1TYEB

Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
440
structure length
440
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-IIb
publication title Structural basis for allostery in integrins and binding to fibrinogen-mimetic therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 115
structure length 440
sequence length 440
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 1tyeB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 1tyeB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1tyeB03
1JEQB 1LFAA 2XGGA 1NA5A 5LN1A 4O3UB 4HQNA 3HXOA 4NENB 3EFOB 4CN9A 1M1XA 5KYUB 5KYYB 1DZIA 4K3JB 3IJEB 1XDGA 3E2MA 4C2AA 4F1KA 4M76B 4UM9D 1DGQA 2VDKB 4C2BA 3EGXB 1JEYA 4CN8A 3K71A 1L5GB 2XWBF 1BHQ1 2WW8A 5KYWB 1ATZA 3K6SB 3FCUB 1SHYB 2VDPB 1QC5A 3PPVA 1T6BY 3BN3A 1FNSA 3IBSA 5E6RB 4CNBA 3PPYA 3ZDXB 2IUEA 3EGDA 3M6FA 3T3MB 1Q0PA 4HQOA 5E6UA 4IHKA 1M10A 1M2VA 3TCXB 5KYNA 4O3TB 4MMYB 1XUOA 2ADFA 3OKWA 1ZOPA 3OL2A 3PPXA 1MQ8B 3HXQA 3T3PB 4G1MB 1SSLA 3EOBI 2VDNB 1U8CA 1SQ0A 2I6SA 3FCSA 2ODPA 4IXDA 2NUPB 4O02A 3AL8B 3EG9A 4WK2B 1MHPA 3TW0A 1M2OA 3V4VB 3K72B 1L5GA 3VI3B 1MQAA 2QTVA 3HI6A 5KYXB 4MMXB 2XWJI 2VC2B 1IJKA 3EH2A 1TYEB 2UZYB 3ZE2B 3EOAI 3OKYB 4NEHB 3Q3GE 1JV2B 1T0PA 3NVQA 1AOXA 2NVOA 3ZE0B 1JLMA 3PPWA 4A0QA 1QCYA 4C29A 3BQNB 1UEXC 5E6SB 4IGIA 1MQ9A 4MMYA 4Z7NB 3NIGB 3VI4B 2NUTB 4G1EA 2X5NA 4Z7QB 1AO3A 3N2NA 4JDUA 1JEQA 1M1XB 4NENA 2VDRB 3EFOA 1N9ZA 5KYUA 1YUKA 5HGJA 1CQPA 1BHO1 5KYYA 3BQMB 3IJEA 3NIDB 2O7NA 1OAKA 1U0OC 1YVPA 1JEYB 1AUQA 4MMZB 3K71B 4FWWA 3K72A 3EGXA 4DMUB 1ZONA 1RS0A 2WINI 2VDQB 1QC5B 3F78A 1YVRA 5KYWA 3ZDYB 1RRKA 3TVYA 3K6SA 2I6QA 2VDMB 4HQFA 2ODQA 2VDOB 1SHUX 4UM8B 4HQLA 3RAGA 2M32A 3AFCA 3EGDB 4XW2A 5E6RA 1IDN1 5E6UB 4GZ8A 3ZE1B 2VDLB 1RTKA 1M2VB 1M1UA 4WK4B 3TXAA 4JX0A 4FX5A 2I91A 3OL2B 1XDDA 1PD0A 4WK0B 1V7PC 1PT6A 4Z7OB 3GXBA 4UM9B 1PCXA 1ZOOA 1U8CB 3ZQKA 1IJBA 3FCSB 4G1MA 3F74A 5HDBB 4O02B 3EG9B 1U0NA 2NUPA 3AL8A 3NIFB 4MMZA 4F1JA 2B2XA 4WFQA 3EH1A 2ICAA 1IDOA 4HQKA 3QA3E 5KYXA 1CK4A 1OLZA 4MMXA 1PD1A 1RD4A 3V4PB 5HJ2A 4WJKB 1MF7A 2P28A 4PN7A 1JV2A 5BV8A 4BJ3A 1FE8A 5ES4B 3AL9A 1MJNA 4G1EB 5E6SA 3ZDZB 1SHTX 2P26A 1N3YA 2NUTA
chains in the Genus database with same CATH superfamily
3KQOA 1HS6A 2O2XA 4PR0A 2AK4E 4DZRA 4L4VE 4DSZA 3Q44A 1N5IA 3ZK9A 1OWNA 1O87A 4YRPA 1K4YA 4I48B 4CM4A 4WBXC 3THMH 4PVLA 3QG6B 4APQC 3OPNA 4LKCA 1E2DA 2JFBA 3K6KA 4WFEE 5L3QA 4S0TD 3E2HB 3SDCC 1KC1A 3W1ZA 3CFNA 3Q2NA 5BQPA 4P83A 4RHTA 2NNLD 1BHGA 5CSZB 2VFAA 3S35L 2BIIA 5SWZA 2J8UA 1JV2B 4O9HH 2BI8A 3EO0A 4GXTA 1B42A 2YGPA 1VE6A 1ZL2A 4X60A 2X4GA 1ECLA 3DVNB 5LBSL 2VG8A 2Z6UA 2DM7A 2VYFA 1CD8A 1MCPH 4TNWK 4AP5A 3C6LB 4TMYA 1JXKA 4FMBB 3KEMA 2WT9A 4KMOA 1NPUA 2LU5A 1F3DJ 4BO5A 3Q41A 5FKJA 1OHZA 3S2EA 1K7FB 5DNVA 2QTLA 4O4IA 3U60B 1VIDA 2OG1A 3OX2A 3OZXA 5FBKA 2AI0L 3DEHA 4DYVA 3UAGA 4DPBX 4EMSA 4EITA 3ITNA 4EPYA 4OHCA 4YMGA 5CS7A 3L8EA 1A4XA 2XE8A 2CF6A 2J4FA 1QFJA 2AV1B 4LXYA 2YWRA 3KYJB 5PAZA 1MIMH 5GSRB 4LF9B 5AW5B 1BF8A 2I7XA 3E15A 3NYWA 5C9KA 1BFVL 1V35A 2GPTA 3DF7A 1AXSA 5NULA 4NQED 1U7ZA 3FYUA 3SYQA 4G97A 1ZUNA 2I22A 3ZE1F 4E9WA 1NP3A 3LDUA 4DLYA 2VK4A 3RTLA 2Q6WB 2CK3D 1BVKA 3QZLA 5IBUG 4G2AA 1N26A 2H26A 1BPVA 4KR0A 4FE9A 2D00A 2D5LA 1SBSH 1CDDA 2WZ0A 1E2IA 4ZEOA 4BSVB 3V97A 4ZU6X 4LVHB 5U4XA 1PEAA 5F7UA 4B40A 4EHBA 2X42A 5D7KD 5FPYA 3GN2A 5DUBB 3LFHA 3RNQA 1IGIL 1KELL 3JTTA 2JLVA 2GASA 1NGZB 1D9KC 4Z2YA 2Q49A 3MOQA 1G8GA 1LO2L 4P81A 5EL0A 1G3RA 1P7YA 1DBML 4NRXA 4UUMA 1VADB 3HVDA 5LA6B 1PG7X 5KDLA 4EZBA 1KYQA 2K4MA 5I8CB 1GRCA 5DMGD 1L5VA 1MVYA 3L6FB 4GOMD 3PD1A 3D4YA 1LK5A 4H26B 1FLRL 5D1XB 5FA4A 3VXRE 2D31B 3MXVL 4F37K 4U3CA 3KLHD 5DNYB 2R11A 1N5DA 4KOBA 3QX8A 4PPTA 4XQ9A 2OO5C 2PL1A 1Q1GA 1SB9A 2OMTA 2OXHB 5CU7A 4YJFB 3VI4E 4YJ2B 2NY3C 4I13B 3BWVA 4X20B 3EW9A 4NAMA 2QPUA 2WLIB 3GWJA 3UAJA 3TQIA 3K20A 4R1UA 1GS6X 3X1XA 2DIAA 4QXVA 1VPEA 3B2EA 3EH3B 4QG7A 4D81A 4H1WA 3ARXA 5HIAA 2Q46A 3MWJA 4EI7A 3VDCA 1CD0A 2YPLB 4F7EA 2OBNA 3NEEA 2J88L 1KGUA 4E6EA 1A5TA 3D0VA 4AIXA 1NPYA 1ORWA 1RAIA 2Z93A 2EHDA 5SX4H 1YRHA 3FCOA 2ZJ8A 3P0YH 3TSCA 1ZHFA 4QAMB 1A72A 3IULA 2M1XA 2XZAL 3DMHA 4X9FA 1PQZB 3MRLA 2W6ZA 2YQ3A 1G8HA 2PU5A 3T7RA 2RKBA 5BR1A 4CDHA 5I1DA 1H8SA 1N6HA 4U7KA 3W5DA 2PMKA 4C6HA 5E24E 2FBRA 1G0XA 4J3OH 2XJKA 4CADA 3TQRA 1GN8A 3ZWQA 2ZW9A 2Y0CA 4LZZA 4AVHA 3GT7A 2BC4B 3KU1A 1G63A 5AM1A 3ZHVA 4AJ4A 5L4JA 4KIFA 5AI6A 1LBSA 3WIIH 1MEJA 4MA8H 4HUJA 2A6DA 5CFPA 5FGCB 4C87A 3IMTA 1TQ8A 3RYMA 1RUML 3FMOB 2YMMA 2P90A 1KKMA 5IBTL 3D1VA 2YQ5A 4ZOQI 1GG9A 1G7IB 1FE8A 3H1PA 2AOXA 3KB6A 4S0ZA 1DQQB 4Q74A 4IMPA 2X7JA 4L29B 1ZN2A 2CXTA 1O96A 2BZCA 5KU7A 1BQ3A 3TQSA 5ANMB 1LP9E 1E5QA 1Y7HA 2I78A 4CTMA 1AGEA 1H0RA 4BVAA 1MLDA 1OTUD 3CLHA 1A4BA 5FM8A 2PTTA 4C22A 1RWVA 4M0FA 3BW9A 4D8PA 5GHWL 4MXDA 1N64L 5DC4B 3T12A 3TFQA 1ES0B 2QVMA 3C41J 5GGSA 2OEPA 4GLJA 5IRCD 1KDJA 3PHBE 4OGQC 1YBVA 3UFIA 1CWUA 4APXA 2RK6A 2IYAA 1RV6X 1UWXK 1XLUA 1HDXA 3N2GA 2XX3A 1IOWA 5KN5A 3QKWA 4O58L 5D4QA 3S96B 2BMKA 4F3FB 2VABB 1QMUA 2Z2XA 2NSMA 4Y6QA 4UQOA 3T5MA 3C3WA 5I15H 2FCAA 1LTQA 3QX7A 1UWXH 1FYTE 3N74A 3WWDA 4ZCIA 1RH8A 2BW0A 4XYLA 1NBZA 3RZWA 1FXUA 1Z4JA 1NASA 4IZ6A 3R9WA 3ZQKA 3ZX5A 1IGFL 3QF4A 1IT9L 4R2MA 4XQCA 2XZPA 3F6JA 2XZDA 1DTSA 5HI3D 2F1IA 5FWAA 5CCXA 4IRZH 2JQZA 4K8RD 4KN5A 4RMWA 3QQ3B 3V2UA 3LKPA 1UACH 4GRDA 2JGNA 1YE5A 2HJHA 1U8LA 2I8CA 3HXLA 2CXKA 3L3OC 5EJ8A 1D7AA 1HNZB 3R1IA 1EWRA 5DD0H 3WTUA 2I71A 2ED9A 5B3JF 5E2BA 1L5ZA 2WIKA 2PQMA 4K9RA 3UGQA 2J3EA 1O08A 5HGDA 3PEUA 3LQ2A 4MQFA 5LQBH 1Z2EA 1Z47A 2I32A 4KH1A 1IB6A 3BEVA 2DD8H 3UHPA 1NFRA 3KLSA 4JRYA 3SDSA 2H0PA 4L57A 4F2MB 2VBFA 5MEOA 4JREC 1UVQA 4ALAL 3ABOB 1WWBX 1EJOL 4GLRI 4BDSA 2FX7L 2Z9CA 5FXCH 1XIWD 2BIOA 3VXTA 5KJEA 5KNDA 4XWOC 4X7BA 5GVRA 2NPOA 5I0XA 1ZWLA 1LL1A 1JEOA 2UZXA 1K9TA 4KFTA 3HWSA 2F9FA 1CFJA 4LSUH 5JH7B 3K09C 1NVDA 2YYYA 3CWGA 4JRWA 1F06A 3VU1A 3PHHA 3H53A 1AN0A 2EDHA 3DO7B 3E9UA 2W6OA 5DBOA 4X1KB 3SHWA 3ND6A 1IE4A 5L9DL 5C3MA 3IURA 2NY4B 5KTOA 4UT9L 2FR8C 4O2AF 2PWEA 2WU8A 6LDHA 1N7MH 3F74A 4JHBA 4YHYB 2IYNA 1PPIA 3ORHA 4RHYA 2HKIA 4FE3A 2VN3A 2E7LC 2DU8A 3R4CA 3A9RA 3BJLA 1XNRB 3FK3A 4W4OA 2CJYA 2WIAA 1JHKH 1V95A 1P9MA 3W5MA 2H4FA 2D3JA 3ILEA 4BZ2L 1BFOA 1NHGA 1KK3A 3LHPL 1D5MA 3ZVVA 3EF3A 3IX7A 3C5SA 2I4OA 4M8SA 4XCNA 2NY1C 1E0OB 4LXGA 1DMRA 4UDUB 5E8EB 5BYBA 1P9NA 3N1FC 8ATCA 3FB5A 4IMKC 3OC5A 4IHJA 4EZEA 2O2DA 5DURD 5B38B 4QTHA 2W90A 2Y8EA 5HYEA 4HK4A 4KN9S 2O7SA 2V5YA 4AMUA 1CB7A 3EG5A 5BJTA 3OCXA 3AC0A 4JFQB 1YEKL 4GAGH 3KPQA 2CN1A 4KI1A 4A2EA 2R47A 2YD6A 5AK3A 4V0MA 1UD2A 4XPAH 4ZVPA 4NKIH 1IZJA 2C5BA 5HW0A 4DG5A 4EFLA 4HS8L 1JAXA 4HUWA 3HMXA 1IEVA 3E9YA 4MAYB 2CCGA 5EBWA 5JW3L 4BWUA 1YZZA 2ZB2A 4WENB 4P2QE 1I6WA 3CSTA 2CKMA 4GOKA 4KHPB 2VDMH 3TJMA 1WDWB 4YCSA 5ADPH 3NK4A 2WYOA 3WIFB 3CB4A 4IUCS 3OMNB 4O02B 3VGAB 2NVWA 1DUYB 1E8XA 1OWLA 1OPRA 5K0TA 3EDFA 4YGAB 2FOXA 2ICAA 3DJTA 3B5JA 4FIDA 1GCUA 5G40A 1OXBB 4I9WD 4AUMA 2BFVL 1EUCA 1WUTA 2QRGA 2V4MA 4FL4B 2VDOH 1JHUA 2WKOF 4PRHD 3AS1A 1EM6A 2QUKA 3I2KA 2WA1A 1UBUS 4JIMA 1ZDQA 4PJAF 4OCLC 2EDLA 1Y1RA 2PETA 2RHBA 1JGLH 5DRWB 3PRJA 1IC7H 4M7JL 4EG5A 1I9RL 5BNFA 4FDTA 2IV2X 5BMVA 3G08B 4PXSA 5KDDA 1MDAA 1A6ZB 3IJYB 3AY7A 1OVZA 4A7SA 2BDUA 1ISJA 4N2EA 3TZVB 1X5YA 1Z74A 4ONHA 5HI4D 1SWVA 3CXHK 3FL7A 1TMKA 2H2WA 1IK4A 5GISH 3OLZA 5LR6A 5D1ZB 4BP8A 4A0RA 3RGGA 3U1PA 5DM4A 4QF1B 1F17A 1A71A 1P29A 2X9VA 4AW7A 2BVPA 2WIFA 4NRZA 4GBXA 1KC5L 2EACA 1U0RA 2WVHA 5IQ7H 4RA6B 1KMCA 3AESA 4PJ7E 4OU4A 3DDOA 4IKNA 5BNIA 2MHAB 5TDOB 1CJUC 1JLSA 2C4VA 5I9QC 4ZOBA 3RKDD 3U39A 5JUWA 1LZKA 3RZCD 3NU1A 5L3SB 5HNKA 4WLUA 4B8WA 4EENA 5I18H 2HRGA 4OLEA 5F0PB 3Q1SL 4YO8A 5EHZA 1DBQA 2R48A 3I5UA 3Q7JA 4E5XB 2F19H 1OW0C 2NYYC 4U00A 1YH3A 1I94B 4LCJA 2WV9A 1ZANL 4CM8A 3HFGA 3OQIB 4HL6A 4K2UH 1UA3A 4DUXA 4OB6A 3BSZH 3PE6A 3TNMB 5EU3A 4TS9A 4KO7A 1UJ4A 5AW0B 4GLOA 3P9CA 1X7QB 4M4RB 1RAEA 5D5ME 3FFTA 4PG8A 4RHCA 2IY7A 3FCCA 4MQLA 3E8XA 3UJAA 1RDFA 4MUNA 1GJUA 5ENVA 2HT6A 3CCBA 4JJAA 4KODA 2XUZA 1E5BA 3IPAA 4L1LA 4BNGA 5A7GA 4GO8A 4XWTA 2V98A 4FBGA 2G75B 1XFDA 3STLB 4H8VA 1PX8A 1A2QA 5FA3B 1A8JH 4UPEA 4CMAA 4EUNA 3K05A 4K0RA 4JH0A 1OT3A 2KC0A 1JHOA 5BSHA 1U3HC 3K16A 5DTRA 2BNRE 2YIDA 2WTXA 4D25A 1NJ8A 3Q8KA 3T3MF 3KR0A 1F45A 2P35A 5ECGA 3O1HB 2AK4B 3RUGA 5JXJA 3VZQA 4XLTA 4EF3A 5C0IB 5D85A 1SQFA 5EPOA 3GRWA 5AW4A 4S1SL 1AKUA 4ZQHA 2QX8A 3W2DL 2IC2A 4DIDA 1YSCA 1YR1A 1SQMA 3GPDG 2VYCA 1J8QA 1H2HA 2PUCA 1HILA 3CW8X 3OPYA 2QN1A 4CIAA 3NCCB 2C2XA 3SE0A 1Y7LA 2HWZL 5A2LH 1MFNA 1KY6A 2QQGA 1R6DA 2UY7A 4OZIA 4TQHA 1ASPA 5ESQA 2DWEB 3H9HB 5DS8B 3FW6A 3G6WA 2W4IA 1G2QA 3GV0A 3H0TB 5K59F 1RYZA 1SXPA 1EMDA 3ZQJA 3M8OH 3HB3C 4U6HB 3D52A 4KHZA 3CRVA 4D3ZA 3HFML 4TNVK 1HHGB 4APQD 2D5IA 3L02A 5TE7L 5E6IA 4BFKA 4W8HA 2B1GA 1T1XA 3GAFA 3GJ3A 5CJQL 3I9OA 2XWPA 5JW6A 4K28A 1U9YA 5EIQA 3OKEA 2JATA 3REVB 4FXGC 4MCAA 2VDWB 4GAJL 4RIHA 3CZPA 3W9EB 4IDBA 5LKAA 4G09A 2KB0A 1F9EA 5T57A 2EWVA 2IOFA 3B60A 4XC1H 3CDYA 4WWKB 1V11A 2NP6A 3QFGA 2NMVA 5K8JB 1FVCB 2NUBA 3ETLA 4KNYA 3V1TC 2FSFA 2PPVA 4AUUA 1X3DA 2BVTA 4G5FA 4R1MA 4K9EL 4A5SA 3M88A 3T9DA 4MA0A 5E56A 2VCEA 2W80C 1WHTA 1PIGA 4GI5A 1L9RA 2ZNWA 1K6QL 4NYLA 5K0ZA 4NT6B 1SCUB 2XB2A 1VPDA 1GTMA 1NWCA 1P44A 2AXEA 2ORYA 3LN4A 4BYHA 1REIA 3RKSA 5IHXA 5BMFH 3I9GH 2J5QA 2UWEB 2WP3O 1SF3A 2ZB3A 4QZVA 1UBEA 3SPXA 3P9PA 2FSHA 2HG5A 3QVXA 5K9JH 2C1PA 1VJ1A 4AZ3B 3TZCA 3HFFA 1F2UA 3L4SO 4OX9Y 3V0VB 3DIFA 3ZLJA 2P52A 1EV2E 3BZUA 1U0QA 4FFRA 1NI3A 4EMUA 3MRRB 3L7EB 2ODAA 2I8AA 4CM9D 5A6LA 2UUOA 1ZUWA 5IVXE 4XXCA 4RFOL 3RAEC 3NOOA 4HJEA 4ZTBA 1UCFA 1X19A 3WTTA 4E46A 1H8EA 2RGBA 5C0GA 3C5HA 5DO8A 4X4YA 3PQ6A 4BBWA 3DOSA 3RS4A 2DMCA 1I4LD 1NM5A 3U7QB 1C7RA 1YNKL 2OG2A 4Q9DA 1SVLA 4B7AA 5AOCA 4MYDA 2YD4A 3IPEA 3TSAA 2HJWA 5A1TA 3VXRB 2E4TA 4J0HA 1T5SA 3L4UA 4ND3A 2W83A 2J3SA 1XZKA 3RTBA 4S2EA 3LQZA 1SXJC 2VLRA 5BWLA 1X1SA 1XCJA 1XLWA 3NBYC 1I2CA 1ZESA 3VGBA 1T4CA 2BHUA 2J55A 4GRIA 5D7IB 1LX6A 4UVDA 4OQDA 2Y07L 4TLLB 4Z4FA 4D7BA 4PVCA 5FO8B 1A3RH 1YR6A 4FZ8H 1YU6A 3WQRA 3V4PB 1MKFA 3EBHA 5ISZE 2QA5A 3MJSA 3CCCA 4GFXA 3FHOA 1WISA 4Z9KB 2JCCA 4Q16A 1BVHA 5DHYA 4CMHB 2GHTA 1S1MA 5CFOA 2YFYA 1U92A 3TNYA 1PFCA 1ZXKA 2IYFA 2EDKA 3K1TA 5CDFE 3CVHH 4D94A 1A1NB 2I9PA 3AHGA 1O97C 4HJ0D 4FGZA 4MKRA 1DSFL 4NCAA 2N42A 1OLSA 4QRRE 1LLCA 2ONCA 1NHWA 4OQXA 2NY3D 1BWSA 1PZ5B 4AV4A 3PNYA 4PRPD 2Y7NA 1O4VA 1V43A 2V59A 3D2UB 1XZGA 3KD2A 2OL3B 1ZG3A 4YSAA 1K6EA 1IGJA 1SN7A 3QPVA 2HJVA 4KV5E 2Z0BA 4MIEA 3L1GA 2QSJA 3IPRA 2QM7A 1OI7A 4GIPD 1Z5NA 4Y5YC 3IXAA 5D70L 3MWKA 2OP4H 3TJRA 4N6RA 1UJ3B 4XOIA 4XBGA 2HLDA 5CVTA 5KZMB 1BQRA 2ZF8A 1M1YB 2YXNA 2R69L 1PNCA 1XBDA 1T22B 2C1OA 1XD8A 2C5LA 5BVPH 1PV2A 2WJVA 4KRMB 5E9JA 3MUGA 4YECA 5C1PA 4C55A 3RP1A 4WY7H 2PBRA 3AWFA 1V2GA 2FJGB 2CNLA 4PC1A 4P23B 1KV7A 5LDUA 3A2NA 1H22A 3S99A 5C97A 5DHAA 3WVNA 4HQQL 3H42L 2J2ZA 3FO1A 4DDTA 1YRYE 2UZYA 4PREB 1N2IA 1VFNA 4LLDA 5JZ9A 5T3ZD 3Q05A 4EFMA 1EGVB 2P4SA 4RKRA 4EL0A 2EEBA 3RSCA 2QBWA 2Q5BA 4LQ1A 5EZLA 3VDXA 4XVCA 2WVVA 3PJSA 3GQBA 2ERJC 3ZZNA 2GUYA 4F4HA 3NFNB 1PGQA 3DVLA 1RZJL 1PZBA 3QRGH 2O5RA 1IAMA 1TAQA 3F8TA 2HRRA 3FTGA 2DQJL 1J0IA 1OLOA 4OFQA 1YJDL 5E8OB 4QWWA 3PC7A 4OV5A 2H4HA 1N0HA 4HWOA 2JV6A 5KOIA 2EX4A 1AN9A 1KDIA 4M1OA 4W81A 2MFNA 2OP1A 3HJUA 5IC4A 3TTVA 1JFSA 3R7BA 5F73A 4AQ1C 3V4ZA 4DEXA 3FWYA 3BLKA 3CO0S 1FYTB 1OBHA 4ZO9A 3NJRA 5H8DA 3ZDQA 3N2NA 3NUQA 2AQ3A 3GPIA 2QL7A 5DR5L 1YN7A 4K26A 4C03A 3QUGA 5KG9A 2AXPA 1QLFA 1PR9A 3QFSA 5TFSH 1M3JA 2A59A 4D44A 3EVGA 1JZGA 4FOTA 5I0VA 1HORA 2VTVA 1QQ5A 4GRLB 4UNNA 2FMFA 1WHPA 5JSZB 4L8GA 2DI9A 1NCJA 4OLXL 4XMTA 1TJIH 4QHLA 1OI4A 3TG8A 4A10A 4Z99A 1CPYA 1YN6A 12E8H 4TTVA 2DJ4A 4ZW6A 1A8HA 1KAMA 1Y1PA 2G9HB 4P2AA 2OSLB 4GH7B 3S6CA 3V4RA 1H4TA 4PYHA 4MGYR 1N77A 3WO3B 4G5GA 3R8XA 5DUMH 4C2BA 2W9DH 4C5AA 5AB9A 1QPBA 5LP6F 4OGYL 3E6FA 1I8MB 3KPSE 5DHPA 2B4CL 3O6LH 4X6CB 2JH8A 4QDKA 4PRAA 3HS0C 3DCYA 3EGDA 3I84A 4JFDA 2BWJA 2OOSA 2Q1XA 5HA5A 3SN6A 4N65A 3DRTB 2O4CA 2EQAA 3CUUA 1M1NA 4XVTL 4IIQB 3LKQB 3BDYL 1I1FB 2CCLA 4R7LA 4LT7A 3RVXC 3HRIA 4NI5A 3BM5A 4YR6A 1X7HA 3AXLB 1DBAH 1NCWH 5K09A 3B6JA 1SDDB 2C4WA 1PUJA 3ZHBA 1A7NL 4S24A 4K15A 3DROB 5E03A 4MNGA 2IDFA 3BFKA 4DYDA 2V7TA 1XFPA 1N6NA 1GFIA 2CJSA 3SC6A 1UYWH 3VXMA 2MSCB 4ZO7A 3GW8A 2O5XH 2K8MA 3NGLA 4QPCA 5LDGA 2GZSA 3QVAA 1F56A 3VR4A 4DAGL 3D7MA 2CDEA 1JS4A 1OR8A 3F83A 2GSMB 1YEDB 4FJYA 2QTHA 1YSOA 3VXUB 4UBKA 4ANUA 3Q8MA 2EERA 1M7IB 5DTQA 4Q9AA 4FXKA 4EPRA 3T0EC 2NUPA 1GZ5A 4UMSA 3LY6A 2P3LA 3QHPA 2RAMA 1H9CA 1ESZA 5GZ1A 3GMMB 1H9BA 2CMHA 4XN4A 3S68A 3ECBB 1XRJA 1SGWA 1TF4A 3ABLB 1LE9B 1H15B 5L8KB 2V7WA 1GKEA 3DV4A 1LPAB 3NO4A 3PLNA 4GAAA 2OHIA 5I8KL 5ALXA 2WPDA 1RMYA 1KEZA 2P24B 4OZHB 2JIPA 1JE1A 1EHCA 3O8DA 2HF7A 2N0SA 2GBVA 4Z23A 1DWPA 2YV1A 3UAVA 5LXGH 3EYUH 3WMPA 3WJLA 4CSZA 3EVFA 3W5JA 2IVZA 4UDTA 4JG1L 5CBAA 5JCJA 5AAMC 3R41A 1MI5A 4XNMB 2CKBL 5FW8A 4GKJB 3MRHB 4YRDA 4HAOA 2VQ1A 3MNZB 2NY1D 1EP1B 1XH1A 1WIOA 3D6MA 3E9DA 1CFQA 1J8MF 2IH4A 3WIAA 2HP4A 4CU8A 4S10A 4DZTA 2PKDA 1J9CT 4HGWA 3WXMA 1A8PA 4C29A 4QECA 3D8NA 1NBQA 2NPFA 1T0MB 4II3A 4XARA 4A15A 1V7QA 5FL3A 1K86A 2HN7A 1HH9B 2QE7D 4RE6A 2XAUA 3V6ZB 3SIRA 3V8QA 3KCNA 2AN9A 1KMIY 4JMLA 1WBBA 4M0DA 5DRZA 5GJVC 3V0JA 3LQQA 3CKLA 4ZOLA 3CZUB 4NNPH 4UFPA 4D0CB 4J94A 3X11B 3BXXA 2ZIWB 4E15A 2WJJA 2VM4A 5AG8A 2EKPA 4W9NA 3AMLA 4Q24A 2YLHA 4TMFA 2ZTHA 4F84A 1WL8A 2AB0A 3VYNA 3IKMB 1SQ2N 3MRBB 3Q6NA 4EVIA 3PIRA 1PZUB 4RF5A 3KR3L 3IJEB 3TAXA 4Y6RA 4X1YB 4LSTH 4NDAA 1Q6ZA 4U6VL 2IH9A 3B82A 3BHBA 5DUPL 1AKJD 1QHFA 4ZEMA 2VZOA 3OQ3B 4NOJA 4RCZA 5ADUS 4C4PA 5EBLA 4O4HF 1P9LA 4PJ7B 3QBEA 1NNUA 4IBOA 3ZXXA 3CZ5A 3EB9A 2PGNA 3EQ2A 3I6ZA 1J88A 3QI9C 1VFUA 5DI3A 3K72B 2QROA 1M7BA 4YK4C 3SQMA 4O00A 3TLGA 3USZA 4GSRA 2OZ4A 1QH8A 1O57A 2VLKD 1FCCA 3D0LA 4UJ5A 5E9WA 4P5EA 4F5ZA 3ON5A 2I07B 2PSFA 5JIQA 3ILDA 3WYRA 5HGAA 1B2LA 4AX4A 3L43A 2FK7A 3KUDA 1QLEB 3IBFA 3V6FB 1VL6A 4IEFA 4FJZA 2I3AA 3E53A 3KG5A 4EAEA 4M3HA 2G7MC 4W9LC 3UTTD 4BNKA 4NO3B 1WCIA 2NNFA 3BZFA 4GI7A 3PAUA 4NNYA 4GW1A 2E4XA 3WN5C 1P45A 4CSSA 1MQSA 4ODUA 1XMVA 3GJFA 1OIXA 3C3EA 3C48A 3I9MA 2A6JA 2ADOA 1JNYA 3X1KA 3MNFA 1WZEA 3GFRA 2EXWC 1WBYB 2TSAA 2PQ0A 4LJAA 4PIPA 4ODHH 5IJ0A 4ZQKA 1O7DE 3JVIA 3AITA 3KKOA 3KWFA 5JANA 3O6ML 4ESVA 3IAXA 2KHZA 1X5JA 1UEJA 4GG6A 1C0PA 2YQZA 3P2EA 4IUBS 4Q12A 2I7OA 2BNRB 3ER6A 3ZPXA 2X5XA 1HDYA 3DP9A 4EIZC 3GGWA 4G6JH 4HUUB 1HQCA 3PDJA 4ARZA 4YDQA 4M0LA 4AJ0A 2GUWA 2VDVE 3NZHL 1Z6QA 4JRXA 4I6JA 5A7HA 1DTEA 5H16A 2CJXA 2DPKA 5EC2A 1KIQB 2ZBQA 1MT3A 5I74B 5AW7A 3F8UB 1LB1B 3PNBA 4OXXA 2H0AA 4AEHL 3FB4A 3COVA 4GKZB 4MB3A 4PS7A 5A4DA 3IMVA 2G6TA 3B9BA 5C0FB 1L3IA 5LGYA 2ZUCA 1EZUA 3L05A 5T4EA 1YEEH 4XCEB 4L50A 3GMNA 4YHKL 5JARA 1OWPA 3FB6A 4IVQA 5FTKA 1JRLA 4L3CA 1HT1E 2OCXA 1SM3L 4F8NA 5EUBA 3ZHKA 3DURA 2ON6A 2Q3BA 3A1EA 4F71A 3DLIA 1WFTA 1A9BA 2DQIL 5F1NA 3O8XA 3ZZLA 1UWYA 1TQDA 2NT3A 4AV0A 1J0BA 2F61A 3APFA 4JI3B 2WBJC 1SAYA 2D06A 3MRKB 2RI6A 3PDHA 2Y4OA 3R06B 4KY1L 1XCMA 1QRDA 2XPGA 3OCCA 5I24A 4RK6A 1VRCA 4RMIA 2OXIA 4B71A 4QOSA 5L4SA 3ARBB 5D6CB 1EHKB 5KW9L 4TSFA 2WOJA 4KXZI 3LOUA 5ALEA 5A9SA 3BDAA 2BFWA 3BO8B 3V4VL 1KIAA 4HOZA 1GG2A 4WI8A 3IRUA 2R6ZA 5CIPH 1KEMH 4A9AA 2O0KA 1AGCB 2C03A 1HL4A 3T77B 1Q7RA 3F62A 3F4LA 4FQQB 3WFEL 4P58A 4F3RA 1V3KA 3UJTL 3W1VA 1JNLL 2C3VB 2RHDA 4PPQA 4KY2A 5FCUH 4WI1A 4QSHA 2NW3A 3SOBH 1V3VA 3KCWA 3VXSE 2Q3LA 3BWUF 4TTTS 1YVLA 1H8LA 3GJ4A 5CXQA 4AQ7A 4U7FA 1UP7A 3L7FB 3ILVA 1TIBA 1JL8A 1K3UB 2YHIB 1JHAA 4OFYD 1PD0A 1U8QA 1F2VA 3FGPA 1JJBA 5E5RB 4Z1PA 4HGZA 3CHPA 4CC0A 3OY7A 2A33A 1Q9KB 1K5PA 3UCEA 3CRRA 1LO3L 3WY4A 3WFHA 3RDTA 1PJ3A 2AZTA 3K0AA 1YO6A 1PNDA 3GDCA 1UA7A 2WY2D 5IVXB 4YXKL 1XCXA 5G4OA 5HDBE 2GBPA 2QQ5A 3GJ0A 4NPYA 1J1OL 2L7QA 1HNYA 4NUJA 4OI1A 2YHBA 4K5MA 5IR1A 1T9AA 2Q8AL 4PLVA 3RG2A 4L2LA 5HJGA 4OK3A 4LJLA 5DRNA 2PL3A 3RK1A 2WC1A 4I3HA 1BCIA 1FJHA 4XWGL 1NGPL 1Z6PA 5LBGA 2V2XB 1A7QL 4JFEA 4I9HA 4D4GA 2XWJI 4IDCA 3GDGA 1N4XL 1YCSA 3FBTA 5A43C 2BC9A 4TKMA 5EIAA 4EGAA 2GCNA 4WO0A 2X0JA 3I30X 2MCMA 3F7VB 3HG1E 3AB8A 2B1RA 5JHAA 5K8CA 4MHHG 5LNK1 1UPUA 2VH5L 2NTYC 4N6GA 3S2FA 5AAWA 1T3SA 4L37B 5ISZB 5ED4A 1KTRL 5T1MB 2Q0SA 1VB5A 3GJEA 1Q9OB 1RZKH 1RZFL 3IAM6 4QBFA 4BMVA 4Q0XL 2Q4OA 2KLSA 3NVAA 4FMCB 3VXKA 2O5VA 3JD3A 4D80A 4JS0A 3T9WA 2G2RB 4GMHA 1R3LA 1HTYA 2SODB 3TE6A 4EJ1C 3TS8A 4QRRB 1ZC4A 5EULV 3VMFA 3HUJE 4RLSA 1P1IA 3K1AA 1MIEH 4TMZA 3ELAT 4YSCA 3L84A 3RPIA 4UATA 4H4CA 4KL8S 1JQ5A 5GGUA 3VDAA 5IB2A 4J2OA 4G0WA 3O11A 2GRAA 5ICZA 2FZ5A 2W98A 2PFSA 1I36A 7TAAA 1Z06A 3EA4A 3PEWA 1USZA 1LBQA 5AOAA 1WF6A 3ZH2A 4HEA1 1KO4A 3Q98A 2AN5A 4D9HA 5CJ2A 2CHXA 3MRQB 2VS1A 3FZNA 2X3AA 2WJ3A 3IJ8A 4HB2A 2PWPA 4NZFA 2Y1ZA 3LKBA 5CA0A 1JYWA 3R18A 5EKSA 4FAAB 2XQJA 4TULH 3HMKA 3UYRL 5K9KB 1KI7A 2EH8H 3FJOA 5C2JB 1YS4A 1PG7H 4H0CA 5LQJA 1XCTB 1L9TA 2YMXH 3G5VA 4K3DH 1TDQA 1N2EA 3F7KA 5MEPA 1RVV1 1UOPA 3K2QA 3NAQA 4R71A 2C7FA 4Y2XA 3MGGA 1VDGA 2R0LL 2VHTA 1FL5A 3D39D 1J05B 4G43A 5HZMA 4ZI7A 1OK0A 3DI3B 1PSDA 4XE0A 3FNKA 1UANA 4X98B 3OXSA 2CBOA 2OQVA 2ZSBA 1HQRB 1GZ7A 2EAUA 3PK0A 1SN0A 4M9XA 2GWHA 5KYXA 4I89A 1TPYA 4JO2L 1EXUA 1LO5B 3O6FB 5ICFA 5HHTA 5AHRA 5HM8A 3AL0C 3SK0A 4RAUB 3CKKA 1LD9B 2G80A 1DKNA 3L7LA 1VPWA 4CETA 2CFOA 4ZYXA 1N9GB 3WLAA 1P4BL 1FI8C 2I6TA 5IT0A 3L4CA 4IR7A 2UZ0A 4RNCA 2Z5VA 5K6AC 3LRLA 3QUKA 1ODCA 2GEDA 1EWVA 4XP1H 4ZS6C 3TEWA 1ECZA 4IHKA 4GM1A 1E6EA 1SOMA 4G80A 4MVJP 4BCXA 2J3IA 3CBKB 2ZVPX 2MIZA 1YTUA 1G9NC 2RQEA 1V39A 4FQXA 4EDXA 4JQZA 2K7PA 2PLNA 4HMCA 1FG2B 1A9RA 4TPRH 5FD8A 1OYYA 4D3SA 2A9RA 1XEXA 3LVFO 2OCIA 2IOQA 2OTWB 3T06B 3VBEA 2DLEA 4P4KA 3Q43A 1VSTA 3IJRA 1CP2A 3H9QA 2WICA 2X9NA 4MKHA 2ZVDA 1SYVA 4JO1L 4JL6A 1D6EA 3VQ2C 3ZEAA 5DRXB 3SQBB 4XMKH 1C9DB 4M93C 1CUJA 3QVVA 1ZMXA 2DT5A 4GRWH 5K0CA 1B6TA 4MA4A 2YAPA 4WFQA 3KPSB 5KWEA 1GGVA 3EEBA 2P6OA 2V3VA 4QDTA 1CFZA 3K30A 4YVNA 3UC2A 2ADFL 3IKKA 3R4VA 2RGSA 4K23L 3UG6A 1IIRA 2YXDA 3J81k 1GPKA 1OHHA 1OJLA 1I9IH 2P9YA 5BXFB 2EXSA 2JTDA 2FG7C 4L72A 2GC7C 2WXPA 4QTIL 2W70A 3E3QE 3OKLA 2H1PL 2D4AA 4PRIA 3RS0A 1OTTD 5E1DA 1QX1A 2W0MA 1RR6A 4NQXB 5A1AA 2HJRA 2O2HA 3L3HB 1FMTA 4DJDC 2VPIA 1UP6A 1A8QA 3HSKA 1FXWF 1QGOA 4MCNA 4NULA 2YGNA 1N2HA 5DC9B 5HPMB 4MZIA 3I6KB 4GICA 4OGXH 2HT2C 3OBBA 5FO2A 3MAJA 3ATAA 4GBED 3G85A 1RCUA 1R34A 3KVYA 2GY5A 1VHLA 2XBTA 3UTPE 3KXFA 3ZTDC 2DLHA 4XWKA 5DHTA 4OHOA 2D0PB 5HKAA 1NL3A 3L6CA 4UE6A 2RFXA 4RF2A 2JJ8A 3WNJA 2WF7A 2ZT9C 2QGFA 1BZ8A 1KLFA 3KPPA 1D6NA 4OK5A 1USGA 4ALNA 3BA6A 4UAJA 4QDZA 3DM5A 3U36B 3GXOA 2ZKHL 2IA5A 1SU8A 1M7XA 3QZWB 2V6GA 4JHVA 3JQGA 4Y2LA 3CO5A 4R9HA 4M22A 1DKOA 4M7WA 3IHWA 4M5ZH 4BZPA 1ZJWA 1SXCA 3KKEA 4XE5A 4L0ZA 3LKSB 5JG7A 4CHGA 4QO7A 5IHPA 4HH9B 4ZBJA 4IDQA 3MJWA 1AR1D 1KBWA 3FHLA 5LGJA 2BIFA 3T7EA 3R0MA 4YK7A 5EO1B 3O2DA 3IAUA 4Q9RL 1A7BA 1JR2A 3IC5A 4L48A 4JPIB 1I0ZA 1UBTS 4NAQA 1NMAL 5AKRA 2XBZA 4HISA 1GUFA 1G38A 4HBZA 2PO6C 2O61B 3SGKC 3JXEA 2UVQA 1KFAH 4NRYB 4NQEE 4HKJB 4HH4A 3I8OA 1W5AA 3JT2A 3HZMB 4PJXF 3GMRB 4FN4A 1KFKB 5I9MA 1G7HA 1M54A 3C3AA 4HI0E 4LSVH 5HHNB 1IRAY 5A2IH 2XPYA 1U41A 4EPVA 3ARTA 3KFXA 3T3IA 1MJ8L 1TNDA 1T1GA 1N5MA 1V9LA 3DBIA 2AFIA 3WJLC 5C1MB 2YMTA 4B31A 4HXBL 1JUFA 4E21A 3EEFA 3OKYB 3D6HA 3NWOA 5K99A 2VOEA 1DJWA 4R40A 1XR9A 4CN6A 2FT7A 4Y6GB 4NENA 1S2DA 4DTIA 3T5WA 3AUFA 4F33B 5BQFA 2X15A 1U7DA 1NCOA 5C9JA 2M1ZA 1SOWA 3RTDA 1UINA 4WZ9A 1E32A 2RBLA 5CD9A 2FLWA 4NTZA 3UPCA 1FDRA 4R7XA 1DL5A 3O2SB 3N43F 2PZGA 1KULA 5F0JB 2AXNA 4YC2B 4K9MA 3RODA 5DDIP 4RSGA 1DOAA 1P5HA 1G9EA 5FYJL 1QFWM 4MSUA 2HCJB 4GZ5A 2B16A 1P2GA 4ZW7A 3TA3D 1J25A 3WLBB 1L8XA 4KH2A 3KPNB 3TLAA 5IESH 5F7ZA 3RLFA 5HD8C 5CVJA 1A7AA 5FUOH 6CHYA 4RLDA 4FOMA 4XCFL 1PDWA 4BB6A 5F64A 4NFCA 5F8RC 5E3JA 2R79A 3FSOA 3MV7A 1RUKH 4Z7UE 3BXNB 1L3WA 1XUOA 2QPOA 4GMKA 3I9FA 3KC2A 1CNMA 1TCMA 1AQHA 3O26A 4Q3KA 4X9IA 3NHZA 5AK6A 5KQLA 5GS0D 4TT3A 4YIQA 2HKHH 1A9QA 1Z5LB 3TBTA 4FGKA 3REQB 5CLXA 4NBRA 3WHE0 5IEKB 4G5OA 4MS8D 1PY0A 4D4LA 4R54A 3DTDA 1C9KA 4HH1A 3MFFA 4EBQH 3L0YA 4Y2SA 1LK2A 3VUEA 1XU9A 4BVFA 2E59A 3A6HA 3G9VA 5CZVH 1YUKA 3F97A 3A4TA 4JG5A 1T5WA 3GBDA 1GFZA 4AZSA 4HB3A 5JO5A 4Y7CA 5E6RA 2DKUA 4N20A 4CVXA 3TI9A 4XAWL 2BNQE 3PDOA 4QO8A 4E30A 3QDJA 5IMKA 4UI2A 2B8JA 3SR0A 2VN4A 2WRZA 4ZPVB 4NFLA 3GPBA 2AR0A 4MOWA 5HJ2A 2JANA 4PUBH 3OG9A 4N6OA 3G5YB 2RBGA 2A9CA 4LJSA 1RXIA 3K2KA 1FHGA 4XP6L 1BIHA 2BUCA 4LSMA 1J97A 2F9LA 2V9UA 1RHRA 2WYWA 1BWPA 1OLXA 3ZIMA 4PWKA 5JLAA 4NFYA 5TPWL 2J73A 3UHOA 4M1DL 4WZ6A 1XGUB 3PUVA 3QP9A 4Q39A 4P5TB 3WWEA 1ISHA 2JVJA 1IXRC 3G2LA 3QEKA 1EDQA 1S5IL 2VUHB 2CRIA 1YY9D 5CGYC 3W3ZB 3Q5YA 4OF5A 1QOZA 3PNSA 5CFQA 1H3FA 3UATA 2WSDA 5CBPB 3MV01 3BXPA 1YFZA 2OK7A 3CF4G 3SCMA 1FZMB 2DL2A 3T7IA 3H11A 4DV3B 3B1YA 1T0UA 5CIYA 4EHAA 3FT1A 4S1NA 5BSTA 1BQUA 5GTDA 1A6TA 5KVFH 4P2OC 1M8PA 4I0PA 3WFBL 1DTUA 4ZMZA 1MFCH 2Q9BA 3LCMA 1ZLSH 4R69A 3QW9A 2EDMA 4JDEB 5AVSB 2CJUL 2WG2A 1DPGA 1T6WA 3VV3A 1CUGA 4TQAA 2C7BA 5KREA 3EPLA 3W77A 1F0YA 1IOLA 1KB5B 3NT5A 1G20A 3DO5A 3H3PH 3UC0L 4EI5D 4LJ6A 1K4DA 1Y81A 4N9GA 4C54A 1SULA 1FZJB 1J2TA 4FHFA 1GJWA 2OD2A 3HXKA 4RJJA 1X5XA 4FXTA 2WWFA 4QHNB 4G0UA 4O4JA 3APNA 1DZIA 3I9NA 4Z4GA 5FDYA 3C3BA 1U2DC 2DH6A 4JI4B 4W7HA 1X1BA 4EKDA 3DUFA 4PAZA 4JFZL 1WXGA 3O8XC 2HDWA 5B1SA 5ENWA 1K8YB 4JZOB 4RAVA 1MAAA 2PXHA 3EPJA 3P4MA 5F8QC 4O0LA 4DUVA 4NH4A 5I4BA 3DJYA 3AS3A 1TYAE 3BP7A 2KWIA 1OGTB 1VGEL 2Q29A 3MB5A 1QFPA 1XTUA 3L7IA 3VHXA 2NXNA 2H5IA 3ZOZA 3CVBA 1NAML 5CITA 1KJ2B 3ZHNA 1D5XA 3SHOA 4PZYA 2QN3A 2BSEA 1Z8HA 2WI8A 3IQXA 3ZHUA 4N3TA 5CPBA 3E9NA 1NUFA 3BSFA 1CRQA 2WNSA 1ISIA 3GJ5A 3RIXA 2JK1A 1FVHA 1YQ2A 4GI2A 5DZ9A 4DEYA 3KQNA 3WU1A 4CZ2A 3O73A 5D7JB 3OLEA 1NMBH 1N5RA 1L7TH 2OMZB 2Q07A 3MR9B 3O03A 5I7AA 4MDYA 4J6RH 2NTFB 5IB5A 1Q19A 2PKQO 2J7LA 1H3WM 3BH6A 4HDSB 4HUKB 5HDBB 1MCWW 4D74A 3IDYB 3QLVA 3RI5K 2PVCA 3SS9X 1MFEH 5REQB 1QRAA 1KBVA 2QTVB 2VTDA 3LX5A 4JQIH 3KE9A 1EHLH 3D1JA 2F58H 1X1AA 2HCTA 2NZ8A 1B3IA 3MJ7A 3AW9A 1Q15A 1Y7PA 4R8KA 5J59A 5MF6A 3LECA 3OLXA 4HSGA 2IU6A 2FJUA 5AVVB 3V1YA 2EDQA 1A6WL 1YASA 4GX1A 2AG1A 3U1QA 1QUFA 3DOEA 3PWSA 5LMZA 3RC8A 1X5LA 3GHHA 2O8EB 1E66A 3BKYH 1Q4NX 1SUSA 3IP3A 3RB5A 3FB7B 5JZ7C 1T9HA 3RFTA 1LE5B 2YWXA 4QPDA 4AQEB 4PJ9A 1EFXB 3NTXA 5TC4A 1FVDA 2HTKC 5KJ6A 3PT5A 4UANA 4K94L 1W4ZA 2LDXA 3QUYA 4FHBD 4YI3A 4D3CL 4TKVA 4FDLA 3JWNC 2BRUA 2Q4EA 3LFTA 5DJ2B 1KYZA 3KLPX 1PBNA 2CMGA 1Q83A 2R6CA 4LARH 5E1IA 3FSVA 3UMVA 4TTJA 4URVR 4B2IA 1OB0A 5DZNA 1GDHA 3I58A 4LHJB 1X4YA 3ZBPA 2HXGA 4JX9A 4ZK2A 4PY7B 4CW7A 3HUJB 3DX9A 5E0OA 5CYOA 4EZJA 4UQ2B 3FWPA 1GR7A 1CGXA 2ZOLA 4MP6A 4JVNA 3DP7A 1JZSA 3UIYA 3DHVA 1I4OA 1L9SA 1TVHA 3AB3A 3IEUA 4KE7A 4NDNE 4DEVA 3CLEL 2E9GA 3IRPX 1C9YA 1F6FB 4OI8A 3BAEL 1SRQA 4X91A 4PINA 4I9WE 1NVFA 3GO1H 4PGZA 2CLCX 3NHKA 2FSEB 5L88H 4BQEA 2EIDA 3DFMA 3BFQG 4AXBA 4M62L 4UQAA 1KJZA 3VMMA 3H9YA 4NAJA 4U31A 4UM9D 3KOOA 2P4QA 2X3YA 3P2JA 3FUVA 4X85A 3FFAA 1R5WA 3BE8A 5E2TH 1LNSA 5CPFA 2ZXGA 4JY4B 2PWBA 2QBYB 4F7TA 2C0QA 2QMJA 4M5YL 2JJQA 2JE8A 5C35A 1ZGLA 3U7GA 3ZKXC 1MQ8B 2WU0A 2VR1A 2GSIA 2IH2A 3OZ9H 3HA3A 4HJUA 1XZHA 4C89A 1MCHA 4ABWA 5LQUA 1HQYE 4M6ML 1GJIA 2X1XR 4MJ2A 3OY2A 1TLTA 2W0LA 3VFNB 3CSYB 5ALYA 1BJMA 1EEZA 4J1SA 1R3UA 1BBDH 2KQMA 4YXWD 5EFZA 1IN4A 4FE4A 2R96A 4YRCA 4MUYA 5CM1A 1THCA 3VI3E 1E6UA 3ZU8A 1OAQL 1MG0A 3C74A 5TMDA 3AFCA 1DBJH 3K32A 1V3JA 1FJ1B 3EYSL 4N0RA 3PFQA 3CVIH 2OMBA 2EC8A 4XX0A 5LBVA 4I8XA 4GXQA 3QG7L 3MW8A 2K1MA 1K8RA 5CIQA 4AGPA 3RNKA 3T3PE 2GFIA 5I6XB 1T43A 1A14L 2L8AA 4NCJA 2VPZA 2H1VA 1BJ1H 3NIGF 2OV4A 3RB7A 2FA9A 1RHHB 4HFUL 4OQTH 2ENYA 5L0QC 3HVIA 5T4FA 1JXFA 1JIQA 3DS8A 1NJ9A 1BEYH 2GPAA 621PA 5CWSB 2VAVA 5FUYA 1JFLA 5KYVA 3ZGIA 1CGSH 5CLFA 2ZRJA 3UTPD 3VFMB 4UTOA 2XXFA 3NPSC 4ZANA 2UYOA 4LSQL 1TRKA 4QDOA 1PLBA 3PEFA 4X9HA 4XBMA 2HQBA 4NN7C 2IP2A 2XTLA 3NHRA 2AC2A 4ZS6D 4AUEA 2NZ9D 4UQDA 1TJXA 2B9AA 1IM9A 2XN1A 1IQRA 1RADA 5IF0B 3HHSB 2AUTA 1HEUA 1D5ZA 1TT5B 4DVRL 2L17A 2Q6VA 5LWYH 2F62A 5EGSA 1X1CA 2FGWH 4DO5A 4MUXA 2WE7A 1WWCA 2YA1A 3B9QA 5KVMC 3PLRA 3N6RA 2OMVB 2QX6A 1QFWI 4WHTA 2XCIA 1NLUA 3L48A 2WM8A 3CUEF 2AEPL 2DKFA 4R4BA 3UP1A 4DGIL 3ELWA 5DGQA 4MMXC 1WSBA 4UU1A 3EOYG 5EF3A 2J0EA 3H8NA 2VN6A 3VVMA 5K0EA 1IAIL 1QW8A 3V4UL 5C2BL 1WAAA 1AZVA 4HLUC 3ZLBA 4KIWA 2D3TA 1SG0A 1CO1A 3VV2A 3VPXA 2HFJA 2XD9A 3NG1A 4PBXA 2LP4Y 4YT4A 1I3UA 5DW3A 2UYLB 2ZI5A 1VQ1A 1F4YL 3LAFA 4AI6A 3BN3A 1HCFX 2YBGA 1NDMA 5DBFA 5HIMA 1L7IL 1TUPA 2GPBA 2J9RA 4KX8A 4O3TB 1UM5H 2YWGA 1B00A 2FTKE 3GYBA 1BXRB 3T9EA 5MFZA 3VSTA 1T36B 2UKDA 4PPFA 4UNRA 1MHHA 4EY4A 5BR8B 1H4QA 2KHAA 1I01A 1M2NA 1BVZA 3DE2X 1WZ2A 4DILA 4U1HB 4JT4A 3IMWA 4BOYA 2GEVA 5JE8A 2BBTA 1K68A 1H2WA 4NQSB 4B2YA 4Y4KC 3B6MA 4QO1A 1AHWA 3JASB 1BAGA 2HADA 2WIIB 2V4ZA 1ELOA 2YR3A 2AE2A 3DDHA 3OFNA 1Y18B 3PT9A 2AJZB 4D9BA 1V16B 5INCB 2Q7NA 1N8KA 1TZHA 3IL2A 4UTNA 2PMWB 2J3HA 2WYZA 2YFNA 4HQLA 4WDQA 4AM0B 1PFWA 3QTTA 1U3JA 1G5GA 5T1JA 1RZ7L 3JQOB 3V8VA 2PIAA 4KLAA 3UO1L 3NHMA 1LF0A 4UOW1 4NQEB 4PX2A 4DANA 3L4BC 4DKAA 5IM7A 1KCVL 4F8QA 4B7CA 4N9OB 3T8VA 1ZR2A 4F8YA 4DKTA 1NF8A 3SMVA 3H13A 2UYGA 3AUSA 3CZFA 3G5MA 2X9YA 1AXEA 3FTUA 4G5HA 3PR1A 2ZUQC 2BH2A 2A4ZA 5EEGA 4KGZA 3MREA 3TCKA 3SGLA 2FD6H 4MW5A 3INNA 3UICA 3JV4A 5IQOA 4UBMA 2GJ8A 2FUG6 1KZ6A 5KYKA 1W8EA 4A5OA 3D9AL 1TZIA 5JUEL 4HDRB 2R29H 3RWFA 2W2XA 3ECAA 3MYZA 3P30L 3RWEA 1W5TA 2WF9A 3QHZL 4BDVB 1IY1A 2EW2A 1N33B 5ALBH 5JU6A 4P2RA 2ATPA 5E08L 2JWGA 4UIKL 1L3CA 3RM3A 3UPRA 5JQ6L 3ZH9B 4N8CH 2TYSB 1JGUL 3ME5A 2R7EB 5GJSL 1KJNA 1SEBA 4RO0A 2A94A 2ZT8A 4NZMA 1IJKA 2Q2NA 1VSUA 2FO4A 5G0WA 1W7AA 3MLWH 2Y1VA 1VERA 3DUSB 1Y4UA 4M83A 3MBEA 2VDPH 3VVCA 4JAMB 1KZ9A 1D9ZA 1Y1DA 2ZS9A 2BNQD 2APFA 2EVIA 4YLCA 1CFVH 1JRHI 3SE3C 2DWXA 1S02A 3ARDA 1BF2A 1YDFA 3OLWA 5ALDA 4MULA 3WLQA 1CJMA 1CEXA 4WOJA 3L1UA 4ZFGH 1GOTA 1ZWIB 2F59A 3G8DA 4PLKC 3O3UN 2WAYA 5KYGA 1I1NA 4M6WB 3DL4A 3CLSD 1I1RA 1K6IA 2CHNA 3N2ZB 1SUHA 1DL7L 1S7QB 4IJ3C 4U1NB 2CB9A 3SSOA 3QISA 4UNPA 5IG7A 2NNCA 2GFBB 3ZQ6A 2FSPA 4WSOA 5BRPA 5GQBA 3VXNA 4PHFA 2E82A 4Z7UB 1YDPB 1IO4C 1SUFA 2WU4A 2DLDA 5DW0A 4U1JB 4ZFOL 3VZBA 3KJFA 1X7ZB 1WDTA 4TWJA 2FPIB 5BRZA 3LTVA 4MDJB 4MXQD 2KYIA 5DD5H 1VIWA 4BWTA 4C9BA 1IG3A 3THYA 2W0KA 1JTFA 1ABFA 1ZEAL 1RJDA 3B48A 3LDBC 2K5UA 2CE6A 4LPTA 5B1BB 1KJMB 2NPIA 3UN1A 2YTZA 4Q6IB 5MI0C 1DBPA 2EYTB 3A6JA 4QTZA 1ZRNA 1K7XB 2XIBA 3ZXUB 3Q12A 3G2PA 3DTVD 5LMUB 4PRPE 2KLTA 1Z82A 5CBKA 1RMFL 3LSTA 1K75A 2OV0A 4W4NA 1M9NA 3RSGA 1D5BB 4C7OA 2RGGA 1HHKA 2BGLA 5J13C 4DMMA 2NYZA 1ACZA 3OF6D 4L2IA 4ZMTA 4G5ZL 4ZRMA 1PKQA 4DW2L 5DQJA 1JMYA 1NR7A 3KJNA 1AO3A 4WUKL 4YSRA 5DSXA 5IDVA 1EP9A 1CDZA 3ADCA 4HD5A 2LPMA 3T6VA 2PCFA 1YR2A 4N0FB 1Z5GA 4A03A 4EOWH 4B6JA 2JQMA 1AXTL 2BERA 4M1CC 4ZUWB 3AEQA 4LWPA 3QAZB 4L0PB 3BGFC 3B9KA 3QWQB 3CZ4A 4L2YA 4Q1DA 3DZGA 2EX0A 1CIUA 4Q4JB 4D9MA 2RHJA 1RM4A 4ZQCB 2CAKA 1AOHA 5IBLC 3BDVA 2DFPA 3W4JA 4P59L 4BNTA 4N8VG 5T3ZE 3RWGB 1AE6H 2JSFA 4C14A 2OLKA 4K9QA 2WG1A 1IBRA 4DA4A 3OO1A 4NYMQ 3S2GA 1XD2A 3OWOA 1L0QA 1R0LA 3MJDA 5KSAD 3I72A 4GMGA 2NP7A 2H31A 3RGBA 1U0BB 4G8GA 4DFHA 4DIBA 4BZZA 3TT1L 3G6JA 4QOKE 3E3NA 1JWUA 3KYKH 4LEXH 3PNWA 3C5JA 4UCFA 2COUA 2QP4A 3WQSB 3I3DA 4GKAA 4WAFA 3W78A 4XGZA 4LLAA 4NJMA 2EZ9A 5KTNA 2LE0A 3QH4A 3JWNH 1EZZA 2VR6A 1WSST 2D5AA 1D8TA 4FTDA 3C6SA 4RGOL 3C1AA 2WB7A 4JBHA 4CEIA 1L7BA 3BI9X 4JL2A 4WX2B 5KNCH 2HX7A 4IIYA 4YA6A 4LWZA 4JB9L 2V1XA 1AS2A 3IEKA 1VIVA 4K8RB 2ZWKA 2AV6A 2ENWA 5SV2A 2ZJ2A 4J3OD 1OTHA 2W6ID 2A9ML 2Z8SA 5AB0A 4XO4A 3DOCA 1Y5NA 1UQUA 3C09C 4MCZB 1GXSA 1KR2A 2JJ2A 2X7XA 4YPFA 4DVJA 2FWNA 5C7LO 5ESAA 4G9DB 4PRBB 5FWXB 4HD8A 4BKLB 4BHUA 1E99A 1P7BA 3F6LA 4MA7L 1KJJA 5KS9A 4W6ZA 3LBHA 1IOVA 2XNSA 5BRAA 2YBDA 4OBWA 5YASA 3VR5H 1MW9X 2Y71A 1AGPA 1EJ2A 3KT0A 5EUCA 1E20A 2ZT6A 4B4OA 2Z3FA 1R8QA 3O8LA 4RQQA 2CD7A 1NLBL 3ND7A 4JN2A 4NLLA 2XSZD 4R83A 1TZ8A 2XZCL 3F9CA 5JZVA 3NABL 1JDNA 2OP0A 2IG2L 3OFSA 3ZKND 3KS9A 1R4XA 5DMKA 2QD5A 4M55A 2X7HA 5LBIA 2ZICA 1NC1A 3X3GL 3TLBA 3GSNH 3T65B 1RLWA 5COQA 1OX6A 1LC0A 3UJ8A 3LXCA 1XIWB 3HMWH 2HXSA 1AZSC 4RMRA 5ELLA 4HKTA 4WY2A 4V0RA 5AVRB 4MS1A 3SF8A 3ZJUA 4AKTA 3B5IA 4HR7A 3IYLW 4IRSA 3X12B 3WNLA 2C8VA 1IIBA 2IS2A 2CEAA 1M2OA 4LFBB 4GI1A 2MNWA 3TQHA 2WD7B 4YE4L 4HETA 1W5FA 4IGEA 2NUAA 2DSNA 1NKRA 2G5BA 4FQLH 1SCQA 1LGVA 1CUBA 4AM0Q 2YMOA 2GMWA 1TG8A 4F8TA 3C3KA 3C7KA 5JIIA 2NY7L 4AE0A 3M82A 4AQZA 4Z5RA 3MJ8B 4LLYA 4TV8B 3L4VA 4O59O 1IN5A 4RSMA 2Z1PA 3CXDH 4DIKA 4NFHA 1NBMA 3IFPA 1AHHA 2HYMA 2VXSH 4G7RB 1X74A 1KPRA 2PPDA 5IQ9A 2YJTD 1Z4NA 5EIFA 1DLHA 2DZDA 3DLAA 3OMXA 1YEWA 4IOMA 1KSHA 1YHZA 4NBUA 4XEHA 1JFHA 2FPRA 4JM0A 5J58A 4C7VA 5DURB 1SKAA 1FTQA 2XWZA 5HEKA 5BSUA 2VP6A 4FNLL 3A1CA 1Y9JA 1YEGH 3M4XA 4YSPA 1ONQB 1FO0B 2P9FA 1P9WA 3QWRA 1UK9A 5FTMA 2W2KA 1MLCA 4Y2OB 2A1UA 1R4ZA 2QYHA 4MVJF 4LAQL 4U6TA 1KVSA 3TESA 3SKMA 5IOPB 4KUZL 1UD8A 2PMDA 3CFBB 2DBVO 4C78A 4IK7A 2WMDA 3L3GB 3JAKB 2CWRA 1S7RB 1E3FA 2AITA 4K3EH 2YJGA 1KO8A 1WXWA 2F15A 4PJ9C 4PSAA 3FNHA 2YAMA 1YZHA 1NH6A 5EOCJ 1G7PA 3MCWA 3P8ZA 3PJDA 2HTKD 3DK2A 3KQYA 4HWPA 1E3IA 4DRZA 1X77A 2PZMA 3OPUA 3FMGA 2A9JA 3BF8A 3BILA 4HDOB 3E9EA 3UA3A 1NANI 5FBHA 1IVLA 4JFFE 1Z7BA 2Y66A 2P2NA 3M9WA 4PRHB 4KQFA 4ANWA 1MX3A 3OSKA 1P18A 2ZKMX 4X84A 6REQA 2OMNA 3OMZA 1PCSA 3WLFA 5FCDA 5FBVB 3A9UA 1ADFA 5C0BE 3C6KA 3UBXG 5EC8A 4R2JA 1OANA 1I9JH 4GXNA 1ZGBA 2GN4A 1FDTA 5EP2A 3CR8A 1FFHA 2JK5A 5G2NA 1ACYH 4X8OA 3LX9A 4IKPA 1IBGL 1P8JA 3FONB 1UH3A 4K8OA 5D5PA 1OAYH 2VW4A 2C3XA 2QMOA 3U2SA 3PNQA 1MHPL 3H9EO 5K6TA 1WC7A 1ZVKA 3TFKC 3WKQA 3WK6A 2WO4A 4Q6KA 2GPNA 3GSWA 1R2QA 3WEAA 4O2BF 5C51B 5K8LA 5AXAA 2AN3A 5DM0A 4XBEH 7PCYA 4X4KA 1OGPA 4W1TA 1DBIA 4W5TA 1A9ZA 2J6IA 4TVOA 4PJGA 5EIIB 2GAFA 2N1BA 4F3CA 5A0VA 4G6ML 3A2LA 4TSCH 5HYQA 2X8JA 4YP1A 2IF7A 4LRNH 2EDDA 1W73A 3VI3B 3RZCB 2JFGA 2QORA 2PA3A 2ATCA 2CHEA 3BVDB 2ZP1A 5DDHA 4JL8A 4Y2PA 2YRBA 5F71A 2IGLA 2VLKE 3Q6FA 5IB3A 5E6SB 3DE4X 4L4VB 4JVOA 4UZSA 2M9MA 1LWHA 3AP1A 2KPWA 3S5ZA 4ND8A 3ZCVA 3RFXA 2BVUA 1R6VA 5BMOA 3EAKA 1UDCA 3G6KA 3LOQA 3T52A 2AFVA 3B20A 4P4GA 4N8VA 4DP5X 4W9MC 4UHKA 4P0QB 4FFZH 1YMMA 3IPXA 1A7OL 2IPKA 1ULUA 1NI5A 3PKZA 3UTTE 1GSMA 5CW1A 1NN0A 1V5JA 4JKPL 1I0IA 3I01M 3UUFA 5JW5B 3O95A 2VPPA 3MGTA 4JLDA 2ALJA 4X00A 4CBPA 1S8DB 3TQOA 4BE4A 2C58A 1MB2A 4MRMA 4IBQA 1YVUA 3GGSA 2DUNA 3PWTA 5T3YA 3CUPA 1NA5A 4Q0MA 4G1BA 1AQDA 1QYGL 1GC1L 5LUBA 1U3YA 4DKDC 2CHZA 2WGXA 1D7FA 4KFRA 2F8TA 1GQFA 4UMEA 2SEBB 3GA0A 2FX8H 5DGRA 4GXUM 1DVQA 2WM9B 4DT2A 3SDCD 5KX5A 5DX0A 4U2EA 4MYTA 3WHIA 5FOSA 1M74A 4Z7OE 3QIWA 2ZRIA 1B1CA 3PS6A 4G7SB 3KYNA 1BCSB 3M6LA 3Q7EA 5HPOA 3KTFA 3Q2CA 1U8EA 1OSPH 2E56A 1SCJA 1LO4H 3BQNB 5IJBC 4DPAX 1YEJH 3TSWA 4B5KA 2WKQA 4GE0A 3FZYA 4O4LB 4HDIA 2XBDA 4RZKA 1DAIA 3X2SA 3W8NA 1O77A 1QHEA 1X2EA 4IBTA 4PTTA 4JODA 1N59A 1GGIL 1F0PA 1FNDA 4DEUA 4ISCA 5GGTH 25C8H 4H8UA 2VDMB 1XCBA 3M07A 3AVWA 1U58A 1CLZL 1JQLB 1J9GA 3O3AA 5B55A 1UT8A 5B3KA 1WZMA 3ND5A 1W85B 3W06A 4B6SA 2I55A 1U8CB 1X5MA 4PAOA 4HEJA 1EX1A 3ZR4B 4BRSA 3QIUA 4V0SA 5F9MA 2YD7A 1FBNA 2HD4A 4LS3A 4GG1A 3WIHL 2FWUA 4E4TA 1JKFA 4FX2A 4V1CI 3D3VE 4OM7A 5KUKA 2GJAA 4NI6A 3SHFA 4G0YA 2Z7ZA 3FYUC 2DQGL 4PY8J 4AKSA 2IDZA 3FMFA 1CQXA 4ZNEE 3L7AA 4YT5A 5LJIA 5BP7A 5CUSH 1SCBA 4FNTA 1CBUA 2WFLB 2DTSA 4AYEC 3B7RL 1EJ0A 1WU7A 2FQFA 1AZWA 1JWLA 2BKLA 6ADHA 4ZCMA 2EZ0C 1AS0A 1IY0A 1ZVMA 4BB5A 3BZEA 5BXQC 1GGBH 4B6EA 4F96A 1D6VL 2A4KA 5GS2H 2GZRA 4TWAA 4I18A 2ODTX 3CBJB 2W58A 4F60A 3JZ7A 4NATA 4LASL 3HVRA 1OM3H 5ESDA 3AAZB 1KXQE 1TYBE 3CRW1 2G9NA 2QIPA 3EWIA 2QT6A 2UUBB 4YHMH 3WP1B 4LPKA 1T2XA 1VPOH 1UZNA 3A3NA 3EJ6A 4I3RL 3VI4B 5F2FA 5FOWA 1D9KD 3RSHA 2FCRA 3L0BA 2FXIA 2P9JA 4RIEA 2ZUXA 1SHXA 4XPIA 1M6HA 1U8PB 3IT8D 4R97B 2BW5A 1ERNA 4OIFA 4EDWH 1CC3A 1AD2A 2XWBB 5GIPE 3Q0HA 1GVNB 1P2SA 2ZWOA 3KBBA 3RT9A 3TEZA 5IOKA 1HDOA 2BEVB 3F05A 3C75A 5K3FB 5HXAA 1Q92A 1JGEA 3SZMA 3R19A 3FT4B 5J4HA 4D9RE 5JD3A 2BFEA 3M4JA 4BGUA 3GXPA 1YEHH 1TEZA 2ZOOA 2LE9A 3FSZA 1SURA 4PR5B 5J3JA 3TBYA 1DCFA 3UAJC 2IMMA 4OHFA 5AVJA 1RZ8A 1VLVA 4QTUB 4NQRA 5IKEA 1R9MA 3PNOA 1ADWA 1MFBH 2UXBB 3A37A 2WMNB 1L4FA 3OA2A 4CN8A 4RDQF 1V6CA 4I4NA 5JPNA 1FTWA 3CXRA 1ZXLA 5HUJA 8OHMA 4YWGL 5E6UA 3Q40A 3OKDB 1KDTA 1SZDA 1UOWA 4DM7A 3MODL 3W37A 1DLIA 3MM4A 3KUKA 1N5AB 3N40P 4WUVA 4LU5H 1MJGA 2C2ZA 1A88A 3UDWA 2LU7A 1BU8A 3SJZA 2G77B 4Q89A 5DCCA 1DP4A 1JZHA 3OQRA 1IZ8A 4GIAA 2IDUA 1EHIA 4ALJA 1LP9B 3UBXA 1JTVA 2EAEA 4EZMA 3MT8A 3VJMA 1EIWA 4KC0A 3MBEC 2V7NA 5IZ7A 3HAEG 3A23A 5F0LB 1XWFA 3WLTA 5EZPA 3K2BA 5KSBA 4PJCF 5LNK6 3S28A 2OYLA 1WE2A 1QFOA 5IAGA 3JVUA 1NMQA 3ZNPA 3BGDA 2XODA 3FF7A 5GSVB 2ABWA 4BFCA 3N41B 5J2TB 3ZKAA 1KERA 1NTOA 4A2MA 2DLNA 1EUTA 3LUCA 3CAFA 4JU9A 2MOQA 4QOKD 1UBLS 2IGFH 3K4QA 1IEAA 3F00A 3FFDA 3BZ5A 4PRPB 3H3XA 1BMDA 3DV0B 2CA4A 2ZSVB 1Z33A 4J1TA 3M8KA 4ELDA 1ADJA 2OFQA 1DJQA 2R0ZL 1TJNA 1ZIBA 4XB8A 2C9UA 2H4XA 2P91A 1S9VA 2R9VA 4TWBA 3UMYA 2VUUA 1A9XB 4X80L 3G5WA 4KDRA 1B4RA 1TLFA 1DSSG 3NZUA 1C0EA 3VDRA 5CEYA 3U4DA 1EQ2A 2VLJE 1JZIA 5LCVH 1Z6ZA 2AN1A 2W2PA 2NQ3A 1A3QA 1DC5A 2DBZA 1C8VB 3IDQA 1R9GA 3SYRA 3Q3GA 2WPGA 3TW6A 4N3GA 2GCOA 2Q5JA 1X7YA 5AK5A 5JSYA 4RIIA 1FF5A 3FLMA 5T67A 1TYRA 2HH0L 1IIIA 3FUWA 2FG6C 1GEGA 5GS2D 4B0PA 3G5ZA 4YGYA 1NFDF 4L8CB 1I9EA 1PNOA 2B2NA 5HQ3B 5L8VA 3AUKA 1QAOA 1L9NA 1PEWA 3QE4A 2GEQA 4RK5A 2I6QA 3D39E 4Z3JA 3FMPB 2Q6OA 4AP6A 2PAAA 3KVNA 1LDSA 1XGPB 3SKUD 2YAOA 4PJDE 3LQ4A 2P5YA 4I77L 3KAQA 2REBA 3L2LA 4B8YA 4IWXA 2UXFA 2H06A 1GD1O 2B36A 2PX0A 1X7WB 4BM7A 4P46A 4ML3A 4LE2A 1P4JA 1SEPA 1UXJA 3N0PB 4W5OA 3WJMB 5AHOA 3FBQA 3MTDA 4W5QA 3OX1A 2YC4C 3IFNL 2WMYA 2NADA 4U0QB 1U91B 3LXXA 3F2LA 5K7SA 4F7MA 1VPTA 4KQ1A 2ZRNA 3MACL 3LP5A 2FJHB 4KXAA 2FZVA 3HBMA 3GZOA 5GGVY 4QPJC 2JB5H 4JDPA 3I39X 1Z2CA 3TR5A 2Z6AA 3PWLA 1LDEA 1GNLA 4WKBA 1PYWA 4UNUA 2V6FA 4M87A 1X70A 3EODA 3ZSTA 3QEUA 3ESUF 3EZ2A 3AR9A 3GL9A 2UYQA 4X6FA 2OE2A 5BQXA 5AVQA 1NONA 3MOGA 1NMCC 1NC2D 1JXQA 3K73O 4QUOA 3QVMA 1OD6A 1N68A 4XWOD 5CD5C 4ZI5A 4LCYA 2N56A 1WB6A 3U44B 3KB1A 1I7ZA 4I2NA 2OD9A 4M54A 1CK0L 2Y7SA 4K81B 1W35A 1U3GA 2XQYK 4H25B 2BKEA 3M3DA 1KZ4A 4CQLB 4UE2A 1EAPB 1ZONA 1QNZH 3E9QA 5BCAA 4ZMPA 3SPIA 2XCMC 1S9WA 4OZFG 4WSJA 3IHLA 3MCYA 4Y5VA 3BCHA 4GOJA 2DQDL 5FBWB 4HGQA 3R44A 3ZDWA 4NO0B 2IEAA 5LNEA 4ZUTA 1NG1A 5DP2A 4TWRA 5MDHA 2PYEA 4J8PA 1XGQA 4BQCA 3WBBA 3M1BA 2J5WA 2RHHA 3DARA 4W4OC 3EVBA 2P5ED 4NKDB 4NZRL 3WL8A 3QY0A 4E07A 3BUIA 5BNWA 1KIPA 3X17A 1P9MC 4R8RA 1VSBA 4LBEA 1Q1NA 3DE0X 3ZZMA 1NIFA 3WL7A 4Q9JA 5EERA 4YHNA 1GITA 2WZDA 4ACBA 1HBJA 4UBIA 1XHLA 1Y6QA 2B0SL 2Y1DA 1MA3A 4ZAFA 3FO0H 5DZOA 1RWMA 2JZCA 3M70A 2CLFB 2J6HA 2YQ2A 4P2QB 2N75A 1NICA 2GHWB 4I87A 2Z5GA 2G9UA 2FR4A 4Y9BA 1QI5A 3C6BA 1EPUA 2OKGA 3F8WA 5DVNA 4ECEA 1RJWA 5GRUL 3GKZA 1SCKA 2R6HA 2ROXA 2YD3A 1FDLH 2F2TA 2YIVX 2DJMA 4XJTA 3SY0B 2EVGA 4N0MA 4JFFD 1M7DB 5CMLA 1NQ5A 2BJVA 3K94A 3VB9A 2IH3A 4RTJA 1NQWA 1YL7A 3HN8A 1Z0FA 2FMTA 2P41A 4FOOA 2JKJA 1JEQA 1OLUA 1HQKA 4BECA 5C0BD 4RGYA 2DTXA 1JI1A 3HY3A 4N0EA 3DIDA 3UABA 1SFRA 1OP4A 1ZEMA 4BBPA 1G55A 3ZIYA 3Q1EA 1YEIH 2HSZA 4ENTA 3L5XL 2IU3A 1G5FA 3WYFA 4CLOA 1KPVB 3BN9C 2BEWB 1V4NA 1NUAA 2CYAA 2AVFA 3IDXH 1W72A 1KAOA 3VRHA 1G291 4LE0A 4I3FA 1NDTA 1GLVA 3L40A 5ITBL 2YS4A 1JD7A 5BUQA 5T5NG 3VE0B 1A7RL 2ACWA 5F52A 2JHCA 3UB4A 2IHKA 4URYR 4U1LB 4NEGA 4MSWA 3GB7B 3VM5A 2CFSA 3AM5A 4KVNL 1SMKA 2NY6C 1DQVA 5FB3A 1RAGA 2ZI7A 5I7HA 1FMJA 3NQKA 4BZXA 2VITA 3PHOA 3NYKA 5A2QA 4S0HA 1YG9A 3OT4A 2L19A 1QLWA 5GMOA 2A88A 3B3GA 4DT1A 2ZAYA 3RVNA 2FWOB 1BN7A 4UT9A 3OZCA 2XA9A 3PWKA 1II8B 1RU9L 3HAEA 1BW8A 1T1ZB 4AQOA 4YFLF 4ER3A 3VR2A 4GBXC 4Y9GA 5J47A 4L7VA 3MA7A 43C9A 3I32A 4B5ZA 3O91A 1W47A 4IDDA 3MRNB 4Y2YA 3B2VH 1XB3A 3VU9A 5CGQB 4ZI2A 5IYZA 2H1SA 1HE5A 1V26A 4P3DB 1O9HA 4ACTA 1A25A 4FC3E 5D5MB 4BZ2A 3CK0H 4U3SB 5I7UA 10MHA 2EFJA 1E18A 4X50A 2WXRA 3ZQ4A 3Q5DA 1CV2A 3OT1A 3M86A 3P0FA 4BQPA 2V2WB 3R9KA 3TBHA 3ZLUA 5BOVA 1E8NA 5HGHA 4KGDA 4FABH 2NYYD 2JHPA 6FABH 1G8YA 2ZG3A 1AKJB 4CDNA 3UXYA 2H51A 1CU1A 1VHWA 3ESQA 4N68A 2YVQA 1E96A 4LP4A 3HJTA 1TCRA 2ODIA 3U9UA 3FH8A 2CBMA 2ZJSL 2F5BL 2DQUL 5DF1A 5BT9A 5G5DA 1A9EB 4WUUA 1CY2A 1Z7YA 4ZOEA 4WLEA 2J8ZA 4BXOB 1F8GA 1G4AE 4C21A 4JOBA 1IC5L 5I1IH 3WDIA 2EIZB 5FM5M 4CIBA 5GGQL 2VLKB 3DT6A 4HYTA 1A3LL 1UBNA 3Q9UA 3O7WA 4P7JA 3DJSA 5LGHL 5IVKA 7REQB 4GUAA 1E7YA 4CHTA 2YSSA 3MA9L 3RVTC 3SEFA 1Y1KE 1F3DH 3HZ3A 4Y8AA 2HG0A 3WLIA 4DLXA 3IOEA 4PHHA 5TQ0L 1A4RA 1DIGA 4OA8A 1DDOA 1U3HD 1VCAA 1NZFA 4HZLA 2IX9A 3GJ8A 3RRZA 3DX0A 2I3DA 3EZFA 3PR2B 1PDKB 3OICA 1BGXH 4ZDHA 5B4MC 1W80A 2H9YA 4KHTH 3X1FA 3C5VA 5ECGC 4FFYL 2CL5A 2HRPL 2QN8A 2CLOB 3D3VD 5B58C 2MT9A 3CHQA 4CNIA 1MIOA 3R3SA 4E03A 2NG1A 4CI9A 4AGMA 1UC8A 3MROA 4AUNA 4WZAA 1U8HB 3WNOA 3W9SA 4LSRL 4G5SA 1IDOA 1MUJA 4HJXA 1EXVA 1KK0A 3IFOB 3GZJA 1CEQA 1WBXB 5FK9A 3U83A 1HGXA 1FPTH 4L9AA 2WLJA 1FAKT 1DFBH 1JEJA 1ZX1A 3C4QA 4KPHH 2NO6A 2IS1A 5HE9A 3QT2A 1HIML 2VR8A 1ROWA 5I19L 1A6VL 2CIKB 3O3NB 2R1YB 1EGHA 3AHIA 1EEYA 4YDJA 3TO5A 2A0LC 2NDFA 1TQ6A 4OXYA 5D72H 2IBBA 3HB3D 4FEAA 4DTGL 1L6ZA 4FJ1A 3K0BA 4DMCA 5E6IC 1ZA1A 1G5QA 4PV9A 4CE6A 3I50H 4OHWA 3KDMA 5KVGE 1M6OB 5DZAA 1N6IA 3LSOB 2DLCX 4YXLH 4MWOA 3ZNNA 5JMWA 3ARQA 5EZYA 3UV7A 3W4IA 2WXIA 4LKXA 3GC6A 1JDAA 3QIWC 2VK2A 4J3UA 3EY9A 3FCEA 1GPWB 4WGGA 4Y2UA 1DQRA 3E3LA 5A5GA 3GA7A 3QE0A 1VKRA 1FYWA 4LOFA 3CQ9A 1BD2E 4D9RD 2FB9A 3LUGA 1JE0A 5AVTB 1QBGA 4I08A 3HZVB 3NJGA 2WUBH 1U9CA 3IFSA 5B3LA 3QK7A 3LPWA 1R5IB 4G8IB 6CGTA 4POUB 4B4DA 1FE8H 2HM7A 3ZU4A 1EDEA 4RK7A 2LGJA 1E9DA 3K2EA 4G9FA 2A73A 2BEJA 3K6JA 1A6AB 2O6DA 2CLRA 2GM9A 2F55A 1QP1A 2X6VA 3R7WB 4IW3B 1BAFL 3D7NA 1TLLA 4NXSA 3NOQA 1CLOL 3DC2A 4E2OA 1P1JA 4XCYA 1E92A 4MVBC 2WO2B 4MVWA 3EASA 1XVVA 3AX6A 1S46A 4J2XA 3KXIA 4NZZA 1FNLA 3BT7A 4XXCC 5I1EH 3V7NA 3EAQA 3NHWA 1C7SA 1YIAA 3MRFA 2QG9A 3G8YA 1BEUB 3CWZA 4OY9A 4HLNA 1HL7A 5BN4B 4L22A 5E4EC 4QDJA 2ZTLA 3T3OA 4WK2B 2YJLA 1PY4A 1NM5C 2G36A 5EUOE 5ECDA 4N39A 3SEQA 3PUJA 4Q1AA 1OE0A 1KY7A 3R1GH 2VJMB 3FO2B 2GK6A 4LDNA 1TAGA 3C2SA 4FQHA 2V3FA 4HK3J 4U7SA 4PJIF 1A69A 3V5HB 3OMWA 4JN1H 4NWUL 5DLLA 4X9YA 4DQVA 3DLTA 2ORBL 1U1FA 1LC3A 1SXJD 3FKSD 1QI4A 1JU9A 1C7TA 1I3NA 1KQPA 3OIGA 1SYSB 4GS7B 1I7DA 1C30A 2ZJAA 2R7LA 3TK1A 4DSTA 3C4JA 1EG7A 3DX8B 2YARA 3CFKA 3WICA 3HG2A 4A23A 2QVYX 4S2UA 3KWVA 1P72A 4ALIA 1TNNA 2X4UA 2C97A 1PD1A 4JBLA 1E3WB 3ADOA 2FZ3B 3PIQB 2ZRQA 5T41A 1NC4D 1N0XL 3THWB 4U1IB 5JAQA 4QRPA 1U8OA 4MGHA 3DT8A 3SKNB 5I5MA 2VLJD 2DEXX 2GJ6E 1O97D 1CTMA 5E9NA 1KS9A 4CPDA 1XSOA 1BZ7B 2FH5B 1HFWA 4NDMB 2KM1A 1QOKA 3GMIA 1QS0A 4MV7A 4TKZA 3HTXA 3PREA 4GP5B 1F4WL 3BH9B 1Q2UA 1RIIA 3SX2A 2E9BA 2IPTL 3QQDA 3RBZA 1XSKA 2O0MA 2EIEA 3HN2A 4DNQA 1AI1H 3T09A 3WL9B 1TJMA 4BBJA 3W5BA 7PAZA 1IQDA 3U7YL 1VF5C 2ZT5A 5KNDH 3F8SA 5I17B 2BGGA 1DCMA 3DE7X 1KCBA 1TQCB 3QJQB 4N5HX 4W6YB 1REQA 3PDCA 5GGVH 4D96A 4NABA 1PJCA 3CIAA 4H4NA 3V5KA 1M6UA 4L4JA 1SLVA 2BJMH 1MT0A 4ZVSA 3IFLL 3HS8A 1GGTA 3MQIA 5KWVA 2NY0C 3KOZA 3TTSA 3MVSA 1UBMS 3OGCB 4PICA 4FRWA 2BVQB 3NP4A 2ZWZA 3RTAA 4OQYA 3KZ1E 4OGLA 2QAGB 1QABA 2EDYA 4JXKA 1L0YA 5KVFE 1SOUA 3DX1A 1PZCA 5DXAA 4BIKA 2Y72A 3IPFA 3N2KB 3QXTA 4DK5A 2FWJA 4Y2VA 2OO7A 4Z0XA 4FQ7A 4I1YA 5C0RL 3FCAA 3K3QA 3UUGA 2JGMA 2A83A 2X4OA 1KP2A 3REOA 2F74B 3OAAA 2ITDA 4XASA 2D1RA 3WLRA 2H2PC 4R5HA 5KOHB 1FTYA 1KYOJ 5ADWA 2VQUA 3AG3B 2ZLBA 3OE5A 5K3BA 3GLFE 3V4LA 1ADCA 4QWWC 1E9QA 3HZYA 3OIFA 2IAMA 4ZSOA 5HJBA 5AJVB 3ZI0A 2UAGA 2Q8BH 3OEHD 4OBBA 4IOIB 2ARKA 4D6XA 1KS2A 5J4KA 4BWVA 2WXGA 1JAIA 1UPXA 1P2UA 5FYKU 4DNFA 4XRRA 3D39B 4E36A 3HMXH 3LEYL 3DMMA 4PJDB 5F1KA 1V7NL 3DA0A 2Q9UA 1I3RB 5J11C 1V3TA 2R1XA 3PXJA 2E9WA 2IHNA 3FQTB 5A05A 3CG4A 4W9KC 4MR8A 2EIHA 3DMGA 2X7LA 4HV8A 3FPAA 3GLGE 4YSUA 3DAOA 4ZQIA 3CC5A 3JYCA 1NLDL 3S3TA 2GYSA 3GEMA 2OGUA 5I2IB 4BP3A 3UWMA 3W3AA 5EO0A 5EZJB 1VRWA 4WNCA 1FAIL 3T7TA 1OAZL 1GV1A 3WYDA 4DFDA 1QRRA 1B3BA 1XZAA 4BFXA 2OM2A 4B1FA 1YBHA 5E4OA 3ULSA 4KCGA 1HXHA 1QG0A 3O9WA 3ICWA 1TA9A 3NPMA 3EBLA 3ET5A 1FX0B 5DHMC 1XP8A 2FJFA 1J9QA 4IF6A 5GXBB 2YA2A 4MLCA 4O2RA 4BLWA 3LG2A 4FP8L 4HUQA 3R6DA 5LKNA 4N0DA 4W7IA 1FL9A 3T1QA 1E9FA 4LL9A 4IIHA 3NC4A 3HKCA 4MPTA 2RCSL 5IFAH 5IIEB 1N2GA 2ZREA 3HXQA 1QH1B 3NRPA 3RVXD 1MCBA 3AP2A 2G88A 1Y07A 3ZTNH 3WIOA 1HYBA 4EB6A 2Y7QB 2Q1YA 4I50A 1QP0A 4NK4A 3GZPA 1CZLA 4WERA 3S40A 4XUDA 2X9ZA 3KFLA 2YN3A 2GJ9A 2AEQL 3O82A 5CG1A 3QUZA 2XMBA 1SIWA 3RIFK 5KYYA 3QORA 5CLWA 4J03A 3BPOB 1KTLB 2E27H 5J0BA 4MQTB 1KJ3L 3I2YX 2ZCZA 1UAYA 1B2WL 4EI6B 5DJCB 3ILYA 4XPTH 2JLZA 4FXKC 5FECB 3RH0A 1E9OB 3T0ED 4BJHB 4KEAA 4GXVH 2QMHA 1DEEA 3X14A 1YQVL 4CWAA 1XRSB 4FTWA 4Y30A 5L3VA 3KALA 4XQEA 2OBYA 1FLVA 1KMHB 4YPOA 1UJMA 2SKCA 1G1YA 5KTTA