3NIFB

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alphaIIB beta3
total genus 122
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nifB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nifB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nifB03
1N9ZA 1N3YA 1T0PA 3AL9A 1DZIA 3TCXB 1IDOA 3BN3A 1T6BY 3AFCA 4XW2A 2NUPB 3ZDZB 1SHTX 2XWBF 4UM8B 2VDQB 1MHPA 3OKWA 1JEQA 2I91A 1SHYB 3K71A 1L5GA 4GZ8A 1LFAA 5HGJA 1JEYB 1L5GB 3EFOB 4HQFA 3K71B 3ZDYB 2VDMB 2IUEA 4O3TB 4HQKA 1JLMA 5E6RA 4K3JB 3K72B 3PPWA 4WFQA 2NUTB 3EG9A 2VDLB 4IXDA 1RS0A 4WK0B 4HQLA 3PPXA 1U0OC 4JDUA 1MQ8B 3F74A 4A0QA 1PT6A 1Q0PA 3ZDXB 5E6SB 3IJEA 4UM9B 3OL2B 1MF7A 1MQ9A 1QCYA 1SHUX 3NIFB 2I6SA 2P28A 2WINI 3NVQA 1M10A 2XWJI 4C2BA 3ZE1B 4C2AA 4NENA 4G1EA 1AUQA 1JV2B 1CQPA 3PPYA 1RTKA 1FE8A 2VDKB 4G1MB 1SQ0A 3T3PB 3IJEB 4G1EB 1YUKA 4IHKA 5KYYA 3V4VB 5ES4B 3NIGB 1IJBA 5KYXB 2VDRB 3HI6A 3EH2A 4HQNA 3EG9B 1BHO1 1RD4A 2UZYB 3AL8B 4MMYB 4NEHB 3BQNB 1MQAA 3EFOA 1JEYA 1AO3A 1M2OA 4CNBA 3K72A 1XUOA 3HXQA 3NIDB 5E6RB 2XGGA 4UM9D 3PPVA 1NA5A 4NENB 4MMXA 3FCUB 4O02A 1QC5B 1M2VB 3GXBA 1PD1A 2O7NA 3TW0A 4DMUB 5LN1A 4Z7OB 1M1XB 3K6SB 3TVYA 3ZQKA 3OKYB 2B2XA 4CN9A 4PN7A 4FWWA 4Z7QB 2WW8A 5E6UB 1MJNA 2VDNB 3OL2A 1M2VA 1OLZA 5E6SA 4O02B 1M1XA 3V4PB 3K6SA 1YVRA 2ICAA 2ODQA 4IGIA 4F1KA 3HXOA 3EH1A 4JX0A 3QA3E 2NUTA 4WK2B 1IDN1 4C29A 3FCSB 1CK4A 2I6QA 3F78A 3VI3B 4WJKB 3FCSA 1JEQB 2ODPA 2VDOB 1XDDA 1SSLA 3EOAI 3Q3GE 3AL8A 2NUPA 1ZOPA 3IBSA 4Z7NB 3EGXB 1AOXA 2P26A 4WK4B 4G1MA 1U0NA 1M1UA 1QC5A 2ADFA 2NVOA 5KYYB 1RRKA 4MMZA 3N2NA 3M6FA 5BV8A 1DGQA 2M32A 5HJ2A 1TYEB 1IJKA 4HQOA 4MMXB 5KYNA 3EGDB 3TXAA 4MMYA 3VI4B 1UEXC 3BQMB 5KYWA 1ZONA 5KYUB 5HDBB 1OAKA 1U8CA 1BHQ1 1XDGA 2VDPB 4CN8A 5KYUA 5KYWB 3EGXA 4BJ3A 1ATZA 4FX5A 3ZE0B 3EOBI 3ZE2B 4M76B 3EGDA 1U8CB 5KYXA 2VC2B 1FNSA 1V7PC 4F1JA 1JV2A 3T3MB 4MMZB 4O3UB 1PCXA 2QTVA 2X5NA 1ZOOA 1PD0A 1YVPA 3E2MA 3RAGA 5E6UA
chains in the Genus database with same CATH superfamily
3S7TA 1M7XA 1BZOA 4UAHA 2O5ZL 2WJ6A 1RZRA 4DKDC 3D87B 1UKQA 1D09A 1GZ7A 3TEJA 4YSUA 4HS6B 1PYGA 3C3EA 3FU6A 3WDIA 4YCMA 4FYSA 2QX9A 4EK9A 2WAQA 5J11C 3BA1A 2ZKIA 1JXQA 2A77L 3F7YB 2VDNH 4F15C 3C0KA 4NNPL 3WXVH 2N46A 2QI9C 1K5WA 2CT8A 5FOBB 2OTUA 1QCDA 3ZG6A 3E23A 1C4XA 4GYBA 4QRSA 4GH5A 4C2UA 2QD1A 1H69A 1DJMA 1V3LA 3VH4A 2JI1A 5DRYA 5C18A 3V2HA 3HHSA 3HI6A 4K81B 4NC0B 5JIBA 2YO3A 3ESMA 2ADIA 4H88H 5DVKA 3GEGA 1GS8A 2B77A 3I72A 3MBEB 1GKLA 3OFSA 3PAUA 3GHEH 5CVDA 2ZKWA 2QXUA 2PCFA 4GLLA 4QGHA 4CLDA 2Q8AH 4PN7A 4RTMA 1VHWA 1SHJA 3VC2A 1FK8A 3ADOA 1T0PB 2E8YA 4R8WL 2W6ZA 3FOWA 4JM0A 1QLWA 1JU9A 3B5HA 2VWEE 1O8CA 3D2CA 2VMJA 1QLJA 1U94A 3QNYB 2Z9TA 3IV7A 5AKGA 3C7TA 1AQHA 4CTMA 3LPPA 4OHBA 2BNRD 4M1YA 4WK4B 4U3JA 1XRJA 5ICYA 2BNUA 2CLVA 4YHIB 3HJBA 2VATA 5FDYA 3TBSA 1JKJB 3IPFA 3QXSA 5FOXA 2VH5L 4BMDA 3BUYB 2L7JA 2M8XA 3N41B 1EM6A 1F2QA 1CE1L 5B3AA 1NUQA 2NY3C 4AP6A 4HDKA 3GLFE 1MN4A 5IOPA 5IPFA 3SR0A 3BICA 1E0AA 4LSSH 4UVGA 2JZOA 2NO4A 2GM9A 2DAVA 3RPEA 2IXEA 15C8L 2EIZA 4U0RB 1CF2O 3QJUB 4MULA 3ZKXC 1L5FA 5I8ZA 5HGXA 1RJZA 3BYTA 4KXBA 3W9DB 1U3YA 3GPCA 3WGGA 2PW1A 5LJYH 3JBG7 3P9CA 4XUDA 1ZW1A 1PDWA 4HVBA 4JQIH 1NN3A 2NXZB 4OGXL 4KC0A 5K3AA 5DMHA 2H5UA 1K3TA 4JFRA 4YBQC 2GY5A 4MDIA 1FDSA 3E0QA 2IF0A 4XPAH 3LBHA 3CVOA 1NMBL 2DQDH 3Q98A 2VDNL 4URFA 2VP0A 5ITBH 2V8LA 5C0IB 3C8ZA 1KH2A 1PS3A 3DEFA 4QBGB 4D9QE 5C37A 4J1TC 1GAQA 2PL9A 5EBGA 4WWKA 4YRPA 3IP8A 4M99A 3FCTA 4XH2A 3D7MA 1SKAA 3OWOA 4ZQFA 1U6KA 2F59A 4M7KL 3A1DA 1DQKA 5LFAA 1NPNA 5KINB 3B1TA 4R0LB 4MKZA 5HF6A 1Q7RA 2DBLH 5GAJA 4PRNB 5D7BA 3HG5A 5KWVA 2DTML 2P8SA 2P9BA 4DP9X 2ZKYA 1OBFO 3ORRA 5FLUA 2XKSA 1XVVA 1U2EA 1WBYB 2ATKB 3K20A 2IYZA 3MRSA 3MC0A 2A6PA 4FBLA 4MWGA 4TVBA 3U4EB 4EF3A 3PP4L 1UOLA 1G4RA 2G8LA 2KZBA 5D1XA 1N9ZA 2WMDA 1LEIA 3O4LB 4OFPA 4ETQB 2NUPB 3FOMB 2JLRA 5SWZA 2OBBA 1DFBL 4OH7A 1GTG1 4X4KA 2R5NA 4L3ED 1W36B 2BM8A 5BW6B 2G5CA 4V2UA 3QIBA 3DXAB 5CJBA 1MPXA 3NTLA 5F8RC 2CDAA 3GFOA 2NY7H 4KNWA 3ZWAA 3KPMB 4C3ZA 1TTAA 4Z76A 1DB3A 5TFSL 2R4RH 3QTTA 1SZCA 3A4LA 1O77A 3U7WL 2Y2WA 4JKPL 2G25A 4C4TA 4U3XA 1XXLA 1KB3A 2FP4B 5A4MS 1ZLUK 3CFYA 4LWZA 4P3OA 3WTSA 3UTTB 3ZXUB 4TV3A 4CRPA 4QGYA 1UK7A 2EFYA 1XO1A 2XH8A 4EVNB 1S0UA 3DVAA 2O30A 2WNKA 2YIJA 1GTJ1 1TQDA 4A6YB 2AERT 2HJLB 1G5QA 3ICEA 5ED4A 4LJ9A 3IDXH 2V37A 1KDTA 5EMHA 3MNMA 4HX2A 1I3MA 1A3LH 5DRNA 4JYAB 3HMQA 4GR5A 3Q8CA 3P9MA 3TIIA 3MKGA 3UC9A 2EBUA 35C8L 1H5BC 4X7MA 4CM4A 2DKSA 3EQ2A 1IQ0A 2V6BA 3BCSA 2AVFA 4JRYD 2OMYB 1U9KA 2ADFH 4B7ZA 2GTZB 1MJGM 1F11A 1MI5E 3DYIA 4PNZA 3EGSA 4XJSA 3OCXA 2R66A 2L7QA 2IDKA 2KLTA 4EQ6B 4RX1A 3V4VH 3NM4A 3ARED 1Z4IA 3VOAA 3I34X 2GHZA 1XZKA 1ZCAA 2YMLA 4PIPA 4F8OA 3ME0A 4N40A 4DIMA 3ETCA 4CM1A 4KMTH 3ZZ0A 1KDJA 4XVUC 5HKLA 5MFPA 1CGSL 4FDWA 2GEFA 2V9CA 4EDWL 2QYHA 2O5VA 5FUQA 3TOSA 4PX5A 1JKFA 2B4CC 3EIEA 3KKNA 1KK3A 2EP5A 2WTXA 2R3SA 1CKEA 2APXA 1IY2A 1IAQA 3W1WA 4DBLC 5ALYA 3BGMB 5B58C 3W57A 2QJTA 3FDIA 4JXJA 4N54A 3DECA 4K23L 2ZVDA 5BRAA 3V6FB 2QJRA 3R9XA 4ELMA 1BD3A 4GM1A 4PZCA 2REQA 5DHYB 5HTKA 1L5HA 4WJZA 3L1GA 4HLZH 4UB0L 2WLNA 3IPBA 1K8DB 1UOWA 4P7FA 2ON6A 3DR3A 2Q7YA 2WV9A 1QWSA 1XGYH 2FBOJ 1CGYA 3IBTA 4N5HX 5JDIC 1S89A 4CIDA 2XRZA 3VHXA 3A6BL 5JW5B 1I1HA 1B2YA 3S5LA 3UTTE 3U6XS 4KGDA 4XP9H 1W44A 3SSMA 4WJ5A 1R12A 4U02A 1J5EB 2ZRJA 5GGRB 5J1AA 2WQAA 4AT1A 4NG4A 5CUSH 1VPDA 1GPAA 3P32A 5E2WH 4H26A 2MR6A 4NSNA 4CW7A 4M1CC 3CN2A 2WZBA 3L1FA 5TS2A 3QVGA 4FQLL 2R6GA 2ZSJA 3US1A 2J5WA 5EMJA 1MUJB 3JUZA 3SJVB 3H5TA 2NW2A 3F5QA 1MVOA 4L29B 1UT9A 3L5IA 3S3DB 1ZRNA 4EIUA 3QE5A 4QYSA 5B2EA 5DSXA 1W5AA 5KI6A 2F58H 1U02A 2ZOKA 4ITRC 2ZRLA 4JFVA 1ISGA 1KEVA 4F7TA 3UV6A 2H7XA 3E6HB 4L1DA 3RJOA 1RRFA 3QCVH 2L8AA 2HXAA 4NQDB 1SH7A 1E20A 3U7GA 1G7QB 4JJZA 5IMKA 4FGWA 5EZYB 5F88A 2XTJC 4ZZ3A 3U7AA 3VFPB 2HFFA 2NYKA 3PZRA 6AT1A 3S8GB 4ZT2A 2Y1DA 3QPXH 1WU7A 3DJSA 3TYFB 1IY8A 3UB3A 1KGYE 3MTJA 1P6WA 3H3JA 3FU0A 1J7KA 1RJFA 4LJKA 3CLUD 3OQJA 1UZ8B 3IAS1 2KQNA 1CLOH 1SIWA 4GP7A 5LNK6 1BWSA 4D8VA 3ULUF 5CVJA 3ESOA 3S9DB 5A1TA 4LHUG 2QR3A 4CUKA 1Y4AE 4D4MA 2A0LD 4V2BA 3WWYA 1J5OH 5IV2A 3LHIA 3D8BA 4NQCD 3B7PA 3LY7A 4RXTA 4YHYC 4D74A 4CKCB 4DGWC 3BK1A 4JFYA 4WY7L 5DP1A 4HNGA 2HU2A 3O4JA 3ZW8A 1OY3B 4RA9A 3JQCA 3EGVA 4D0BB 1ZANH 4TOIA 1KSGA 1CUJA 3KE8A 3G5ZB 5HY9A 2O1SA 1HZZC 3E0GA 4EBQL 3IE9A 3T77B 2CMFA 1Q16A 4HUVB 5LQSA 4PLGA 2G80A 4N7MA 3V7YA 5C0JB 1X1CA 1GPLA 3LKNB 3VI3F 4RRPG 1OF0A 2WWFA 1QRAA 4IEEA 3UIEA 3LXBA 3AU9A 3EBIA 4RHEA 4UB0H 4MAZA 5EPMB 5CR1A 1FNEB 2ZIWB 3DZDA 1ZE3C 4FKHA 3ZYZA 3WWEA 4Y2DC 1KU6A 2BBWA 1QFMA 2XQYA 3O8OA 4D8UA 2YRFA 1QBKC 4JG0L 3CMCO 2F58L 4E21A 4ZXBA 2IYFA 2G9VA 1S2IA 3ZLTA 5LBIA 3BTSA 2IV2X 4YLQT 5AIBA 6FABL 2AMLA 3KLNA 5HYQA 1M33A 5CCHE 5EIIA 1J86A 4PG4A 3RC9A 5IRCD 3EJWA 4B1FA 4PGJA 2A1TR 3MCWA 2ZJ6A 2WQWA 1BH2A 3MOBH 5HHMB 3EVNA 2CPCA 3G2NA 3HJNA 3L8QA 2WQ7A 1FNBA 2FWAA 1DBJL 1RRVA 1YEKH 5BS0D 4FCVA 1G9EA 3BPOB 3Q85A 4YP5A 4DQOL 2AP2A 4PNHA 2EFHB 4MVCA 5HM6A 3IFPA 5A1AA 2WM3A 5I8KH 4OBXA 2OCCB 1WUTA 4XP1L 4I8DA 2P68A 2R1WB 5FR1A 3WMRA 2ECKA 3MPUA 3R7DA 1EDBA 4LJ7A 1VRVA 1KRXA 3OJXA 1NL0L 1RK1B 1VHPA 1TU4A 1PK8A 2FMFA 2HLDD 4M9PA 3QP9A 2JV6A 2A9BA 4XP4H 4HJGB 4TYQA 1XGYL 3ADPA 3DBHA 1AJEA 3HDTA 3CVHL 1JEOA 3I6SA 3PL6B 2XNAA 1MIEL 4QUDA 5HF9A 4HH1A 5D1ZI 2VDOL 4UM9B 3KWLA 1SPDA 3W0WD 3DETC 4HQQH 2Z0UA 3V4VB 1CK0L 1QQ7A 3NAQA 3L5WA 3KLQA 2OJZH 4P4SA 1I1QB 3FBGA 3ARDB 3WNCA 2AJZB 3ULUE 5DGTA 4AM0B 1H42A 2I03A 2WYUA 3ZK7A 4EPWA 3IDAA 1L5MA 3RBXA 4UHDA 4P59H 1JAHA 3QXGA 3ZHOA 1FDOA 1NLBL 3BIOA 1DUYB 5JPNC 2PXYA 3FTCA 7YASA 5I19L 3ODGA 1MQSA 5IEHB 4AXWB 2BFOA 2ZWKA 3ZT5A 3LTEA 4QPDA 3RVSA 4H0LC 3I9MA 1PYDA 4IX9A 4QXVA 3UT5A 1UPAA 1XPUA 4FXKC 3VRLF 2JEOA 5B3LA 1L8LA 5C8YB 4B3XA 3OCYA 3TZCA 5IWAB 4W68A 2ES4A 2I3GA 4ZODA 4DSOA 3KYOB 1WDKA 3WO1A 1E4HA 3DVGB 1SYSB 2VT6A 4JMXA 3MNVA 3WDHA 3HHEA 1LPSA 1NC2B 3OGOE 1JHLH 4RIRB 2QSZA 1CR2A 3GO1H 4BCYA 2PRIA 4UD2A 2CXXA 4B84A 4CTOA 2X6UA 3DX6A 3WL4A 3EYFA 2B2NA 2VRAA 3L8GA 1JAXA 1QPZA 1JIUA 2XG5B 4HAIA 2WXKA 1A3QA 2M2DA 3ZV6A 3B83A 3EPHA 4NO2A 4A0QA 1IBBA 3BT2H 1B00A 5I5RA 4UILH 2MRYA 1G98A 5TT1A 4M8QA 1ACCA 1TMQA 2C1OB 2IHYA 4GXNA 5G0WA 1U31A 4ZWNA 2IDCA 3O6LL 3WDKA 3RVLA 3S37H 5IF0A 2OMUA 3GK8H 2JQAA 1ZGLA 5DYYA 5E7QA 4PFJA 3N0VA 3Q7IA 5CH5A 4DPCX 3PQYD 3F7RA 4Y30A 4NFBA 3LCVB 4PQGA 2YUWA 5CIPB 4E12A 1KYAA 1JS1X 1MFCH 3IDJB 5CCJA 3QE2A 2WMNB 1JZ5A 2K8QA 3EFHA 3MYYA 1MAVA 4ZVRA 4LL9A 5AUMB 3VQMA 1GR0A 1YOVB 3JQAD 1U36A 3QKIA 2CUNA 1PDKA 2P0AA 3HTXA 4CM8A 4WNYA 3EO1B 3MYJB 5E8RA 2NZUG 3DBRA 3RHWF 1MREL 2A1UB 4BLWA 5K9QI 5F7FA 4KW7A 1M1UA 2W70A 5K0BA 2CKDA 3K0AA 3BH9A 3RWJA 3QEQA 2A7QA 5DTIA 2G7MC 3I02B 3NBKA 2V6HA 1T04A 2ONKA 3TSCA 3VO8A 1EQUA 1RUQH 1GUZA 4PJXE 2D8KA 3EDOA 4M4RA 5JW3H 2C4KA 1EAQA 3BPLB 4BFNA 4JBIA 2JWGA 2MWCA 5KBLA 1A64A 1X7WB 3LIUA 4P4UA 5CPBA 1UADA 3L0OA 3MWDB 5JPDA 2JGLA 3VU1A 1G0OA 4L3OA 1NKTA 4BU1A 4P23A 3QOYA 4GRMB 2IH5A 1BHJA 4AF8A 3LHAA 4WW2F 4NO5A 1XHFA 2VXTH 1SHSA 4YR6A 4N3AA 3P9SA 4TXMA 5DHVH 1DBML 2XTJD 1KI6A 1HXMA 2OS7A 2P9HA 3SQOA 3QYAA 4OJNA 5K39B 1DBMH 5L2KB 1YO6A 1VYTA 4J91A 2QLBA 5JVDA 2P69A 3ZBMA 5BZDA 1WAEA 3HCPA 4FG2A 4JO1L 4ZS7L 5F7WC 3ZDZE 2VPZA 1LS1A 4YC2B 3BH4A 2OJEA 1DQPA 4KQEA 5FCDA 1V11B 1YAIA 2PNFA 4AQ7A 3IDIA 4GKKB 1L4YA 3UTPE 3V4PH 2QRVB 1N12A 1SZDA 3HZOA 3VFGL 4LCYB 2D0GA 2ONYA 2V2TB 2PWZA 4L50A 2KPOA 4KR7A 3Q3CA 4LNRA 2GM5A 2FF5A 3GLAA 3K09C 4WFHD 4EIGB 5JBQA 2NTSP 4N5ED 1NZJA 1WY7A 1OH7A 4U7FA 4FZEL 1ZA6B 3JR3A 4LF5B 5HHMD 2ZE6A 5I1DA 5AAPA 5GS2D 2G36A 2GBPA 1HVXA 3HLAA 1XDUA 1RZUA 2P8LA 4YDQA 2CRZA 4RTOA 4ZN6A 3DOUA 4OKVB 1QNZL 2GJ4A 2EDLA 4MV6A 4L4TB 4K6OA 1NEZB 2WV3A 3F6BX 1SUJA 4AE1A 4BNDB 1MCBA 4MR9A 4PM1A 5CBEA 5B8CC 2ZG1A 3UH8A 3EGIA 1CTMA 4ZUSA 2Q62A 3KH4A 4JI8B 2BUAA 2GN9A 3W5DA 1RURL 2Y9PB 3VFMA 4J0HA 4M61B 1SLXA 3F7MA 5AKZA 4RENA 2QHRL 3IEXA 1MU0A 5EIFA 2WAOA 4B6GA 3D6NB 1T2FA 4IMLA 2VQ3A 1BEYL 3KPQA 5F89B 4XNUH 3ARBA 2B4CH 5PCYA 2ZM6B 2CSXA 1HTYA 5K5EA 4KRPD 2HKFH 5IGXH 2Z1DA 2HMIC 4WWID 4N2AA 3AKZA 4IF4A 2K7FA 1F0KA 4E41B 2CUZA 5DK3A 1GAWA 4V02A 3GT3A 3ZDDA 2DBZA 4C06A 1IDN1 4IHQA 1I3KA 4W9CC 2VP3A 2IDFA 3LS4H 1I1AC 3QWFA 1E3DA 1HO3A 1BXVA 2AQIA 4Q9QH 2FX8L 1QIEA 1UYWL 3G2JA 3Q5GA 1IZ9A 3T0IA 3C4VA 1N0IA 4X5QA 5IJKC 5L0QC 1MPAH 4PQRA 3LWBA 4I9GA 2DGDA 1Q21A 3ZUPA 4BVFA 5I0ZA 3C6SB 4GRWH 1EX1A 3FU5A 4IHOA 4GBED 5IOKA 1NOJA 2IW3A 3ARFC 4Y16A 4PJIB 3W2HA 4JFEB 1R5WB 2ZJ0A 1TETL 5IJWA 3VD4A 3T0DA 4BV2A 1IIIA 1OGTB 3OEEA 4APXB 3ARGA 3QFRA 3A6ZA 2EECA 2IE8A 4OJEH 1GSOA 3MSXA 1CUGA 5CFRA 1NOKA 1E8ZA 2MQ3A 2I2FA 5FKAA 1W47A 4CKQA 1ZGZA 3HCDA 4BUQA 4X80L 1A1MA 3JAKA 1Q94A 2X89A 3CLTC 4PC1A 3S29A 3G9AB 1BM3L 2I22A 4X91A 2J32A 2IEGA 4N3GA 4YIQA 4BWTA 2DEWX 4GUCA 3LBNA 1X8JA 2NVUB 1Z13A 2XSZA 4RMVA 4YHPA 1BVKA 1GITA 3PRKE 1G5HA 3V0GA 4O4LA 7FABL 5IMOA 4XVSH 2Y6VA 1IZYA 1W0CA 1IFHL 5F7HA 2FECI 1KJVB 4KYUA 4ATTA 3VPSA 3DIFA 1IPHA 1WUKS 3V5NA 5I7RA 1OIOA 5H3CA 3GRRA 3A1EA 1T1ZB 1MLBB 1IY9A 4CDGC 3IOCA 2ZWMA 4N28A 1H0KA 1ZT1B 2J5RA 5HHVL 1WXIA 5TPWH 2IJ0C 2J4WH 5KG9B 2ZW9A 2NXYB 4RETA 1UCFA 4YXWD 5EU7E 5HBGA 4L72A 1SXAA 2PO7A 1GCUA 1UK6A 3LQYA 1KYZA 1KYQA 5CLTA 3TBVB 3BZWA 3WNZA 5IHHA 3UTDA 3BLBA 3PFFA 3IFNL 3LZQA 3TN0D 2A6JA 2CHXA 4QHMB 1QS0A 1UANA 4PHHA 2GZDA 2FZEA 2DIBA 4HNAB 1W96A 3CPLB 1EQ2A 2VZ1A 4XRGA 2Q9UA 4IDFA 4BQRA 4J3WA 3F1KA 1TYDE 2EEAA 3AEQA 5D7EA 5LO7A 4P9HH 2NQCA 2A86A 4UE6A 3WQBA 5IUKC 1Q0PA 2RK6A 2YXEA 5T57A 3FR7A 2AAAA 1R4AA 4OEHA 1R8YA 4JI2B 1OAQH 3ZGZA 5JCJA 4GXTA 1VMKA 4G8JA 1PF7E 4B6OA 1HXMB 4G42A 1DINA 1RP8A 1J1XH 5CLQA 4D4KA 2V3FA 3FQXA 2P4UA 2O6HA 2EGHA 3LUKA 3VR6H 3WKYA 1OFGA 3TBHA 4DNXA 4NCC1 2GAIA 2H2SD 5TE4L 3W11C 1QIMA 5CDYA 1M34B 5EPEA 4YFEA 4RD1A 4F6CA 2C84A 3MROB 5G41A 1WZMA 4LXUA 4EY6A 4XXWC 4TXHA 4Y0AA 3O9ZA 2LCQA 5TE7L 2BVPA 3LVTA 4N8VG 2VXQH 4HRYA 5FV7A 2HKHH 5BNFA 8FABA 3S8WA 4W9RA 2K8MA 2INGX 4M49A 1J2YA 4HRVA 3V8CA 3N86A 1Z16A 4YHZH 1XAGA 1EWYA 2XFXA 1F06A 1BQRA 1X14A 1QSEE 1ZIXA 1REQB 2IALB 4P3KA 2FPSA 3LSOA 3JV6B 1EEZB 3FH7A 2ICES 4JR2A 1QYRA 5GXBB 2X77A 1BZQK 5I8OH 1Q12A 1Y1PA 4YEEA 1JYXA 1BBDH 3SCZA 2WCPA 3VR5A 4CBPA 4AK1A 4XNBA 3AF5A 1YN7B 3T1YB 3OHMB 4G11A 2GD0A 4RD4A 4PAMA 4JC5A 2NQ2C 1JF5A 3DGDA 4EY5A 3VV2A 4GXVL 4C08A 3HRKA 2CD0A 4MRCA 4B3RB 5HR5A 3DE3X 4XP5L 1U8JB 3HU2A 2QMZA 1F1AA 5H16A 2BLFA 1L7IH 1SYSA 3WV0A 3EJQA 2BHYA 1N7HA 1J48A 4AUUA 1K98A 4PSPA 5BQ7A 4G2AA 3ATBA 4D2NA 4UBMA 2Q07A 2XA8L 4OA5A 1CBJA 1SC9A 3ABMB 4XLZA 4PBSA 3EX7C 4MYSA 2FB4L 1UVQA 1JLKA 3IA7A 2A9QA 3SOZA 5DHAA 4TQPA 1RLWA 5DBGA 3SFZA 4AXXA 2ZXQA 3WIHH 1E1RA 1CPUA 3P0YH 5D72H 4MLPA 4WD3A 4Y2HA 3EVGA 2UYLB 2XWSA 1XRQA 2YHSA 5DZ9A 5K03A 2IG2L 2XCTB 3TJRA 1AHWC 4M8NE 3HC0A 4HALA 1T1IA 2J9RA 2BOCA 3Q9NA 4QXPA 1ZX1A 3UIZA 3G17A 2O5XH 1JDNA 1ZOIA 1I7RB 1CF4A 2D4AA 1LU9A 3I85A 4BE6A 1U0SY 3L41A 3AVQA 2VJ0A 5IQ9B 4QRPA 3IU3B 5GZOA 1CI5A 2X53A 4GG8A 1V1RB 4XIGS 5FX3A 1C5DA 4FNLL 1IQDB 4OUOA 1WM1A 5ULLA 4U39A 2CWDA 3NOOA 2KQUA 4TNGA 3QPWA 4NJMA 2O0JA 3RJ5A 2OQJB 3VZBA 5E5UB 4HBGA 4R1LA 1O6SA 1Q1QA 2WFAA 2VK1A 1F0LA 3NRPA 3JVDA 4WGKA 4MYWB 1JZHA 3HKEA 4YMIA 1VE9A 5JW6A 4XNYH 2G9RA 1RHQA 1KGXA 3EMDA 4R0MA 3O83A 1D07A 3EIOA 4JWTA 1KIAA 2F5BL 4JLRA 3R0QA 4F9GA 3DSNA 2AK2A 4IBLT 4WFIA 2F3UA 4C22A 3TA3C 5HI5C 2V6IA 4J7XA 2M6LA 2VZ8A 3AEUA 2Z9DA 4KROB 4LESA 4HEQA 5KAPA 1XCQB 4NWTH 3UXFA 1RC8A 3EVFA 4HIHA 1UZGA 4Z7VB 4ONFH 4ZX6A 2EXWC 4AV0A 3X3GL 1HE2A 4DZBB 3KXFD 3AWDA 2I7DA 2C8NA 2GD2A 1FFGA 3S6CA 1VGEL 3DX0A 4POZC 2OBLA 4U6NA 3K53A 1OWPA 1N25A 5IANA 2YXPX 1P81A 1NMSA 4K3EH 4LSQH 4D0RA 3OZ9H 5LDSA 4GI1A 1JI2A 2QLYA 2V2XA 1JXDA 2D2CC 3EZNA 4Z7NE 3QXAB 1E62A 3FLEA 1U9ZA 3B7UX 1XVSA 3MINB 4KQKA 3L54A 2ZT8A 1MEEA 4Q9CA 4S1TA 4Y4FB 4LLVA 2PX2A 2E48A 1OW0A 2ODAA 2QGZA 2ZJZA 6TAAA 1NGYA 2ZVQX 5CM1A 1UFOA 4W9MC 3NVDA 4ML3A 1YLBB 1SCNE 2BSRA 4DETA 4MXDA 3NIGF 4LLUA 4G43B 4Y8DC 3CO0S 2ERCA 1CZ8H 3VGDA 2JCBA 4NUGH 2KB0A 2IF7A 4BFIA 4HRAA 4F2FA 4YGXB 3E9MA 3IULA 3WLSA 4HJRA 3FLMA 1JLHA 5DEOA 2FEEI 4OZFG 1E89A 5AI8A 2NO9A 2YMPA 4PJDF 2TMKA 3KPOB 3QUMA 2V8MA 2W2XA 3ZEAA 4TKMA 2D2VA 5AYUL 4I4TA 2O6LA 3CCFA 4EUPH 3E9UA 2QV4A 2PF6A 3UTZB 2Y6SC 4FWWA 4GIOA 3F98A 4I4LA 2ZUTA 4LGYA 3EK2A 3DIVA 3HFMH 3CRNA 4EN3A 3HHRB 1JX6A 1F0NA 5FNZA 2IPTH 4KV7A 4NARA 2NP6A 4AQEA 3URMA 1Z08A 2VYND 5KNBH 2VUTA 4BB0A 4XODA 1JB9A 1SYVB 3RUFA 3FMFA 1QVVA 4TVOA 2YNMA 4IJMA 3AXTA 1HETA 1TKWA 3PC8C 5I7VA 1V3VA 1OMOA 4ND7A 4YUEH 4MGEA 5B36A 3WTTA 4N9OB 5CT9A 4G83A 5AAWC 3MRDB 1QQDB 1LO0H 3H6KA 3O0DA 3M81A 1IG0A 4WI1A 4AH2A 5CX1A 3T35A 1TTPB 3D1LA 4U0RC 2GZHA 2QX6A 4QTFA 1GN9A 3RIYA 3EFOB 3KYDA 3PHQA 1Y3DE 4CKZA 3WGNA 3B4NA 3UK2A 4QVGA 2VDRH 2R7AA 1ZNWA 5IM7A 2EVGA 2JCWA 3QDMA 3CZCA 3RFCA 5C9JB 2B83A 1DVTA 4XWGA 5K0NA 3I5UA 1H6UA 1BHO1 4PBWD 1XL0A 3Q8WA 4IS6A 4G2TA 1TZGL 2Z0MA 3W7VA 4INAA 3MUOA 2G72A 1DS6A 1Z83A 3EBLA 1BXXA 2NW2B 4FNLH 3QVWA 1NXOA 4XGRA 1LO3L 4QYXA 1H5BB 1PLLA 3S68A 1CDZA 3UMCA 3POHA 2FE4A 2IOFA 3ZL4L 4CT4B 2I0FA 5F51A 2CV0A 1F4XL 2I78A 4NCIA 3UMGA 4FZVA 2AZTA 2VEOA 1E2QA 2QORA 5DHYA 3N2NA 3PNWA 2OCDA 2CMRL 1IJKA 1SCAA 1WXQA 3NCHA 1L4EA 4FA6A 1P9MC 1F0YA 5JECA 2X38A 4UXIA 2GN4A 4AKHA 4FRWA 2B35A 3AY6A 4KKLD 4Y1RB 4ER0A 5K5YA 2GVDC 4POYA 4NJOA 3ZKAA 3CLTD 3CRZA 3EEIA 4OKIA 2VHYA 3ZI7A 4DJMA 5K39A 5DF0A 1NCAH 1DE4A 1DKQA 3DV0A 3T4XA 4AC9A 1AQ8A 3DAHA 3GZJA 5ID0A 3TQOA 3MRGA 5D1ZA 4KJYA 3WC4A 3BILA 4MHSA 1DZ0A 3B51X 2DM6A 4O25A 5IW1B 1ZHBB 4WWNA 4LO9A 2GJ6A 3APDA 2WLYA 4HFJA 3K0SA 3CN9A 2BHFA 4DGUA 3PF9A 1J5XA 3ZDXF 3DVIA 2IHNA 3C1TA 3CEJA 4QHSA 4ZU6X 4FTDA 5DGXA 4XNQA 1V4BA 4UNPA 5B1AB 5BN5B 4OMDA 5ALBH 4HWBH 4NN6B 2UY7B 1MW2A 1NKSA 4MMXA 1QKKA 4RSRA 3U46B 3NOQA 4QYOB 3FOCA 5JLZB 1M3SA 5KREA 4B8WA 3D6FA 2PXYD 3RE0A 1R6AA 3ISYA 3E1KA 3VGJA 1MJ8H 4ZUWB 4F3TA 1SSLA 3T5MA 5LZ9A 5FA6A 5CJ2A 3PGDB 4IIQB 3I8XA 1AO7D 2XWRA 1SHZA 3UFBA 2O8EA 5B4MD 3Q5DA 1NI4B 1CNEA 1RWOA 5D5MF 1XDTT 2WHVA 1XF9A 3OUUA 1YAZA 3GXFA 4HZUA 4TLAA 2WA1A 3O2VH 2DLFL 1RM4A 1MIOB 3GXOA 1N5LA 4V3CA 1QYIA 4PSUA 5E4FA 4N12A 5E0FA 1JCKA 3K9GA 4QSHA 3K0WA 4OLEA 1FYXA 3EBOA 4N9GB 2NN3C 2Z5GA 2YYAA 2WM8A 1IXKA 3SZ6A 2Q5LA 2ZR0A 1E6OL 4PLCA 4PY2A 1YXMA 3GSQB 1FBIL 3K4QA 3NHWA 1D2CA 2ODNA 3UO8B 2O2EA 2FPGB 4P4KD 5DMKA 3RUAA 2IANE 2RCYA 1VJCA 1E8XA 1AJ7H 4FQIH 3PQ6A 1L0QA 4Z7OE 3ARGB 4A63A 4XGIA 3O6FA 1R3UA 3K94A 4L8SC 4QRRA 4AJVA 1X9RA 4PJIA 4ZMLA 2IOHA 1ZNZA 2OWDA 1EO7A 5C0FA 2WJVA 1PSZA 3T5GA 5HJBA 1NSNH 2VR8A 1SN2A 1AOZA 1HZHH 1RHUA 1YMME 1HNWB 3TTTA 1D6VL 5GHWL 1E79D 4K9RA 1JN0A 5E4AA 2H0EA 5JNRA 4QM7A 4XE5B 5IMSA 3T04D 4B4DA 1TKAA 3M89A 4RS4A 2Y22A 3QA9A 5H9WA 1ZDQA 5K0SA 1DOHA 2BCGY 1MV8A 1WFJA 1RD6A 1U0NA 3ZWVA 2NZ8A 1N4DA 2P5WD 3MRRB 5D7JA 3UHAA 2YGQA 4MA7L 4FUTA 5IHLB 3NACH 5A2LH 2PRZA 1X80A 2FZLA 2WNSA 2OPBA 2B5IB 1KJJA 2DPLA 4IWNA 3OQ6A 2WXJA 5D1NA 1G66A 3T1OA 1EWRA 2P8MA 1IKOP 1ZXKA 4X8XA 2YZKA 5EUCA 1WDWB 3Q7JA 1RFGE 3CM0A 4LCUB 3IEKA 1EAOA 2ZJ8A 3ISRA 3EIHA 1B8OA 4OQTL 4U2DA 4K87A 5ALNA 2X0DA 3WIIH 4ZMWA 5DYTA 3K71B 1QTQA 4EN2A 3TDMA 1IL1A 4WEQA 1U8HA 4BO1A 3HXTA 3D2TA 2HDNB 3BFJA 2VTBA 1UMDB 1ACYL 5BN4B 4N20A 2FKAA 3HFRA 3B6KA 2GWHA 1DC8A 2JHPA 2JFYA 3NTRA 3FB7B 4K94L 4EGFA 2XAAA 4F1SA 1FF9A 1WLHA 5H82A 4B9GA 2RHEA 1XI2A 4MVJF 3IKCA 2GHQA 2JJTA 3AB8A 2ZXEA 2HNKA 3UYPB 2NPOA 1J9TA 1P44A 2DUMA 3TSWA 1KGUA 2YARA 4EX7A 1ZA6A 4GXRA 4NKMA 4PZAA 3NHKA 3GJEB 2GFBB 1K0UA 2CDNA 1V41E 3OL2A 3N85H 4N0EA 4MXWL 1U3CA 1Z29A 2VR1A 2NNAA 3UMBA 2Q8QA 3PFNA 2IEYA 2N1TE 2JLWA 1JGLH 1NMQA 5DM4A 2HB0A 4K8RC 5IFLA 5AJZA 1ZAGA 3O8XC 2RAUA 1YQUA 2HGSA 2P5PA 3DVRX 5FWRA 3H8VA 5BW4A 1UMCB 4D80A 3ROKA 1E8NA 2W6MA 4LL4A 1KIQB 1UJNA 2CA4A 5F1PA 1QFWH 5CYGA 4D9KA 4RGYA 5CVVA 1XZGA 3JUYA 1F13A 3WJ1A 3W5NA 4A6DA 3PL6C 1G7PA 4TQAA 2YJNA 2VKXA 1G7SA 3O4HA 3D7PA 3CBGA 2AFNA 1C16A 2X4SB 1XQVA 4A2QA 3WXBA 1KVUA 5JDSB 4XWOC 3KPSE 5D51S 2X4TB 2VH1A 2WKOF 4ACBA 1X19A 4QDKA 1H0RA 3NH7L 3WEAA 3AMVA 4IBOA 2JWYA 1V8ZA 1YMQA 2GN2A 3G5ZA 1QK3A 1QQTA 2AT1A 4LHUB 3AFMA 4OOEA 3FWNA 5I8CA 1GPKA 1OYOA 4RK0A 1OLUA 2VP9A 5ICFA 4E5YA 3LZ6A 3KQYA 4ANFA 3AS3A 4NFCA 4IVNA 4HTAA 4X6BA 1WGVA 2AXJA 5GINE 2IAMD 4FCAA 4C04A 4RGOL 1KJ3L 3B13B 3W3ZB 5EOQL 3T7DA 5JIQA 1IOLA 1XAIA 3DEZA 3WLNA 3DSFL 1HXHA 5DYGA 5F9JA 3UOGA 4L9DA 3TOZA 3EPRA 2MOVA 3F12A 3J81k 3FC8A 3UV3A 4LCVA 4CN4A 1I8UA 1YBFA 5AZ2L 4X8JA 1KT2A 1J18A 1OCZB 2XWTB 4QOJA 1F6AA 2HFEB 4JNXA 2UZXA 3WTWA 2OMXB 2VCHA 2W0FB 3L8DA 2DQEH 2JCCB 3WYEA 4EI7A 2N7AA 4HH8A 1A7QL 4LCIL 2OK0L 1O2DA 2XOKA 3QJHA 4H7JA 3UWSA 5T41A 3HS0A 4ZV4A 3L5HA 1YHNA 2LCFA 1UXOA 1TYJA 5GHWH 1Y81A 4CMGA 2QVZX 2EXYC 2J44A 5L7YA 3VXMB 1J0EA 2FR4A 2C95A 5JORA 2HMTA 1QO7A 2YRPA 1QKZL 3DLPX 1QKJA 3TOVA 2Z8SA 3C5ZB 4XYEA 2DM7A 1EZUA 5DJ0B 2H9YA 4HUWA 2TSBA 4Z7UB 3IHKA 1KTVA 3PSAA 1IWOA 1NBZB 4JGIA 4NBUA 5F1IB 4O8CA 2QZJA 2BSSA 1IK6A 3SYNA 2HMID 3DBVO 3LUAA 4BFXA 4V1DE 4X8LA 5LDUA 5TXGA 1SUBA 3ANXA 1P5VA 3GLFB 4JU8A 5I30H 3ABLB 1Q0RA 5I6XC 4K0OA 1Z4OA 8CGTA 5JANA 5IT2H 1Z28A 4Z7OF 1NM5C 1KYOK 2GC7C 2RH8A 3RSFA 1L7NA 2I71A 1HQDA 3TH5A 4S1QH 2XKUA 3BPLC 3WAKA 3OC8A 2OBXA 4M6NL 5GIPE 3U6RB 1NQ5A 4G0QA 3ARFD 1L8AA 2IOIA 3SKMA 2IGFL 4KJPC 1XKQA 5GGVY 2JFOA 3U1SH 3QVXA 4CU8A 2YGPA 1T6BX 1OAKH 2ZIAA 1TPYA 3GJFB 4A1OA 2XCQA 4TULL 1MUUA 1CS0A 4HQ6A 4LSGA 1CEYA 1ZOSA 3KC2A 5J1SB 1DQLL 4HWBL 5JTWA 1MLDA 3DQPA 4RDQG 1KSJA 3I2CL 5LDHA 3SDXE 3IUEA 4DS3A 3BW9B 1V6SA 4ZYLA 4LOEA 3IGLA 4ZTEA 4C56A 5BN4A 1X39A 3F12B 4F2HA 4F4DA 4H6PA 3ATEA 1K1EA 5IJVA 3LV3A 2Q2LA 4JEMA 4A8JA 4ZMSA 4ZT3A 1A7RL 4QYWA 3QXCA 4F33B 3NABL 4Y9EA 4YHHB 1SXQA 4QECA 3DRQB 4MPDA 4QRDA 4E46A 4PBXA 3U46A 1PHPA 4Y2NA 1Z2KA 2YWGA 4REQB 1ORQB 2IZ6A 1BD2E 1YZNA 1OLOA 5F7MC 1A9VA 5AK5A 3FRPB 3T71A 2ZTSA 3EXFA 3NWOA 2P9FA 4ARCA 3PJSB 4DIDA 5A4DA 3INTA 3RFFA 2GLXA 3BVNB 4ZVVA 1NJ6A 3NEAA 1XZ0B 3SZ3A 1T6ZA 4UBDC 3DXAE 5F7LB 2EDEA 2VDPB 2CA3A 1FVFA 4PFKA 5HW0A 1OCWL 5IM5A 5HHOA 1ATZA 2E47A 2M26A 2ESVB 1LDBA 1JDDA 3KYDB 1EERB 2AJSH 1A9BA 2FO1A 1AC0A 3UBXA 2RGRA 1G7PB 2IP1A 1BG1A 2JVKA 2FECL 2VO1A 3H9HB 5L4JA 2YJ3A 1WSAA 2XHNA 3ASZA 1BMQA 1Z7GA 4KRNA 1F2VA 1P84K 2RIKA 4LVHC 4TUUA 1HE8B 4NWUH 2LDXA 3MTIA 4JQOA 4MYCA 4L8CA 5H5JA 5C0BE 4NM4H 5F9WC 1LBSA 5E6YA 1IQRA 4HCGA 4PRHD 5D9SA 4C6SA 4FQCH 3LC1O 2PQ0A 2VUHB 4MUGA 1CXLA 1JKMA 4P0QB 1CFZA 4D9NA 4NQTA 4QJ5B 3TAXA 1B2RA 2XGGA 4UMVA 3K8OE 4HUWB 5JJCA 1WBXB 4HWOA 4REOA 3N0RA 4UPVA 4HJ1A 3GAFA 1T91A 4QREA 4GR9A 1LEKA 3THXA 1IBSA 3RL2B 1AQJA 3EBHA 3GVCA 2XWDA 1OBHA 5I3ZA 2A9RA 3I3DA 1KKLA 3FCTB 4XH2B 4GO8A 3E8XA 3RKSA 4B9KC 5HQ3A 4YT8A 4MBRA 5TQ0A 4II7A 5I6DA 1AFVH 1S8NA 4V0ME 2EU8A 2PX6A 5MN5A 1JXAA 1G9HA 1ZT7B 4F7CA 4MWCA 4MUAA 1ZH0A 2V9RA 4XPGL 5BW7C 1ZNXA 3SC3A 3PAVA 1OZUA 3B1KA 5FFLA 1PGRB 5C6TL 5AVWA 3A6BH 2XWTA 3X14B 2XBMA 1A3RH 5ALGA 1XTKA 4F9LC 1THAA 2R23B 3WK6A 4JQYA 1K75A 4EJFA 1IILE 3UACA 3QIBC 2ZQ5A 2XWBF 4Y5YB 3SGJA 1H05A 3TZKA 1E2HA 4IV0A 2ERJB 2AG6A 3HKCB 3EUEA 4GMDA 2PUWA 4O2LA 5FUWA 2OSBA 4FN5A 1A9QA 4IJVA 1C7QA 4AZ0A 4UQCA 5G4NA 2FU5C 1PFGA 2ZYRA 4ZYVA 1P1ZB 5AK4A 4C7JA 3CLFH 1GG2A 4HDNA 1V7CA 2MDTA 3VR5H 1T7ZA 3S5UA 2C59A 2FYTA 3WWZA 3ULVL 1AVAA 1MDBA 4BKOA 5I0XA 2R0LH 4ELDA 3I58A 4WTWA 3BQVA 3ZZTA 4FS8A 4KKNA 1E77A 4JL6A 1A6AA 2DOKA 1DXQA 1QZ1A 5CJ5A 2Y4OA 4Q34A 4F5YA 5FYKD 2VK8A 4MVYA 1Q1JH 3DVNB 5C09D 3WKMH 4FYQA 3QOFA 1KCUH 3B3GA 3L01A 2ZVJA 1AR2A 3FT3B 3RUPA 1CL7L 3V1YA 4DLNA 1V2GA 4Y2QA 4ETWA 4U2KA 3IUYA 3ZVRA 3RTQD 4LHQB 5P21A 3E7FA 4PV8B 2C7PA 1KDRA 4YACA 3ILSA 4URHA 2P5WA 4MRPA 3DZJA 4JG0H 3IIEA 1WPXA 3EZFA 4RAQA 2BV3A 1UMCA 5LAXB 1DVXA 1QP1A 3VISA 3WLQA 1ZUWA 3WNQA 1V16A 5JG7A 4KTTE 1SGKA 1ZK2A 4PW3A 4K4KA 2Y1CA 5DNVA 3CZRA 1Q9LB 2AMJA 4TTVA 1XNQB 4BZWA 1BQ4A 4JRXB 1JEYB 4P4KA 3DDZX 1GOGA 3MRLA 4YHMH 2WNHA 4H0IA 2WYHA 3IAXA 4CCAA 3T2PA 4KIFA 5C7XL 4NI6A 1SKYB 4GOMD 3UEQA 2KUTA 2RC5A 4X94A 4X6DA 3NP7A 1U80A 4GAGH 4LSPL 3D4NA 1XSIA 4LDEB 2SNIE 4QE3A 4LFHD 3VFSB 1DKUA 3CQ9A 5E99L 1C1EL 4N65A 2UYLA 4H3VA 3RNQB 5CN2A 3NCWA 3ZWNA 4DAOA 1JGIA 2OMNA 3C5JB 3CMMA 4LDLB 1E4WL 1WPGA 2JNWA 3PYLA 1T9ZA 5I6KA 1U7XA 1B73A 2EILB 3NBYC 1JA0A 2X0WA 1UZMA 1J2UA 2HUPA 4UEOA 3UO1H 3QIWB 2GJZA 4F80A 2D00A 2R59A 1BRTA 3CF2A 1EFLA 2IPLA 2G3NA 4C6RA 5FIUA 4BBZA 2QSYA 2WTRB 3T0VA 4EB6A 4BKPA 1EZVY 5CILL 1SYVA 4PIBA 2QL5A 1OGIA 4LSQL 5H4YA 6ABPA 2EERA 1R10A 1DCKA 3PQYA 1IYZA 4HBCL 2ACEA 2EP6A 3PUJA 4AYID 5ESWA 2DN7A 4EGJA 4GPEA 2E76C 3FTDA 1FYTE 5EO1B 4AYDC 1FV1A 2NY3B 2J6WA 2PVSA 4UTRA 3PDOA 1NUAA 1CQKA 1FNFA 1AQKH 4L5FL 2XV1A 5I6XB 1U1EA 5G02A 3GZNA 1KTCA 4G9DB 4Q1FA 4P35A 3QI9A 1ERNA 3E3QC 3I50L 1W75A 3C08H 3MILA 2UX6A 4Z9FA 3Q7PA 4O1MA 3TTSA 3CLRD 3BRSA 3ZDZF 5AZEL 2HT1A 2O6EA 2ITEA 4JZNB 2YYSA 1CGSH 4HLUA 3NDBB 2PWAA 5KQSA 3Q05A 1V6CA 2N9UA 4NNYB 1GJUA 3RWGA 3NCTA 1H8LA 3L7MA 1DWUA 4AJYV 3W8EA 1J0JA 2W0PA 4JLPA 5TD4A 3HFGA 5HVGB 2J7PD 4OQTA 4OHPA 1E30A 3JAWB 1A9XB 1UA6H 5EUKB 1J9CT 4RPKA 3TZVA 1NVBA 2GITB 1VG0B 5KVGL 4BWFB 4JKKA 4JGMA 3WNNA 2O52A 5JNYA 5IKMA 4AGLA 4NVRA 2CF6A 5DWDA 4XX1E 4B44A 5DJYB 2OMWA 1QAWA 3KR1A 3JSXA 2XKNB 3PUWA 4JO3L 2GLUA 4J1QA 3R18A 4PJFA 4NDNE 5IJ9B 5B55A 1BJ1J 3RB7A 1G291 2OCYC 2OV6A 4JA0A 3O9WC 4GPZA 1OD6A 2QWXA 5TQ0H 4DQ0A 2IS2A 3HPQA 5B7GA 5EA0H 2Y5EA 2DDQH 1CR9H 1V54B 4GKBA 4LGCA 2E7BA 4FFBB 4HMEA 4BGLA 3SVZA 2NCEA 3MA0A 3GHEL 1F4WL 1AO7E 2XY4A 5BURA 1JTVA 5FGCE 4QATA 2Q86B 2VKTA 5D6DC 3GUTB 4FPXA 1AY0A 1PNTA 1O9WA 4NJAL 1L9QA 3DX8A 5DQDL 4PB0L 2PV0A 2BWQA 4Z1MA 4DCNA 5E6SB 1YNOA 3OX3A 4AEHH 2ZX7A 3TRFA 2H47C 3ALPA 3WLBA 1AGEA 1OT1A 4UDUB 2R0QC 4R6WA 2VCEA 5K33A 5LMZA 3CUKA 4B3EA 5E8EA 3W6OA 4YO8A 3SDCD 1X7XB 4FG0A 4CW1A 4Z9KB 1D0IA 3NH7H 3FU9A 4ZIRB 4KK5C 3GJQA 4FQHA 3S4YA 3R9IA 3C97A 4L78A 3WLWD 5FDWB 2PH3A 2O5ZH 5ILTL 3GUZA 5K0GA 2ESRA 5JDSA 1U93A 5IREA 4KVAA 2YD0A 4LBYA 3HS3A 3A21A 1K0FA 1UZNA 2Q0SA 4IGAA 2WSPA 3H2HA 3LF2A 1YVDA 4QLRA 3IFNH 4BFGA 1DELA 5GOZA 3HNRA 1DJNA 1OTUD 4OV5A 4WW0A 3GLGE 3LDAA 4D0CB 4MKRA 3GMOB 4OQNA 1GP2A 3UVEA 1MB3A 1QHGA 3MBWB 1EMTL 1G7HB 3GNSA 1QACA 3KLHC 3T6QC 1IBGL 4X7PA 4AIRA 3WGLA 2H1SA 2NDFA 1D0SA 4HK0A 1OAAA 1ZSYA 4U7MA 1RSYA 4N0UE 3GYGA 2E6KA 1X5MA 3TZVB 1FSPA 1UJ6A 5KNCH 3CBKB 3ATAA 1VAHA 3N2ZB 3B2XA 4G0MA 2LLNA 1Z9LA 5KO2A 4XM1A 1E58A 3O2DL 8ABPA 5BSEA 3TGLA 5SWSA 3TJEL 2R47A 3GGSA 3PE3A 5HZHA 4FHJA 5C4IA 4FFDA 4UDXX 4UJ3A 3PRHA 2FGKA 4LPYA 1U4OA 2X3CA 2GEJA 1FORL 3AWFA 4DCSA 1HX0A 3E9RA 3L82B 2R8EA 3SD2A 1ICEA 2UXTA 3MGTA 3CPEA 4UQPA 4U6HA 3AILA 4IS6B 2ADJB 3KLHD 1MXGA 5BV7H 3GGOA 4XFJA 4KYTA 1EHKB 2JI6A 5ANRB 3OKLA 2GBFA 1KPHA 5J4VA 1FDLH 1KNOB 4NYIR 2WSLA 4X6DF 4L16A 4X7RA 5LAPA 3M6UA 5DLEA 4EI2A 2BVEA 3UP1A 5KVFE 3ETBF 4RJIA 2QMEA 3MUHL 1W0WB 1F8FA 5TDNA 3G2MA 4DERA 4LMBA 4AO7A 4MRMB 1P31A 1C9SA 4Q56A 1NWHA 1TLTA 1FC1A 4IDJL 2EEDA 1M6WA 5JW4Q 1B9KA 2VDPL 1KIPB 3BVWA 3Q88A 3V9EA 2FLBT 3K9BA 1FAKT 4U63A 1E1LA 4L4SA 4ODXA 4EDXA 3QIUD 4JJ5A 2NZVG 3QPUA 3U3XA 1NSFA 3SZLA 4JJKA 2V7EA 3KG2A 1KL7A 4BE5A 3BMCA 1IGTA 3BLKA 4FHDA 1KI3A 2JFGA 4QGFA 1U58B 5F71A 3ZDZB 1Q0XL 4G8GE 4QXGH 2E9BA 2X4UB 3X13B 5AVVB 1NCGA 5IZ7A 2AMVA 2R751 3HC3H 5H7XA 2ZYTX 5E1BA 4QTHB 4X1IA 1IM3D 1F8XA 3PBKA 1JZ7A 3QUXB 4Y2DB 4RKWA 1C3EA 2JXMA 1MRCH 4N9QA 3KR3H 2CKMA 5F1NA 1JG6A 4Q9DA 3L18A 3MQIA 1V5IA 1LZLA 1BFOB 1NZRA 3FU7A 2R97A 5HIJA 1EFUA 1XAJA 4PZEA 3LUCA 4I0PA 2QY6A 2OMWB 1ZO8A 5CXSA 1JWBB 2H0AA 3ZT6A 5A0FA 4F7WA 5J0BA 3UJTH 4AIZB 3IDUA 1NGWB 5DRZB 3AFIA 3PI6A 1L6XA 4RVGA 3TEXA 1U2CA 4Y4KC 1FLNA 1CGVA 4UBDD 2X3FA 4NUGL 2ICAA 1DQQB 4LLMA 1E66A 1MJJB 1NC4A 1TYCA 2ZI3A 2XXAA 1MAWA 1USZA 2O8DB 1UT2A 5L6LB 1QFZA 3I2HA 3RAFC 4NQXB 3IBOA 1KB5B 1QMGA 3PK0A 1B4DA 1TU2A 4YMPA 1SXCA 4F4FA 4EOGA 5FW8A 2WMOB 2V5UA 2WFZA 3CDYA 1GGFA 3Q8EA 1WXHA 4FNSA 1NI4A 2UUDH 4F93B 4HJTA 4DFIA 1JG7A 4X1IB 2WWKO 2Q0ZX 2ZIFA 4IDLA 3EWSA 2GBLC 5F7JA 1ECYA 1QH1A 4MJID 3BXXA 1R19A 4R1SA 4AYMC 4MCJA 2L4OA 4XCFH 2B1IA 2YW9A 4MD5B 2R2BB 4OBBA 3TAHA 1TITA 1N34B 3MERA 4C0LA 4OB7A 1MCWM 2KPWA 5CINL 2HX7A 4OZHA 4GPIB 5B3JE 3EGCA 1J49A 1VKXA 2G4EA 5H2BA 3HPLA 1HLGA 2NVWA 2B3DA 4CILA 5C08A 3VJKA 3DTVA 5JCXA 4PY8I 1SEQL 2W6OA 4XRCB 4J23A 1EAPB 3UANA 5K69A 4C05A 1LVGA 2WSSD 5JNLA 3KDMA 4PV1C 2A3NA 5HUJA 1PLGH 4O4YH 2NV0A 2P9ZA 3RTCA 3ITEA 1KJ2L 1JR2A 1F42A 1UXWA 3GNQA 4JV5B 4JVMA 2EDOA 4HTFA 4M0PA 2EBHX 5LA6B 4P54A 5EEXA 1KI8A 4HXGA 5DRTA 1NCAL 4FDVA 3DAPA 4JLUA 2QUZA 4PSDA 1PLAA 3U56A 3TO2B 1TM4E 3V7AE 1ZLEA 4BLOA 4PS4H 1CFVH 4Z4GA 1LSUA 2Y2YA 3IGKA 1HH9B 4MCIA 3JVGC 4FZ8H 2W4MA 1DSFL 3ARWA 3EOBI 3FKJA 1L5YA 3I37X 3H1EA 1JVBA 3FCOA 4ZAFA 2GJZB 2YD4A 4PLHA 4N2NA 3RL2A 5C08B 4H35A 4QX6A 1SN7A 1QGYA 3VSDA 1RYYA 1I1OA 2OZ4L 4XC1H 1FBTA 3IMWA 2EIMB 2UVQA 5JSQA 3H5AA 2P3QA 1RIUH 3TBYB 4XRRA 4H20H 2BW0A 5JIMA 2PS1A 3K8KA 5AUOB 4JBXA 3QIWD 3K70D 2OAEA 4QYTA 25C8L 4QY8B 1U3FA 4XPFL 2QDVA 3K35A 2BCKA 3X1JA 3AS1A 4QGGA 4X6DB 4DLZA 4LCWA 1HGXA 3TCLB 4K9QA 3SNKA 1CQZA 3RY4A 1SU6A 4JDEB 4B81A 2C2ZA 2N1KA 3EXLA 4GL4A 3F5WB 2R48A 5T6MA 1MNUH 3H9EO 4PFSA 4M3KB 5KJFA 1JXGA 2CDCA 5LBSH 4KXAA 1AQLA 3TG2A 1PV4A 2C7UA 2HRHA 4AG4H 1R3LB 3UEOA 1RZGA 1ZL0A 3I4FA 3RD5A 4IDHA 1KYIA 4MRNA 4HYTA 1KJ9A 3AV0B 1P6FA 1RZKC 5I45A 2NY0D 1UYWH 1T34A 2YFQA 3LOQA 2WZAA 4PJ5E 1L4FA 4EVRA 1DJLA 2CC2A 4R6XA 5FX2A 2XI9A 7MHTA 4OKSA 3QJTB 3WK4A 1I8LC 4MX7B 1XZFA 4CMAA 1CZLA 1FZMB 4Q9LA 1WA2X 2OENG 2B1QA 1JBKA 3VC3A 2WF8A 3MB5A 1ANUA 3JWOL 2O2GA 1VE5A 4Z7VF 3AG5A 1OB1A 4I1OA 3ANYB 1XSEA 4GEIA 2M6RA 3ZWOA 3HACA 3RTQB 1N6NA 3VDBA 5SV2A 3MJ9H 2FVYA 4OU4A 3FFTA 4I1VA 2ODTX 4HPOH 3BSYA 1BWMA 1P74A 3HFJA 1OGAD 3CXDH 5C09B 5AVVA 4CF6A 1LC3A 1E3EA 3ELYA 5EZYF 3BH8A 3C16C 5DK0B 4KRYA 3W5SA 5EEHA 2F19L 3U7HB 3UWPA 3E8UH 3LZDA 4KI5D 5KUMA 4O4LB 5LGJB 1QHHA 1IUPA 4AZ8A 4KXUA 3VC1A 2AXNA 2KI6A 1Q9WB 3FN0L 1HG0A 3SD7A 1E3ZA 3FYCA 4QLOA 3TVMA 3D4PA 1QSEB 1FFPA 3LKVA 1ZLSH 5FI5A 3EVDA 3O8QB 4GGMX 1KB5A 4HC1H 3AB3A 4IVQA 1MOEA 5TE6H 1ORVA 5FYLL 3AEQB 3QY0A 3OB8A 4BJLA 5HS6A 4FQHB 3H5OA 1L9XA 4EAEA 1GQQA 1EGAA 3ZNPA 3WS6C 2JKZA 1GZPA 2IH1A 1R3DA 7CGTA 2I4OA 3KB6A 3KUDA 4GMSH 4C6TB 1YRHA 4HIIB 2O8BB 4CM5A 4BK5A 4N0MA 3VXOA 2FSFA 3GPEA 5B1EA 3ZR6A 5J3HD 2WVJA 3BEDA 4GHWA 3HZMA 1VEOA 3GJ0A 4RW0A 3GOQA 1VJSA 4M93B 3I32A 4B46A 1EUTA 2F74B 4MZ2A 3C15C 1JHTB 1UQRA 3LCJA 2OR9L 1ZOOA 1P9OA 4OBWA 3C6EA 1W4AA 4D4JA 1QG3A 4FX2A 5DNWA 5LB2A 3OECA 3E2HB 3JTSB 2WAHA 3D8TA 5F78A 2V4ZA 1WD5A 2DWEA 3C1OA 4DVJA 3AY4C 3ET4A 4R4BA 4D0BA 3SEQA 2XRMA 1AFVL 4IDQA 1GILA 3GT7A 3O73A 4N1AA 2C4FT 2RIPA 4ZS6D 2RD2A 5T1MA 3KCPB 5K8IA 4M62L 3EDDA 4ETMA 3P11H 3VACA 2QJWA 2J20A 3NN8B 3QDGE 6REQB 5ENWA 4MLDA 1MCLA 3EXEA 3H2YA 4R1MA 4Y2JA 4KWTA 4GRLB 3WXMA 5H94B 2FZGA 1SG6A 2C97A 2V7NA 8GPBA 3BJ91 1HOCB 3AU1A 2W95A 1KK0A 1UJ5A 2SKDA 5BSTA 4UDOA 1J21A 3P2EA 5EN2B 2R8ZA 3TECE 4F6RA 3ZQ6A 2GTWA 1FNCA 3EF3A 1P62B 1NYQA 4E22A 4ZTBA 2HPVA 3NJLA 3T3HA 4INZA 3VQTA 4D9EA 1KZHA 1VGKB 3HDQA 5E9DD 4ERSL 4DV6B 4XVTH 1UMKA 1O8BA 1GPOL 3W0WA 4I0PD 4BNJA 1LK2B 2FHCA 4PZ0A 4KAAA 1GPMA 4YE4H 3V6BR 1A4XA 4WVFA 4FDAA 4RCAA 3X17A 4HDAA 5LC1A 1BXRA 1D5BA 4M56A 3HWX1 3RRJA 4U6QA 2AWNA 5HDLA 1HEHC 2QQQA 2PW2B 2P91A 2ED7A 1BVRA 1DHKA 3ZLQC 4PJXB 1JH8A 1CBVL 4F5DA 4CLOB 1ZU5A 3DULA 4PGMA 1MCQA 2CK3D 3EG9A 4PLKD 4F5ZA 2YC1A 1NEZG 3RWJB 2AC2A 2NQ8A 1DHTA 5IEBA 1TZ8A 1KYWA 1VLQA 2R9HC 2EDKA 1WZUA 1QSFD 4Y7OC 1CT9A 1C9EA 2YHGA 3MA9L 2Q4DA 3KQNA 5D4HA 3EJPA 5C53B 4ARAA 1IVLA 4BUJA 5HJ7A 4ZC1A 1BFOA 2P62A 1W15A 2ZRAA 3MRBA 3W6UA 3RKDC 5LGJA 1FQOA 2CUKA 4R7VA 4XCYB 2WYWA 3UFIA 1TGYA 3IO5A 4ODWB 3OKOA 3PUZA 1K8DA 2FSDA 4QRQA 3VFPA 5I75B 1CZRA 1PEKE 4M9QA 1CE6A 2IV7A 1YEJH 1IEBB 4JL5A 1V3JA 1IM9B 1ACLA 3UAXA 4QAQA 2MQGA 2IXGA 2OV3A 2QD4A 3Q3GE 3UL4A 5DVZA 4KFZC 2Z35B 4Z7AA 1J0HA 4U2ZA 4BCCA 1SQSA 4ZI5A 1GYWA 1KIUA 2VLRA 5DTFB 5JZ7C 5EUOF 5HDBF 4DH2A 1PX0A 3R7SA 1U8OA 1QNZH 2JCVA 5EIIG 4H2DA 4IKKA 5AKXA 5AM5A 3T3MB 3WLBB 3EVEA 3IOMA 2D31A 4F3KA 4FHEA 5CKGA 3SF8B 2O8DA 4UIMA 2CUTA 4D6XA 3U9SA 4J0GA 2GBAA 1WRFA 1X7TA 4NERA 1K8QA 3VWKD 2O93L 3K16A 3MVEA 3L6UA 3GNLA 2PXXA 1KXQA 4YDLB 2KZKA 3EZ9A 4K2UL 4PRLA 1KEUA 3QUXD 5ISMA 1QHOA 3H7AA 2JIRA 3M1CA 3OT4A 5T5FA 2Y93A 4W9EC 5C0DA 2PP8A 5KSAD 3OWRA 1XAHA 4D3SA 4JG1L 5IJ0A 3I1JA 4PJ7B 2DJ5A 5DD3H 4BLRA 3QHPA 4LJAA 3GSWB 2CUMA 2BGRA 1A2QA 3GNMH 5IH7A 3L7AA 5JSUA 3OD1A 5CA0A 1VHJA 3PAYA 1UM8A 4I18C 4PRKA 4J6FA 2D73A 2HT2C 4O5LH 2J85A 2OV8A 1QDEA 2ENJA 1Q92A 3NSYA 2ZG6A 3BDAA 4HLCA 4GBXA 5AUNB 3C5ZD 1D2HA 4EZJA 1O6CA 4YDKL 5DJCB 3OZGA 2VF2A 4M9SA 3MS7A 3WTCA 4LPTA 2YPVH 3LQAL 2AANA 5MP6L 2NV2B 2NO5A 3BMCB 1UFVA 4O59O 2OYPA 4PY8J 4FFPA 3GJRA 3DDGA 4CI9A 4GUAA 5ELIA 1G9MH 1UENA 3SPIA 5KWIA 3BX1A 3G9UA 2OBNA 3DL0A 1T3FB 5EZQA 3S2EA 5KX5F 4FX5A 4HU8A 4CJXA 4JELA 5CEXA 3G5VB 5T1LA 1X9IA 3WGTA 4LX0A 4M7ZB 1Z35A 1NFFA 4UIKL 1GY2A 1A6UL 3DB1A 1VI6A 4L8GA 1BBJB 3BUQA 2Z4SA 4D9GA 3O31A 4WACA 5G0VA 1WF5A 4R4NC 4ZCPA 4TNVK 3QH4A 5E8OA 1UJ2A 4FD3A 1JI1A 2K1MA 3S0JA 4PH8A 2CLFB 4FEIA 7FABH 1KXHA 1TUIA 1XQYA 5KZMB 3GXIA 1RIHL 4MR9B 2XZCL 2FZVA 3HZKA 5IG7B 2FWOA 1MTOA 2V7HB 1A8SA 2CDBA 2OCJA 5I1AB 3WFHB 3FYTA 1DEHA 3WN5A 3HJHA 3VH8B 1CJUC 1G3RA 1PTJA 1ZMXA 2FSPA 1KJ8A 2XMBA 4ND8B 1ACMA 1HFJA 3EUWA 4N2FA 3ECVA 4PFEA 4ZDIA 4TMVA 1CZ8L 1NN1A 1T20B 2C26A 3DBXB 2ORED 4PS4L 3TZVD 4WWKB 2J8OA 3S8MA 1EKXA 1FH5H 2R39A 3GXDA 4XN1A 1GIGL 2C3MA 3HXOA 5IJCC 2H2IA 3VMOA 1RZ8A 2VSXA 3GPDG 5IJVB 1GC1L 2NV6A 3FU8A 2O8EB 4EUPB 3S1LA 4L8YA 1RLIA 1QI5A 1G6Q1 1QO0A 1R6DA 3RILA 2GFQA 2Q4TA 2DBRA 4G8CA 4QL3A 1R8SA 3FTXA 1N10A 3QIBB 2HXYA 3N58A 2AFIA 4O4IB 3QAQA 4PP1D 3K4ZA 3OPYI 1YQEA 4UT9L 3ZXXA 4M1EA 2ZI6A 1PJ3A 4DIKA 4WN9A 4HIJB 4RDCA 5H81A 3MLRH 3ADKA 3P19A 4G6ML 2HWZH 1Y63A 3L6FB 2JGJA 4TN1A 5LJIA 3N6XA 1F9AA 4X65B 2WUWE 5A05A 3K4DA 2JKYA 1QPBA 3QUYA 4WBXC 1V7ML 4N5DA 1ZI6A 1Y5RA 2DV6A 3BA6A 4LOHA 3ZU4A 1TTTA 1TT6A 4F7EA 5FDWA 4LHUA 2NNXA 4L4JA 4RQQA 3ZOAA 1PU0A 1JL3A 1F2UB 1SY6L 3I6QA 1OWWA 4OM1H 2UXVA 4CGTA 1X7XA 4B53A 4IMLB 2BH0A 4AMBA 1JGVL 1PQUA 1RJDA 2AJXL 3RQ3A 5KAQG 5I0WA 3ESPA 5F76A 3JQAB 3NV7A 4OQZA 3ELWA 1PZDA 3H6AA 2DH6A 5B1DA 5GZ3A 2BGMA 1S7GA 5C46F 1TOAA 1FPTH 3APCA 3DT6A 1QZUA 3BCFA 5LQKA 4PW4A 2I65A 4UARA 3RGHA 2V1XA 2FQDA 2WJZB 1XDDA 1WAAA 4RORA 3BT0A 3OOHA 3EC1A 1X80B 4PP2A 3C7AA 1ETZA 2XVLA 2DLIA 1V39A 3GA0A 4EF5A 2X89D 5HY9B 1EXHA 1ADWA 4IOFD 5E0OA 4YRQA 3ISVA 3QUYB 4QOGA 4HWPA 1KFGA 2O20A 2PCPA 3ELDA 4FA8A 3U13A 3BFKA 1NEPA 3VR4A 2AOUB 3AM4A 4NWTL 3EXJA 5DI3A 1HI6B 1ZWIA 2FSVA 5JALA 3D0LA 2KWIA 5A2KH 2MMGA 5E9QA 5L4SA 2JLQA 2J88H 1NC2D 5E3JA 5CFOA 3U0BA 4J6EA 4RSVA 2G9ZA 2XVKA 4ODVL 3UMTA 3WGVB 4S3MA 1T4BA 5DYNA 5HYQB 1OXUA 1ET7A 3RDJA 2ZWYA 4BZ2L 2W9EH 5COQA 2CNWA 4D8XA 3RTDA 1BWPA 1SPXA 2JFFA 1LDYA 4TLDA 1RTKA 3WWDA 5BUZA 4W99A 4KDFA 4B0MB 4JDTH 1QFPA 4MIYA 2YICA 1JEJA 1MOPA 3EXHA 1RXSA 3G04B 5JVDB 4CNBA 1DAGA 4FNTA 2Y7NA 4AH2B 4ZCRA 3GSQA 1P5VB 1E6WA 1PLGL 2C9XA 4ENVA 3ET5A 1DKPA 1Z5PA 3SDAB 3RDPA 2PGAA 5AVZA 3R9XB 3EIQA 3ZH2A 2QLVB 5K0EA 4IGBB 4PJ9D 4OQEA 4FJ0A 4MQFA 4PJCB 4LSWA 3RV4A 4HZUB 3PF2A 4IEFA 1P84J 1QWOA 3NRCA 1GFSA 3K3PA 3DX9B 1NPJA 2C2BA 2QLTA 2XMDA 5JWHA 3L1OL 3MNDA 2FRGP 1WE2A 1NP7A 4PRNA 1RULL 2H4FA 2AWOA 3ZXYA 4A8JB 3UHJA 4Y7MA 3LDUA 5CYPA 4NBTA 2K6YA 2AJ8A 3QPQD 4WKGA 4PRDB 1YIDA 2PIAA 5JY1A 3AOEC 3AFNA 4GOND 1Z6GA 5CTJA 2XA8H 4YLCA 3I74A 1VJ1A 3X2FA 2HCFA 3OJCA 1HCVA 3HZYB 4GI5A 2HCTA 1KTJA 4QFDA 1ESEA 2BSEA 3JQAA 2A3RA 1W80A 4X9HA 4MPTA 4ZVTA 4GRWF 4HWZB 4IRJD 3VX1A 2PUJA 1OL0A 2I8AA 1D1SA 3HA0A 3CEHA 4EDFA 3ZUGA 2PM8A 2LE9A 3DTUB 3SIRA 3M9LA 4I4NA 4X63A 2WSBA 1U30A 1QVZA 1N6UA 3S35X 1DUZB 1OT2A 4O2BB 1FQWA 3LZNA 5DK2A 1AMOA 4PR5B 2QPUA 3MTQA 4A73A 1J7VR 5TH2A 1H3FA 4V3BA 4UWQB 5I7EA 4N0FA 2HYDA 1VL5A 1F12A 1ID1A 1T5WA 5I9SA 4Z3JA 2XOEA 2PBRA 2WVSA 3CH5A 3KJHA 5CINH 4Q6WA 1DE4B 4BVLA 1N0VC 1OK0A 2F1HA 2WWKT 1R5OA 3BWDD 3QFJD 1MRCL 4QLBA 2NTFA 5C2BL 2FSUA 2B1RA 3G5TA 4TKWA 1YJBA 1PX4A 4AY2A 4W4NA 1GM5A 1TM2A 4Z8FH 2ZPTX 4GW1A 4Z3IA 1CYDA 1GLVA 1C2TA 5E9DA 1BQLH 4TYUA 3VRIA 3DX4A 1T3GA 4FNQA 5J2UB 2JFCA 4CVXB 4LSUH 3NRBA 2GTZA 4ALNA 1YZYA 3C7DB 2JK1A 1BOOA 5D3MA 1GGYA 3G5MA 3S5LB 3GD1C 1PYOA 3D6UA 3L3GA 4TRPL 3ZBUA 1AH2A 1EVYA 3DOJA 2H3EA 4JY6A 1BVZA 5E8PA 2Q5FA 4GWLA 2Z31A 5IBUB 5BZWA 1CXZA 1J1OH 3AVUA 2AQQA 3O4FA 4NQCB 3SJBA 2J72A 3AZPA 4NOBA 3HGTA 1E3WB 1RMQA 1KFAH 4AKGA 4JP2A 1M2NA 3IMTA 4Z7IA 3LK6A 4RQQB 1S9YB 2ZRHA 3L5XH 1M2OB 4NZRH 1L5KA 3C6LD 3BGMA 2P44B 1I80A 3K2QA 3VVLA 3IDYC 1M67A 1GUYA 2I7XA 3AEKB 4IHJF 2CL7X 4HDSB 4QULA 2DPHA 5DXFA 1QSVA 2CNDA 1CFNA 3O8XA 3RR2A 4EF4A 3T3PF 1NCBL 2J4WL 3RVNA 5J58A 4MVJH 1UM5H 1NEUA 4MDIB 4YREA 5L4NA 4UINH 5C97A 5K0LA 5FOSA 3MLTA 2YPLD 3EJSA 3M8OH 1FIGH 5DTJA 1QGZA 3WYNA 3DV6A 4NZUL 3ZY6A 1PD6A 4RVSA 1EX0A 5EZYA 4XTRD 4BJ5A 1LY1A 3DURB 2I32A 3I6LE 3JTBA 5KOMC 4PU2A 3VJ6B 3ZU6A 4YO7A 4MW5A 1G1OA 3RVWD 4C7VA 3NKVA 3ZWMA 3FK3A 3MJVA 3TQCA 2C9YA 2KX7A 4KUHA 3PVZA 4A4DA 4GG6E 4RSGA 1YECL 2XQBH 3V4OA 1ESDA 2PGJA 3NGXA 2EQAA 4KX7A 1J90A 2I29A 1WSDA 2JKJA 2VXBA 2DFTA 3HEMA 4PRAB 1L5GB 1NVEA 2AQ2A 3KT3A 1BTOA 3FNQA 3AACA 3NIFB 2GJRA 2FNBA 5LZ4A 4DJJA 3I9OA 3KQMA 4CVXA 5B3JC 1FPTL 4NYLA 2P9QA 5JCOC 4HKXB 5AW2A 1RURH 4QRPE 4KK5D 4WWHA 5T4HA 2GSGA 2VRCA 4I08A 3X12A 1RJWA 4OIMA 4NPYB 2C7VA 3EZ2A 3MJ9L 5CITA 4QDUA 2NQDA 2VDNB 1GGBL 2A5LA 3V42A 2QV0A 5LU9A 5G4OA 4RESA 3QA3E 2RCNA 2D62A 3GPBA 3PRYA 3FG9A 2UUBB 2M98A 1M9WA 3ZDYF 3LJ3A 2ATEA 5J2TF 5L3QB 3PGCB 4NZTL 3WKQA 1G5FA 2FEXA 2BHSA 2E5WA 4Y88A 2HWZL 2O4EA 1PV1A 2CGEA 5DPMA 2JLPA 4C4RA 3SDYH 2D3NA 4KRPC 1G9SA 2KYRA 4GI6A 3MIIA 4AE0A 5ICMA 1SJMA 3U1BA 1LQTA 4J3OG 4UT7H 1AD0A 2YJZA 2J09A 1XF2B 4RACA 1EFXB 4J2TA 2WKLA 2ZZMA 4JLMA 1N6QH 3NSDA 2QQNL 3TVMB 1L1RA 2Y2TA 1HESA 3JWNG 1LW7A 3GI8L 5CGTA 2IQIA 5M95B 3WX0A 1H2WA 4WFJA 2EDHA 3LOWA 4QWWC 2Z57A 3F6LA 3FHOA 5D1XC 2P6MA 3BXEA 3ME0B 4QUEA 2J3KA 4G9EA 5K3EA 3K5SA 1Z56C 4Q66C 5HZMA 2IH1B 4J0FA 2RCSL 1GZPB 1ORSA 1Y5LA 4AYEC 2X1MA 1WB6A 3ONWA 2CSUA 3OJEA 5E4TA 2G1PA 5INDB 5DJ8A 1NCUA 1SQ2N 1SUFA 4HDCA 5JHDE 5BRQA 2KI5A 4FFWC 4HSGA 3HXPA 4OIBA 1CULC 3PDWA 1G7JA 4B6JA 4ZDHB 2IIQA 1GKKA 3WBFA 5F2KA 4M8UA 3BKCL 3B5EA 1NT2A 3AGQA 3U7IA 2H1PH 2QP3A 2CGZA 1B4RA 2J6IA 5E9DE 2JCCF 3G7NA 2IWFA 1FMJA 2H00A 2EDTA 4CZ2A 3TESA 3CUEF 4BM7A 2H4XA 5B7QA 1EAJA 2AX3A 2BFNA 3B38A 3QJQB 1BMTA 4ZT5A 5GJWC 5F73A 2FJGA 3SAJA 5HIIA 2KW5A 1FNSA 4KPFC 2CMGA 3M1YA 4E5XB 4NDMA 5C0DB 3GZTB 4YR9A 4Q18A 3MRTA 2YWJA 1CB4A 1B6RA 2QU8A 2IOQA 4L6IA 4MD0A 1XF1A 4CA4A 3C8DA 2QQGA 1PX2A 4H8PA 4KAQH 3IRVA 4X1YA 1CLUA 2GETA 2WUDA 4PSVA 4TWRA 2YAHA 2V7NB 4P5TA 4FABH 4YGYA 1O7DC 1PNCA 5C3MA 3QWOA 4K2HA 4OATA 2X2OA 3OC5A 4QY8A 5E4JA 5EINA 4MDEA 3CN1A 1F2TB 4B33A 2JZNA 1TNMA 1D5MA 3ZZQA 1GDHA 3ETGA 4PANA 2NM0A 8FABB 3E8SA 2P5EB 4DT2A 2HKAA 4NZJA 4KY2A 1DSSG 2EE6A 1FFDA 4Z7OB 1EFPA 3PHBE 5IC6A 3EISA 2J0SA 2P35A 4FDMA 4NNPH 3WXVL 5D3ZA 1JYSA 3VE0A 2HRZA 2O59A 5AVZB 2PZEA 4L1TA 1MW0A 1SWVA 4YDKH 7ADHA 2PPAA 1QNLA 1BBJA 3OTOB 2ZAOA 1NXWA 3KJZA 4QRFA 1EANA 3NCMA 2QZSA 3RGWS 4F45A 4A37A 5F1IA 1XDZA 3WY2A 2WHPB 4YT4A 1O75A 1HS6A 4Q1DA 3L8CA 4DLWA 3EGXA 2GZ3A 5FWQA 1OXXK 1MRFL 4FJ2A 4PC2A 2OYLA 4MUBA 1XGQA 1QANA 1K86A 5F2OA 2AF2A 1J7JA 1UXHA 1KFJB 1YV9A 3VHQA 4APQA 3GJ3A 4P4LA 4NQSA 3P8ZA 4PLVA 5C5EA 1DCLA 3B2UD 2PH7A 1ZLDA 1W88A 4JFFA 4ISCA 5AWFC 3OR6B 2RGNC 4LHUD 4UAUA 4YT2A 5I4CA 5LWHA 1E5QA 5JNSA 5TPZD 2AOVA 2DTXA 4KI5E 2XDQA 3GJEA 4HS3A 3HI1A 4B3FX 2IODA 2Q2QA 3RU9A 1YUKA 4D4GA 1GTNA 2GI4A 4W5OA 2XWJA 4HMPA 5G3ZA 4DLLA 2MH4A 4CV3A 4HAGA 3TA3A 3B60A 3F3YA 1QZXA 4UU1A 3FCBA 3Q48A 5D8DA 3BUIA 2QTGA 3E1GA 5E2IA 4NWIA 4PG2A 2WZ0A 4E33A 1R5VA 1PNVA 1Y9ZA 2XWPA 3C39A 4HKTA 1GA4A 3UTSE 3BD9A 5FYJH 1I1AB 1V5FA 4CCYA 2J0QA 3L9RB 4OM0H 4EQ2A 4LGMA 5HEKA 2QEQA 3AZOA 3QUKB 3WKNA 2E8ZA 4QCIB 3WLKX 3Q6MA 3T0EA 4JRXE 5IBLD 3RZCB 2R86A 1UZ6F 2G0NA 4HDKB 4DMGA 4XB1A 4G0UA 2JLVA 5EG6C 4FMBB 5IC5A 4KY1H 4QRRD 3P9XA 2FLVA 1AZVA 1I85A 1BX0A 4UUNA 3KTDA 3NHSA 3IVXA 3LIIA 4QU0A 3D6MA 3KCPA 4DZTA 2NXYD 5FO9A 2BNQD 2EZ0C 2C3HA 1V11A 4TKUB 4QHTA 1XQ4A 2YMMA 2NUTB 4OSPA 2XKKA 1Y5MA 4N2LA 5B8CB 4V24A 4CDMA 4BH7A 4GT1A 1ZICA 1IBDA 5I66B 2AD5A 1ZQ1A 4RWHA 5A3ID 1R75A 1X5FA 2BFGA 1M2HA 3IBGA 3ARSA 1AO7A 1WW2A 4XDHA 3MZ0A 3HMXA 2K9FB 4XN8A 1W5TA 3P4MA 1Y3BE 2QENA 3BULA 5D1QD 3QDGA 1XUOA 3ZCTA 1WXDA 3DBOB 1JLLA 3MS2A 3IJ9A 3ZHCA 3CN4A 1UXIA 5JQ6L 3A6PC 3NFRA 2R7KA 2P45B 4FOSA 2DTEA 4ZCSA 3V8RA 5C32A 4N7JA 3V6OA 1UT1A 2X40A 1FYHB 3X11B 2C57A 3VTKA 2X0UA 4HAUA 5D5ME 5CXUA 1PX3A 3ZKMD 4KOBA 2FWIA 4A23A 2HFJA 4U1SB 1P7KA 2P26A 1WG8A 2NSMA 2XGOA 4JLRB 3AVXA 1IBYA 1NYRA 1YEDA 1WL8A 2O5NA 4BPBA 4HX1A 3UTSB 1VKOA 1RUPL 4Z0XB 3K5PA 2VZVA 1ZSNA 2OZPA 5GS0C 1R3KB 2RBLA 1EK5A 2VW6A 3ECCA 1OVGA 3BAKA 3L3IB 3HYSA 2XMGA 4HWUA 1BMFD 1N2GA 4A1RA 1IK4A 1PNQA 3U2IA 2CLOB 1UBOS 3IP9A 4PX9A 3SC6A 1KMGA 5CA0F 2Q6WB 3I04M 3K71A 1FDUA 4MWOA 5CX1B 1TVDA 4P99A 3SDCC 1Z0SA 4EI0A 4TSKA 2B1GA 2CHUA 1BGXH 5CDUA 4ES6A 2I24N 3WZ2A 3TG8A 4PIRF 2HA1A 2A6IB 4L95C 3G7UA 4BA0A 2QTHA 3BP7B 4KPUA 1JV2B 4PRDA 4G1VA 2W1NA 2I3ZA 2FT6A 4A0FA 1BREA 4OD2A 4DZRA 3HRZA 1PQPA 4TNVF 3VWJD 3CY6A 3AQ4A 3KQUA 1EFVB 3NABH 5DQDH 4F96A 1A47A 4XPZA 3VXUE 4AG6A 1K9SA 4G0XA 2VQ1B 4MAYD 2ZUVA 4IEFB 4Z7QB 2E1PA 4W9ZA 1RSZA 2H3XC 4RZ3A 3DLQR 2FEWB 3TI7A 3SKOB 3E8UL 4XCNA 2FFHA 2K9UA 4PRPA 4IHOB 1H66A 2HYMA 3NGMA 4ZJYA 1YK1A 1AO7B 3PGFL 3FYHA 2EVWX 2P77A 1RQPA 4RTPA 3IK2A 3JWDC 1CLYL 4PLWA 3FQRA 4GG6F 3R76A 2Y2VA 2BF4A 1N26A 3CX6A 4Y3UA 1PV2A 2AJLI 1OVMA 2QMQA 1FP7A 2VLKD 1V95A 3ARPA 2ITCA 3LKSA 1CI3M 2UUCB 1JP5A 3O3OB 4Z4FA 3AIOA 3JYCA 2QVKA 1NNUA 1FZKB 1NCWH 3OF2A 4UUOA 2OLEA 1Y89A 1XR8A 1DJOA 3QZMA 4JAMB 4ZUUA 3E2HC 3QBTB 1OSNA 4D8WA 2R2EA 1GGJA 3VR3D 1CIJA 2D2XA 3PNOA 5EP3A 1ASOA 1DFHA 1QUEA 5KKNB 1KC3A 2JCSA 3OLGA 3AJ9A 3BJMA 3G9TA 1O54A 4BXVA 5KSOA 1HORA 1R6TA 1OC4A 1MHEB 2E56A 5F1OA 4KO6A 4HUMB 4A82A 5A2CA 5AHKA 1M2GA 4M7PA 2BFAA 3LQMA 1BGWA 5I1EH 1ZN8A 1XH1A 2I1VB 3L7FA 4QMEA 4N18A 1U2RA 1YBMA 3DOHA 5PNTA 4AN0A 5K0JA 3WLPA 4YBLC 5DGDA 4B3JA 3AHDA 4PJBA 5B1JA 5JR1H 3HU1A 3OKYB 1QOKA 2ZYAA 4XVUD 4HB2A 4HG4J 1YYML 4D45A 4WXYB 3FCSB 1RZIA 5FHBH 1D5ZB 2O0HA 1HHIB 2KM1A 5I7FA 3L84A 3PHCA 4B3BA 2AXEA 3LPWA 5EF2A 2BFEA 4N4YB 1ZJAA 3K1KC 3MREB 5F0MB 3K0HA 4H20L 1BZDA 5EU5B 3GLHA 3CT6A 5HJ2A 1OT4A 1Z9SB 3KJ6L 3JATA 3FTSA 1V26A 4HH9B 4JXZA 1SZNA 4BWYA 2ARKA 3U7JA 5LJLA 2BSTB 1OOEA 2XTNA 4PTTA 2QRHA 1NMZA 2YR0A 1GS6X 3D2BA 4UOW0 5KIAA 1Y3CE 4Z4HA 4PG6A 4YAIA 5GZNA 4BV9A 3TCXA 1UG9A 4GMSL 4EBBA 2D9QB 3QENA 2QTMA 4V0LA 3DFFA 3H9ZA 2AI1A 2BGUA 4OZHB 2CVZA 4UNRA 1M8PA 1S7CA 1DPFA 5BQPA 4XIFA 4OTZA 5KKAA 4NE7A 3TRD