1TYEB

Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
440
structure length
440
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for allostery in integrins and binding to fibrinogen-mimetic therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-IIb
total genus 115
structure length 440
sequence length 440
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 1tyeB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 1tyeB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1tyeB03
1JLMA 2O7NA 4G1EB 3HXQA 3EG9B 4DMUB 4HQLA 4MMZA 1CK4A 4Z7OB 1U0OC 3FCSB 4NENB 5HJ2A 1JV2A 1IDOA 4FWWA 5E6RA 4MMYA 1L5GA 4C2AA 4PN7A 1DZIA 3QA3E 1RD4A 2VDLB 4Z7NB 3ZE0B 3NIGB 4F1JA 4NEHB 4IGIA 1Q0PA 1BHO1 2M32A 2VC2B 4NENA 5E6UA 4UM9B 1SHUX 3EFOB 4WFQA 3RAGA 1M1XB 3AL9A 4CNBA 2ODQA 4JX0A 3OKWA 3F74A 3V4VB 5E6SB 5KYYA 4G1MB 4O3UB 3BQNB 1L5GB 3NVQA 2QTVA 3PPXA 1PT6A 2ICAA 4WK0B 5E6UB 1BHQ1 3N2NA 4HQOA 2NUTA 3NIFB 3K6SA 3ZE1B 2VDOB 3K71B 2NUPB 1QCYA 1JEQA 1SHTX 2XGGA 4FX5A 1JEYB 4HQNA 2P26A 3BQMB 1TYEB 4G1EA 3OL2A 1CQPA 3EFOA 2VDQB 1M2VA 3EGDA 5LN1A 1MHPA 1FE8A 2IUEA 4MMZB 2I6SA 3V4PB 1ATZA 3K6SB 1U0NA 4BJ3A 1N3YA 2X5NA 2VDKB 3EGXB 4G1MA 1SHYB 1MJNA 3ZDZB 5KYWB 4MMXA 3AL8A 1M1UA 3M6FA 3EH2A 1M2VB 1QC5A 2VDMB 2WINI 4WK2B 3EH1A 4JDUA 1JEQB 5KYNA 2VDRB 3VI3B 3OKYB 1AOXA 4F1KA 2XWBF 3OL2B 1U8CB 3EG9A 1YVPA 4MMXB 1MF7A 3AL8B 3HXOA 4Z7QB 2I6QA 1MQ8B 3F78A 1QC5B 3ZQKA 4CN8A 5KYUB 1SQ0A 3VI4B 2UZYB 1MQAA 1T0PA 2NUTB 4WJKB 3IJEB 3GXBA 3FCUB 1SSLA 4IHKA 4M76B 5BV8A 4A0QA 1JEYA 4O3TB 3EOBI 1JV2B 3EGDB 3PPYA 5HGJA 4GZ8A 1M1XA 4HQFA 1AUQA 1RTKA 1U8CA 1XDDA 3TCXB 1DGQA 3TVYA 2VDNB 4O02A 5ES4B 5KYYB 3IBSA 1OLZA 1PCXA 3K72A 3PPVA 4HQKA 3ZDXB 3PPWA 4UM8B 4IXDA 1OAKA 2B2XA 5KYWA 3IJEA 2ADFA 3ZDYB 3K71A 1M10A 1ZONA 4K3JB 2NVOA 2P28A 3T3PB 1NA5A 5E6SA 5E6RB 1ZOPA 3Q3GE 3K72B 2ODPA 3ZE2B 1PD0A 1RS0A 1YVRA 1MQ9A 1UEXC 3HI6A 5KYUA 1XDGA 4O02B 3EOAI 1YUKA 1N9ZA 1ZOOA 2NUPA 3EGXA 4XW2A 4C2BA 1FNSA 4C29A 3BN3A 1AO3A 5KYXB 1IJBA 1IDN1 3T3MB 3AFCA 1LFAA 2I91A 3TXAA 4CN9A 3TW0A 4MMYB 2VDPB 1T6BY 3E2MA 1IJKA 2XWJI 5KYXA 1M2OA 3FCSA 1RRKA 2WW8A 3NIDB 1XUOA 5HDBB 4UM9D 1PD1A 1V7PC 4WK4B
chains in the Genus database with same CATH superfamily
2C54A 3GLFE 3FOLB 4D9CA 3OHPA 2EGGA 2F64A 4QIHA 2C3HA 3ZBQA 1V3QE 4Y5XA 1X3DA 5GOZA 4ISVA 3GBPA 1NOIA 1VSBA 1G98A 3N1FC 5BN3A 4PLJD 5F21B 2AIRA 2DJIA 1UMDB 1FBNA 1XDZA 5CDFA 2B9AA 4S1QL 4X91A 1RI2A 5F7WC 3L4BA 1NM5A 2WU4A 1R64A 5FYLD 2IWRA 3D3NA 2FBJL 4OU4A 2PIDA 3HC2A 3CSYA 5K0LA 5DHVH 4B9PA 1FU8A 1SXJB 5DQ9A 5B39A 1AI1H 3DIDA 1L7TH 1UKYA 1BHGA 1AS6A 2PZMA 1WG3A 4I0PD 3WL9A 3KLNA 3M81A 4RU1A 4TUYF 1JUFB 4IOFD 3VI4B 3UB3A 1JDVA 2C99A 1SUAA 3U6RA 2F3PA 2XZLA 2R6DA 5CIQA 5D2CA 1RQPA 2XUGA 1LB1B 2J5RA 1MRFL 3ZHBA 3LKSA 1X4YA 5EMKA 2CB0A 1DC5A 4YRBA 1U3HA 4FDMA 2EDAA 4DDKA 2MQ0A 5ACZA 4W4TA 3CLUC 4M1QA 1WZCA 5IP5A 4ONGH 3ZBTA 2ZICA 3FI9A 3OY2A 2VMFA 4JL2A 4LCCB 4YE0A 5E2WL 4RHXA 1EFXA 3DNFA 3EIHA 2XF2A 3RA7H 1HUQA 1OJLA 4MMZC 4GKZB 1Y81A 2ZJ0A 4KTTE 4DWVA 4ODTL 1DDTA 1UKQA 2HP4A 1PFOA 2JI2A 1FNBA 1IAII 1UXSA 1Y7PA 5F1YA 3OOHA 1OC4A 3G0IA 2XCRB 2ZBQA 3PDWA 1BD3A 1VIAA 2ZX8A 1C7QA 1U21A 4JZNB 3QNWA 4OZIE 2CEKA 2JBAB 5I1GH 2VDNH 3TGWA 2A6KB 3QI9A 5IFHH 2FO1A 4FFVA 5T8IA 1FORH 3RIHA 2WKPA 3UTDA 3V5DB 4R7GA 3FRUA 1RWOA 1X3SA 3K0YA 3TJRA 1JR6A 4GWGA 1GXSB 4EA6A 3Q1EA 4GI3A 4AAYA 3QFRA 3FSEA 2W1NA 4PJBA 5T33H 2WQAA 2J67A 1OY1A 1FJXA 3MMXA 3L9XA 2E3VA 4KX3A 3NHWA 1GZHB 2VS1A 3LT1A 4IMLA 3ZJVA 2LT9A 2IYUA 3WLPA 1MJJB 4QXTA 2FP3A 5IEJA 2YQGA 4WEBL 1IC5L 3TJMA 4HNTA 4XSHA 1M71A 4BP3A 4G43A 2PGIA 1LYQA 3BQ9A 2XVAA 1SIOA 4I9GA 4JFHE 3BIWA 3HCEA 3QMVA 1KYVA 4QYOB 3IKLA 3U4AA 1GUAA 4AQEB 4OF7A 2PL3A 8AT1A 2FYYA 4QDKA 5KUKA 1JZTA 4AM8A 2P44B 4DXHA 1I3KA 3CFBA 4P99A 3BZDA 3WYBA 5ICSA 3VXOB 3HAEG 3CLRD 5FBLB 3K6JA 4AJEA 2AK4E 2OX5A 3RGGA 3CMGA 4HDMA 1EERB 5ENWA 2JVJA 2FN7A 3TFKC 1NCWL 1DBKH 1FPTH 1EFVB 2JFOA 3A9CA 3GW8A 5J2TB 3DTTA 2JL1A 2JAUA 2OLEA 4YBZA 1T35A 2X4SA 2I99A 4OZGA 2CUAA 1SEQH 5DZVA 4AJJA 1YEEH 4Z95L 3DFIA 1UM4L 3OKNB 3CW9A 4DAGH 4JO3H 2QVKA 4J1UA 3MR9A 3UYPB 2ZATA 5DHVB 4DZ8A 1AT1A 1QIGA 3FN4A 3ROZA 4P3YA 2CHGA 4GVXA 5TDPB 2AUMA 1U6AL 3BXZA 5LQUA 1JH9A 1PZSA 4HZ1A 3WFDH 3MV7E 2I6SA 2QR3A 3O3MB 2AHOA 4X6DE 1QUPA 1I80A 2SBTA 5AVYB 1XAKA 2IYNA 4ND2A 5L88L 8ATCA 3T4AC 3HBQA 3WL3A 3KAAA 1UENA 1BCSA 4HGWB 4JHUA 4AYMC 1J8HB 4GMFA 3HMWH 3V10A 1U98A 2PCJA 7FABL 2WQVA 2AG6A 2YOHA 1E7WA 3OLDA 2IMMA 4LQ1A 1FLAA 2ATEA 1T21A 5F5LA 4PEVA 2QVCA 4MX8A 4AVKA 4ZTOL 4NKMB 1OWMA 4IIQB 3LZNA 4Q66C 2HW8A 2DUWA 3N53A 5F71A 4JFFB 1B0ZA 3L17A 3CK0H 4QTTB 4FQXB 3ISYA 3N40P 3K72B 3QG7L 4O5LL 4BVKA 4B83A 3GP8A 5BQOA 4Y1RB 1DVSA 3R0MA 4ZQCB 3QZBA 3IUSA 2JRLA 3TZBA 3OESA 4G07A 3ZY7A 3I5UA 4PN6A 1CJVC 4FQ1L 2NO9A 3MV01 2E87A 1SUFA 3GS0A 2C9AA 1YQXA 4ELMA 4N5UA 4KOCA 3RAFC 3OAYK 3MPOA 4JXJA 5DSXA 2BJWA 3QUKB 1NLMA 2YMPA 3SMVA 3LH2L 4CFZA 1KWKA 1Y1UA 3CC5B 3FVQA 3IU3B 4AJ9A 3BMQA 3D8NA 3P2YA 4CDRA 2DB8A 5CLFA 3ZHQA 3WEXB 5I0WA 4RGNE 3MC1A 3UCQA 4EI6B 2AABL 4CMIB 2BEVA 1H15B 3RWFA 1L1RA 4OHOA 1U0TA 4M4RA 1XX6A 5B55A 1YK0A 3OQNA 1UQSB 1USIA 3LPWA 4RFSB 4UUJA 4YHIB 1GZHA 2QQLH 1FU7A 1YMMB 2O48X 4TYPA 5I18L 4F2GA 1QIDA 4BK4A 2FQYA 2VUTA 3AY4A 4JO2H 1C3VA 2DMHA 4BZYA 4Z2YA 4XXHA 4TWJA 5FYKH 3EF3A 1HYEA 3JAKB 4UEJA 1ELOA 4RM3A 3CFKA 2UZ4A 2IAMA 1YZQA 4FQPA 2FWJA 2ZJBA 2BKUA 3IJHB 3FN0H 2FWNA 2DQHL 3GEIA 3CC8A 3IAGC 3GWGA 3VR5A 2FT7A 4BTEA 2A1TS 1EQWA 4WX2B 3UC5A 2ZJ8A 1AGEA 3RKDC 3FPCA 2NADA 1ULHA 4INPA 4AM0B 1G8KA 4L8YA 3ER6A 5E2UL 1M3SA 1YQ2A 4TS6A 3F12A 1U8LA 1S7WB 4HH9A 3ZHRA 3Q8LA 1D5CA 2C2ZA 4Z18A 3B9KA 4RJ2A 3GSNA 1DHRA 2EDKA 4GR4A 3RX9A 1WISA 3BRDA 4BFTA 5DHVA 3FMGL 4TT8A 4K86A 3LQAL 5DJ8A 3CSBA 5E99L 2ORED 1I9IH 1ATIA 3DKPA 4K7PX 1XCGB 1WDWB 1QO3B 5BS0B 2WYTA 2OC4A 3ZQUA 4K1XA 2OTUB 3QG6B 4M5ZL 4Z7VE 4PIVA 5FHRA 5B36A 3QDHA 2FPIB 2JH3A 2V8MA 3ARFA 3EOAB 4FKMA 2HYIC 3OCYA 3HOGA 1ORRA 5EQTA 4IHQA 1K9VF 4XJSA 4ZU3A 5HDLA 5T5FA 1FPMA 1Y1DA 3T09A 2OUIA 3MBXL 3GX1A 1W5EA 1P7BA 5EIIG 2VUSA 5KTKA 3PQYE 2NY0B 4Q82A 6REQA 2OV2A 3UW1A 5ES4B 4J0IA 3IC5A 1DN0A 4QRPD 4IQHA 5HSFA 1GGIH 5LQJA 3BFWA 2DKNA 2QTLA 4JPVL 4CRPA 4DF3A 4BO5A 2P5YA 4XWTA 3KEHA 4O02B 4XB2A 521PA 2F8TA 2BSDA 4L9AA 4HXBH 4ND4A 2J1YA 1PR0A 4O2LA 1PV4A 4XNDA 3ONVA 5TMBA 4B9ZA 4TZ6A 5GS0L 4CG0A 2FEEL 1I7DA 2RBKA 3LHPL 1VFPA 4MD5A 5GGSB 4KPUB 3BMQB 4ZXPA 4R2GD 3LT0A 1U91A 4FZEH 4PSPA 4DGIL 4J2QA 2ZSHA 4PZDA 3URKA 4LHWA 1CUSA 3OVUB 1TIKA 2QQ0A 1GYWA 4HIEA 1H2BA 2AN5A 4MI9A 4LQFH 3BQNB 3VXSB 2OWDA 2YFKA 1QSFE 1CDHA 2IUTA 1UC4B 2IOIA 4CTKA 4I2XA 1DX4A 4WJZA 1TKCA 5CSZA 2OMUB 4E2YA 1CE1H 3DPDA 1CUWA 3IAUA 3RWBA 3MOIA 1DVTA 2V3FA 4XPFH 3GLHB 2ZYIA 1WUZA 4I3SL 3PQ8A 2YD5A 4TXNA 1D5RA 1Q1JL 2Y67A 1J8FA 4OXRA 3U19A 3TSAA 1QYRA 3AEQA 4XCNA 1GZHC 1KOLA 3MTQA 3UNXA 1S8OA 1BHSA 6TAAA 1H65A 2H1PH 3L3IB 1JEYA 5KJ4A 1V45E 4M7JL 4Q89A 1JR2A 1DBVO 3JCZA 4E6PA 4NIYE 3X44A 3ZH2A 2VYND 3SEAA 5L3ZA 3G23A 4NXSA 1CF4A 2QMHA 2J5BA 2VRKA 4ZPTB 2GJKA 3X3FH 4ENSA 3GMRA 2ONCA 5DLQC 5J2UB 1GV0A 1S7GA 2Y1GA 4Y2LA 3TA4D 2CO6B 3AINA 2X6QA 3BXXA 3DT8A 3TW0A 1GXSA 3W4JA 3MRKB 5DQJB 2HX8A 1U8JA 2Z4QB 2ODNA 4P3WA 3QOYA 4HKZB 4LSSL 2CC2A 2HHJA 3A7DA 4EIGB 1NGWA 4A2PA 2BP7A 2IF0A 2XBTA 5E1AA 3FYDA 2P45B 4V1DB 2LR4A 5FXMA 2YMQA 2AJ3A 2FK9A 1E28B 2A4KA 4R7VA 4B4WA 4JCCA 1NDUA 2ENYA 1F4HA 1KJWA 4YAIA 5EL0A 1GZPB 2O2ZA 1YR1A 2WYZA 1CIVA 1SYSA 4OH2A 4BV8A 3NDZE 5C92A 3ZGIA 1XI2A 3ILYA 2PP7A 1UJMA 3WIBA 4AC4A 2XG5B 1YVDA 5F73A 4YJGB 3TN0C 2O61A 4MRBA 4JHWL 4QUJA 2XW6A 1ZEAH 4HW6A 3NT4A 4BHTA 1SQ0A 5C0AB 3FYUB 4UBKA 3PL6D 4PX2A 3VTAA 3QQ3A 3D39B 5FA3A 5JISA 2HUNA 4WUUE 4IDHA 1BJKA 1MKFA 2QIOA 3SN6N 2W4IA 2JFGA 2YRZA 5IVOA 3HGMA 3II6X 1ZUNB 3QXVA 4UDTA 4NE2A 4DJMA 5CHYA 4D82A 2X0FA 2OUKA 4JRWA 2WJ5A 4FIDA 1DEEB 4MVWA 5D84A 3C15C 3R3YA 2GUOB 3Q15C 5EIAA 3IHLA 1KCKA 3EJCA 3AU8A 4LDZA 2IHZA 4K7PH 1IK6A 2NYKA 1W0JA 2FETA 2SICE 3ZYOA 1KY5A 1AZRA 4MWFA 2FMIA 1T24A 4E46A 3UYKA 2PETA 1S9KC 3TFOA 2VQEB 3CJTA 3PGMA 4AMZA 1N6HA 2CK3D 4Q9IA 5TF0A 1Q0PA 4BKLA 4OF0A 1XBDA 4KR6A 2BJML 1G5PA 2J3MA 2NY1C 2ZW9A 4L75A 1WCIA 3QULA 3TYFA 3VZBA 3IGUA 5GXBB 3UXHA 4QPEA 1ZGLA 1FDIA 1TFHA 1QPZA 1WHSA 2ZYTX 4IBWA 1F6WA 5HFJA 5AW6B 3S27A 4CKYA 2XIDA 5LQKA 4FM9A 2BH2A 4L4SA 4NZRL 3OPQA 3QBJA 4HALA 4CJXA 5EU5B 1UWXK 5IXJA 3SBQA 3REQA 2XE4A 2NV6A 3QYCA 2DYSB 2PLFA 1HHGB 3AUVA 3B53X 1XGQA 1GTG1 3BGVA 1W52X 4I9WD 4EIZC 4R3SA 2YJQA 4QFCA 5B1KA 2ZJZA 1EHAA 3PQ4A 4OM7A 1X8LA 5BJTB 3UAJA 2FIKB 1OP5K 3K2MC 3W11C 1E79D 1KYXA 3L7NA 2TRSB 4X24A 1WAPA 1PAMA 4XNAA 1NN0A 4CL0A 1LGVA 4D9LL 5HTSA 3IKTA 5JY6A 3TQFA 3ZDYB 4EI8A 4U1GC 1E96A 4NB7A 2PK3A 5IFJB 1UBJS 3KBBA 4QHLA 1QFUH 5JYBA 1P2DA 3QWNA 3ZOKA 3WIIH 4WQMA 4OM1L 5EU6D 4M3KB 2O5YL 2BZ0A 3CLEL 1GQOA 1IHUA 3DLCA 3VXSA 4U6XB 1BKDR 5MENB 3SCMB 2AC7A 1BDBA 4GM4A 2KZWA 2Q99A 4WDIB 5CD1A 3EWIA 2V9QA 2DG2A 4HX2A 2HJKB 3LH9A 4WASA 4EQ6B 1FGVH 4CCSA 1XRRA 2XCOA 3WYCA 4A82A 1CLOL 4Y2JA 1T1EA 3FDJA 1C1EH 1W87A 3OT4A 1HL9A 4DOHE 4YHLL 3DAFA 5A7GA 1P8JA 4EY3A 1JNHA 3U9PH 4G8GB 5CWSB 1NNSA 4YEDA 4P2OB 4LRUA 4BWFB 2PMDA 4Q4EA 2WBLC 2FX5A 4YJGA 2CK2A 4NWTH 2Z93B 4FKHA 2NM0A 5KW9L 3RO7A 3C6BA 2X2EA 5IW6B 1BCRA 3CLTC 3OE7D 3ZHDA 3UAOA 4DZZA 1NV8A 4AM0A 3VR4D 3PRZA 1C8BA 2QKIC 1ZUHA 1D2CA 1E2QA 1VEOA 1TTGA 2IAMD 3BT2H 4EVNA 3I62A 4F5WA 4RAUA 4HIJA 1NWHA 1N3BA 4BFEA 3FGPA 2V7NB 4YB8A 4K5PA 3AHEA 1WRBA 3S7TA 1I3GH 4EL5A 4Y1TA 2GZ2A 2NZ2A 1IWBB 1US8B 1OOAA 2FSUA 2NSMA 2PN1A 1E6LA 1EEZB 1KG0A 3WK9A 4AZ0A 3DUUB 1E3LA 1OY3B 1TC1A 1Q1AA 3N8DA 3RTGA 4ODWA 5I8OH 1WPRA 4ZEVA 3L95B 1EFRA 3HNVH 2A9MH 3KHTA 5EIQA 4JP2A 3QX7A 1FYXA 3L4JA 1UXHA 4ALJA 2IP4A 4WDRA 2XWJI 4QARA 1M2OA 1HSBB 5T3ZD 2BHTA 3PV7A 3S4YA 1LDGA 4OQNA 2G0NA 5AAMA 2DJ5A 4FKKA 4XGQA 4LNUA 3UC0H 1XK6A 4PCYA 2F7SA 2RJNA 3R6GA 4U0RC 1V8PA 3A36A 3FT4A 1G21E 1JA1A 1A9BB 4JPVH 4UM9B 5GZNA 1WHSB 5D7JB 1GNRA 4D9KA 2CXPA 4UMVA 3MJRA 3FRPG 1X4ZA 3LUFA 3TLKA 3TIDB 1U11A 3F6CA 3T0BA 3KJFA 5KN5B 2FMHA 2X7LB 4Y9TA 3DOFA 1VL1A 1T80A 2IMNA 1J8RA 2HA7A 4UCXA 2X6UA 4NOMA 1Z4NA 1YY8A 4I7EA 4U33A 3HLKA 4M54A 1SCNE 3I34X 4P9HH 3HA3A 1XDWA 1DELA 3ZOZA 5J1TC 2JKIS 4KVNH 3M9WA 1D6JA 1NVMB 5B6JA 2GUOA 1BXXA 4X5PA 2G76A 4DSUA 4OGYH 3R9XA 4CEIA 1SXJA 1MRNA 3G3EA 1PLAA 1TO4A 4TWIA 3K6IA 3BUYB 4BCXA 4IHJB 3LC0A 4E36A 2QQNL 1XJCA 3OEEA 4ETIA 3OMNB 2J9RA 1X5HA 1OB5A 3MV9A 5C8XA 1L7XA 5DK0A 5B12A 1ZD5A 2QTBA 3GINA 2XVBA 2J56A 3HE6B 3VSCA 1U0GA 5ITSA 4GRIA 3BGMA 4TVUA 2QE7D 4ODTH 2DFNA 5WRFA 4C7KA 3S3JA 5DX1A 1CETA 2QIPA 4D4LA 1KB5A 2JS7A 4HFUL 1JZSA 5FYLH 3P30H 1HR0B 3DHYA 3GLVA 2ADIB 3F1LA 3OPXA 3HUJA 1L8AA 5BOZG 2YDXA 1OFUA 4UTVA 1ISMA 3Q9UA 4NCDA 1TO2E 1KC5L 3BH8A 4LLMA 3KKPA 2Q1SA 3HSYA 3ZN2A 1F2TB 4XD7D 1XTKA 3T0GA 3SDDB 4LMQE 2QJWA 4YHKL 3HHMA 1MCOL 1BOYA 4XN8A 5TE7H 1Z2EA 5EIWA 1EBFA 1YDFA 2VJCA 2R7MA 2OK7A 1C0LA 2GGSA 4QPDA 2NYAA 5H5JA 3PHLA 2I0FA 5IFJA 4WW2C 1ML0A 3IJ8A 2AB0A 3NCCB 2NY7H 1BPVA 4Y6OA 5EZYF 2XQVA 2ZGVA 4WGFA 4UBOA 3VU9B 3EGDB 3LDUA 2XWRA 2Q5QA 2BOCB 4G9FA 3DARA 3ZNQA 4UC0A 1MW0A 2V17L 1V8BA 5T3ZE 3WQQA 2OENG 3WRXC 4XB6B 1MC1A 1G0DA 1V54B 1QQ6A 1GCGA 5BQFA 1KP3A 1WUTA 3GLGE 4XWYA 4C7OB 2EJBA 4XNQB 5KU7A 3OLGA 5B58T 2FE1A 3HCNA 4WO4A 3B5GA 2X1QA 1NOKA 1E5BA 1VYUA 3OUZA 2WWVD 2QSUA 4DM7A 2ROXA 4G2NA 5K5YA 3VW3L 1V37A 2YGNA 1OAQL 1IBLB 1E7UA 2YBEA 1E9BA 1UYWH 4JN2B 2JGKA 1MAAA 4AQEA 2Z93A 2JGIA 5KDLA 2O2DA 4BLQA 2L7QA 2IDQA 3MFYA 3QQ9C 4GEIA 3FYSA 1MIHA 3W3AD 4AKEA 4E2WA 5IQLA 2FPUA 5ALJA 5H3CA 4FQ5A 3QSGA 2NUAA 3SJ7A 1C8VB 3SXUB 3G5VA 3QXUA 4WLEA 5K8UA 2HSJA 5DV9A 3ISWA 4M00A 5FAKA 2AG8A 2QUBA 2I1QA 2IEPA 2CNKA 5I15H 1WNFA 4EP1A 3VSDA 4DO4A 3PNKA 1WAAF 1FSGA 2GH1A 3GFVA 1JNXX 2AJTA 3KSBC 1PWEA 4MKXA 4XPGH 3UOWA 2V7PA 2Z9BA 1M1YA 2A5JA 4QYSA 2Z2XA 2E6QA 2JATA 2QG6A 3DC2A 4OP3A 4MAYD 3JUYA 5A4FS 2ASEA 3IODA 2YN0A 4UVDA 4M7OA 1NJ1A 4KRPB 3ECSA 3WTXA 4R5TA 1HSZA 1PX3A 2PWGA 5IDVA 2L7JA 2ZXFA 5A4MS 3RWGB 4BBPA 1OTTD 3PPWA 4HGWA 5CZRA 4ATWA 4BRSA 2QTTA 4AH2A 4CCYB 5FPTA 3TN0A 4KMQA 5C9JA 3QNZB 1ZLVH 2G3XA 1NCCH 5TE7L 2R8EA 2XX0A 3CZQA 5DRNA 1KIPA 3QU7A 4B81A 1M1NA 3M1AA 4B2IA 3STVA 4OSPA 4JG9A 3WS3B 4RNCA 1F8XA 4FILA 5SICE 1Z5GA 1W36C 5FYKU 3AL2A 1XEAA 1TVBB 1REQB 4JPSA 3FNRA 1FMTA 1SBHA 1WAEA 1D1QA 5IT0A 5TF1H 3RDTA 1YU9A 4MW5A 4PRBA 4PJCB 2G82A 5MN6A 2IY8A 3UV7A 4HEMA 5D2LE 2GVDC 2TRYA 2OV4A 3RZCB 2R0KH 1L0QA 1M1XB 3HZYB 4NULA 4Y2YA 1HORA 4IDLA 3LQ1A 1UIRA 1L4KA 1GZQA 2E85A 3T41A 1MN4A 2PNDA 2BWJA 3FTDA 4YRTA 3FFCA 1QFYA 3STBA 4MUFA 1N36B 2IXBA 2FMTA 5GSVA 4B27A 1GUBA 4PVBA 5IKXA 1BREA 4XI9A 4WNSA 3PFIA 1YC2A 1OB0A 2V5YA 1A6UL 3C2SA 1RWBA 1IOLA 1NJSA 1JGUL 4G5OA 4H27A 5LSAA 5MEPB 2ERXA 4N2MA 4CMCA 5FYKE 1UOOA 4F7EA 3OE5A 4BLRA 2IJGX 4N01A 3S35X 4PJ7F 4J3FA 1I3LA 2ZUTA 3MNDA 4LF4B 3UROR 5CFAA 5I8CA 5IB1B 1YU6A 1N6OA 3U3MA 3X14B 3ELAT 5HZHA 1NVDA 4B8YA 1TK2A 2Q20A 1PJ8A 4PSKA 3DMFA 5LXTF 5FA6A 4X92A 2RG7A 5C0GA 5DIZA 3BB4A 3C9NA 4N82A 1BLIA 1Z9OA 2YJ4A 2NY6C 3G8CA 1N4XH 3RBAA 1CY6A 1WXHA 4DE5A 2BHFA 3EOBA 2VSNA 4FFZA 4DWWA 4LX0A 2P1RA 2RA1A 1EXWA 1X9QA 5LWYL 2HLPA 2VDUE 3UN1A 5FI5A 4BKRA 5KZCD 3T7SA 3MIIA 1ZM3A 3DO3A 5ITFA 1SOAA 4LZPA 2C5EA 3UZEC 4RQUA 4UT7L 2UYOA 2GN1A 2HVJB 4U1IA 1SOUA 2YPLE 1KPRA 4P1ZA 4Z4IA 2X4QB 3EGWA 3VA7A 5AJZA 1KMHB 5FOSA 5K4AA 2A83A 5EHFA 4EYGA 3O8QB 1I9RH 2KZKA 4JFDD 3BWAA 5E9AA 4LF9B 1BQSA 4NM8H 5JZ7C 5BQ3A 1EXDA 3MLAA 5HJEA 1J33A 1YZKA 3ARTA 4OUUB 3DZBA 3ZDXE 5DJ8B 2GJZB 1XRNA 3C3BA 2G07A 3SZMA 4EIWA 3VVVA 4FFYL 4P59H 2CBTA 2IE0A 1FO0B 1UWYA 4UMEA 4G70B 3MREB 4P2QD 2WJJA 5IEBA 1AAJA 4WGVB 2RHLA 2CJUH 2RB4A 4NZUL 1YIAA 4R8KA 2VEDA 1RLUA 1GIAA 2MKWA 3OAAA 3HG1A 4PFKA 9MHTA 4C56E 4G6KH 3FDZA 4J4TA 3ZHZA 2VXSH 1F8YA 1EVEA 5ALHA 4ALKA 1QKZL 5J63A 5FP0A 3C8DA 3GM0A 2VPTA 2XVKA 1FRGL 2VBFA 3SQMA 3LMJL 4V38A 5D00A 3NIDB 5E8PB 1BN7A 4TLTA 5GS3A 3DBLB 1L9PA 1TUPA 2OFXA 2R56H 4FHJA 1U5CA 3TL2A 1QRDA 1GNQA 4DIKA 1ND6A 3PGKA 2V6MA 2QG9A 3T65B 3KJNA 2Z0BA 4Y8DC 2W07B 5T1LA 4L08A 4YALA 1VQ1A 3FWPA 3K9BA 4WZZA 1CD0A 3V52H 4B6ZA 3IIKA 2UDPA 3GJEB 2P6RA 1ET8A 1U91B 1GAEO 3O4OC 3CSYB 3Q9NA 5E9DA 2ZE0A 3EXHB 3PPEA 5JQGB 5GGSA 4KDTA 5L4LA 4KV7A 2RIKA 3WTWA 3RPEA 2X4OA 1KJ2H 5AVRB 1A5TA 2J9XB 3SOZA 6CGTA 4NCNA 4DW8A 3IXTA 3G5TA 3QFTA 4NRXB 4TUKL 2CO7B 2FJ0A 1ZVJA 1AI1L 4KNUA 1TRKA 1N5DA 3MNZB 3MGOA 2JJMA 1U1CA 4X8CA 2ZXGA 3QNMA 1JDTA 1XLTA 3UJAA 4EIBA 5LOVA 1Q11A 3KR1A 1JNJA 1YUMA 4FC3E 1RVDA 4OB7A 4UTNA 4YHNA 3FMIA 4QL3A 1FZJB 2R4UA 3I42A 3SBRA 4KFTA 5E8OB 4EG5A 2XQYG 1SMDA 3MYJA 3UMMA 1G17A 4F9LC 4N41A 2EW2A 2C5HA 3WLOA 1WEJH 5DLEA 1IHDA 1OE1A 2W83A 4M6WA 5EZ6B 4XHJD 4L1SA 2AK3A 4IJQA 3NC4A 3B1KA 2IIJA 1JZ4A 4D2IA 4HWTA 2HJRA 4M1DH 1C08B 3OX2A 4QHMA 1WA0X 4PQRA 4YNYA 2JLVA 4GUCA 4N86A 1CEQA 4IP0A 1UBSB 3P3TA 2HJSA 4UB0L 4YBQC 1NE2A 5CX1A 1ZJAA 3VU9A 4OCMC 4O1IA 3DKIA 1NLDL 3IVKB 2W0MA 3PABB 4JLRA 2W37A 2D3LA 1QNFA 5JZSA 1IT9H 3MRQA 3EW9A 1ABFA 3FOWA 2YOFA 4DKEH 2HRDA 3GKWH 4KRFA 3FT3B 1F6AA 4Z0BH 3Q7TA 4GM1A 4WZAE 1KJMB 5AVTB 2JJWA 5DYYA 4FZ5A 5LUMA 3DT9A 2GRAA 4A7QA 3BIFA 4N90E 1WOYA 3C39A 4ABTA 3NP9A 4XGZA 1S7UB 4K2UH 5DA0B 4Z4FA 3ECQA 4ZCRA 3QQ5A 4MW9A 5C0BB 1X7WA 5B30A 4BINA 3VXKA 2OP4L 2W91A 3UTZB 2GD1O 3EASA 4JMPA 4PR0A 3FSGD 4HDIA 4QXVA 1ZK1A 5K69A 4Q2ZB 1ZI6A 4WO4D 1QX4A 1CDUA 4EKXA 2Q21A 3D51A 5KTYA 1J9EA 4HUTA 4QVGA 3H4HA 5L6LB 5GGUA 1VMDA 3Q43A 2XUAA 4ZS6C 3RFTA 2IU4A 1E2NA 2H7XA 2V3VA 2GSGA 2HVJA 1A47A 4NQZA 3EYQD 2B15A 1T2AA 1WPQA 1OF2B 3QR0A 4HZAA 4PWHA 2NTJA 2B82A 3AYXB 5KVSA 1GOTA 1P4GA 2A83B 1G7JA 5ALDA 3FG9A 4BQBA 2YVUA 2C3PA 5I26A 3N2KA 4WI0B 4BB5A 2ZBFA 3U3XA 4F85A 3GRZA 4KXZI 3WLAA 1IN8A 5IJ9B 1HXMA 4JRYE 4JFZL 4P7BA 4PBSA 1K3IA 5B3JA 4H0LC 1JVSA 3I2IA 1WDLA 3VXRD 2QNBA 3CZRA 2Q9CA 3OI7A 1A96A 3VMFA 1S3IA 2LE0A 2VWHA 5L7TA 5I6DA 4ZUUA 4JB9H 3R4DA 2XMPA 5F7XA 5EWMB 5ALIA 3IAS6 3QWAA 1KQFA 1YE3A 1BJRE 3Q87B 1SPBS 2I2WA 3U7QB 2WLKA 4YC2C 4DLSA 5T1JA 1T89C 5L3VA 1VSVA 3K72A 3ENNA 2XAAA 3WSTA 1I82A 2BM3A 4H7EA 3AT9A 2JJ2D 3Q9SA 2QQLL 5K1VA 1VHQA 5HHOE 1JHYA 4YSEA 4S1TA 1CLOH 2R29H 4IKEA 3ZYIA 5HYQA 1ORIA 3A3PA 4PWJA 3QNXA 4J3XA 3Q6NA 3GRRA 4R7NB 1PZFA 2X9GA 4L8DB 5FGCE 3MRNB 4CJ1A 1QANA 3G1TA 2ZJ5A 3PNLA 2GZAA 4MLZA 3IGLA 4WVLA 3EXHA 3OU7A 3VPAA 3WGZA 5EO1B 1MVFA 1KJ3H 3LEYL 2VNCA 2WWFA 3CZAA 1YEGH 1PNTA 4NKIL 4MIYA 4OUDA 4RMTA 4FTVB 4FNLL 1OVMA 3UT5B 4CR8A 3ZV6A 2EFYA 1G8PA 2C7VA 5AI8A 3KHUA 3MRRA 1QJCA 2EFEB 4FI3F 3TOXA 1OV8A 4XRCB 3RAPR 1CZHA 5DGXA 3DLBA 1J5DA 4BX0A 1OF0A 1RJLA 1ESNA 1BWRA 5ICZB 4K6CA 2K9UA 4MDIB 4GLFA 4KI1A 2YC2C 1ROWA 2DTDA 4YVNA 1WZ2A 4LV5B 5A0VA 2Z34A 3GGWB 2G5BA 5DOVA 1WVMA 2LV8A 1BVYF 4G1VA 3PPYA 3WFBL 1QLWA 2Y25A 3Q3CA 3HUFA 5JDSA 5AVVB 1F3DH 2I9TB 2BOBA 2ZRHA 4LXXA 1WB6A 3S3SA 4Y16A 4XC3H 2YNMC 4GF5A 3TEJA 4FQQA 4BDVB 5KNBH 3KYNB 1P0SE 2LHAA 4EL0A 3ZGZA 4PJDB 3BKYH 2XECA 4U2EA 1FYTD 4NECA 2DBYA 1ACYL 1LQSR 1G9MH 4UXIA 1BGXL 1P7KA 2E6KA 1BEEA 3BEWA 1NEZG 4JB8A 2REOA 2CLEB 4H1LH 3MTRA 1QSZA 4P0PB 2RI1A 3TLMA 3LKQB 3PCTA 5JYCA 5K9ZA 1LWHA 3KZVA 1IE4A 2CCKA 3ZMEA 3F46A 3VH8B 3N2EA 2R2CA 1ABEA 1BDHA 3MMEB 5EGSA 1BD2D 4LSQH 4J2HA 1WUNT 1BGXH 4FA8A 1XP5A 2Y1DA 4BTLA 3K7EA 4Z5XA 5BV7H 2ZYVX 1R3UA 4U1KA 4MRPA 4BFUA 3PKIA 4N12A 5DR5H 3MJ8B 1W94A 2PUCA 3VJKA 4LLYA 2YIMA 4N48A 1KEMH 2CLFB 2AZTA 1NOAA 1O5IA 4LTDA 1XDBA 1E60A 3B5TA 3TAXA 4Z3JA 4M8VA 4HDIB 3GRCA 1NCDL 2IQAA 1B4JH 5F7UA 2XOKD 4CNIB 2VDRB 5JCXA 4Z3EA 1WU7A 5DQ9B 5CB8A 5G3ZA 1QSED 4UT6L 4ZVTA 4QT4A 4MQMA 1NG9A 2NLJB 2O05A 5F1OB 1KXTA 5K8VA 4JM2D 5D7IA 2R15A 1IC0A 2F7QA 3FDFA 3GLIA 4FLHA 3S29A 4WO0A 5SWZB 3H9HA 2OGTA 1KARA 4KJPD 3N86A 4I3RH 3O45B 4X5WB 2FZCA 2PP9A 1GZ7A 1KJ2L 4LOIA 5AIBA 4I4LA 2DJMA 4AP9A 3IEAA 4R7ZA 5HGXA 1F4XH 3QNXB 1K5DA 4QU9A 2NUPA 4YIQA 1VG1A 3T7RA 2IANE 5EEVA 2CO4A 2GAJA 5CYFA 4DLBA 1P2SA 5KVGE 3CC1A 3IO5A 3VZSA 2CIIB 1YB5A 4KQMA 4PC6A 3UMTA 3U9SA 3L6DA 4UQPA 3MV9B 5TT0A 4KQ3L 1O94C 2CLKB 3H2GA 1LDNA 4MI3A 3U6XS 1UZLA 1GTSA 2NZYA 1EB9A 2H2GA 4L07A 1HZHH 4JUBA 1J09A 4AJ4A 3PENA 2VIIA 5IQ7H 1FVDB 2IXEA 3ZU6A 1E0AA 1KB5B 3UG3A 5C86A 4YMUA 3G2KA 2R1XB 4PNEA 5CNHA 4DIMA 2A9RA 4PG2C 3QPVA 1A9TA 3A26A 3LUHA 4CT4B 2FHBA 3E38A 3RJ9A 4YQXH 1KDRA 5DBFA 3R7NA 2VLRE 1LQBC 2RGDA 4LSRH 4E51A 2CV1A 2KLRA 4B4UA 3II1A 3HGTA 3BJZA 2ZIXA 1A8SA 2OLKA 5T3UA 2C57A 3MA7B 1ZC4A 1X1TA 2ZE8A 1Z7GA 4C89A 4M1KA 5AFSA 4WK6A 5KIAA 2P8MB 2BGJA 3I2HA 2DIAA 1N8OE 3OE1A 4P3XA 4YHBA 4CG2A 3IU3A 3VR2D 1UADA 3PYXA 3PAUA 3RVXC 5C0AD 4PJDA 4O58H 2CL0X 4S0ZA 2J1XA 1TUIA 3RHSA 1V10A 5ILGA 4CMIA 2P5EE 1I3OA 2FSVA 4P2BA 2WU0A 2ARWA 3IGFA 4LLWB 2YVKA 4IJ5A 5DMIL 4OGLA 5C1IA 3DTVA 5LLDA 4G9FB 1RIIA 2Y1OA 2FX3A 4RL4A 3WV5A 1AXSB 4KKVA 3RVBA 3UAYA 3X2EA 3RFVA 2W98A 4QSHA 3DI2B 1ED3A 4XYLA 1TU0A 6CHYA 3QWOB 1RK1A 2D1RA 3KZ1E 4ZZ3A 3E8VA 5AQ0A 3O03A 4YC7A 4I5EA 1Y8QA 1H6DA 1FCCA 3MLXH 4GG8A 4ZAKD 5F5NA 1C7IA 1BIIA 1T4KB 1OD7A 2IXQB 3ARZA 2W4MA 3KAJA 2CJFA 3ILQC 2CFCA 2QUAA 1SY6H 4PO1A 3BB1A 3A04A 2WILA 5HXAA 1TSRA 4C22A 1SXAA 1BS1A 2WTUA 3V4VA 4JFEB 4CNIA 1T5BA 1FDVA 3IGKA 3GPIA 1UD5A 3WDKA 1EU1A 1N0VC 2VJMA 1WVIA 4KMMA 2IIQA 4X99A 5BZWA 1MCWW 5P21A 4DSNA 1ISGA 3QQ3B 1IMHC 4H4EA 5K33A 2VH5L 4XX1G 4OIIL 4OQZA 2GFIA 3NPSC 1R6UA 2DBRA 1WJGA 3EJUA 3LLUA 3VFWA 2PD3A 3LBIA 4Z7NF 2YK1L 4A9AA 1H2HA 5IH7A 4C01A 4ZPVA 1DIRA 4UF7C 4EJ6A 3LRSB 1E1NA 1B1AA 2PCFB 1SG0A 2BTEA 3N43B 3F04A 3PHIA 1UA6L 1LRLA 3K4ZA 4M93B 4WZAA 4Y7MA 4YQXL 1XEXB 2QLFA 3T0AA 5AW9A 2XZDA 1I7ZA 4IBQA 1QHSA 4MP6A 2CIIA 3KOZA 3R1GH 2H3EA 4F7MA 1MREH 4BX9A 5F7YC 1JRHI 5HKKD 3AI7A 3DBOB 5AM2A 5D87A 5CJQH 3BP5B 1UAGA 4QXRA 1A7OH 1U6KA 1J0HA 1JQ3A 1RUPL 4PLPA 1UXJA 5IC5A 5JW6A 2WNHA 4MNQD 2QP9X 1KC1A 2ZREA 4I4CA 2IDFA 5B57C 5JADA 2KJQA 1HESA 4LIQH 1J22A 3AF5A 4II7A 1RM0A 2PS0A 5CG2A 2JJTA 4E1AA 4IU2B 5C0FA 5KYWA 2CCVA 1OBHA 2GCOA 1I1AC 3GMSA 1N7MH 1W2HA 2XY2A 4I85A 3R8QA 3DRTB 3E70C 3GCGA 4DC1A 4D44A 3K9WA 4PJCA 2GVZC 2Y71A 4AITA 5EEYA 3K8KA 1W0WB 3HZ3A 4P07A 3ZU2A 1Z15A 2E89A 2IQ5A 5KSVA 2R6FA 4L76A 1PY9A 3DTUB 1DC6A 2V54A 1USUA 2X44D 3V4UL 4LEOA 4BB9A 4XVUC 4GPVA 3RG1C 3HY4A 4MA3A 1YVEI 5DD0L 1HNYA 2FQEA 3TV8A 1VIYA 1IM3B 2E82A 4L74A 3QPDA 3O8OA 1JUFA 1WQ4A 3GGPA 4DANA 1FO0L 1KN4H 4Q1FA 4MXVF 3WHIA 1RBZA 1KYDA 3EPJA 3HMXH 2MR6A 3VRJB 3FGOA 4ILKA 3S7ZA 2H1XA 3WN5C 5JO5A 4U6NA 3QQ4B 2DBZA 3TECE 4OD1H 2VOEA 4IIHA 3B51X 1FIGL 2ITEA 3I12A 3QPCA 4U1LB 1ULTA 1T7WA 3KXLA 3BYZA 3TNLA 4TLBA 1BQ5A 2QPLA 2NU8B 2Z2JA 2UYYA 4MJ3A 1WIOA 1P7HL 3G0OA 1N19A 5K0FA 2VITB 3HI1A 1RLIA 3ZHCA 2VN4A 3QYAA 1J0YA 5ICMA 3HFMH 3HW7A 4I55A 4AUMA 4RX4A 1RYFA 2IYPA 3G5YB 4KVFA 3NGBC 3GSNB 1AZNA 3PP4H 4YJDA 3S3TA 5CEYA 5AVVA 3CSTA 2C4VA 4X8GA 3AESB 4S3MA 2ZSFA 1JXKA 1FH5H 4EE2A 2IPOA 3EBPA 1LSJA 4HU8A 1IGCL 1LPBB 4JYPA 3FROA 3LRTA 2GJAA 2E5WA 4F71A 1NN3A 2FSVC 1NCWH 4W93A 2FO4A 3EAKA 2VRQA 4M0KA 4ALAH 1KGWA 3KYBA 3A70A 4HISA 1HL7A 1UADC 4ZK6A 3O8QA 2HHLA 2YMXH 4EVQA 2YD2A 1AQKL 4PJBB 1OP9A 3S2AA 5ALLA 2VRBA 5HDBF 1UOPA 3NWPA 2Y7LA 2JFNA 1SDDA 4L4RA 4MZDA 4YHOL 3AH8A 3EVAA 1U6AH 4APQC 3QYNA 3GHYA 4JHAH 2G5UA 1JLSA 3WICA 3PWPE 3WJJA 2BGLA 4F58L 3CE1A 3IP5A 1K98A 3O0RH 1NNUA 3LA8A 1AXEA 2BWDA 2I2AA 2BDTA 3AFGA 1ZOLA 2Q6LA 1IIBA 4RGOH 4IGEA 4UT9A 4XMTA 2P5WE 2PNFA 4E9WA 1QQDA 2CLLB 5EJFA 1I5RA 2DOKA 4M6OL 4JFEA 1YGYA 1GA1A 4PJGE 1W1UA 1A9BA 4QOEA 2DQ6A 1OX6A 3FN3A 4LCUA 2WLYA 1CUAA 3N42F 1T4CA 4E68A 3W9BA 2ONKA 1Z29A 5D7IB 2X3BA 1TPXC 4G84A 1J9SA 1O94A 1Q1PA 3GI8L 3E3LA 3V8PA 3QY9A 6ADHA 2NQ2C 4JPWH 4BZ2L 3C1TA 1U80A 1OT1A 4IZHA 4AY0A 1IKFH 4ODHL 4DEPC 1EESA 4QGHA 3KPYA 3K6SB 4XDHA 1A9QA 4JT8A 1KCVH 1TYJA 5JIMA 4F45A 1UVQA 1KCSH 5IHZA 3V34A 1BAWA 5GGVH 2PUJA 4XX1A 5C2BH 3PXEA 4HBQA 1NRWA 3TZKA 2GB4A 2X1LA 1OB2A 3GVXA 2QBWA 3CLHA 3RPBA 5A04A 3Q2KA 3PQYA 2D8AA 2EIMB 1GW0A 2NTEA 3EAFA 1NPJA 4G82A 4OKNA 4RFNC 4JGBA 2AFIB 4RVOA 2XA8H 1YN7B 4M1ZA 5DNUA 3GDBA 3KSUA 2DR2A 1E5TA 1PTJA 5HZGA 3ESRA 2FSHA 4UTBL 1TEHA 4FJYA 2A0YA 3VFRA 2V98A 3NJRA 4UU7A 4IU2A 1MJFA 4IRZH 4HXAL 3UWPA 3LK7A 3J80A 1J0ZA 1V96A 4UARA 4M36A 3PL6C 3N59A 1M74A 3ZDZE 2CBQA 5FA5A 1JFQL 5IAAA 5C0BE 2O0JA 3K70C 1LWNA 3WHKA 1IRIA 4K9NA 5TDNA 4H0CA 4P2RE 2J3KA 3JD2A 2ET6A 3RVDA 5D55A 3LN5A 3GUYA 5FWRA 3Q6FB 4M89A 3OIWA 5FNVF 5B4TA 4M6MH 2A7BA 3E9RA 3S1SA 1W80A 1P75A 2ARJQ 2ZK7A 4XVQA 2NT1A 4BK8A 1DU4A 2GOYA 2B14A 1G6RH 4I7ZC 1GILA 1WSDA 3IDUA 3IAQA 2QADC 3JZFA 1MRFH 3ASUA 2V5UA 2YNMA 3MLWL 2V0AA 1JIQA 1H0SA 5EP2A 5DXJA 4KRLB 3C5ZB 1BZ7A 2NY2D 1RU3A 2GG1A 1KJMA 1WVGA 3E7XA 1HDGO 4AS3A 2PWEA 1RZIA 4GOJA 4O58L 4TVKA 1UPXA 2OBXA 4BZ1A 4IX1A 5FORA 4HDMB 4NPAA 3OLEA 3TV3H 3DXAD 4NJMB 4TV9F 4ZT1A 2ZXWB 2BELA 3ROOA 1UFUA 1G6RL 3QIWB 2H92A 2VE6B 3C48A 4MS3B 3A1SA 5ULLA 3HKBA 4L4ZA 5FNVB 2J3LA 3OKNA 5F98A 3N58A 2AGJL 2PR4H 2DJ4A 1OT2A 2X8JB 4ZYUA 5HK9A 5IW6A 3UZUA 1LGYA 2P7TA 1EVZA 1A4RA 2F1RA 2NRDA 4KE7A 3ORFA 5AYUL 4G1UC 4N1AA 4IEEA 2VDWA 3S5YA 2YW2A 4L2LA 3FBWA 3LNIA 2FZGA 5IKCB 1N2CE 2J85A 5ICXB 1NLDH 3L7AA 4MWFB 3HR7A 5FWXB 2PRSA 3V0VB 1U9JA 4ZVLA 3DO5A 4IGBC 4LHQB 3PYMA 4JA2A 2WWMC 2ILLA 5FUCE 2B4RO 2GYWA 4TVPE 2Y6SC 4IOJA 3D0VA 4Q0XH 8PAZA 3EEQA 2WUBL 4DREA 3BLBA 3DOEA 2WYOA 1L9MA 1AZTA 4LXQA 4V2BA 1BC5A 5I0DA 4PX5A 3DROB 5ETJA 5ITVA 4L18A 3MXWL 4ZP1A 1N5KA 3LP8A 5KNDA 3TT3H 2GJ6A 1DJNA 4RH1A 4WKPA 1ZL2A 3LWZA 1YHPA 3CMOH 1JI1A 1NWPA 2VP5A 3C85A 4OCWH 3UYRH 3MWLA 3HS0B 3RRQA 1CI5A 1EDYA 5CJOH 2NXWA 4LASL 4HG4J 2RGBA 2VIRA 4I0WB 1YS4A 3ARED 1DV2A 3CONA 5JW4M 4W9LC 1UWFA 5B1SA 4LCWD 3RU8H 2GCOB 3NGXA 1KIQB 4DF9A 3THML 1IM2A 4N0UB 4JFOB 1G7MA 4X8LA 3FCXA 4GIOA 1IE5A 1CCZA 1ZVHA 5DHAA 1NMBL 5E00A 3U2SB 2NVUA 2HCJB 2KW5A 1NBYA 1YQUA 3G59A 3CUSA 4A63A 1V8DA 4DEXA 1YDMA 3OOWA 1R27A 3W5DA 2CSUA 1ZT1A 2WXGA 3LF1A 1WRFA 2R66A 2AE1A 1EVYA 4F97A 4EZKA 1BVZA 1UH3A 1X1QA 1P81A 1UQUA 1F0NA 1PDKA 2WG1A 2PPLA 3O6LL 3U1SL 3BUYA 4IHJA 1NUGA 3U6XA 2QZPA 4Z3DA 2CPCA 2C2XA 4S2EA 2G83A 1P4LB 5FDWA 1V1JA 5CA0F 3WSVA 1Q9KB 2NX5D 1AJEA 3CT6A 3D2TA 3BAKA 5CBAA 4M7ZB 5E9DD 5AUMA 4B6EA 1VJDA 1LDPH 5DJ0B 3WGMA 1JJ7A 1QSVA 3ORHA 2O7SA 3TVTA 1GAFL 3ZI4A 3C3MA 3CZ5A 3UWMA 1SKMA 1MJGM 3V9PA 4QWWC 1MV8A 4OK6A 3TH4T 1DBIA 1M2JA 1K8DA 3R3ZA 1B73A 4GPD1 2JIXB 4WVRA 1DIOB 4KFRA 4F8TA 4MQXD 2EUVA 2YWCA 1JHKH 5LJIA 1UPUA 3OQIA 5AOLA 2UVQA 1R15A 1OAZH 4QDUA 5JU6A 1QGDA 1SCUA 3KVNA 3T4XA 5DMKA 4A7VA 3T5CA 1TJXA 2R0ZL 1ZT7A 3AWGA 2CEAA 1Y1PA 1LDBA 2R47A 2P2CA 1KQPA 1TETL 1ZHLB 2CXTA 1Z4PX 2X5XA 3Q6FA 1YQ9A 2FKAA 5AJUA 3DECA 3QUXD 4XNYL 4IKNA 3NVDA 4PCSA 1KJ9A 4U31A 1I9RL 3SK0A 4OCZA 1ZOSA 1Q77A 1N7JA 4LOUC 1DBKL 3WSWA 4KI5C 2WMYA 3S2YA 2F1OA 2UZXA 2YV3A 3BEDA 3I52A 3DURA 2JB6B 5JTWA 4PRIE 4NO0D 4WSKA 2O7VA 4TKVB 3EEBA 4YDJA 4DR1B 4H9GA 1OARL 5D3MA 4YMPA 1M6NA 3RIAF 4BP1A 2PXYA 3L7FB 3NRPA 4XASA 1TVDA 4HTFB 4Z9BA 4BQ6A 2BKLA 1C5CL 2NACA 3QQXA 3CS3A 4NR0A 4LPTA 1DCTA 5E8DH 4LHYA 2GJ6B 1IUPA 4K5LA 3ND8A 1QC5A 4WV1B 5D7SH 2GSIA 2Z31B 3GPSA 5B1JA 4N2BA 1CG9A 1BRMA 5ISMA 3AMKA 1EX0A 2NXJA 1YS9A 2HRZA 4MCIA 2CLZB 9ATCA 3A8TA 1A14L 3M7OA 5KSAC 3DONA 1G9NH 3EEOA 3MHZA 4B9FA 3IGAB 5IKPA 2IHKA 1JZDC 2P5SA 2WUEA 5AVWA 5G0TA 4AMUA 4IHAA 4WFGD 3GGDA 2QPAA 4X54A 3UA3A 3BSGA 1ZSDA 4CHTA 5KWJA 4JC5A 1LDEA 1QSFD 3C6XA 1DP0A 3ZI7A 4HIEB 1BZDA 3PC3A 3RIYA 4N1HB 5EN2B 2VHUA 4FLFA 5A3IC 1MB3A 2VISA 4UOW1 1CTNA 2IOMA 1D09A 1J5EB 1PIGA 2D31B 1T34A 5IV2A 4B74A 1Z4JA 3JWDL 1Q14A 2OORA 3STWA 3D4PA 4UQBA 4O00A 1NVXQ 4J1NA 5I73B 1X87A 2ZJ2A 3PYCA 1XDUA 1EJBA 3QH4A 1TJ3A 5L0QB 4Q7QA 4TUOA 4ZOBA 5AJHA 2IYVA 3EJSA 3A21A 5LIRA 1JTPA 4OM1H 3NWBA 4IS2A 3BWYA 2EUXA 3JQ8A 1KAHA 2N1TE 3SYAA 4KQ0A 1CRPA 1UT5A 1CUDA 1KYZA 5TS2A 3KT0A 4B6FA 3Q8AA 4BNXA 4NMLA 4WW1A 1LK7A 4G42B 4N6GA 1QX1A 2PQMA 3LMJH 2W9XA 4GXVH 1E50A 3A1EA 4NRZB 5DDIP 2W48A 2OMKA 2UUDK 1V8HA 5GV8A 4BZZA 3ROMA 1BJ8A 1W581 4L29A 2PWZA 3ZQJA 1MXGA 3U2SA 1ZGJA 4R1NA 5BPPA 1JEOA 3B2XA 2FKNA 4UTAH 4L85A 3FTCA 4V0SA 4PJ5D 1JDDA 4MBOA 4QPZA 2OS7A 3WY4A 3TWCL 4N68A 3WI9A 3T8MA 4MRMA 1DTEA 1GRRA 3N76A 1EO8L 1IXYA 1C29B 1B2WH 2G5TA 1SN7A 2K4WA 1JR3D 1NCHA 1Y5MA 1YI0A 4N8UA 4X8JA 3V1UA 4LBWA 4I36A 1S9WA 5JYLA 3VAYA 3AQYA 2A78A 4TMKA 3VTKA 5FCUL 4XGIA 4NZNA 4X6BB 3GRVA 2C8KA 3COZA 1SBYA 2HH0H 2DP4E 3DMTC 3D3EA 1DX9A 3LVFO 3L3OA 1Z4LA 5LBTA 4GLRH 3R9IA 1AF4A 4X6FB 1E7YA 1QI5A 1W4ZA 3X1YA 5J4HA 4JX9A 1WXFA 4QOSA 3TOVA 3NJIA 5FA3B 4PNPA 4I46A 3ZUGA 3TIEA 4D9QE 4JFYB 3JQBA 4PB9H 4NK4A 3K4PA 5C3IA 4ZIRB 4WFGE 4JGIA 1JNHB 1DAKA 1LEGA 3KLOA 1GOHA 1XB6A 1VJRA 2WPNA 4HUNB 3ZT7A 4KHZA 3QUTA 2FZ3B 2W2LA 1GKEA 3OH8A 2EYRA 3N8KA 5J1TB 5F72S 3G0DA 4DLWA 2ZP1A 3T1NA 3IWVA 4OZIF 2P75A 1NCAH 5IJVB 2RGEA 2IXGA 2W5UA 3B43A 3QBVA 1G7CA 2FR4B 3M6LA 4PV9B 3W0LB 2P68A 5J9PA 3COWA 5JWOA 3DGGB 3TG8A 2FGWL 1RZFH 1W1IA 4B35A 3F3HA 3I23A 2IT1A 1W8OA 1I7RA 4NDAA 1V16A 5KBNC 4Y89A 3D12B 1XIWD 2FWOB 1T5WB 4P5MA 1GFZA 3R9WA 5I6PA 2NPIA 4QUAA 3ZNPA 4TYWA 2GCGA 1V4NA 5J8OA 4XVHA 1T83C 5KJEA 2WJHA 3F6BX 3STLA 1IC7H 1CIJA 4OUUA 2DTSA 2WOYA 4HB0A 1XCWA 3EFHA 4H2CA 3PX2A 2BINA 3O92A 3NPMA 3ZKMC 1HOTA 4QSMA 4P2AA 2N7AA 3ADDA 3FT1A 4MB2A 5J4MA 2VYVD 4WEUD 1KEGL 4CA4A 4JWTA 3ZR6A 1NOFA 5LB4A 3BVNB 3Q88A 1WBXB 4H1LA 2OV0A 4X42A 4PBWD 3OZVA 5LIPA 1NDHA 1W8IA 3FVRA 3WJ7A 1AZUA 4WI9A 4LVUA 1G16A 5E00B 2DRUA 3CNLA 1CUYA 4RFVA 4YI5A 2R29L 2CBGA 4YFYA 4EN3C 1AQIA 5KX5B 3U7QA 3HCRA 1EXVA 1DN2A 1J00A 3CTPA 3O47A 4KK6C 1ONBA 4RHFA 3VI3A 3CSFA 3LKZA 3TB4A 4K5NA 3COJA 3QELA 5FIEA 3CMOL 3CVIH 1GGCL 4J0CA 4E9QA 2HA1A 5BVPH 2KSQA 4Y4KC 1V5FA 1P2UA 3QZWG 4PVNA 4Z0NA 1Z25A 2PS3A 4YV2A 4ITRC 3CW2A 4POYA 3NM6B 3V4PH 3Q6GL 4F7CB 2ZXBA 3WOHA 4QC2A 5A6LA 1YK1A 2IS4A 3B3FA 3JQOB 4GNKA 2SHKA 4EG7A 2AXHA 2I7SA 4XNMA 4NCXA 4TS9A 4LHUG 5SZIA 4G8GA 4XDYA 5DU7A 4YV7A 3FIUA 3EHBB 1UH4A 3WB2A 1O6VA 3KTAA 5AYUH 4ONEA 5L95A 3ITNA 3H2ZA 3BAWA 3QGVA 1AKJA 2B8JA 5T8KA 3KPTA 3VRJA 4BQQA 3SBDA 4WSJA 4QY8B 4K8RB 3R0QA 1WHTA 4WNAA 3RVUD 1G94A 1X6NA 1X5LA 4KKBC 1YPZE 5LG6A 2JHGA 1GZSA 4E5MA 1Y8RA 1YN6A 3BC9A 5ICZA 1DBWA 1CT9A 4AMYA 1KEEB 4XTCS 2VCYA 3IAM6 3AWIA 1J8KA 1TCAA 3E6HB 4XP6L 4Q03A 2ZSVA 3VFPA 5BWLA 2BIOA 3RIFK 5C7ZA 1UYWL 3MA0A 5AICA 3WGYA 1RAHA 2K4MA 3MPCA 2EERA 5G0SA 1TJIH 1JNYA 4UOW0 2VC2L 2JLWA 3S5LB 4NWIA 5IJVA 1RZ8A 5KVGH 2XNKA 2IZ7A 5L6YH 2AYYA 2CFTA 2IBSA 3GH1A 1T2XA 2UUBB 1P44A 1JGVL 2P47B 3TC9A 4XIYA 3AUYA 5H4HA 4C2TA 2GJZA 4KQ1A 2CDEB 3AOEA 3BH0A 2FMKA 1KDZA 3ABMB 1R3DA 4MQBA 3N42B 1MDTA 3VNSA 1MUUA 2OO7A 4KRGA 2GO7A 2P49B 3BF8A 4DMMA 1N6VA 4OQ1A 1NCDH 1VLMA 1ZHHA 1YEEL 3OIYA 1UBRS 4EF6A 4QDJA 5DHQA 1NAKH 1NUFA 1NGYA 2GFQA 2H5EA 4CVUA 5CFRA 1MAJA 3VQ1C 1NSFA 5L4JA 1T8TA 2NSHA 1NQXA 2UZ0A 2IPNA 3MO1A 3QIBD 3GSOA 3T08A 2XA3A 1FYVA 1DKLA 3ISTA 1E77A 3FHTA 4AJ0A 3I05A 2V5MA 1HRKA 3BGIA 1SXJD 3R20A 5I51A 2RGYA 4OCYH 4QXPA 2WN3A 3H8WA 4CLOB 4KHXH 4S1VA 3APCA 4XR9A 2NR6D 4J0GA 2AI0H 1FFEA 3SJZA 4AJ1A 4RIHA 3GMOB 1WLHA 3MJ8A 1YDWA 3ZTJG 4JPWL 1M3IA 5A5EA 3JR7A 1A9XB 3M86A 2F3TA 4H40A 1L7DA 4PWGA 4NFYA 1GV1A 2BRUC 3OXSA 4UXJA 1BMZA 4BE7B 2VL5B 4ETNA 1X9LA 1RJFA 3N2GA 3EZYA 4K3VA 5I8KH 4K7FB 4R97B 2F1BA 5EERA 1NBMA 3GROA 4MDYA 4PY7A 2UZIH 5JQ6H 4HV4A 2R69H 1JSXA 4CM6A 4IHKA 4DN6A 3DEZA 3A06A 1P5FA 1EAMA 2QRNA 3TZVA 4FHDA 1H8OA 5DYIA 1FGNH 3GHBL 2IRWA 2D4HA 4C6SA 1RI1A 2FRDA 3L4BC 3QBTB 5LXVA 1E2DA 4M0DA 4IIQA 4OUOA 5F8QC 4LDRA 1MCQA 4EB6A 4HHAA 5LVEA 4ZKEA 2XMCA 3B13B 1IVNA 2QMOA 2QMUA 3AR4A 1JPVA 4AH2B 1IBMB 4I48B 1XV8A 2WG0A 5LZ9A 4ZALA 4EENA 5KSBE 2VXOA 2XOEA 1TFUA 1UA7A 3CJQA 3SDDA 3OKOB 3B36A 1CS0B 3C24A 3WAJA 3FOMA 5DNCA 2I34A 4JG0L 1CIDA 2DY0A 1X9RA 3R77A 1KVRA 4TT3D 2UUPA 1ZVYA 1KN2L 4TKUA 4J0JA 2RC5A 2PMZA 1DZBA 5KPDA 1K4MA 3DHNA 1WZ1L 3RDTB 3IVCA 4PRBB 1MKYA 3WK5A 1PZBA 3FK3A 3MJ7B 4JY4A 3LSOB 2G77B 2HDOA 3PKJA 2R23B 1C30A 5BW6B 1KBKA 3AT8A 2R1WA 5DMGD 4EKJA 3DWIA 3FRHA 5K2MA 5GINE 1WDAA 4XLZA 1DBQA 1KO1A 5FR3A 3AB3A 5A6MA 4N6QA 3X11A 1OCRB 2NYZA 2X1MA 2Q3JA 3I85A 4LL9A 3CH8A 1H3NA 4TMTA 4X61A 2VZTA 1XMWA 1CC1S 1ZY9A 4XMVA 4G8IA 4NZUH 1ZVMA 3U4BL 4F56A 5IMOB 5CT9A 2YHIB 3D3VD 5LDGA 3U6BA 1RTKA 3WKDA 1Z3CA 5CXQA 2PFKA 3KUDA 2DLGA 1HFEL 3H4TA 3SZ6A 3AJ8A 4CKVX 1A7RH 1ZXBA 3WJ2A 3BZ5A 3MV7A 1BZ7B 1ZMYA 1KE1A 1K9TA 3CN2A 2V9CA 3MRRB 3KKOA 1ZVVA 1PW5A 1ECPA 5IEKA 3L40A 5GJSH 1RI4A 1AU9A 4X60A 4HVAA 4DHWA 5TDOB 3L08A 2X4UB 4GUPB 2X88A 1IAKB 3OQRA 5JUWA 4XPTL 3BP7B 2FYTA 5KS9B 4AKIA 4NERA 2Z9TA 4QHUB 4XCVA 2N3JA 4HQLA 1C0EA 4I1UA 2QX6A 1ZITA 2RBLA 1OOEA 5DC0A 2F7PA 1XZEA 3P3YA 3GMOA 1WBZA 3TLZA 4CR7A 1Y7LA 2DQEL 3DEIA 2D0DA 1E2UA 3BXHA 4BKQA 2WYUA 3CIQA 4COOA 1X92A 4IBYA 1ZANL 3PGFH 5B1EA 3FUFA 1NBVH 5IF9A 5K3EA 2VXYA 2A9QA 4MJIA 4YHPA 4C06A 4YROA 3NIBA 4HLDA 4M43L 2EKPA 3OURA 3GSVA 1OL0A 1EKXA 4WKZA 4NONA 2RCSH 4AT1A 3LKNA 1TZGH 4RH0A 1Q9LB 4JANA 2I9PA 4MHHG 4OZFG 3AL8B 1WC7A 4GH7B 1DCKA 4QXGL 3EYVA 4FF9A 3C60C 5SZKB 4UUOA 3OUTA 1AG6A 2EDRA 2MRYA 5EWMA 3QBTA 1TCRB 4BJ5A 2F48A 2I2CA 3NPSB 2XUOA 1XTRA 3ZGHA 4QUOA 1NGPH 1PR1A 3VH8G 4I0KA 4X7MA 3C08H 5E1BA 4FRWA 4OLEA 1HDMA 4KJQC 2NY1D 2WAXA 4NU5A 1UWCA 4DS3A 2V1XA 2H0RA 4H7JA 4RKEA 2RGSA 3FIJA 1Z7JA 1UEJA 3D52A 1JE1A 5CZXD 4UVIA 1Z7YA 4KNWA 1MT0A 1OFVA 1OROA 5KYGA 2J6BA 3PDHA 1YDPA 3ARDC 3B89A 1ZLYA 5K0NA 2IXTA 2VL5A 5C0FB 4X6YA 1K72A 1KGYE 2RAMA 4JKPH 1F12A 5IESL 3G7SA 5BSGA 5CLGA 4IOSD 1KSRA 4NQQA 1LO3H 1ULAA 5F7LB 1VKOA 3WHXA 2BKVA 1X2BA 3FN9A 1ZRMA 3LLSA 2NTSP 3V9AA 2SECE 4GP7A 3E7PA 3R6TA 4OL0A 5AOZA 4AVHA 3TGLA 5EVCA 1XCTB 1Z6TA 2NYUA 2XGJA 2Z57A 3GVIA 4JM2A 1YQVL 3BFJA 4E13A 1VBNA 4AD8A 1VTKA 5F77A 3QSYA 2LIPA 3V7UA 8OHMA 2H0QA 4BHUA 3W6ZA 3G6JE 4QULA 4A8JC 3MN8A 1VPWA 4PJFA 4ZUVA 1KKLA 3DAOA 4MDHA 4OHYA 1MPTA 5HM6A 1H93A 4ODXB 2IALB 1BO6A 3MWEB 3IEKA 2JJSA 3UG7A 3HJNA 2OD7A 1TEFA 2O14A 4EHHA 4FLRA 1YCSA 4IRSB 4UQ2A 7PAZA 4OI7A 1R4AA 1OFGA 2D7QA 4RK7A 5DW0A 3L9BA 4WXRA 4JZNA 1HL8A 4F8PA 2A4EA 3EARA 2C8VA 4HUCA 2NGRA 4Z95H 4FMKA 1G8MA 3KKQA 1VZIA 4PS4H 4HFMA 3VFPB 1BXRB 3VSEA 4GMTH 3CPEA 3Q2IA 4MRVA 3D4NA 1HQRB 4KXWA 1JIKA 1N2CB 4U5XA 4MVJE 5AK6A 4J2TA 1H4QA 3T9WA 1E4EA 3FB6B 1Z33A 3K15A 5HYJD 1SC9A 3TCXA 3G5YA 3HG1D 3HIZA 1HXKA 2DTXA 3IWUA 4YDKL 2F9FA 4JR9L 4UUBA 4BMYA 3QDJE 3BSFA 4BFBD 3REVB 1U90A 3W6OA 1KK0A 3HRKA 3CFEA 4PHCA 3CLEH 4AV0A 3AKDA 1FVEB 2MSEB 4DT1A 2WSSD 4R9SA 4TKVA 4I87A 4KJYA 2NO1A 3ISJA 3FU9A 2VNIA 4QJ4B 2R0WL 2G1KA 3UT6A 4DLVA 4U3HA 4AJ2A 1DFBL 3BGOS 2BZCA 4ZV7A 5HHME 4JA0A 3F7QA 4YSAA 2ESVD 1UUSA 1QA9A 3QOWA 1FUIA 1E6EA 3H42L 1JHKL 5IWCA 4B9KC 1KB5L 3T9CA 3QVGA 4GRMB 4OIAA 3AVEA 2GF0A 3DULA 1XXFC 3WSQL 3VMPA 4UU1A 3KBOA 4HH0A 1G1KA 3KPOA 5BRZA 3BGFC 2BEUB 5L4FA 4DLLA 1P8AA 3SE9L 1KCSL 2EX4A 1VJSA 1WITA 3F7NA 3FKQA 2HFEA 3O8XD 3KGUA 4UE6A 3QXAA 3NBXX 5JZOA 3RCBA 2XN9A 2E7DA 4BDTA 5L7XH 2H65A 1CWUA 3CIOA 4D7PA 4ZN6A 1LILA 1YDPB 4C5AA 4BNLA 4AUKA 3VPDA 3RUPA 5CCKL 5JIHA 3OTQA 3A0UA 2LRHA 2IOYA 3F96A 4D74A 1X6LA 5ECDA 4F3TA 3AETB 4E9XA 1L4UA 2H9GA 3GLFB 5KKAA 2DIEA 1YR6A 4G59C 3VYOA 5C07B 5E95B 3OV6A 3ZE6A 1P73A 3T1HB 2VL4A 1INEL 1OTSC 4P8QA 1NM9A 3IP8A 2I4IA 1PSKL 2C8NA 4FYXA 1PP4A 1O97C 1Z5WA 2C4WA 3LKRA 5AKIA 3TAHA 2WLSA 2VDMB 1INDH 4HF5L 4XXCA 2FJUB 2QM7A 1CICC 1M7IB 4G4SO 5BUPA 3W79A 3AJRA 3CHXA 3SC3A 2QJDA 3AEUA 2JGNA 1YMHA 3CVUA 1E2JA 2V7XA 2OZKA 3H2JA 2BFDA 4B5KA 2E7MA 1CR0A 5FBQB 1TCUA 1O7VA 3BMWA 4MD4A 4L23A 5A9RA 1BKYA 1MFCL 5CLIA 2SKEA 1GNSA 1CT8B 4XQ9A 1ZSVA 3PWTA 4CW1B 3O2QB 3QQNA 4NRZA 4NQCA 4AW7A 2QSCH 4DVRL 1V3TA 3VD9A 3PUUA 1IQRA 2EZ8A 2J6EA 5FYJD 5IHUH 2RKOA 2W71A 2VDPH 1L5OA 2EH8L 4M8KA 4L4TA 4ALAC 4NMHA 2GUWA 4QRRE 4FWBA 1SJEA 2PYFA 3Q2WA 3F8SA 1H6TA 3FUXA 4YJ2F 4HXAH 4QU8A 2HV8A 4NN5B 2HJFB 1GGYA 5KSBB 1M34A 3E1F1 4HFWB 3MAWA 4KKBD 5D96B 4MRMB 4OT1H 3BIJA 3ZW8A 3RIAK 1U3CA 4OCRH 2AITA 2VO8A 2PSHA 4HRAA 4G43B 3PUWA 3GEFA 1X3LA 5JCOC 4F3RA 2CFRA 3WB9A 1JNLL 5HPYB 1PKQE 1DVFB 4A2DA 4ONHB 2WZBA 4YUAA 3MLXL 3E1ZA 1B2WL 1GL9B 1U28A 3Q5YA 2A2ZA 5KNCD 2ONYA 1LTKA 1YASA 4S05A 1IN5A 2B3TA 1C80A 2Z3VA 4BCDA 4EO4A 2PX8A 2GJRA 2WQ7A 2JFVA 1VHJA 1QIKA 1E3EA 1YEHL 4ZWNA 4ER7A 4DG5A 1FUKA 2AK1H 4KHPB 4JVWA 4OV6F 3PXDA 3JQEA 2OV3A 3VHQA 1C1DB 5CXSA 1XAGA 2D1SA 2D03H 1L5MA 3IE0A 2ITDB 1ODIA 2G2RB 3CF4A 1U1GA 2PR9A 4ZYKA 5KSBF 2VWPA 5DSTA 3FFCE 2GM4A 4CIAA 3DVGB 1OGIA 4RZCB 5IROD 2OO5C 2C4KA 5FFGA 4RENA 4MJJA 1NXWA 1QHYA 1CBUA 1ETHA 4YUEH 4YMLA 5J4LA 1BYOA 2XIQA 5EPUA 1WD5A 3WDMA 1QU3A 3TKAA 3BFVA 1JHRA 1XH3B 3UXYA 1QO3A 5BS0A 4ZZ2A 2H1SA 2YN2A 3FOFC 3GJTA 1ORSB 4C2AA 2R56L 4IFTA 1F2VA 1IBSA 4F3FB 2VHJA 4ZOLF 2FEJA 3PQDA 4KO8A 4C2UA 2YAQA 3T12A 4Z86A 1OCWL 2W2QA 3A2LA 2PUBA 2WIMA 1AKYA 3HM2A 3IETA 3OHMB 2HRPH 4X4YA 2GHQA 1R1CA 1FYTE 2YPLB 4F8NA 4XPIB 3KLQA 2V37A 1NU6A 2XXMB 4XMXA 2A74A 3FT2A 3EKCA 3DK0A 4O4YL 1EPUA 5B6IA 5D6NA 4BC0A 5KN5A 4EJ1C 3FNQA 3NSYA 4Y2DC 4AWBA 4KQ3H 2WLZA 5CAEA 1HCZA 1TL7C 3LXRA 3BH6A 3L4YA 3B5IA 4ON9A 1I4TD 1YA8A 2POCA 4HPOL 4H59A 4RZ3A 4K23H 5F7FA 1EFCA 4OQYA 4A8JB 3GO1H 1IB6A 1WM1A 4RTOA 3WMEA 3NYRA 1SXQA 2JKWA 3I3DA 5IW8A 4YP6A 1EVIA 4MA3B 1U7OA 1Z7WA 4L50A 4IWNA 4I8DA 2VDNB 1T4CB 4PO9A 4AYSA 1FUUA 4MOWA 3DV6A 3GGSA 4ZQKA 3T99A 1L5QA 4OQPA 2DEUA 3ZKWA 5EOCH 3P0VL 5JVDA 1VM6A 5KX5A 3QI7A 5CCJA 3L8ZA 4K23L 4HWEL 3W38A 2C9VA 1KFEB 1ODFA 4H8VA 4TQUS 2H45A 4DO6A 4GMDA 4FG4A 1PAUA 1GGMA 3P19A 3N8GA 4X4XA 2CHNA 5L8VA 3KCPB 5IVZA 4K2UL 4Z77A 2ZOKB 4MDEA 4R84A 2LWIA 4M0PA 1NVEA 1YMMA 3ILHA 3HK2A 4IIJB 1Y7VA 4WOKA 3MJ9H 4XRCA 4F6LA 4JGNA 1LTHR 4IKIA 4YLBA 5G02A 1B9ZA 5DB4A 3MJSA 1SXGA 3PDOB 4NYIQ 4G5GA 3QP9A 4DKFH 2QVGA 4B73A 1B0PA 4L5FE 2XUZA 2HO4A 4EJMA 4C14A 1RIHH 2ZWZA 4R5VA 4A2MA 3BIXA 1IFXA 1L5VA 2ZT6A 2R5FA 5T5FL 3SY0B 1ZOIA 3SPXA 1EUQA 4N8VA 4JUIA 2UU9B 2Y7MA 5ANME 1JBEA 3WBFA 2BW4A 2I9TA 2ZRKA 2F00A 1BBJA 4CM3A 4EHBA 3KB1A 5SYMA 3FHQA 3MTXA 4B0OA 1BG1A 5I75B 2QI9C 2J44A 4CETA 2CO6A 2OSWA 4XNBA 3L8GA 4IDEA 3W8EA 5A2LH 3DMRA 2NY6D 1X80A 1OK0A 4FFWD 3GRWL 4CFSA 4PSCA 2B5OA 2JK0A 1XHLA 2B6HA 1USKA 4PIMA 3PXJA 1OZUA 3RZCC 3D3KA 2FJGB 4ZQBA 4ZUSB 4KROC 3GP5A 4OLZL 1YJ5A 4M7LT 1HZKA 3ZDRA 1E67A 4NZZA 3WNQA 1Z0AA 4N28A 4QUGA 1M2KA 3U40A 4GFXA 5CCXA 3A4FA 2A9FA 1SKBA 4NMMA 5IM7A 3AYZB 4PTLA 1JHTB 1RWNA 1NDMB 2EDJA 1KMCA 3FNBA 4KVZA 4G8CA 4G25A 4B44A 1I3RB 4GMTL 1EDZA 4G80B 3DTVB 1HH6B 2X05A 2LNDA 2UY7B 1B0UA 2OHGA 2ZWVA 3F47A 4DPKA 4XMKL 4POAA 5KVEL 5I0ZA 1Q6YA 2PKYX 1JDSA 3L6OO 1CLZL 3MO1B 1IAQA 5I9LA 3KEGA 3KPOB 1QOZA 3E7WA 1PZDA 1XFDA 5B2ZA 1OI7A 1ID2A 5KVFL 1NAKL 2HDNB 3N28A 1P9MC 1YRQA 4O2BA 2GVNA 3NRJA 5TF4A 4I18C 2W9DH 2EIEA 2JCSA 1VYVA 3T1VA 2BVPA 4RTKA 4BX8A 3PE6A 2BXZA 1JYXA 2XR1A 2A9KA 5L6YL 1QIEA 4I6GA 2ID5A 1SQFA 3BQVA 2P90A 4N20A 4C6HA 1H3GA 3BJRA 1Z2NX 3U1BA 3ZTTA 2I9KA 2NNCA 2OP1A 4JELA 1N8NA 2HF8A 3DMNA 4LCBA 1RPKA 2MKLC 3TW4A 5K93A 5DQDL 2QL9A 5JW3H 2TRHA 4AEIH 1BVRA 4BO9A 3NU1A 5IFKA 4NLLA 1SG9A 3FWZA 1OX5A 2CGEA 5KAQG 4PJGB 2UYLB 2OAEA 4QATA 4PZUA 4XZ4A 3SHSA 3LB6C 2FG7C 3WMGA 1P6FA 2C4FU 4NFLA 2BGWA 4Z78B 4YVUA 2EC9T 4EUHA 3P73A 3BQUA 4KAJA 1OBOA 3SBWC 5FUZH 1XDTT 4UAOB 3QW9A 3R4VA 1T66D 2PEYA 5CVCA 2JKXA 3HFRA 2ERYA 5ARBA 3MUHL 1H5BB 4N9WA 1MHTA 2I4RA 3S36X 2PZ8A 5A2JH 4M2LA 3NA9L 2BW0A 2LV4A 1CSEE 1JZ3A 4B9GA 2ROYA 2A5LA 1K8RA 3EFOB 3OCVA 1GTZA 3V2HA 3X1MA 3WIFA 3OLQA 1JLKA 3VVCA 4HKTA 1F06A 1MZVA 4HJ0C 1AO7E 3OPZH 5BJTA 3B1ZA 1AY1L 4XP5L 2A6KA 3RUFA 1E2KA 3GMRB 4KOAA 2IOHA 1VFNA 1QAOA 3ZKAA 2EICA 2ZKIA 5BNXD 4E41D 2C5DC 3X17A 3E7JA 1CY0A 1JAHA 5DK3A 4FERA 5BUSA 3ZQXA 4IYKA 1DG9A 3WKCA 2JKLA 4GQBA 5B7GA 4PGAA 2AOWA 3EPKA 3SJVE 3TZVC 4QDTA 3C5ZA 2XV1A 4RLSA 4NNPL 5GONB 3V4SA 2P8LA 3W57A 4EI9A 4RD4A 1ZC3A 4OFXA 5LKAA 5DUBA 4HS3A 1AD0A 4FJ2A 3BW9B 5HHQA 1W9MA 3MRDA 1TQHA 3WLBB 3BAEH 2YAFA 4GKLA 3OA2A 1RK1B 3VJRA 2AI0L 1GAQA 4BELD 1N8TA 5IM7B 2BGIA 4IS3A 2DLFH 1N0HA 1I24A 3FWHA 4RA6B 3C1UA 5A9TA 3GJFK 2XB4A 4MA0A 2IHBA 2QVYX 1RI5A 4CTMA 2QS9A 4H8UA 2HWKA 3DE6X 3IQGX 2WKLA 4ARUA 2UUDH 5IEKB 2FB4H 5F6HJ 5BN1A 3QWRA 4Y4HA 1GC1H 3P30L 3DUFA 3TZLA 3RGVA 2YAPA 2R8OA 2NSDA 4LJYA 3LWDA 3FJTA 3U83A 1TQTA 2BSED 4TSCL 3Q8KA 1Z28A 4AJVA 5C8YF 3ZTNL 1LUAA 4Q4HB 3AWDA 4ELKB 4BE4A 3RG2A 4XN1A 3D9AH 4LOEA 1H6BA 3FMPB 3LYUA 2P26A 1T9KA 1LEGB 3GLZA 2W93A 1AGFA 2QFRA 4FPXA 3F9CA 3MRGA 3VSQA 3QO0B 4PBXA 2P5WA 2O9JA 3TL3A 1AH1A 4E70A 2VT0A 3CFJA 4AC9A 1R1DA 4A8HA 3TPZA 4ZI7A 2XWJA 3NUGA 4YSSA 4EUSA 4ADSG 3EHDA 1ORHA 1JFFB 4NS4A 2CCGA 4RC9A 4UBIA 4F3YA 5LG1A 1X7YB 4DETA 4YMTA 1XF4A 2H0PA 1Z6QA 1FXWA 1XGTB 4LSVL 4P33A 4GEKA 4NQED 1FFOB 2WOOA 2OMBA 3FFDA 4TUJA 4P4TA 2FNAA 5IG7A 3E2HB 2VIRB 3KPVA 4PYKA 4RFOH 2DWDB 1SVCP 1BMTA 3W3AA 4R71A 2PX2A 5CUSH 1B16A 1JFVA 2X7XA 3BP4A 5GPRA 1MPXA 2YHGA 2Y72A 1ZLSL 4PJ5A 4M99A 4RMNA 3GJ0A 2VDKH 4D96A 4M6NL 5D5PA 3S35L 5E03A 1CDYA 4HKBB 2C83A 1KC5H 4LARH 1RHUA 1QZ3A 2BWQA 3ENZA 2H7CA 1CTOA 3X2SA 5ELMA 2MCG1 5B1YA 1JPTL 2CFIA 1BV8A 1NC1A 5I1IL 4HK0B 1MNUH 4RXTA 2WVAA 2BVQB 3TTXA 4P5EA 3TEZA 4JO8A 2EZTA 1B3BA 4YV1A 2EADA 3AY0A 5FI3A 3MDJA 1QHEA 4OHZA 4AV5A 3B9VA 1ZHOA 1IHXA 1GNVA 5DEGB 4B80A 2EXWD 3SYOA 4XEHA 4HT3B 3HN6A 221PA 1AB5A 1KIRB 3UWSA 2RONA 1CR9L 4L0ZA 4F1KA 3ZEAA 2CLMB 3HNOA 2GBFA 3OBIA 3BKCH 3ZTWA 1N34B 2X0KA 4GUAA 4TWZA 3O4FA 5FW8A 3BAZA 5FV4A 1IV8A 1JWMB 3E8SA 3GXBA 4DQVA 1IBYA 2EUZA 3CDCA 2XYGA 1YEJH 5CEXB 3O2VH 3CBGA 3W56A 1F2DA 3UO8B 5KTRA 4L1BA 4HQKA 4MYDA 4P5TA 1NFDA 3RKSA 4H7PA 1T5SA 1ZCJA 3VI3F 4D41A 3VJLA 3SVLA 4DR5B 4OGWA 5FK9B 4JLMA 4FABL 3T3MF 4PFEA 5HD8D 1KGJA 5GZ6A 4W9NA 1PYOA 4YR6B 4XMPL 2C4MA 3O4RA 3RG8A 3W1ZA 5HS6A 3V4OA 3HS0C 2IL1A 4LLMB 1DE4B 3DUFB 1JAEA 2VPWA 4JU9A 1WUKS 1S9XA 3JS5A 3AU0A 4M43H 1K06A 1Z3RA 1L5SA 2BT4A 3L3GA 1F58H 3O3EA 4G8EA 2H47C 5FF6B 5IZ7A 4JFDB 3ATBA 4PRKA 1CDEA 2IHUA 5LNK1 1EBBA 1E7SA 5FO1A 1S46A 3W0WA 3PUKA 4AX4A 4I88A 3NKLA 1A6ZA 4L5FH 1JEEA 2X15A 4U8HA 1N12A 1CE8A 4FQ2H 4XOEA 1US8A 3SJAA 5CD3A 4DBVO 1ACCA 3QO0A 2IDUA 5HG0A 2FJGA 3NFRA 2WUCL 2Q3DA 4OQDA 3DOSB 3F3KA 3ZJ5A 2F6RA 1GFIA 1Y8CA 4QEDA 1SOVA 3DDUA 4IMJB 3IQDB 2WABA 4DHEA 1OW3B 2APBA 4JUSA 4UTRA 5D7LE 1VSCA 4FXGC 1XMVA 1ST2A 1S9DA 1E4KC 4G80A 4HQFA 1VXRA 4PS7A 3VBEA 1AHIA 1WULS 3UMBA 3DC7A 1KTRL 5GRUH 4D0BA 4JXKA 1OGAB 2HX7A 2X2PA 1G1AA 3T6WA 3MJCA 1FQ9C 2ZE5A 1MJUH 1IATA 3UL4A 3UCFA 2DQFA 4W6YB 3NAZA 1V71A 1SLVA 3HB9A 2XTJC 1KY6A 2ITFA 3QE0A 1UDAA 5C6WH 3M3PA 3FO0H 5DTRA 5CDYA 4I1NB 2BMFA 4N22A 4J9VA 5EN2A 1LF0A 2UWEF 4DK5A 2RI6A 2A0WA 3IFLL 3NRFA 3EGVA 4P4KC 5HF9A 4PJEB 4O3MA 2D31A 3LZDA 5AHRA 4WW0A 1G7JB 1KJ3L 3LEYH 3NT2A 5D2LA 3SAJA 1P2VA 2YC4C 2NTNA 2W88A 3NV9A 1JPNA 2J7LA 4XMLH 2PRKA 3BUTA 4QUHA 1K0FA 4NO3A 2E0PA 5E95A 4KBPA 5EWJB 3GPEA 1JFSA 1TECE 3AETA 3F9RA 1SKAA 1OE2A 1T1YB 2FWOA 2IOFA 3UZQA 1HZZA 2F3QA 2X0WA 3PA6A 2VRCD 1RRVA 4F33A 3NA4A 1TD1A 3PIQB 4ICWA 5G0UA 3DI3B 1I75A 2BFOA 5TT1A 3IA2A 1EUUA 2VOJA 2Z2ZA 3I75A 3GMLB 1AKVA 1MB4A 3VR3A 4K8OA 4N25A 3N3BC 3QFCA 5JAPA 4GNRA 1EPFA 4KKNA 2WA2A 3BWBA