVXA 1C3VA 2LIPA 5FUMA 2ALWA 3RZCC 3JVGC 3ZWBA 4Y2SA 4HS9A 5FNVF 4GOJA 4TLUA 1E8WA 1G7JA 4BEWA 3F7NA 2O07A 5TE6L 4X61A 5KBDA 4LVUA 3AONB 4FHFA 3KXIA 2RHWA 1UD4A 5EMHA 2PS9A 2CUIA 1PUXA 1EWTA