1TYEB

Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
440
structure length
440
Chain Sequence
b'GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-IIb
publication title Structural basis for allostery in integrins and binding to fibrinogen-mimetic therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 115
structure length 440
sequence length 440
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 1tyeB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 1tyeB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1tyeB03
4G1EA 3EFOA 1QC5A 1FE8A 1M10A 3ZE2B 1N3YA 1SHUX 4JDUA 1JV2A 4NEHB 1MJNA 3HXQA 1DZIA 1XDGA 3EGDA 2VDNB 4C2BA 2O7NA 3E2MA 5KYUA 3OKYB 1T6BY 4MMXA 3EOAI 1FNSA 2VDRB 3OL2A 1RRKA 3AL8A 4HQFA 1AUQA 2QTVA 5HDBB 1M2OA 5E6UA 2VDKB 3RAGA 3EOBI 3F78A 3GXBA 5KYWB 4C2AA 4O3TB 2NUPB 1MQ9A 4GZ8A 1QCYA 1YVPA 3NIDB 1JEQA 1U0NA 2IUEA 3K6SB 5BV8A 3VI4B 2NUTA 3IJEA 4MMZA 3EG9B 1JEYB 5KYXA 1ATZA 5HJ2A 5KYYA 4IGIA 4K3JB 1MQAA 2I91A 3ZDXB 3BQNB 4A0QA 4CN9A 4Z7NB 1M1XB 1U8CA 3K72A 3EGXB 4HQLA 1MQ8B 2VC2B 4MMXB 3ZE0B 1AO3A 3PPWA 3Q3GE 5E6RA 4F1JA 4Z7OB 4G1EB 2XGGA 1QC5B 4G1MA 1ZOPA 3EFOB 2VDPB 4UM8B 1M2VA 4IXDA 2NVOA 1JV2B 5KYNA 3PPVA 3HI6A 3K71A 3BQMB 1PCXA 1MF7A 3EGDB 3TCXB 1YVRA 1IJBA 1ZOOA 5KYUB 1JLMA 3ZDZB 1RTKA 1IDOA 2ICAA 3BN3A 3OL2B 1UEXC 1OLZA 1MHPA 4NENA 3EH2A 4DMUB 1DGQA 5E6UB 1V7PC 4WJKB 1IDN1 3OKWA 1SHTX 1T0PA 3T3MB 2ODPA 1OAKA 1YUKA 1JEQB 2VDMB 2ODQA 3FCSA 2NUTB 4HQNA 3IJEB 4MMZB 4MMYA 2VDOB 1TYEB 2VDLB 3T3PB 3AL9A 5KYXB 2B2XA 3ZDYB 3V4PB 5KYYB 4WFQA 3TVYA 1SHYB 4O02A 1BHQ1 1SQ0A 3VI3B 2P28A 4Z7QB 4WK2B 1U8CB 3K72B 4IHKA 5E6SA 1BHO1 3IBSA 1L5GA 4HQOA 5E6RB 3PPXA 4HQKA 4G1MB 2VDQB 2UZYB 1M2VB 1PD0A 2WW8A 4FX5A 2I6QA 1XUOA 3AL8B 3K71B 1Q0PA 1RS0A 5HGJA 5LN1A 1SSLA 4O3UB 1N9ZA 1NA5A 3TW0A 1CQPA 2XWJI 4BJ3A 3F74A 3EH1A 2XWBF 2WINI 3N2NA 4NENB 1XDDA 3TXAA 5ES4B 2X5NA 4WK4B 4M76B 4JX0A 4CN8A 2M32A 1LFAA 3ZQKA 4FWWA 2I6SA 5KYWA 3QA3E 3AFCA 4UM9B 2NUPA 1CK4A 3FCSB 4MMYB 1IJKA 3NIFB 3V4VB 3K6SA 3FCUB 4F1KA 1ZONA 4PN7A 4UM9D 3EG9A 3NVQA 1JEYA 1U0OC 4O02B 2ADFA 2P26A 5E6SB 1M1UA 1AOXA 4C29A 1PD1A 3HXOA 1RD4A 4CNBA 1M1XA 1L5GB 3NIGB 3EGXA 3M6FA 4XW2A 3ZE1B 1PT6A 3PPYA 4WK0B
chains in the Genus database with same CATH superfamily
4MA1C 4XNAA 4N6OA 4OLAA 2B5WA 1JA0A 3DFFA 1NCDL 5JOFA 4QPPA 1B0GB 4FDVA 2YQGA 3NIDB 4BV1A 2MMGA 3MRIB 2O5NA 1MV5A 4ZVRA 3L0OA 3O3EB 4FYQA 2JFUA 3KUXA 5IU6A 2PGIA 4XN1A 2PJDA 3KBOA 2P5SA 3T09A 3HE7C 2IXEA 3ARGD 4ND2A 5GJSH 3TXXA 3E8VA 5AKKA 3TQCA 3UJNA 5C0NC 4ES9A 1PVDA 2ANCA 3VXSB 4DLUA 4E5PA 4P98A 4R6UA 1CO1A 1FMTA 3TBCA 3Q3HA 4YUYA 4P9HC 1UK7A 1PKQB 2BC4B 4QNPE 3PPXA 4I5FA 3ROMA 1J8HE 1Z2CA 2N7BA 1WAPA 3T0AA 3KL5A 4JUSA 1DIGA 2JGEA 2UVEA 4BJ3A 4C22A 1CS0B 4KKAD 4QRRA 3AUTA 1DZBA 2OMXB 2GLTA 4F6RA 2BRRL 2GCEA 4Z95H 3NG5A 2BCJQ 5J2TB 2PZKA 1VSCA 1F9AA 2VB5A 1A7NL 5H59A 4C08A 5K0BA 5EI5A 1WHPA 5HOQA 3X12A 1R6AA 1UBKS 5IDXA 2PS0A 2DFKB 1YSOA 4G8JA 2JEZA 3OG9A 1JT2A 4K7PH 4EBQH 5EZLB 5C0EB 2OBMA 3MT7A 4ESEA 2VNJA 2DWPA 3CDGA 2C7QA 4G6JL 4XPGL 2LV4A 4ZVUA 4XIIA 1NI4A 3LV3B 1YEHL 3RS4A 4PB9L 4JPQA 4WRLA 5CBEA 3EYQD 5AKIA 4BUQA 2A67A 5EXDA 3VD2A 1X5JA 3OLGA 1RQLA 4QBGB 3DDWA 1MKYA 5EE3A 1DKNA 5CNHA 3WO4B 3DRQA 1A9TA 2FECL 2BGUA 2W37A 4FADA 3PGKA 4EFLA 3CQQA 2Z98A 5BW7C 2YRXA 4JVUA 5BWLA 2ZKWA 2ZPUA 1XF1A 4WDIB 3EODA 2BCKB 1XDUA 4TYYA 1U8IA 2NAPA 2ZRFA 4M0UA 3TEFA 4LXGA 3TVYA 2POCA 4EYEA 3IKVA 3TMYA 4D99A 4FP9A 3EXFB 3ETNA 2RGDA 3PXEA 4U6HB 4AO7A 5I7AA 4XP6H 3CLTC 3KKOA 4ZK6A 1U91A 1JMKC 4OHCA 3U49A 1VFNA 1XKTA 5KINB 1XK6A 1V4BA 1JW9B 3VKFA 5FM5M 3EXHB 3ARFA 3WKCA 1MF2H 1KBGL 2UZ3A 1WPXA 3ESPA 4JUDX 2W60B 1ZN8A 1Z0MA 2QHLA 1OX6A 2F1RA 4OM7A 1L4BA 1N4XH 1Q21A 1Q7TA 1IG3A 3BB1A 1L6XA 4TWIA 5IEKB 1TLLA 1VPWA 2P69A 1KRHA 1PV4A 4DKEH 1EHLL 1MAML 1BGXL 5HJGA 3JVEA 5EPOA 4YA6A 2AK1H 4JFPB 2V58A 1W5AA 3C8ZA 1RM3A 5F1PA 4AWAA 1RZKL 3QLJA 4UAOC 2BGRA 5ABPA 5K8UA 4C9BA 4L4UA 5HDQA 4W4OC 4JC0A 5DX8A 1PNVA 4CKZA 4UNTA 3OSVA 5DJ8B 13PKA 1BRMA 4GS5A 3IRVA 1RRFA 1SXPA 5E2TH 1JI2A 1KIQA 3TBYB 2AFRA 3FYDA 4LU5H 4HBQA 2MPVA 2ADOA 3V6LA 3X11B 1AGCA 3ENKA 2DPGA 3C1AA 5J6SA 3UMGA 3EUDA 1NFFA 1W0JA 4PCLA 4Q03A 2VZ3A 4I2XA 3KJIA 3HI5H 1KPRA 4NN6B 1IRIA 3K1AA 1R1CA 3OX8B 2G0NA 4MXWL 5C0BE 4L4RA 2Z58A 1P72A 4K28A 2HH0H 5ESAA 5AXCA 5BYKA 2IUFA 2GBUA 3V5DA 2VLBA 5K3DA 2CXNA 1QGAA 5D7HA 2Z1NA 4OCZA 2UY7B 1N92A 2WU3A 1YASA 2BIFA 2JIPA 1EEYB 4PW9A 2R47A 2AN5A 4JY5H 4HV4A 4B31A 4BJ6A 3DOSB 4K94L 3OECA 1U8PB 2WNHA 4QOIA 3GINA 4B95C 2KJQA 4K6MA 1V45E 3NGXA 1XEAA 1FPTL 3WN5C 5J3HD 5K0JA 3MRQB 3MFYA 5TC4A 1DCEA 3FTZA 2YC1B 2AI2A 2C1OB 2QJDA 2GBLC 1BVLA 2DT5A 3DZIA 1KJ2H 5LXVA 1WQ4A 3GEWB 2HA0A 2J3MA 5CLWA 3EXEB 3ARQA 5J6GA 4KQ1A 2PX6A 3OOYA 3OM3B 1IGJB 4DMKA 3RTBA 1WXXA 1VKOA 2AI3A 5EPUA 3T3HA 5KBNC 3WK5A 4ZYKA 3T4EA 1ORVA 3VFRA 2A1WL 2BGJA 3FNRA 3AEQB 2WF6A 4Z7UB 3U44B 3P4NB 4OZHB 1JZIA 5T4EA 2XXCB 1Z4NA 2XTSA 4ER0A 2VLRB 1JRHI 1XH1A 1CY6A 5F9WB 2ROXA 3AR5A 4CNQA 5E9QA 1TZMA 1N5AB 3EBAA 2JCSA 4IO0A 3E82A 4I1YA 4WLCA 4IRSB 1ZGLM 3W2FA 3WTCA 2VR8A 3SE4A 4WK2B 2JI1A 4IRSD 4ZGWA 1KI1A 2V55B 1AFVL 2QWXA 1QO9A 1L3IA 1CLUA 4PRBA 1V11B 4GXNA 1W29A 1CFSB 3GK8H 2CE2X 3UTSE 1P2FA 2OXHB 4WWPA 3V8EA 1E43A 3ZD8A 2Q4TA 5BV2P 4GKNB 1Y9ZA 1BQ4A 4XI5D 4B3GA 4WV1C 3DX0A 2I9LB 3MMZA 1DBVO 4TVKA 5F70A 2VJCA 3M6AA 3ZJYA 4NWIA 2CLHB 2OX5A 4B80A 5T1MB 4HQFA 1X6LA 1KAQA 2Y7QB 1Z4PX 3ZIUA 4WNAA 1HEUA 1Z7JA 3VZBA 1A5FL 1Q3KA 5LJLA 4L8DA 4FNQA 2AW3A 1SKAA 3UMTA 5JIDA 4AXWA 2O8FB 1I3GH 3D8NA 3PJFA 4RU1A 2FPGA 1DVZA 3U3JA 1MY5A 4BX9A 4CF5A 5IVXB 3DTNA 2XEDA 3WMGA 2V7EA 3HNOA 2P6RA 1JVOA 3JV6B 1USVA 1K4KA 1S1MA 5FO9A 3SDXE 3FOEC 2CNYA 5D6CB 4LOVA 3RWFB 2QD4A 4IWXA 4S05A 1JGEA 5E4OA 4M5YH 4QM7A 4WI1A 3L4VA 5BCAA 3BH7A 1WO2A 2WWWA 1NRWA 3KZNA 1S6NA 2GBTA 1U8ZA 4R4FL 1DJLA 5FORA 3FC8A 4MAYA 1E3WA 2A5UA 4LJ9A 4G9FD 4LLQB 2EE6A 3RJMA 5C5EA 1BBJA 4XX0B 3L5OA 3OLDA 3YASA 2WTOA 4Z7VE 5B22A 3STWA 4GNKA 1ZJWA 1XBDA 4MI6A 4I3HA 3AONB 1GJWA 4HNAA 3VTMA 1D2OA 3DTXB 1J5EB 5IUSA 2AXGA 4FI8A 3L2MA 3PXLA 5BV7H 2OK7A 1QOKA 2VAAB 3QGVA 1NBWB 3GHYA 3KYIB 3L40A 3U7QB 1UCBH 2X6VA 1PG7L 3WS6C 1T4CB 4FFVD 3OX4A 2D0HA 2B15A 4DLTA 3CVDA 5BZDB 1NUTA 4R9UC 1ID5I 2H9GA 4AQ1C 3WMSA 5FYLE 3X1XA 4I55A 4YCSA 2C42A 1VPEA 3S2UA 2A1TS 3PL6B 1MHTA 4S1RH 3EC1A 2Q20A 4P9NA 4LS3A 2DQIL 4NH0A 4R9RA 2WP3O 4L5AA 3HMXA 4ZPTB 3TONA 3FF1A 4NV1A 5CEFA 4XVHA 2BKAA 1EPFA 3U19A 2DFNA 2Q6TA 3MIZA 4OSUH 1NI5A 2WHYA 1OD9A 3EA4A 1NC2A 1R0CA 2EDQA 2FECI 1S8OA 4JDPA 3BIXA 3SPCA 5HFNA 3MOSA 2VL5B 4MKXA 3SIRA 1UA3A 4ZP1A 4N8UA 1L5GA 3LC2O 1I5OA 3F96A 1H15B 5HGJA 3OAYK 4NRXB 1CQPA 2D31A 1YRBA 5JQGB 4HD9A 3OZIA 3QVSA 2J5RA 3KQUA 5THQA 3BUSA 1F41A 2EFYA 4YSUA 3DQPA 1QZNA 1AG9A 2NO6A 2CDFB 4IZ6A 5FPTA 2NO5A 2FW1A 1CI3M 4I6GA 1N6HA 5FWYB 5IJXA 3WDMA 3JARA 3C7AA 5LJYH 2AJ3A 2J8UA 2RAVA 1E1MA 2O48X 5I4IA 2ZR8A 5SX4I 1M8FA 4OZGB 1MVFA 1ETJA 4H7VA 5J5CA 2P67A 1OB2A 1AUXA 2ITCB 1PZXA 2IYXA 2C61A 3W38A 2QXTA 1PUJA 1L4NA 4JL1A 1JHLH 4FOPA 4GI5A 3SJ7A 3NPSB 3K8LA 1H6CA 3A6HA 1Y8RA 4NDNE 4LKCB 1T34A 1PK7A 1HYGA 4B7XA 2FSVC 2IZ0A 1PW3A 3PXBA 1ZLWK 4QREA 1NW3A 1ULBA 4Q9CA 3LKDA 3LQZA 1J70A 2Q8BH 4XPTH 2GD6A 3P9XA 1S78C 5L2KA 4ILDA 3IVKA 2WF8A 1JLMA 3OEHD 3HC2A 4K7JA 4QTFA 1UEXC 4ADGA 2UU9B 5TQ2B 3FSRA 5CJXC 1QTIA 2FW8A 4BWGA 3LIZA 4WJ5B 3IM1A 3PR1A 4F5DA 3RY6A 3MUY1 2IT1A 3PPSA 3PHOB 4Y2DA 3HCPA 4TRNA 1KCWA 3VGJA 2XMSA 1Q1JL 4TSCL 3UPRB 3KBFA 4DK3A 1XIVA 4J3OD 1RMQA 4U4BA 5DLDA 3OFKA 2JFGA 5T3XL 4JJKA 2ACWA 1AKWA 3KZ1E 4FXGA 5TE6L 2AKRA 3ZHDA 1KNOB 4GBJA 5F6IC 4IDDA 3WEOA 1V9LA 1OE3A 3SYTA 4S1VA 1DBRA 2WP8J 4PLCA 1B0IA 3CXDL 2J7PD 2DWCA 1SU6A 2VLLB 5EU5A 2P43B 3VR0A 3FNKA 3IURA 2JSFA 1MI5D 3RYFA 4Q05A 4D8VA 1DEHA 2LU3A 1X7YB 3GEMA 3OKMA 2BP7A 2HF2A 3WZ2A 4JFRA 4N9GB 1XCQB 3IP5A 2GO7A 5IHHA 3FBGA 1NNSA 1J33A 3PC7A 4XXCC 1MFCH 4EEEA 3GPSA 2P5WB 4MK4A 4DGVH 5KYGA 3ZGVA 1X6VA 2DWDA 1Z5LA 4JR0A 5IMLA 3PQYE 3ATEA 2ZOWA 3VM5A 4YHLH 1REQB 4DA9A 1SD5A 3QEJA 3I6MA 5AKHA 3CLSC 3OL2B 3NCCB 3JZFA 5BURA 4MKIA 1BQ5A 2JAXA 2PFKA 3ZXUB 5AW0A 4D0BB 2I7CA 4CMIB 3KOUA 1XAGA 3UJ8A 5IKCA 3TWOA 2YC2C 4XUDA 5GJSL 2FJFA 4JANB 5I66B 1U8YA 2ZKMX 4ZOLA 4I9UA 2EE0A 2D2IA 4P2QE 3SG0A 2W07A 2ZVQX 1X4YA 4AVHA 1I30A 5B39A 4ZXFA 2AN4A 4P5MA 3KWMA 2VJYA 1V10A 3X13B 1F5NA 1JL3A 4M46A 1KZHA 5F9OL 4ZQGA 2OHJA 4IOJA 1ADJA 1WYJA 2RDMA 3F64A 3QG7H 4HNUA 1ODFA 1OQOA 4RAHA 4LZAA 1CVIA 1GRNA 2V6IA 1OEZW 1PD1A 1C1YA 2AJLI 3A4MA 4Z95L 3KPYA 1SRQA 1EDBA 1JZJA 5E8PA 1BSIA 3M45A 5I26A 1RERA 3MUJA 4M1OA 4BNWA 3MWGA 3G9VA 4ABWA 4DCGA 4U1KB 3ICPA 4NMLA 4HDKA 2J4CA 4KQFA 3GOHA 5E1AA 4QXRA 4K7PL 3VXTA 4EBQL 4AENA 1LQBC 2HKFH 1LVUA 4D9RE 4WZ6A 2J08A 2RK4A 1KCUL 1J0KA 4F7MB 2PSSA 1SHWA 5TGTA 1YL7A 4KK5D 4KJZA 3H19A 2IUTA 3DFIA 1AGXA 1GZDA 4UQ2B 3WMRA 3FUDA 2W4MA 1WLSA 3R2JA 1E20A 3FX2A 3GL9A 4BKLA 4JSRA 2XCRB 2JB6B 2C5HA 2ECOA 4X6DA 2CWRA 1KHTA 4BNHA 1H6DA 3UC0H 2H08A 2FDBP 2H6EA 4NMMA 5JZBA 5INDA 4YT2A 2VXQL 1E8DA 1T13A 3MHPA 4ZARA 2ODAA 1AKQA 3DT8A 5HJDA 3TBWA 1PZMA 4A2MA 4LTMA 3TT3H 1Q94B 3KXIA 2UZPA 4LYFA 1YEKH 4XHJD 4KPUA 2DRIA 3OKOA 4DO4A 2XU9A 4J16A 5KJ4A 4XP6L 2HVJB 5B8CA 3OQ6A 4Q93A 2DLIA 3TF5A 5AB9A 1KXZA 4RULA 1T9KA 5SV3A 5IFJB 3JAWA 5CMLA 4PJAE 3CNOA 2H00A 4HZLA 2EJ1A 3VNSA 4KI7A 1KFBB 1MF2L 3SXUA 4UU8A 4MWFB 3HZMA 2JGFA 4NS1A 2CDNA 1N4XL 3R19A 1X1CA 3S5LG 2FTAA 1QLEB 1L5ZA 5IJZA 3F6RA 2VOEA 1IZKA 2VCEA 2I1VB 3WGQA 4B9PA 1KDTA 3Q5TA 3BGSA 3MERA 5B4MC 3UN1A 4DKEL 3MNMA 2ZIGA 2H5JA 1O3YA 2F8MA 5FOUA 3T0VA 2R23A 2AK1L 4KXLA 4XHQA 1IPHA 4OQMA 4JFHD 2NY5L 2CDGB 3N0RA 1UZ6E 3ATAA 4JR9H 3R77A 1JV2B 3ZE0E 4YASA 5JAPA 5C1OA 2NSYA 3QORB 3IRPX 1JTOA 5EZJB 3ICEA 3QIWC 3QORD 1ACCA 2UXVA 4R4BA 1UXMA 4GICA 4A23A 4RBPH 3AESB 3EIUA 4G8FB 4LESA 1XD8A 1D1PA 4EJ0A 5E2TL 3EADA 4LDPA 3GW8A 2OTWA 3VSDA 4LU5L 5CR8A 3W39B 3OAUH 1IXSB 1R8YA 5BUAA 4AP6A 3VJMA 5TNXA 4D92A 1IC0A 4PJ5B 1KZYA 4HXFB 1QO0A 4OXRA 4Q6IA 3PFQA 1NRIA 4PJ5D 3UAVA 1RURH 2WR8A 3BICA 2BS71 3HI5L 2AQ1A 5LIPA 3WYNA 4HUCA 3EJJX 4KU4A 2PWFA 3H4IA 1PR3A 5BQXA 1SCNE 5K9OB 5IV2B 3W4IA 3AUSA 3EIEA 2HH0L 4GKBA 4JRWA 4XFKA 2Z5FA 5AUNB 1XF5A 2G28A 4LPUA 3R1IA 5D7KE 3LCJA 1PQUA 3PNKA 3KT3A 1WFTA 1XMQB 5ITFA 1ZG3A 2CCLA 5K05A 4UPVA 3A6BH 1PZ5A 1ZOIA 1IC7H 2K4MA 3PC8C 3PHIA 4CKWA 3DXAA 4L3ED 2XH8A 3CHSA 4BWTA 2XMDA 4DP0X 4FQXC 1H2FA 4JY5L 1OPRA 1YA4A 1UZNA 1TKWB 2CUMA 3RO7A 1PAUA 1A02N 3PNPA 1IMOA 3I9V1 5AZEH 1I8AA 4QKQA 4R7NA 4L57A 3GGWB 1WZ1H 4ONGH 1RLBA 1VJTA 4QHMB 4QPCA 2X53A 3ZKSD 1PEAA 4PQRA 1AC5A 1KJ2L 2OYMA 1JNHA 3VYUB 3JYBA 2YK1H 4JHUA 5EZPA 3PDGA 1WBYB 4G0YA 2ZX8A 3BEWB 5L9AA 5JO0A 2E0IA 2GYYA 4WSOA 4O2AF 3U7HB 3LKRA 2BWQA 1A7OL 4GIBA 4GEJA 4WY7H 4JOQA 2XZDA 3M5WA 5JU6A 5HGDA 3CWCA 3PI7A 3GLHA 3KCPB 4IMKA 5E56A 2Q45A 1N10A 4LIQE 1HZZA 1JXJA 3BW9B 2IYRA 2WWKT 7PAZA 1SXJC 3Q9LA 3DDOA 4BYGA 1E4KC 1QVVA 3SAJA 1XOIA 1ZUD1 2G04A 4FJ6A 4AM0A 1FXSA 1BS1A 4AMBA 4FHJA 5E6IC 1YIDA 2J0UB 1FL5A 3LKPB 3IRUA 5T5NF 1DTWA 4RGND 1TQCC 3AAZA 5CRIA 1S9YA 5B3KA 3BIKB 2F0CA 2WBJA 1XJQA 2XEXA 4DJ5X 5I1AA 5DYGA 4ENRA 3GK8L 1RQ7A 3UMRA 3UPAA 4E68A 3F9CA 2DWYA 4BNXA 3FLEA 3M6MD 4ORGB 1XTBA 1JF1B 1W88B 3QWHA 3JXEA 1IN8A 5D2NB 1OJ7A 4C5BA 1NFKA 5DW3A 3S1AA 2WWHA 4JI2B 5IH7A 1EFDN 1RAIA 1EWYA 3HHMA 1DP0A 4CU6A 1DWPA 3K3PA 3HAEB 1GSIA 4BNYA 6AT1A 2E4WA 5LG6A 4E42B 2XOKD 3PY9A 3T95A 4Z53A 1HETA 3KJEA 1U9JA 4P5EA 2B69A 4BTEA 3U7WH 1AHNA 2EICA 1XAHA 3UTPE 2ZBFA 3N55A 5DIFA 1FF9A 4AP9A 1ZQ1A 3LYHA 1I3GL 2QTNA 3KG2A 2OQIA 4D94A 3HDVA 3CVCA 2BX5A 3TCLA 3ABRB 4H31A 1XN1A 3N85H 2CVQA 3GLIA 5DK0B 2C3MA 2NZXA 3KYCA 1SZCA 1E9PB 5DTMA 2H3HA 3HNVH 3OKYA 3RB8A 2XKNA 4A9AA 2G0KA 3IMRA 2X9ZA 2ZWIA 3GXDA 2EEBA 1MFNA 5EF3A 4V2BA 2XUKA 3I1YA 4M5YL 4EDFA 1L5VA 2F8TA 3WLAA 4IGBA 2X12A 1IX2A 4MNQE 5IB3A 4FQ8A 1FH5H 3LPNA 3QULB 4AEFA 2A83B 2RGXA 3LNCA 4AYMC 2KMLA 5LZ9A 5IK3A 2IYTA 4CR7A 3V4OA 5AICA 4HAZA 4MKFA 4FC6A 2QRVB 4XTCS 3VDAA 5EOCJ 1JFFA 1SXHA 4WV3A 1TYAE 1GLVA 5GS0D 2IEBA 5ADUS 2KSQA 2Q28A 3VXRD 3NEPX 1DUYA 5JJ5A 1X6NA 3T5AA 3DMYA 2AJXH 1QNIA 5FKAB 5BV7L 4YZFF 3MBED 3SDCA 1B4TA 2V4UA 3BRSA 1YCDA 1U6IA 3RUGA 1E7UA 2W0FB 4UNQA 3W1ZA 1RWWA 1UCBL 2PANA 1P7YA 3ARPA 4YAFA 3OIGA 5HUQA 1DIRA 1LC0A 3TAXA 3SGKA 1UADA 2OPBA 3G9XA 3BQUA 5FLKA 1RLMA 2DWQA 4YRMA 2NXYB 2R4UA 4K07A 2WHVA 4ODHH 4I1PA 2IEDA 3G17A 1ZCAA 4E15A 2O4CA 3RTDA 3RIFF 5J4VA 2QIOA 3KOMA 4TRPH 3UZVA 4S1RL 4KVPA 4WECA 3P73A 4KEAA 4QRPE 4WKZB 3R8QA 2O20A 2J09A 5JV5A 3LKSB 4WOKA 3GIZH 4LV5B 1RXEA 4K8OA 3WTSA 3VHRA 1IZYA 1AKEA 4OSUL 2CDEA 4WFED 1I6MA 3R6LA 2ZCUA 1LI5A 2NYYC 1RAAA 5EUCA 4IM7A 3ME0A 5JDSA 3DX1A 2HMTA 4CYMA 1Q3TA 1U2RA 2BMEA 2OAEA 1JSYA 4LEOB 1ORQB 3IMSA 4P1ZA 2RCYA 1D7FA 2XUJA 4D0LB 3GIWA 3CZPA 1QATA 1EUCB 4CCYA 4FDAA 1BDHA 4NQDA 4DCSA 4Y4KA 2LLLA 5JMTA 3FPEA 3WX0A 5EIBD 2G9ZA 2PWGA 3VO9A 1X44A 4P36A 3OZSA 4GZMA 2A3TA 3IJYB 4QGTA 3Q5DA 2XB9A 3WRYA 3F3MA 1WUHS 4YHOH 3BAKA 3LFTA 3SMVA 2B34A 1MX9A 1RUQH 3SSNA 4GE0A 1D0IA 3EBOA 1QH8A 4JFDA 3P26A 5F89B 1NVGA 1CULC 1H65A 1GGHA 1N59B 1Y1UA 1JHLL 1IL1B 2A0LD 4UIMA 1MJJB 1AC6A 5G0TA 2E6KA 3ZL4H 1OWWA 5HHOD 1ZOOA 2X6BA 3GVCA 3WISA 4F57H 2P9QA 3L6FA 2Q8BL 2PUDA 4XPTL 1O87A 4H25B 1YUKA 2CXKA 3ZWAA 3TZQA 4ZD6A 1QSFE 4TNVK 2LE0A 2Z6QA 4LBYA 2QJOA 4POZD 2MMCA 4PRDA 1YRQA 1XZ0B 2A6KB 1JHAA 4L8SB 5LGJB 2O2ZA 1T83C 2E8ZA 4RD1A 3W2DL 2UYLA 2MCPL 4OATA 3ICWA 4HUVA 2Q4EA 3F73A 2I6QA 1L5HA 4KDEA 3O9WD 4DVRH 4DQOL 5C07B 4LXFA 1TUBB 1X3LA 1NBCA 4TTIA 5C07D 1NR7A 4K03A 5B6PA 1N5KA 3OUUA 3FUJA 1OOEA 2CHQA 2FT6A 2BY0A 4GB9A 3QUYA 2OTPA 1KXQE 1TTGA 4UMEA 1S9WA 1FIGH 3RI5F 4BKQA 1U4NA 1GW6A 4JKIA 3BVPA 4KN9S 4AJ1A 4OYYA 3EZNA 3HCOA 4CC0A 1KETA 2BO0A 1KC1A 2NDFA 3F6BX 5SWQB 2HX1A 1EV2E 4DLLA 5ID0B 2NNXA 4X8OA 1BMQA 2O1WA 2ISDA 4TTGA 5IREA 4Z7JA 2ICCA 2CT8A 4DJFC 2A5DA 1KTLB 5JW4N 4QPNA 2DWEB 3ODPA 1IM9D 4MS3A 3UYPA 5IFAH 2FATH 3TJPA 3GB9A 2ZWNA 4LLAA 4BZWA 1MFCL 5DS8A 2BP8A 2VUUA 4DGVL 2J48A 4CNIA 2H0FA 3NCXA 2HEIA 3ZGZA 4GQAA 4OI8A 5J59A 4NRZB 3CZQA 3KNBA 5T3YA 2Z2XA 4N22A 3FLBA 3QDMD 2AQ2A 1I1AA 5GQBA 4NHUA 4BH8B 4YHLL 4NU0A 3RS3A 4J1NA 3V0FA 3VDXA 2ZAGA 4XJXA 2VTBA 3IB3A 5H37H 2YD0A 1NCOA 4HLDA 3WTTA 3V79C 3ZLTA 4MVWA 4NZTH 1WW2A 4YS4A 4Q6BA 4PPGA 1YEWA 4LJYA 4LC0A 4M43H 3V4PH 2Q3DA 4L3FA 5CK5A 1E40A 1ZGCA 3S81A 4LVEA 1GW0A 2D9CA 1PL6A 4I1NB 4KZCA 3D0QA 1XD2A 2Z6FA 4XEHA 4K7FA 2Z7WA 4U1SA 5E1GA 2ZXFA 1JGTA 2VMJA 2WTRA 3TBHA 2HNAA 2X8AA 4EI5C 5FOSA 4CCSA 1G5GA 2GTZB 3X3FH 1NL3A 2FSUA 4RH3A 2A74B 4OM8A 1T6BY 4C56B 1BAGA 3F47A 4NNPA 3CLRD 1U2HA 5BQPA 1D2MA 4Q3AA 4OY3A 2P90A 3DEYX 4KNVA 4CQMB 3SY8A 3IO5A 1JR3D 2JAPA 1TPXC 1TW2A 1M7HA 4XCYA 5AM0A 2IXQB 4BCYA 1J1UA 5TPZA 1Q7GA 3NEOA 4AITA 3HN8A 1GLGA 1HSZA 3N76A 2BONA 3KJ4B 3K9WA 2HKFL 4WNSA 4GMSH 2J6BA 1HL9A 4YK7A 2J0EA 2OAQ1 2J4FA 2C9AA 4QG7A 4O25A 2JAWA 2Q3HA 2YO3A 4GGPA 2CK3A 5DRZB 5DRXA 3K6KA 2WWVD 4FCAA 5LBTA 1T2DA 4DCUA 4L7QA 5IB4B 3JWJA 3I9AA 3HJFA 3BD3A 4J6IA 3KPRA 3D7MA 5M34A 3ENVA 3AREB 2GK4A 1SPBS 2ZJ1A 3FB4A 1TVKB 1VP9A 3T9AA 1NN0A 1KZ1A 3UC0L 1X77A 2PWZA 3Q2CA 1YB1A 3Q43A 3B3AA 1FVEB 1D2HA 1HT0A 2PVSA 3RWGB 4XP9H 3E9CA 3WLTA 4S1DC 1OI3A 2C20A 3TEXA 4URVR 2OZNA 4HHEA 2D2CC 3TT3L 2CJTA 3UB2A 2I9KA 1OAXH 4NX2A 5DCCA 3L5JA 2P79A 2DKOA 1YEKL 3VFTA 4W9RA 3BERA 2P4SA 3I2HA 1M2FA 3LZQA 3DJRA 4WHDA 1KY4A 3PUCA 1AA9A 3PQFA 3QMMA 3FN4A 3JD1A 5EJ7A 3U0PA 2GAOA 4IHAA 5ELXA 2A30A 3L8MA 3L3JA 3MVEA 1I8MA 3EWAA 3R40A 2PWHA 4RA6B 1NGXB 4D0CB 4GWKA 5D6DC 5IABA 1IAIH 3CPHA 2C8NA 1J2EA 3FDFA 5A2JH 4CUZA 4W9NC 1FV1A 4YX2H 4MUBA 2EDEA 3RIYA 3ZHNA 3L0YA 3ULVH 1Y82A 1TU2B 4ND1A 5CFPA 3VXNA 2FGZA 1SUAA 4FHCA 4N6RB 4AVYA 4I48B 3SD2A 1EP9A 2AUMA 2X86A 1TAQA 4LDZA 3IUBA 2SEBB 2KI6A 4Y9RA 5CGYC 5CP3A 3LB6D 4JFYB 1G9XA 4OP2A 5K4GA 1NBHA 4F45A 4OKVB 4GMFA 4YHZH 4TTVA 3GRRA 1AGDB 4B40A 3OAUL 4M76B 4Z23A 1S8NA 2DYRB 2QMOA 5J63A 3LBIA 1DVFC 4PJDF 1RURL 1QCCA 1NYRA 3IAQA 1CUIA 3Q8AA 3NEJA 2Q6KA 1ECZA 3KUUA 4AY0A 4NR0A 2NMSA 3OFVA 3OJVC 2R1VB 5HVWA 4JI8B 3EJPA 3QK7A 3ESNA 1J9ZA 4EN2A 1AGBB 2XETA 4RZHA 1IC7L 3U7YH 2PRYA 2QZJA 1O7JA 5FKJA 2ZUYA 1RI5A 1ZO8A 5FCUH 3NSXA 2YVLA 2IS4A 3D8UA 4P2RA 5HFJA 1GNLA 2BGLA 2AOUB 3D85D 5AZEL 1BQ3A 1MFMA 1TLMA 3UZQB 4OJQA 1CUGA 2ZANA 1WZ1L 4D42A 4ONGL 1QQ6A 5DNYB 1ZNWA 4Z4CA 4CSSA 5BV0A 3QU2A 1K86A 5DM0A 5J06A 5JC8A 1ACMA 4TTDC 4U6SA 3BH9B 3GUVA 2YK1L 3OB8A 3KTAA 4EG7A 4YHKH 2FWLB 2J30A 2ZIUB 3HBJA 1N67A 3NHPA 1INLA 3VFSA 1YMUA 1MHEA 3VFPA 1IN1A 4DZBB 1TKAA 3T8VA 3BN3B 2CLVB 1O9WA 2FJSA 4P46B 5ICEA 2OYRA 4KN5A 1HU8A 1Z5YD 2KHAA 4HLJA 5I3ZA 2EDXA 3FB8A 4AN1A 5L8LB 1C14A 3B7PA 4Z6AT 1AY1H 3H9SA 1GQ2A 2P80A 3NC1C 5KS9A 4N1EA 3SQBA 3EYOA 3L5IA 1VHTA 4BRWA 5DM1A 3LOPA 3MREB 3PEFA 4JI6B 2WM2A 5BOJA 4JFFB 3JD0A 3NYIA 4MDHA 4N47A 3NLLA 1XH0A 4AJLA 1FNLA 1ZMYA 2QJRA 3ZBUA 1CJUC 3W6PA 1T5IA 1F2XK 3HJNA 3KV1A 5HJ2A 2CZGA 1ZNZA 2BHTA 5GRZA 4QXAA 5LLIC 1F3OA 1P0CA 3V52H 4E7OA 1U3ZA 4QPJC 5DK2B 4ZQKA 4MYCA 3GJFK 1Y7IA 3F58H 3C3EA 1XT6A 1FQKA 2J9FA 4EQZA 1E3SA 5AKTA 3KXFD 4R90H 1VF5C 4F84A 3U7WL 2LCIA 2W6QA 3ASYA 3CGWA 1NASA 1WA0X 2QNIA 3ADPA 2XNHA 3V1LA 4DDMA 4U1JA 4YDJB 3AFNA 1JDZA 3QS2A 3DD1A 5H4ZA 5LLSA 1Z8NA 3RPBA 5KWYC 3OEWA 4KI0A 4UHDA 1JA1A 1F38A 4MDIA 2QRQA 3MTBA 3HNVL 3WL7A 2EVFA 4DK5A 2O1XA 3JWDH 3ZWWA 3TIGA 5IQNA 5SICE 5I1DB 2Z2IA 4WDQA 2AXWA 2D06A 3L04A 3IXTA 2WGNB 1EUZA 2HPZA 3WJMB 4TZ0A 4I6EA 3SDZA 821PA 4P3YA 1EANA 4A2DA 1UH4A 3TA3C 1E66A 2ZRMA 4ZQHA 5F5NA 1QU3A 2Z8ZA 3QEAZ 3PCYA 3EG9A 2C59A 1RHRA 1CYXA 4WY5A 3D3WA 3ZMRA 4UZGA 1NSNH 4QASA 2OSLB 4ZUSB 1FH5L 3HN7A 4NS4A 4YRZA 2UYQA 4O4JF 2PKQO 1E2BA 1E42A 2G4LA 3UY4A 5BUQA 3FQTA 2AV6A 4IWNA 5EBMB 3LC0A 1W4ZA 2ZZMA 4PY7B 1CBJA 1IM3B 1R0KA 3O2DA 5L3VA 4CV3A 4JM2D 3LVRE 1UACH 3QDJA 1TAGA 1IM3D 5BV8A 1BIHA 2SHKA 4CSPA 1JKMA 1MWOA 2WT8A 4GW1B 1T89C 3KHQA 1BG9A 2O3QA 2LLGA 1KDRA 3TSCA 2H4ZA 4FHZA 3Q2WA 2A73A 2AGJH 2XG4B 3GEHA 5C8YF 2JZOA 3BT7A 3HVDA 1OFUA 1NF2A 4HS6B 4PIPA 4HQ0A 5BUSA 5EU3A 4LJSA 3SGEH 2W5PA 1LO0H 1Z0ZA 4ODHL 5GGTA 5IBUB 1DAOA 1Q0YH 1HQDA 3I9PA 1JE0A 1GXEA 3GLDA 3NSFA 4OKSA 4BCCA 4BVJA 3PGJA 4FNUA 3ZYZA 3NTOA 1MO2A 4M87A 3GIZL 2CHXA 3ECBB 1LH0A 3UA3A 2CNDA 2HA5A 3G5ZA 3Q6IA 4G8GA 5K20A 3II1A 2WQZA 3K6SA 1HHKA 2C8JA 3DK0A 1TCMA 5B53A 1TW3A 4EOGA 5G4MA 5C0RH 2ESRA 5CZVH 1JBJA 4QT4A 4XCQA 1EBPA 3NTUA 4FZEH 5HDQH 4C54A 4U63A 3IJPA 3HS8A 4IICA 1DDHB 3CJJA 1HFUA 2XNCA 4IJ3C 1YHZA 4ODWB 1OXBB 2BVTA 3MUFA 4B3TB 3DUFB 3FONA 2YY6A 3FOMB 1UPBA 2G9QA 4NYJQ 2R8XA 3KJFA 3TO5A 4BB0A 3PV0A 2YN3A 2DY0A 2C5EA 4I3FA 2G1KA 3F98A 3UIZA 1MQAA 4NJMA 1IBBA 1E5CA 5JR1H 3TPZA 3UGQA 1ID2A 5IP5A 2YW2A 5D1ZI 1Y1SA 3O0DA 4NQXB 2WK2A 5JFOA 4HLQB 1RUQL 4LP8A 3NHSA 4NBWA 4NU5A 1F0PA 2JGAA 4JASB 3JQ7B 1IAVA 3QF4B 5LP6A 5JASA 1BA3A 4DANA 3RUCA 4O4LF 1TVBA 1PTZA 1JAEA 3F90A 3KEGA 1U02A 1YIAA 2SCUB 3ZL4L 5F4ZA 3FUUA 3U83A 4PO1A 1HCYA 2WYUA 4HUJA 4OZFH 2DQKA 2ZUWA 4F57L 2A9FA 3KOOA 1DKUA 1A6AB 4GP6A 3CFYA 4FMDB 1OO2A 1CYGA 5DZSA 3R0IA 1XZGA 1MGPA 3R5HA 2FJUB 3T3OA 5FO1A 3P3UA 3GXOA 3SBOA 1P5UC 2J1KA 2XXMB 1TAUA 4CEJA 1M7DB 3QWIA 3VNVA 4FJYA 4C2UA 3D6JA 3U3KA 2UWEF 4I4TB 4YIQB 1XYGA 1LF5A 3AACA 3JQBA 4WZAE 1H3XA 4PAMA 5CX1A 1CTOA 3JRNA 4Z99A 3OT4A 4CMHC 3JQFA 3L6BA 5H80A 1P5JA 2CRIA 2LDBA 3EPRA 3F7MA 2ZWYA 4ENQA 2WWIA 1O54A 1FIGL 3QWFA 3BHBA 4X3OA 4EKJA 1IVNA 3QEKA 3GLFB 4LRIA 1D9XA 4TUJA 2GQ0A 1PL7A 1AKJD 4C7JA 3SU8A 1ORSB 4CBZA 1A3CA 3ZWPA 4G1UC 1RI2A 3EDJA 2JJ2A 4NGHH 1J8HA 2HQRA 3CUWA 1EHAA 1ZP6A 5C8JA 4KI5E 2PIDA 3EO0B 2Q0QA 2D7PA 2XE6A 1NN1A 5KDLA 1Z06A 5IFAL 2FATL 3RU7A 4JLRA 1IV8A 4KQ2A 3IUSA 3LDBC 2XUQA 1CXHA 1UXJA 4QYSA 3TDMA 3ZZSA 5JH7B 1LEGA 3PKZA 5ANRB 1NC4D 2RHRA 2BINA 5A4MS 1E99A 2FR8A 2LFEA 4UINH 3VR2D 1TL7C 2NU7A 1RYEA 3ZWDA 1HINH 3UYLA 4WHCA 4MNHB 2QLFA 3S2AA 5ENWA 1SELA 4EKIA 3RYHB 2D00A 3TNLA 2LOEA 4NZTL 1QANA 2WOYA 2HJWA 2VW6A 2HDHA 4HAKA 2BGGA 3N74A 2HJ9A 4Q4IA 4N2DA 1W2GA 2PCFB 4EB3A 4M43L 3V4PL 2HSZA 2J43A 3UAWA 5H4YA 2IBZX 1XLUA 3IFSA 3WIHA 4BMCA 4PBWD 2QJWA 5DA4A 1KEMH 3HXPA 2FFQA 3EBIA 3KJHA 1JTPA 1KSFX 1V37A 1DOAA 3X3FL 3QNUA 3EOAA 1GRVA 5C9KA 4IDBA 3WK8A 2H3NA 2JBWA 4PVCA 4EKDA 1HG1A 3NYQA 3N91A 5J12C 1IHUA 5B1EA 5TGZA 1X5MA 3PHJA 4FHEA 1TM5E 1J09A 2MJLA 4A16A 5HHME 3P52A 3BHIA 4GDFA 1TZOA 3KGRA 4WSJA 1SVKA 4HJTA 5LMZA 5CFRA 4TSRA 4ESVA 3FNQA 2DBYA 5EJ5A 3ZJAA 4ZODA 2HT3D 4N1HB 2ZAIA 2H26B 2VK8A 1JJUA 5D72H 1H8HA 2JCXA 1ZS2A 2L7QA 3OBIA 6CHYA 4GMSL 5EG5A 3SQMA 2ZYTX 3GGDA 4JYZA 2XXBA 3A1SA 1SEQH 5DMYA 2QGNA 2CHGA 4L8BB 3PZBA 1XGKA 4H8HA 3KPQA 2IP1A 2EQ5A 2X09A 5D8JH 1GU1A 3AJ8A 4BNMA 4YHIB 5E9DA 2SECE 3H1ZA 1MW8X 3VKHA 4ESOA 3DLAA 3PIIA 2J5BA 3NCTA 4W5HA 2Y22A 4FD3A 2FQFA 1OB1A 3MV01 5MHSD 3BJLA 4DJDC 1USIA 1UQUA 2QBWA 4F2ME 4DN3H 1YI1A 4C59B 1MCDA 1U7PA 2OB2A 3C5ZC 4PYHA 2H0AA 4QWWD 4XD7A 4N12A 1JKXA 2E21A 3G5TA 2OO5A 3IULA 4LKXA 5E95A 4XP9L 2Y1DA 4BFVA 2GZMA 1RRCA 4JFOA 5AXAA 3PRHA 2H2SC 2IYZA 1OAXL 1SZNA 3LDFA 1ZVHA 4ENEC 1XH3B 2IX9A 3WDIA 4AK1A 1E32A 1FPMA 3HMXH 2QMQA 3MRJB 3T3DA 3NCFB 4GBMA 4TYPA 1RAGA 4MA8H 3OKEB 2ZQYA 1WICA 2Y9PB 3KEDA 1SIOA 3B37A 1JNXX 4ZHQB 4GLRH 3ZTWA 5I6DA 1U98A 3NAGA 3CZAA 3ISWA 1UJBA 2XUAA 3WEXA 1OPXA 2BVEA 1IAIL 1LDMA 4P4KA 4MR9B 5C71A 4NBTA 3UXYA 4YX2L 3WWYA 4B60A 4YAEA 1PEKE 4E4YA 3B9DA 3ULVL 2FX2A 3OSUA 4BQOA 2JIXD 3LYLA 1IB0A 1WMDA 1QONA 1TTQB 3WE6B 5CH5A 3IGAB 4HEQA 4DSOA 3NVDA 3L92A 5NLLA 3P2EA 4LSPH 1IKNC 3TJRA 4JRYB 1KT2B 2JRLA 3IAS6 4TUYF 4JRYD 1GC1C 5JMWA 1YE8A 3A1FA 3SC6A 4PJCB 4YHZL 4KXBA 5TPWB 1HZHH 5JXAH 2YQ4A 2DP4E 1Z22A 4L8WB 2DWXA 3SZGA 3QQ9D 2NMVA 3C3XA 2A7BA 2V0GA 4NP6A 3GJFA 5BY2A 4APQB 2RFXB 3NFPA 5FCDA 1GGEA 3SM3A 3NGMA 4LLMB 1Y5MA 4UBDD 1PP4A 2VLKE 3PG2A 4J4PD 4BJHB 5F71A 5DK4A 3IETA 1AR1D 3GVXA 1K7EB 4V1CB 3TO4A 2J6HA 3L02A 1WBDA 3JATA 5F9DC 5SWSD 1A9EA 4IZOA 2VDJA 4HUWB 3NCHA 5JSHA 2G2PA 3AF6A 3N75A 3SJZA 3LIZH 3EJYD 1QR1A 4GAJH 4EQ6A 3U7YL 1G5HA 5JWRA 1F97A 4G25A 3A4VA 4Y19E 5FCUL 3UTSA 2GOYA 3EGCA 3N07A 1Z33A 1T0NA 3R3SA 3OOHA 4H77A 3L45A 5C0FB 2EW8A 3CCHA 1A66A 2YJZA 2JGKA 3D02A 3R5JA 2WA1A 5CD1A 2N42A 3MYZA 3TIIA 4E7PA 1JWMA 3I2KA 5A1JA 4ZUTB 4EFMA 3VDNB 4H35A 4Y5XC 4HMEA 5ETUB 1QX4A 3AOGA 4OIFA 4YHKL 5A2LH 3IJ5A 5BRAA 1IRXA 4NZUH 3MWLA 2I26N 5DC2A 1OXSC 2Y6TE 4IJTA 2FSHA 3V0JA 1TM3E 3NIFB 4JP5A 2P2SA 3DDNA 4KXVA 3ZQ4A 5CYOA 1POXA 3TSAA 5BSHA 2X2UA 2X0UA 2AG1A 1WFJA 2NXZB 4RTQA 4ZUVB 3KXDA 1EUQA 5CCJA 1VKXA 3KYOA 3R75A 2NXZD 1J97A 4D25A 3MXWH 3M7OA 3W2IA 3SDXA 4GRLC 3I61A 2OM5A 4RDBA 3K1ZA 3LPDA 3BGFC 1SKMA 2FFHA 3T1HB 1JD7A 4P5TD 2WYTA 4JO4H 2O5VA 5CEZH 3GDGA 3TQRA 1AY1L 1QV6A 4NXKA 4WLUA 3WBJA 3GHHA 5CX4A 3S88H 1KI6A 1ZFNA 3OE5A 4J49A 1U2PA 3MGTA 3RVTD 2O2CA 4X3CA 4AUUA 1F86A 4G0OA 4UT7H 2FPIA 3TZEA 1QO3B 4U6XB 2OMYA 3OT1A 3D6FA 5KBYA 4QUOA 2PKDA 4Z7VA 3OR6A 1FGVL 4UQIM 4X1KA 3V33A 4IGAA 2RHCA 3MLEA 3T34A 1VYTA 2QUZA 3OFNA 3V52L 4A1RA 1NSTA 2Y5TA 4CIWA 3KLAB 3F58L 4KMLB 3TEJA 3UH1A 3VVMA 4TXVB 4BEWA 3MX0B 1BW9A 1CDHA 4LCYA 4R90L 5BVPH 3SLKA 1DV2A 2A6JA 1YQQA 3UADA 1NKOA 5JDCC 4ZMNA 3ZD9A 2GJKA 4JFED 3HBNA 5MERB 4Y30A 1PBYA 1HDYA 1V95A 5EAIA 2ZXEB 1GPH1 1ZGGA 3MB5A 1KTJA 1KBWA 4YQXH 3GN1A 1T8RA 5DHRA 4Z4IA 1WS6A 3D69B 3DZCA 4KQEA 3KPOB 1M0WA 2OR8A 3NWEA 4ZYYA 1JQLB 2FR4A 1P7BA 3E3QE 4OUUA 5E8DH 1Q9KB 1FFOB 5A4FS 1NGPL 2JJUA 1AHWC 1R3LB 2VR4A 3PWUB 3Q9SA 4CF6A 5IVHA 2Z7ZA 4U31A 1H42A 2OEPA 4QL3A 1NRXA 4GPEA 2D7OA 5F7XA 4YHPB 1MNNA 5AVKA 2Z4QB 1KG0A 1SHUX 2EABA 2F9BT 1CXKA 3O8OA 2B3IA 5K6TA 3B2EA 4LY3A 1JILA 3L0ZA 2B4CH 5BO0D 1R8QA 1NSNL 4IU3B 3BCUA 2V1XA 1BFVL 1QUNA 2DLNA 4BPBA 4BN4A 5EP2A 2PS9A 5AHKA 1A04A 3EY9A 5D7NA 1G7IB 3MBOA 4BAUA 3I9IA 4NBUA 4XQ0A 3HB3B 1UACL 3HB3D 3BYYA 1CY2A 5TQVA 3OKFA 2X3YA 2QP9X 2AJZB 5F3DA 5FW7A 2Z57A 1F6BA 1ODJA 3DIFB 3BWYA 2O05A 4JI1B 2AGJL 2XQBH 1E2ZA 1MEOA 5K3OA 1WPCA 4A0RA 4TQHA 5JXJA 1I3CA 2YMOA 4D2IA 3W3AD 1NV8A 1OPGH 4R3SB 1RKUA 4B27A 3T4UA 2FP3A 4O29A 4E4TA 5JSZA 4XMKH 4E5KA 1FLAA 5GY7A 1FU4A 1YS2X 3WY9A 5JVDA 1LO0L 5BMVA 4HUNB 1KIRB 1Q0YL 2BMFA 3EC7A 4N0UE 3ATDA 3MOQA 4KRGA 2OV8A 1X1SA 3F5QA 1DRKA 4L1LA 3LRGA 4M1MA 4JC5A 5BS0B 4MA3B 4ZAKB 3BUIA 5E2JA 2EYTA 4ZAKD 1U9YA 2I7TA 4P5KB 4WFGE 3EFOA 2HRLA 2P40A 5CS7A 3UTZA 4RK1A 1OAYH 1XSIA 2E9GA 3WB1A 3Q3CA 3NUZA 5C0RL 4R3WA 2IYAA 5CZVL 2J5LC 4JY6A 1H6BA 1IHOA 2MU1A 4LMQI 4FZEL 3FYIB 5HDQL 1NW7A 1LBHA 4TKLA 1DLJA 4ZRMA 1X7DA 4AQ8A 3SDAA 3VXPB 3VXSD 4E9YA 4TVPD 3BZUA 5HYQB 1PRYA 4Q4AB 5CITA 4GG6B 2A2ZA 3QIAA 4OQXA 4L5FE 2HADA 1H6TA 1FYTE 2QM7A 3NWBA 3FHJA 3MT8A 3UTQA 4NICA 3H9YA 3I02A 3VZPA 4Q9DA 2BI8A 3V10A 4PS8A 4J2QA 4PONA 2IWGA 3FHLA 4OEHA 3BXPA 3FDJA 5E6RB 1IAII 2B0SL 4KO6A 4BKPA 3K70B 3O83A 5LBSA 3APDA 4UAOB 3DI3B 2ZWVA 5DMXA 3K70D 5LNGA 2ED9A 4K9OA 3WIUA 3MCAA 1CEYA 3O1JC 1YUHA 5FAAA 1OOAA 4XXDB 4L2LA 5GRWA 4J2HA 2QLVB 2AJTA 3EQ6A 2P2LA 2C9VA 5C1IA 1XELA 4KZKA 4GOOD 1T8YA 2ZXDA 1RDFA 4BVAA 3PQYA 4N2EA 5J13B 3BA1A 4Q7JB 1YK0A 1BQRA 4NDZA 2GIMA 3SYOA 1JDTA 1NVBA 4N3AA 5EQFA 4U2BA 3HDTA 4IJQA 4M6WB 1D9KC 4NKOA 1E3ZA 1J0YA 5AW8A 3KYDB 1FP4A 3G2MA 2B61A 2I8LA 1GPKA 3Q7JA 3IE1A 4P2QA 1SHZA 2JHGA 5ACLA 3IGKA 3HKDB 3C5XA 3FU5A 5LSAA 5IJBC 3LDHA 3EJQA 3TCNA 4UEOA 1R0SA 1EK5A 5EMLA 4X95A 1JGDA 1ED3A 4CM4B 2IPUK 4PP1C 4RLDA 3WIOA 5EUOE 5E4FA 3IWVA 4NGHL 3NZSA 4BFLA 3AVQA 1CWUA 2F7IA 1M74A 2AA3A 2PPVA 2YLHA 3H9BA 4LF3A 2WANA 4M03A 3ZRSA 3WP1B 2B9BA 1JMZA 5DFTA 4K5QA 3TF4A 4ARVA 3WN5B 4XVQA 2I07A 4CGZA 2EUVA 3UEOA 2HPTA 3N2JA 3HCVB 1RS0A 1VKHA 5H3CA 1MIMH 2VQ4A 4QRFA 3RWEB 3GAZA 3M1IA 5EEVA 4F1WA 4UINL 4ZZ1A 3ZK0A 2P7TB 5DNCA 1HINL 1IKOP 3GA7A 5FBWB 5AUMB 4YQZA 4C8XA 3ZHSA 2PGAA 3HZKA 4E5SA 4GAFB 1TCRA 4KC3B 3EPHA 5JRDS 2ZWZA 4GO6B 3DONA 1NJ5A 1DTUA 1Z4JA 4BINA 3E05A 2ZF8A 4OXIA 1A6ZA 4FW9A 1JKJB 2EDJA 1KTKE 4MGIR 3OAYH 3QUGA 1TEZA 4EB6B 3NANA 4PG5A 3L93A 3N8DA 3O4LE 3CLFH 2O2YA 1NQXA 4ZCRA 4DPMA 5I4KA 2LVCA 5EE1A 2HX9A 1XIWA 4FSXA 2CUTA 3BS4A 2WIIB 2BSEA 4UOQA 3ZDYF 1Q1ZA 1TJHH 1KEML 5ADOH 2NTSP 2PCPA 3MUGA 5TQ0A 1XLTA 4Q21A 1CDJA 1HI6B 4C2TA 4G84A 1E5QA 4ITVA 3JASA 4G89A 3EVAA 4OYLA 3QDGA 1CZUA 4UOJA 3EH2A 2J7LA 1GRWA 4PGCA 4WV1B 3A3PA 3ONNA 5EO0A 2GH1A 3FCTA 4NZZA 2VXCA 2JMRA 2GPYA 1R5IA 4RTNA 1BG1A 4WEQA 3S99A 4Y9CA 4G43A 3KPSB 4U2DA 1H5BB 4PJAA 5H16A 4YYZA 1HF3A 1DBAH 1GDHA 3K72B 3RPIB 4K6HA 4AGMA 3BDVA 3ACDA 2W5UA 3BSWA 4OLVH 2J8HA 5D72L 2CLFB 2XB2A 2CLRA 1LWNA 3U81A 1KK0A 3ET4A 4KXXA 4F8JA 4G81A 3I3OA 4P33A 2P2GA 4MCYB 1CTQA 2VAJA 5DJYA 1P7VA 2RBEA 4DVBB 3UAAA 2EF1A 1ZLSL 2COQA 2EFDB 1SEQL 3U6RB 3TPUB 1YYCA 5E8EA 5BOZG 5MN6A 5EBWB 4MV5A 4ZHSA 1QFYA 3QNYB 1IM8A 5DSZA 3BMNB 3PLRA 4PPYA 4MS1A 1DUZA 4RKWA 4BX3A 1YEDA 2I9TB 2IL1A 1CGVA 4Q6YA 5D7IA 2GSIA 4WCFA 1N7GA 5EZYB 3AVOA 1Z75A 3LSOB 1MC8A 2V3VA 4U6YA 4P2OA 4DN3L 4QTUB 4C06A 2YUTA 4NPKA 4HDQB 2OHGA 2C9ZA 4W1RA 3A6DA 4NFBA 3K35A 4LE0A 3FCXA 4NRYA 4CG0A 3ZRFC 2ADIB 1U4OA 3IQFA 4PJGE 2VLRD 1ISGA 5ENDA 2AJUH 1CJVC 3FZUD 3HRIA 3HWWA 3WFHB 4B6SA 2OKMA 1F90H 5ELLA 2PO6C 2I1QA 3HMXL 4ZMQA 5GZNC 1JPFA 1K5NB 5AP9A 3M1YA 1QIKA 4JFQB 2VH5R 5ALFA 2WXGA 1EZVX 4MA8L 2FPLA 4G1FA 3T5CA 3VXQB 1E0AA 2DM7A 1IBGL 3NIDE 3A4FA 2AXEA 2BSRA 4QNMA 2I5PO 1OC2A 2OWEA 3DHPA 3TR6A 4KZ0A 4ORZC 5REQB 1U6JA 4YNBA 1AZNA 4RAUA 3CH1A 5FA3B 3JVUA 4L18A 2EDDA 1M2VB 4P3NA 3O82A 3EZJB 2ZI4A 1S5IH 3GM8A 3ZE1F 3FJOA 4AQ1B 2O0JA 1XF4A 2F7SA 1XQ4A 3GMOA 1SVBA 1XKQA 3G0CA 2Z93A 2HRPL 2XWJA 4A7TA 1H1TA 1IG0A 1E2NA 3HPJA 2WF7A 3SGEI 4LSPL 3X17A 5KSAC 2C7UB 4U1LA 3TTXA 3A1DA 5LZ7A 2JLAA 5D9SB 4MLPA 4R05A 1IXRC 3HO6A 4HJGA 5GS2H 4AX4A 2G9UA 1IQWH 4YSQA 1HZHL 5JXAL 2ZEJA 3MFGB 2WSPA 5CJJA 4RWYH 1F1AA 4KL8S 1NAKH 1V54B 2JCCB 3VU3A 1PQZA 2XADA 4CLXA 1KBBA 1ODTC 5AI9A 2HAZA 4WKXA 4F37K 4F8QA 2OV4A 4J0CA 1UBFA 4Q9JA 5EEWA 4W5JA 2XTNA 1MZVA 2VPYA 3WDLA 5HRAA 3GXUB 3ZTJH 3K4HA 5FTJA 4TUOA 3DBXA 1ARZA 4C4ZA 5ACZB 1BQEA 3LIZL 1TQWA 2WWOA 5C08B 3GJQA 3FDWA 1IEBA 1A2BA 3CJTA 4AMUA 5GZOD 3Q8KA 4AZVA 4QRHA 2IOYA 1DIOB 3ESDA 3QLUA 1KOGA 4CETA 1KMHA 3HCEA 2BTQB 4D80A 2OXGA 3L4SO 2EEPA 2EZ4A 3ARXA 1Z4LA 2GD2A 4HMQA 4HWPA 2Z30A 1A2YB 1HI9A 3BWEA 1OLUA 4IF6A 5DASA 2YWBA 3NT5A 2CUZA 4R97B 2EDCA 3C60A 4P06A 4HBCH 4L16A 3MJ9A 4KY1H 1OZTG 5C0JA 3HY4A 1GGMA 2Y92A 4BMYA 1T5HX 4IY1A 2OJZH 2FMFA 4BWFB 2A9NH 4LGPB 1RWXA 5DHXB 3WUZA 1Z0SA 1YAHA 1I2MA 3VD9A 4WVRA 1SR8A 1XTVA 4NZFA 4MQFB 5EIHA 1NW8A 4NZUL 5B3NA 2JB9A 1I3LA 3IGUA 4Y0NA 3GRAA 3B6MA 1YLBB 3PL6D 4JNXA 4OGAD 5IMMA 2QMYA 3DCJA 3ABZA 1SM3H 3TB4A 3JWNE 1ZIPA 3NEAA 2EH7H 3MXWL 2PPLA 4NJ9H 3TBKA 1F2UA 1JEDA 3A32A 1Y63A 2ATKA 1BOFA 3AVXA 4JO4L 2HBRA 4DY4A 5E4EC 4ELMF 5CEZL 1PSWA 2R8RA 1U8QA 1BWWA 2A14A 3LDGA 3W9EA 2ZTBA 4MRMB 4V3CA 1PZ2A 2WWNA 2Z2YA 4JKPH 2JDID 3SE9H 4NDAA 3L3OC 4I5BA 4YP1A 4PJIF 2AC7A 3A6LA 3IPEA 3OIDA 3A1WA 2O8BB 1HT3A 3WVNA 3S4SB 1ZW6A 4UT7L 3SSAA 3ZXYA 4CF4A 2IUYA 3M1AA 4W9LC 2HN7A 5A4KA 4PBSA 3MOGA 1QO7A 3FW6A 3JTSB 1VG0B 2VRCA 4N1CA 3I2JA 3RF6A 2G1AA 1AH1A 3SBPA 4DDWA 2ZETA 3FGNA 4LXHA 5IXYA 3BPLC 5BVPL 2WAQA 3GB7B 3AS1A 1C1XB 1EMTH 1SXCA 1QHFA 2R83A 4IZIA 5FLYA 4X4ZA 4AKOA 3WYAA 2NYVA 3H9CA 4RKRA 3EJRA 3T15A 3SE6A 1P84K 3FNHA 2I24N 2O6HA 4NNPH 4YQXL 3Q5GA 3UWDA 3JQGB 2FSEB 4EFKA 5FLEX 1C4WA 3KHUA 3ZCTA 3OCJA 1OXYA 5IJCC 3PAYA 3T7AA 3H5LA 1DJSA 4F80A 5MEQA 5FBRB 1UB5B 4AKIA 5AW9A 3BH4A 4D46A 2FSGA 4X9HA 4DP4X 1CVLA 5E8DL 4Q3BA 4GEIA 5GQSA 2R0LH 3FNEA 3KPNB 1CG6A 1E5LA 4X54A 2RHEA 2IIPA 4A6DA 1U90A 3WIBA 1G38A 3ILQC 5H3LA 2VXTH 1G9NL 3RL1A 4ZJYA 4QRPA 3MCG1 3A06A 2VP3A 5AG9A 2BFBA 5T6MA 4B71A 2QL7A 3LWNA 5DFVD 5E70A 3NOQA 3JALA 4L1BA 4F38A 3KEQA 3MRRA 4P3OA 1NSFA 3S8GB 1D5XB 4LLDA 1L7VC 1Z4MA 4N03A 3DSFH 2QTVB 3QPWA 1K4MA 4EGSA 3Q7QA 3VU1A 4DG8A 3HP4A 5DA0B 1DPGA 3KQQA 2P41A 2VHYA 4R1NA 2WSDA 1JHYA 5LMCA 3KB8A 3LY7A 4HETA 3LPLA 2MRYA 1HS6A 3LOUA 4OR1A 2XQBL 4O4IB 4PRIE 1XGQA 1R4NB 5HIJA 5EKXA 1EA9C 4OZHE 1NBMD 1OPGL 2F8XC 4J0GA 1PNDA 3M8OH 3T65B 3TI9A 1KJNA 2DULA 1TVHB 2VS1A 1ET5A 4WUTA 4XMKL 4PH8A 3AM8A 1GSHA 1XWVA 3BMXA 3SZLA 1AQYA 1TUPA 3DBIA 4PO8A 4F2GA 1N3IA 4M93C 2G06A 5EJ4A 1ODKA 3O4IA 1EZSA 2FPMA 3QRFM 1OILA 3A6CH 3A1TA 1WLYA 3FNIA 4UE6A 2P5WD 4XXHA 3EKCA 4OLYH 3LUFA 3MRNB 1EFAA 2FN3A 4XB8A 4HLEA 5DJ2B 5CA1B 1QVRA 4JLAA 5IGXH 4TXMA 3TCTA 5BOVA 3V6ZB 3W2TA 1QSFA 4CT4B 4JYAB 2VHVA 4HDMA 1AXIB 2Y1ZA 4E1BA 4Z9FA 3Q7PA 1OAYL 1V35A 2YWHA 3MM4A 3BKMH 3SDDC 5BUPA 1R3UA 2B35A 5IDWA 1ZITA 3C45A 4RXUA 5DH9A 2IH5A 4YDKH 1BMFD 4XODA 4Q7MB 4GO9A 4R01A 1H6AA 4PJBF 5CP3H 5IN5A 2RGSA 3I75B 2O2HA 4XX1E 1HA3A 3ZH2A 3QLVA 2JKLA 1U42A 5JZVA 1KXQA 1DVYA 2Z1PA 4ZI7F 1LK0A 3DWTA 2Y2VA 2ZZUT 4ETMA 4ZUWB 4AG4H 2HHHB 3KYKH 2CKBB 5F4BA 3V3KA 3BC1A 3GZKA 1QK5A 5AVVA 1ZIAA 1EB8A 4N4AA 1UJ3C 3D3EA 5DNEA 4FFYA 4FOMA 4G0VA 1PDOA 4JUTA 1N6KA 5FHAH 4UYQA 1X14A 3ZD7A 3CXUA 1JI3A 4O51A 2PUJA 5AI6A 2YY5A 5J7CC 2YYSA 4C4RA 3CVXA 4JBGA 4X4ME 3ROEA 3W3ZB 4O02B 1T4WA 1Y98A 4BLSA 4LY6A 3ZZTA 2YVQA 2ZVPX 2R2GA 3KQLA 1A1MB 4G9FE 5AJVB 2E4UA 3DVRX 2O8CB 1KYXA 3QIWB 4MMXC 4PPTA 2I27N 5IF0B 3EUAA 4D9EA 3LRSB 4GRWH 1DAPA 4KJYB 3TEUA 5ICYB 3RRMA 3FYUA 4J0HA 4HR7A 1Z16A 4C2AA 3TOSA 4G5YA 3P69A 1R3KB 1UPFA 4IRJA 4X4KA 2FO4B 1ZWIA 2AN9A 3DKPA 2AV7B 2J67A 1RZ8A 5KYNA 2ZE5A 4JV5B 3II3A 1ZC4A 4IIGA 3QWNA 3GLVA 5LDDC 2IYOA 5FOBA 1JZ2A 2CSUA 2QGFA 1KZQA 4MZRA 5BYAA 3THRA 4O1MA 2Y0CA 3LWDA 1CTMA 3CFDA 3O4FA 4H5SA 4AKSA 1GGUA 4ANXA 2IQIA 1TRHA 3L0CA 5EJGA 3L3KA 4PRHB 3BCRA 3FMPB 5HF8A 3FROA 5I8KH 3IUNA 3I64A 4L9RA 1AXRA 4FQXB 3EO9H 3E1SA 3FUIA 1PG2A 3CG4A 2D9QB 1XUOA 2BW0A 1WP9A 1QR2A 2W2KB 4RVCA 2BZ7A 4OZFG 4R2GB 3KLLA 3NRBA 4X5WB 4R2GD 1P1CA 3GJYA 1JEEA 4N76A 4YCMA 1HE8A 1MIML 1JX6A 2IU0A 2QMEA 3ARRA 3R06A 4Y88A 4Z0PA 4BK4A 2VWEC 1X9RA 3V3TA 3RS5A 5I1IH 3T8MA 1A6VH 3VB9A 4MGYR 1NCAH 2K7PA 3ZU6A 4FQLH 2QAGB 3A2NA 3JAKA 2YZ1A 3L9EA 5FOJA 2QG6A 1CI5A 3DUUA 4G85A 3WJJC 3EFHA 3RF7A 4Z3IA 4EMTA 1IWPB 5JE8A 2RBGA 4MHOA 2K3HA 2IFFH 3ZL2A 1SXJB 1XF2B 1V43A 3WMPA 4RAOA 3QEMA 3AR6A 3QLEA 2VUSA 5L8VA 3VE0A 3BP7B 1I10A 3LBFA 2WLIB 1ZSDA 4MYTA 1OV4A 2B37A 1JPGB 3OOJA 3CLFL 2R9VA 3CYFA 1QH1B 2DLCX 4PSKA 3ZCQA 4RYDA 1E89A 5DLQC 2D1RA 4ZW5A 1TJHL 4B97A 5ADOL 1V55B 3FVVA 3O7MA 3DZJA 3ALPA 1FP6A 1MPTA 1DBPA 4Q3KA 1PYWB 4AGPA 4CVZB 1OFIA 3RSQA 1CQXA 25C8H 2XVXA 4PRYA 3JZIA 3HADA 4PRNB 1UK8A 1LXMA 3B8HA 1E2HA 3KLHC 5JANA 4YRKA 2PMBA 1BCRB 4IS3A 3EG5A 5C3MA 4FNAA 4OXNA 4HH3C 3SR3A 2YRWA 3VV2A 5E94B 1DBAL 3ZWOA 1O94A 1EJ8A 1WUNT 3U25A 1O2DA 1ISSA 3AF2A 5AD0B 3H85A 2VAWA 4Q7DA 5LZ4A 3JV4B 4M0PA 4OLVL 2W93A 1MCEA 4J1TC 1WVIA 2YGVA 3O2DH 1HILA 2EKPA 4OQEA 3CG8A 3UAZA 3VWJA 1XVSA 3TXYA 1QH0A 4A27A 3N0VA 1D7BA 2PS3A 1I3VA 4GX1A 3HNSH 1MV8A 4C05A 3TYFB 1NQVA 5FWXB 3ETSA 1UXWB 1OP3K 3OQIA 1DQKA 2YARA 2HUHA 4WKPA 3G2PA 5T64A 2PZMA 4PCVA 2YS6A 2Q2WA 5IW6B 4IIJA 3JRWA 1ZVKA 1NI3A 1MI5E 1EIZA 4IJVA 2KL6A 5HYJB 3D64A 1ZOPA 2CHFA 3P11H 2E4YA 3V8MA 1E67A 4U1RA 4FGLA 3GTNA 1GZ7A 5GGTH 1QLJA 4HALA 3K1JA 4BIMA 1UBEA 1SY7A 4LGSB 2AJUL 1Y7TA 2GGSA 1S4QA 2OXTA 4PJEF 5E5MA 3KSBC 1B2LA 4ACBA 4HJRA 3DROB 4LSWA 2NY2B 1SMKA 1MLBA 5D3MA 3P2DA 1XGRB 1T21A 1RT9A 3B1FA 3EDFA 1LNQA 1GPWB 1NAMH 2FO1A 2LIVA 4PREA 4KMOA 1JVSA 3BD9A 3V8VA 3AB0C 5IBQA 4XWGH 4L3WA 3QA3B 1YBMA 4H0NA 1E5UI 3LG2A 2CNWD 5K0TA 2RH0A 3KVNA 2WJVA 1S5IL 4EARA 1PJ9A 2FIKA 4M4SA 3JAMA 3P77A 4PHGA 2REBA 2B1AH 1U9ZA 1H3VA 1CFQA 2VQ1A 3EOBA 1CD1B 4D9IA 4MGKR 3HJ0A 4FTDA 1OAKH 3ULUH 3LPPA 1UC5B 4J0DA 3UCRA 5I76B 2OGWA 5A4JA 4ZCQA 4FLSA 2XFGB 4ZMOA 2UV3A 1VSQA 2YJQA 4AZUA 4O0LA 3DMRA 3V2HA 2C1XA 4QHKJ 2GM9A 3QG5A 3PGFH 4J8QA 3RWMB 5GJTH 2HLDA 3U7EB 1IQWL 1QGUB 1EDDA 4DP6X 1EGHA 2X4OB 2DMHA 2XI4A 2AV1A 4G6MH 5DNUA 4RWYL 4G26A 1NR5A 1XR3A 2NT4A 1JIXA 5DHVB 1NAKL 4MQUA 5ALVA 4OHRA 3LVQE 1IJBA 1BG6A 3EGIA 3ROLB 4XVSH 2OFWA 1VDGA 5KWJA 1KNQA 3FH5A 4Y8DC 1SHTX 9CGTA 4EHJA 1U33A 5LVEA 3ZDEA 1AMOA 5DGCA 1TYEB 2OCDA 4X6FA 1P75A 1CUUA 4XO9A 4Q12A 3UCXA 1B23P 2HA7A 4DIEA 1MEXH 3KYNA 1AGEA 4L9WA 4PGDA 3CSFA 1E2MA 4GQ9H 1H9BA 2EFEB 5KVEE 2CCGA 2R68A 1NPNA 1HM5A 2FRXA 4IQ8A 5C35A 2VJXA 3CA8A 3C43A 3U4MA 3ROPA 4YJ3B 1EUDA 3FMVA 1QMPA 2VR6A 4HBCL 4KY1L 5GRVL 4YRDA 3FQXB 5IDYA 3B9AA 4WWKC 5I73B 2OJZL 2Q1WA 1UATA 5FK9A 2A9NL 1RC8A 4V2UA 1T0PB 1Z0FA 2O7NA 4TLSA 2G5PA 5HEKA 2ATPB 4EIZC 1KBZA 5LMUB 2ZOKA 3FWKA 2IHBA 2C04A 4HDNA 2P5PA 4K5NA 3TJHD 3RDTA 1YS1X 4RTJA 2NXYD 4F4UA 1K9TA 4MBRA 1H1LA 3P94A 1SCIA 2FRGP 4Y6SA 1IH8A 2B8WA 3S3JA 1M6EX 4X5RA 3GZNA 5GOZA 3WSTA 4J3VA 1R3JB 1SM3L 3RT9A 3Q3GE 3G7NA 2Q9BA 2EH7L 3L7LA 1HDIA 3VVCA 3AC0A 1RD6A 4PMEA 3VXME 3WDKA 5J2UB 3FQRA 1G43A 2Y7OA 1U2DC 2AZXA 2FFAA 5HS4A 3NU1A 5DJXA 3NBQA 5FBKA 4M8UA 2AG6A 4PQGA 4G8EB 4JLPA 5JPMC 4JKPL 3OPQA 1F4XH 1WB9A 4JFHE 1VMKA 2PQMA 4RYLA 1L2TA 3II2A 2QLNA 2AQPA 2Y99A 1B42A 3SEZA 3RPKA 1OCEA 1YNTA 3CFEB 4ETIA 3VFVA 5H9WA 1H93A 4GUPA 1FNDA 1MBZA 1RQNA 3BXNA 5AVOA 3OC5A 2WFZA 3LT2A 3B78A 2CO4A 3QVOA 3P0YH 4REOA 5JYCA 3V8NA 1FDIA 3FO2B 4CC4C 5LOVA 3BUTA 1VJSA 3OF5A 4GXVH 3K9GA 3B3IA 5TJWK 4MSWA 1I13A 4KNSA 1EMTL 2XPYA 3M17A 2A6DA 2HTEA 3NQKA 4PJ5E 2ORBH 3WLRA 3T4YB 4NNPL 5B1JA 3GMRB 3H8NA 1PX4A 5B2ZA 1UFRA 2YN0A 3CEAA 2MDTA 4BK5C 1HH9A 3AM5A 5KYWB 4ND8A 1PAMA 2HMUA 3KHSA 4HX1A 1ZAKA 4OGXH 5I0ZA 5JWHA 5BOSB 4NCKA 2QD5A 3F7YA 1JUFB 2R0LL 4XFJA 1OYWA 1P31A 1DNPA 2JE8A 4L28A 4L3EE 2DQYA 3C98A 4WFJA 5IBLC 2VXTL 1OTUD 5KJFA 3ROZA 3BAYA 1Z66A 4PV9B 5AI8A 4BFWA 1GOTA 3OSKA 3QIBC 3UIYA 1EM6A 1OROA 4DFIA 5K9KB 1JEQB 2QRJA 3B2UD 1P61B 3BILA 1LE9B 3SQWA 1EERB 4JQIA 1COBA 3DSFL 2M6RA 4HDIB 4C01A 4YALA 3D8BA 1HEHC 4AH2B 1GGYA 4YP7A 4IWYA 5JG7A 2KBFA 1T0JB 7REQA 2R6JA 1TPXB 1T0IA 1SCJA 4WBNA 1D5ZA 3KU4A 1G6KA 4IGKA 4S24A 4H6VA 5CCEA 3QI9B 3O21A 1ZEMA 3T1NA 4OHYA 1NF3A 3MTAA 3QI9D 3M8OL 5BJTB 5D93C 3NX4A 1O5DT 3IS1X 3DTYA 1R27A 2IW3A 5KVSA 4K46A 4YBRA 3SHOA 3EVDA 4OFZA 3CKKA 4DADA 2V9RA 3SYMA 1LM8V 3UW1A 4RGNE 3MRKA 1Z45A 1ZGJA 1SAYA 3TRHA 7MDHA 4W5RA 3A6CL 3GMLA 4O2EA 1NX6A 3FKSA 2ERCA 4LN1A 4GECA 4LDEB 3L05A 1ZMTA 4OLYL 4LPYA 4ENWA 1GIAA 2YJ6A 4GMKA 4WI8A 5T1KA 5IGXL 2C1EA 2JW5A 5KBDA 2K9FB 2K2WA 4J07A 4N5EC 1ETZB 3O3BA 4TNEA 2DBQA 2ZG3A 4MUJA 3T5MA 2H11A 3BKML 3QXAA 2NU6B 3COYA 2OSBA 4QEDA 1T9GR 4H2CA 2WF5A 4H7PA 3ZDFA 1K98A 4YDKL 1BXKA 3HKBA 1I7TA 5INCB 1PDVA 1THMA 3W9DA 2TRSB 4W9JC 1GPAA 2J20A 1Z5PA 3PSHA 3BZDA 2OL3A 4L22A 3SF8A 4WZAA 4PJ8A 3BOSA 2R4TA 1JG7A 2YD4A 1MDAA 2RGBA 1JP5A 4QTXA 4QQRA 1H3PH 5JNWA 1P5HA 4PAWA 1SCUA 1V7NH 3GMNA 1E5DA 3QG7L 2NY6C 5AVWB 5CIQA 1WCBB 3KB2A 4AG4L 3KYKL 4V0NA 3I6QA 3QQ4A 2HXSA 4ETQA 2DJ5A 3OPYI 5HKKD 4C56D 4N8VG 1Z34A 4X9IA 2WF9A 4L4XA 4HKBB 2C2ZA 4CIVA 2J57A 3DKRA 3OURA 4RESB 5H94B 5HGGS 3QWQB 4CQMD 5FHAL 3CX5K 2FE0A 1ONQB 3BP5A 5IDVA 2R59A 5HRCA 3IJHB 1AXTH 3BDYH 3A3NA 2JJ8A 3NJVA 4YJFB 1A50B 3DS8A 3N06B 2JKZA 2VQ3A 4CBPA 1AGFA 3T8XB 1ND0A 2ZUFA 4FFOA 2I2DA 4BP3A 3LFUA 4DGSA 1BW8A 2VXVH 4X7DC 3P7MA 2IOQA 4Y16A 4ZKEA 2ZQ5A 2WZCA 5KAMA 3NQIA 4YJHA 4JZNB 5AAPA 5EXPA 2WTXA 1UANA 3SFVA 3L9RA 3VXRE 1E63A 1LNSA 4W7HA 1HIMH 4BASA 1KB5B 1JLRA 2H17A 1UT9A 4RUKA 3BFJA 4QKTA 1UAAA 2W6ID 4M8QB 2FX9H 4Z0BH 4C7OA 4KOCA 3ARED 3DAYA 2GJAA 4AJ0A 4QF1A 1W6LA 3WFIA 3SGJA 3LCVB 1SN5A 4HFRA 1H3NA 4F97A 4FFBA 1LK3H 4MUXA 3T9CA 1S7RA 2H59A 4YDZA 1Q5PA 3TX4A 3A9WA 1WU7A 4GSQA 1EEHA 1F3RB 4PG2C 5JZ7D 3TOXA 3MUHL 5I8KL 4HEMA 4R3UC 2YJ3A 1JTFA 4DABA 3DNMA 4YPOA 1TCAA 4GRAA 2IBBA 3EDKA 1IHYA 5FHQA 3FJYA 4Y5VB 1OTSC 2D7MA 2EDFA 2W4QA 2R15A 4IO1A 5JD3A 1JZTA 4M7PA 3FG9A 1IUKA 3FPAA 4X4XA 3A3OA 1KPVB 4WFEE 1NOJA 1Q57A 3ROOB 3O2NA 2C9BA 2R7EA 1F1JA 4GZ6A 1BJ1J 4FFPA 4N49A 3RWDB 1T0MA 1F8XA 5EKTA 3G7TA 3LNHA 2JJSC 2GILA 4AL4A 2O3RA 5I1IL 1A6VL 2HM7A 1B8VA 5IFLA 4FIDA 1NCAL 1ULVA 3KWFA 4HVLA 4LQFH 4QRQB 5FCSH 4HWZA 4JR9L 4KKLD 1YB7A 5KX5B 3OQOA 1CNEA 1P5VB 4JN2A 4L2YA 4LRWA 3RC1A 1QVZA 4CMCA 4G59C 4FBLA 3CIAA 3FU9A 3D4CA 1ZUIA 2KZKA 1ZGBA 4OF4A 2IFFL 3SKVA 2QROA 1NOKA 4OOEA 1GS8A 2AUNA 3AX6A 2C7FA 1C5KA 1SG0A 5DWPA 1HFWA 2X1HA 5A40E 4PG9A 4F2MA 1FQJA 3RIAK 5BQDA 3WZLA 1MZPA 2GETA 2W2PA 1HO3A 4CTMA 3B9KA 2FVXA 2Q4BA 4UD6A 3L17A 3QKSB 3U6KA 2WFMA 1XEXB 5HHOE 3N44B 4NIMA 25C8L 3WHKA 5EOTA 4J4BA 1FJGB 1KC3A 3R0XA 3BAXA 5KSBF 1PJWA 1ZS8A 3DZBA 4GC9A 3P45A 5ID1A 3CF2A 4RENA 3A6BL 5DTJA 3IL2A 1SCAA 2EO1A 3AB3A 2RARA 4BE7B 3VDCA 4UQ3B 5BZWB 3IN2A 2H2AA 5I6KA 1C7FA 2B99A 4PLWA 4D0DB 4MS4B 4CM1A 2V5SA 1BDBA 1AYOA 2GJ4A 1P2VA 4KV5E 3HZVA 5JNYA 2I78A 3FU7A 1J22A 3O2DL 1D2NA 4F8YA 3SCMA 2O61A 1DWOA 3QXDB 3STTA 4R7LA 4HLUA 3THWB 1TADA 3MTGA 5D5MF 3HNSL 2FJHB 3LUPA 2C3XA 4L4YA 3LQRA 3DHWC 2FVNA 4JD5A 1I0ZA 1GCFA 4I7ZC 3P9RA 1G66A 3AHEA 2KZ1B 4ETYA 2Y77A 3IP1A 3BQMB 5HGXA 1W93A 2DTXA 5EMNA 5L3QA 2V3CC 3EIWA 4R8MA 4WY7L 2F90A 1BWSA 3GDBA 3RVNA 5B1BB 4B0MB 4E0RB 2VLMD 5HYEA 1YBFA 2H51A 3MWJA 4V2CB 4TMWA 4LSDA 5EHFA 3P11L 3T3ME 4E9XA 1GR7A 1HEZB 4AQYB 2E76C 5GGTL 1EHYA 2DETA 5GGUA 1FRFS 2DICA 1O08A 4DXAA 4P46D 1OWLA 2C7RA 3ZYCA 2XVZA 5CZRA 5FWNA 3KLOA 5I8PA 1M1YB 4PSRA 3QUAA 3VNQA 1MO4A 3QFHA 4YO7A 4Z3OA 1UHVA 1JK8A 3CUSA 5T8KC 4I88A 4FX5A 1ODIA 1ZPLA 1IIKA 3K5HA 4KO3S 2VLKA 4YFVA 3QDME 1H2YA 3WNQA 3V8OA 2XDWA 3SX2A 3RQ3A 4GUCA 1QASA 4PV1C 3OT5A 4GBGA 5J43A 3W5DA 1NAML 2MJWA 4YCBA 1E2QA 4AZWA 1JMXA 2N01B 1YMMB 3CNKA 1TDJA 2C99A 4JFFD 4LKRA 3DO4A 4XWGL 5CIPA 2C7BA 1AD9A 3TW8A 4UFNA 2X44D 1RXUA 1N3YA 4UAVA 4Y19A 2V7HB 1P18A 2W0MA 1ZGZA 3OM9A 1TD1A 1U0EA 4KDCA 1YDPA 1I32A 2B1AL 1HLFA 3L8YA 4R2JA 3OZWA 2XG5B 4QIRA 3NQ41 5JBNA 5M95B 1OAKL 3ULUL 4A2LA 3C8UA 5AYUH 1JSZA 4B8ZA 1ACXA 3RK0A 4PBVC 5KJ7E 2J3KA 2WIGA 1GL9B 3CISA 4KE6A 1G87A 2F7OA 2VHWA 3N85L 3PGFL 1X7SA 2EIBA 3SZRA 5GJTL 4PYQA 4C04A 2JAHA 1TLFA 1PVVA 4PTUA 5FL7A 4Q14A 4NIKB 4ZS6D 4EL0A 5E7JA 4F72A 1JR3E 1BM7A 4G6ML 4MPJA 5DOZA 1OM3H 3QWRD 5LBSH 1NKTA 4GF5A 3P1JA 2DAPA 3T6XA 3T1VA 1KYDA 4XVSL 1DWUA 3LWZA 2BM8A 3NIBA 1ENPA 2P3SA 4UEJA 2HU8A 4S2UA 4Z2AA 5HGAA 4OUKX 1NF9A 2R2BB 1WX1A 4HQOA 5B3JF 2ZIAA 4JY4A 4IJ3B 4ODXA 1XA0A 2WFLB 2CSXA 4HAIA 1IAIM 2UZIH 4PYJA 3ZE2F 4EHBA 5AAMC 3OX2A 1GUFA 3VGEA 4GKOA 3QFRA 1TMGE 4YC7A 1MEXL 4MJ7A 4XBEH 1SBHA 5AJTA 3U9UA 4YCAA 2JKRM 1BQHB 1WCWA 1QHOA 4IZHA 4WXHA 1F11A 4KUCF 5EIIB 4GQ9L 2ICWB 4ZK2A 4L8CB 1WBXB 4H7KA 3D1LA 1OJLA 2NLJA 2AE2A 3EGXA 2C4NA 2CRMA 3TD9A 3M6IA 1ISMA 2R1YB 3EXIB 4P04A 2AJXL 4MEBA 1FL3A 3WGHA 4JFZH 2FEDC 3TCXA 2O8NA 1R5VB 4FT2A 1L1EA 3L3BA 3ROKA 2K1MA 3N87A 1ETHA 2QTCA 2C4FU 1Y89A 4UHKA 1MLCA 4JVMA 1KJ9A 2BSSB 1HSBB 3HJCA 1P9WA 2GF9A 1KY6A 3UKDA 1RZRD 3QFDB 2A59A 5BN4A 1UBUS 1E6MA 4DREA 3SOPA 3VR3A 2NVOA 4XM0A 2XN2A 2RGNC 4TRPL 3GUFA 3O6FA 3CLWA 5KYUB 5J5VA 4HDRA 2DFLA 4KSBA 4OCSH 1ID1A 4RMIA 1NIBA 2PH7A 3PIQB 4DBLC 5KOMC 3QWOA 1YJ5A 1S2NA 3IAPA 3BPCB 4D8YA 2OMZA 4NCHA 3TN0A 3SPGA 5K8IA 3O4VA 4TLKA 1E2LA 1M7GA 3IGLA 4MUYA 1VMEA 5J1TB 1ZT7B 3DC0A 3T94A 5BWCA 5GGVH 3H6KA 3RILA 1W72A 5E7QA 4XCVA 1WF5A 4MJ6A 1RZUA 9MHTA 5J5EA 1INDH 3F9IA 1ESEA 1J1ZA 4B2PA 5IUCA 1RMTA 3TZVC 4FDMA 1YZNA 2VNAA 1DL7H 1R0RE 2Y72A 3UAJD