3NIFB

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alphaIIB beta3
total genus 122
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nifB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nifB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nifB03
1CK4A 3EGXA 5E6RB 5KYUA 4MMYA 4MMXB 3K71A 4WK2B 1MQ9A 2VDOB 3AL9A 4O3TB 2VDRB 3TW0A 3EGDA 2ODPA 3PPWA 3AFCA 4BJ3A 4GZ8A 3QA3E 3K71B 3TCXB 3EG9A 3Q3GE 2XGGA 1JEYB 3EH1A 1U0OC 4Z7QB 1V7PC 2QTVA 1RD4A 2O7NA 3FCSB 2VDPB 4JX0A 3OL2B 3E2MA 3ZQKA 1JV2B 1AO3A 1U8CA 4UM8B 1RS0A 2NUTB 2ODQA 5E6RA 4CN8A 4UM9D 3K72A 5E6SA 4HQOA 4A0QA 2I91A 2WW8A 4Z7NB 2VDKB 1ZOOA 4WK4B 1M10A 4C2AA 4G1MA 5ES4B 3ZDYB 4FX5A 1IJKA 3EG9B 2UZYB 2P26A 2B2XA 1M1XB 3ZE1B 5E6UB 3EFOB 3OKYB 1L5GA 4HQFA 4G1MB 4K3JB 5HJ2A 4F1KA 3K6SB 1JEQB 1AOXA 3VI4B 3FCSA 4O3UB 4XW2A 4G1EB 1MQAA 5KYYB 1DGQA 3AL8B 4WK0B 1JLMA 2NUPA 3F74A 4IHKA 5KYUB 4MMZA 1IJBA 1PD1A 4IGIA 3M6FA 2NUPB 1TYEB 2P28A 1QC5B 2XWJI 1M2VA 3VI3B 2NVOA 1PD0A 2M32A 1SQ0A 1SHTX 3EGXB 3EFOA 5E6UA 4MMYB 3T3MB 1N9ZA 2VDLB 3ZE2B 4FWWA 2X5NA 1OLZA 1M2VB 3ZDZB 4M76B 4PN7A 1JEQA 3NIFB 3OL2A 1CQPA 5KYXB 1JV2A 1PT6A 1PCXA 1BHQ1 3PPVA 3K72B 5E6SB 3BQMB 1MF7A 1YVRA 2I6QA 1MJNA 4HQNA 4C29A 3IBSA 1MQ8B 1MHPA 1RRKA 2WINI 4O02A 3HXOA 1LFAA 4DMUB 3IJEB 3N2NA 1T0PA 3TVYA 1L5GB 1DZIA 1XDDA 5HDBB 4HQKA 3TXAA 1FNSA 1M2OA 1XUOA 1ZONA 1M1UA 5KYWB 5KYYA 3AL8A 1FE8A 3PPYA 1YVPA 1SSLA 2VDNB 2ADFA 4MMXA 1UEXC 1N3YA 3BN3A 3HXQA 4WJKB 3V4PB 1AUQA 2XWBF 1SHYB 3RAGA 5HGJA 4Z7OB 1IDN1 3ZE0B 4O02B 4G1EA 3IJEA 1QCYA 4CNBA 5LN1A 4NENB 1SHUX 1XDGA 4C2BA 2ICAA 1RTKA 5KYXA 4MMZB 5KYNA 1YUKA 1T6BY 1M1XA 3GXBA 4F1JA 4NENA 1U8CB 2NUTA 3V4VB 3F78A 3NIDB 1U0NA 1BHO1 3K6SA 3HI6A 3PPXA 4NEHB 3NVQA 3EGDB 5BV8A 1OAKA 1ZOPA 4JDUA 2VDMB 3FCUB 3BQNB 3EOBI 1Q0PA 1IDOA 2VDQB 4WFQA 1NA5A 1JEYA 2VC2B 3NIGB 2IUEA 3EOAI 4UM9B 3ZDXB 4HQLA 1QC5A 4IXDA 4CN9A 3OKWA 1ATZA 5KYWA 3T3PB 2I6SA 3EH2A
chains in the Genus database with same CATH superfamily
3M6AA 2O72A 4KIUA 2HIGA 1IL0A 2IALA 3T1OA 1T2AA 1R5WA 2X10A 4QUJA 4DGUA 4ZPTB 2JKSA 2IUYA 4OSPA 3KYIB 2PW1A 2Q3XA 5T1LB 4B9EA 1R9NA 2B94A 4Y5XC 4W9RA 1BYOA 5ALOA 2R2CA 4IUYA 4GL2A 2OKCA 4ZFZB 3A9WA 3IJ8A 5CWSA 1FMFA 2GD6A 1EB9A 2P52A 3BVDB 1IAIM 4MHHI 2OYCA 4GRDA 2WVVA 1HOXA 5TIIA 2VSQA 1JPFA 3O75A 4LKXB 4MA8H 1V25A 2AWOA 3L0OA 4FHFA 1YEFH 4JRYB 2Z91A 4U7PB 5LDGA 3UTPD 1JVOA 1FDSA 4TL4A 2R7AA 4FMBB 4TLDA 1TEZA 3OKDB 4G86A 4D3XA 5CLIA 1U1DA 3QGMA 4MPTA 5KOVC 3IEPA 5GHWL 1FRGL 3T2PA 3QPXH 3RABA 3U0VA 3K6DA 5E8JA 3GZNA 5FLUA 3RC3A 4ES9A 1U0TA 2E82A 1TZBA 1JF1A 5F9DC 3HKEB 2BZCA 2QMYA 3I8OA 1ZW1A 4U6TA 4OTXL 3RE1A 3F7RA 4A37A 3PP4L 2DQCH 5TDPB 1G7RA 4BZ1A 4XMWA 4FQ2H 4TSKA 3QKSA 5IT2H 2HYDA 4APQD 4R6UA 1HEYA 1ZWKA 1H0DB 3MAJA 4P23A 3PKJA 5ARDA 1T9HA 1KTIA 1CE1H 1WF6A 4WFHE 4KMTL 4OAPA 4OY9A 5C71A 4YDJB 4BQEA 3PGFL 5C53B 5JE8A 5JXED 5CM8B 1QI4A 2OXCA 1NIJA 4OK5A 4BRSA 5HDBE 2VAAA 4HDNB 2RG1A 3VOSA 1C4KA 1DJXA 4IDNA 1S7RA 1HEJC 2Q6WA 2D13A 2J9YB 4YHKH 4NWTL 3CSSA 4UM8B 2VQFB 4PW4A 3CFJB 2CUAA 4D81A 4IUCS 2P0EA 4XGNA 2ZKMX 1EO8H 5D1QB 5EPOA 1NMBH 1P80A 1CF8H 1YRHA 3S81A 2WSLA 2BCGY 1VKOA 5JUWA 2H6OA 3MBKA 2MR5A 4F1SA 3TJRA 3I6KA 2VTDA 3RFUA 3ZOKA 4RGBA 2PZMA 1FNEB 2RTTA 3PHQB 4NIKB 5GIRA 2XWJI 2NCEA 3AILA 5KVMC 1O6CA 3IKMB 4ND4A 1B26A 4WHCA 3C3CA 4X62B 4G5ZL 3CVIH 3ZZQA 3RA7H 2XCSB 3Q0EA 4MAUL 1E20A 3RRZA 4HGNA 3VZRA 1UM9A 2ORBL 3U56A 2IOMA 1ZGGA 2WHRA 3HU3A 3BIFA 2G9HB 3TN7A 4N8CH 3FBGA 5KNBD 4RSGA 3WIHL 3GARA 4NNXB 4ONGH 2J12B 3TP4A 1OKKD 3W3ZB 3NN8A 4IBYA 4RZQA 2QW0X 3GFUA 3OPXA 3CB2A 3I2YX 3ROQA 1KBOA 1JRHL 1NFFA 1XXHB 4IJKA 4EMTA 3WGMA 4IIUA 2W37A 4YQFA 4Y5XB 1LPPA 5CK4A 1F9AA 1DEOA 1ZUWA 4MUFA 2NY3C 3WIEA 4WKGA 2ZCHL 2V17L 5AALA 2UVEA 4XFKA 3EW9A 2CMDA 1V9LA 1BVZA 3HFSA 4WLFA 1UZ8A 3KUUA 3V7AG 2RGRA 4EXPX 2F54D 1NX6A 3BDBA 5E2UH 2Y5TA 3NBNA 2NY5H 1P5ZB 3GPIA 2MHCA 3RWDA 3EEQA 2SKEA 2JB6A 4RFNB 4W1TA 2YSSA 1U3WA 3B3IA 4WNAB 1M1YE 2QPAA 5F33A 2EDAA 5I8KL 4QT4A 4PY7A 5B22A 4BNDB 4PX9A 4FZEL 4KTDH 4A7VA 2HJLA 4KLZA 3P30L 2WIKA 1M8JA 2YJGA 1HLFA 5AK3A 1MAUA 3LF2A 1NG9A 3Q6FB 3VDXA 2QXTA 4WGVB 1YR6A 4RULA 1N2JA 4YUAA 2DH2A 2PMCA 1OAOA 4NCNA 4ODTH 3ADOA 3HU5A 3ESYA 3BC1A 4EG5A 2BDUA 1E3WB 1KMNA 2C96A 2XVMA 4U0KA 1KOAA 2ITEA 1D9KA 3CEJA 3QDMD 4V0LA 2FO8A 3MOBH 3G0IA 3GSVB 3OKMA 3SGDH 5MN4A 3C5ZC 1KU6A 4OF7A 1XH2A 2AXHA 2AG8A 3B1YA 2E7MA 4A39A 4ISVA 5I7AA 2CAKA 3DFKA 1QFUL 3I45A 2JZOA 1DXQA 3ZZUA 4BQQA 1QP8A 5EU6D 4Q01A 3VFTA 1ZXQA 2VDQB 4GW4B 3DONA 4LE1A 1EZZA 1CY4A 1TYCA 3BMOA 4F2PA 1E2BA 3ZTEA 4PRPE 1ZIPA 5DK2B 2XT6A 1JXAA 1I8TA 1LSUA 2F1JA 2X41A 2ED8A 4G84A 3TNNA 5FK9A 1A6TB 4DB4A 1VTKA 3ER6A 2DKFA 1JR3E 4XXCC 3TXYA 3SYPA 4G4JA 1OM9A 4RANA 1WSBA 4LRIA 1YJDH 3UT0A 3L4WA 5E8PA 3KYMB 5I1DB 4PJCF 3C2AL 2B3RA 4NF2A 1F17A 4LI3X 2B4KA 4L85A 3AEKA 2BJML 5FO7B 5T67A 3PIQB 1PNTA 4BKUA 1EBAA 4EW1A 1FFXB 5G1PA 4V2BA 1A9EA 4M4RA 1SAYA 1DSYA 5H35B 4JGBA 4ZT2A 2JK5B 4XQCA 3ELDA 4MYDA 4DFDA 1M1NA 5C5IA 2NTYC 2X7XA 5DFWH 2CLVA 2FEXA 3M82A 1Z5PA 3K72B 2QLNA 5TE7H 3JUYA 3K94A 4HDKA 5ALLA 5K8LA 1ABBA 1DDOA 1T4BA 1M5TA 3QZWA 3MJTA 2LGJA 2XKJE 1YVUA 1BJ8A 1Q0SA 1GP2A 1W88B 4N5DA 2Z31B 1DI0A 3V1YA 2CBMA 1ECPA 1ORSB 5ITFA 3HJHA 1KEPA 3FU8A 3PWLA 1KJ9A 2HFFA 3RDTB 3V5DA 4C2BA 1X1BA 3FB7A 4LRYA 2Z0BA 1TF2A 5BQ3A 3MRRB 3GIVB 2FQWA 3QQDB 4I66A 4EJFA 3W2GA 3V0WL 1KYOJ 3TQQA 3B1TA 3RP1A 4C03A 3ANYB 1RP7A 2DWUA 1KH2A 1IY9A 4MQ4A 4Y7CA 1G20B 3GWGA 4IBZA 1D7BA 2YA0A 3H97A 1B3IA 5FDWB 3WFZA 3V4RA 1OT2A 2HN7A 4LVHC 5C51B 1E4XL 3CPLA 5L2KB 3H2JA 2VDPB 1E28B 5JMOC 4GW5A 4UQ3A 2PEZA 3QBEA 4CL8A 1AYRA 3B12A 3IMFA 1BX3A 4K3UA 2YYAA 5DHYA 3CYFA 4ZX3A 2VJNA 3K7EA 1FRQA 2AERT 1SHXA 2G4CA 2WVGA 4WI1A 1EIBA 4FLHA 5KYUB 3WYGA 3FQ4A 3Q8WA 4U1RA 1N3NB 1RZQA 5D70H 3PFBA 3KWXA 4I87A 4V0ME 1WWAX 1NXTA 3K0BA 4A8TA 5B1SA 4DUVA 3BK1A 3I9V1 4QUEA 3P0GB 4QRUA 1M5RA 5G40A 1JMYA 4C29A 4G80B 1VMKA 2EGHA 4G8EB 3NBYC 4URTB 5HJEA 1X4YA 4D9KA 3V6FB 4PM4A 1EVTC 2RGYA 3K0KA 1C5BH 3SQRA 2RALA 5HIJA 4WJKB 3VWJA 3KLHD 1XRNA 3TE7A 4GSDH 5DYTA 2ATKA 5BSEA 2PXAA 1SHUX 3ATEA 2X4TA 3LWBA 3ARDB 2O8EB 4MYSA 1LF5A 5FI1B 3E9TA 1CFMA 3QCUL 2QVYX 1YBAA 3KXFA 4P6VF 5AMXA 2DPHA 2P9CA 4FG2A 2WYHA 2R84A 1OXBB 1ITZA 1A82A 3P11L 4MR7A 1HE8A 4L28A 3C70A 1P2SA 4FQ8A 1JEYB 4M6NL 3VFVA 2QL5A 3HBFA 2YBRA 3H04A 1E9QA 2JZNA 2O30A 1Q11A 4W7HA 3LZOA 2D3VA 2IDFA 2CXQA 4BFXA 1XX9C 2XG4A 4GGPA 3U4EA 2GJZA 4ONHA 2H85A 3AY4A 3GEEA 4PJBB 2E37A 3PF8A 2BI8A 2PGIA 5A6SB 3NBZC 1IC1A 4UI2A 1YDPA 4U1HA 2J4WL 3Q6GH 4DSZA 2J9GA 4L4VE 3FF1A 2NXZB 1MFBL 4B95C 1DN2A 4AX4A 3FCXA 1EIWA 4YRJA 3BA6A 3OF6D 2ZZKA 1G7SA 2RCYA 4R7DB 2BVYA 2BBWA 4Q5IA 1JT9A 3AIKA 1A7JA 1IY0A 3HU1A 2PPDA 2OBLA 4OFXA 1A77A 3UK0A 3HB5X 4TQHA 3RYMA 1E1CB 2A9NH 1D2CA 4I85A 5FOBA 3ZE0B 2IX9A 4EO4A 1Q1QA 1P9WA 1PY4A 3AF2A 2WYWA 4FQXC 3B9KB 4ZALA 4GKNB 2J41A 2GEFA 3BIOA 4TV9A 3U39A 1CJVC 4JM2D 4ZVVA 1RMQA 1YR2A 1FLAA 3W4IA 1UOEA 5BV1A 3IU4L 3ABGA 3CH6A 2PP7A 4AKGA 3NZ8A 3B9AA 2YR3A 1M8KA 3CF2A 4NU6A 4WK6A 4LC0A 4XDHA 1S4IA 1VEOA 1CDIA 4PREB 4PCTA 5C4IA 3Q5DA 4YHLL 4C3ZA 1XX6A 2PZFA 3CLEH 4W6XB 1R1DA 4HWPA 3X3FH 1Y5MA 3WU1A 5AXAA 3F97A 2IEPA 4FNTA 1U3HB 2YXBA 1U2ZA 3RBVA 4H25B 4QFCA 1WE2A 3DXZA 3BC9A 2FPMA 2YWGA 2CBOA 1DFBL 5KSZA 1T7WA 5LZ9A 4X5WA 1N5MA 4J4PD 1JWBB 5DLDA 2F7OA 3ZY7A 5CEXA 3O45A 3KM0A 1SXJA 3NJ4A 1FSGA 4AYFA 1NVUQ 3UJ9A 2G2RA 3RY5A 5H37H 1NWHA 1SR8A 4QOFA 4QLRA 3WMQA 1B2YA 1QH0A 1Z73A 1Z75A 4M37A 5I9QC 5B3KA 2FSFA 2R0WH 2IXDA 3WLTA 4JO2H 3LPMA 3WGIA 2PO5A 2H7YA 1IM9A 4GQAA 4IMRA 3L1EA 2Z8YM 4OZIA 1TUPA 3BG5A 1WUIS 3GLHA 3WEOA 1BVUA 3MLVL 2C20A 1RYMA 3SZOA 1BHSA 3LXRA 4NKDB 2D8KA 3OX8A 1HQCA 1YU6A 4RHFA 3T65B 4RESA 1XRPA 5MFZA 5JU6A 3WKPA 4YSTA 2YWRA 2ODEA 1T4MA 3QEBZ 4EBQH 3TMYA 2ID7A 2WHYA 2GK7A 1O6SA 4C4UA 1YULA 2XXGA 2EJBA 3BORA 1UCTA 1WBBA 2FLMA 4Q6IB 2BWJA 2P80D 2BXZA 3PPWA 2PRZA 2ZBPA 1TZIB 4EI0A 1QR1A 4F5EA 5CD5D 1I53A 2DCUA 1P0FA 3M8OH 2VDLL 2F00A 2I60H 4H0CA 4Z7VF 1DQVA 3B2NA 5IBRA 4MKZA 4DO4A 3ESCA 3E6HA 5J2TB 1HO3A 3IOCA 4MD4B 2XN9D 3X1NA 1CLVA 1Z9LA 3FQRA 2ZCKL 1Z6AA 2V6MA 3B7GA 1GOGA 2NUPA 3G5LA 4A91A 1PNOA 1HMPA 1UJCA 2JGLA 2C4XA 4IVNA 1PNRA 4IHOB 4BGUA 2P5TB 1V7NH 1S8AA 2A5UA 3NUGA 1MWAB 4TT3A 3UADA 1KYZA 3K91A 3GD7A 3WMGA 5D5MA 1AD0A 1JZIA 3TNJA 1MJNA 3DXAE 5E3IA 2HB0A 2AF4C 5A0FA 3UPCA 4N3UA 2IW1A 1DARA 2MOQA 4C2UA 3BIAX 1K8QA 1NBZB 2XZOA 1A04A 2EDBA 4IK6A 5IEJA 5M04A 3VJ6B 3OJMB 4TYUA 2ILTA 4YRPA 1DBQA 1EBUA 2DERA 1I4FB 4ENRA 4JFDB 1GQFA 1I7RA 3A3YA 2A6DA 4CLOA 4LP4A 1O95C 1RAAA 3U3MA 4JDZB 3H4MA 2GW5A 1T6BY 3ZZNA 4L4JA 3QFJE 1EFXD 3VGGA 4XB7A 3NTOA 2GTWB 2XADA 2GBGA 3C16C 5FUQA 5DMHA 4JAMB 2ACKA 4JP8A 1B76A 4J3OH 4NDAA 1N5AA 1TVCA 1UJ3B 1Y98A 2YD7A 3KPNB 4J0FA 4Y9DA 2NNFA 3AQDA 5IB2A 3BFPA 3NFSL 2D1YA 4G5GA 2WBLC 3TQSA 2E9WA 3HFGA 4BFIA 5K9QI 1OFVA 2IS6A 3HNSH 5GZ1A 1UC9A 4ZDKA 2WF8A 4Z7QB 2QGNA 4IVPA 3UPDA 1NQBA 3FIJA 2GERA 2GVYA 5BR8B 1QS0A 4XP4H 2R9HD 2DE0X 1AY1H 3HKEA 2Q0XA 4QASA 5E3JA 1RUMH 4AIEA 1GPYA 2AQNA 2X23A 5C9JA 2DH5A 3D6TB 2JJTC 4JDZA 4BZ2H 1E6OH 4YFDB 2BSDA 1E2QA 8ABPA 1ENPA 1J07A 5EBMB 4W70A 3ZWKA 2FMHA 4FNUA 2PCLA 1VZIA 3O3BB 3OV6A 3AI2A 3QFGA 4EQ6B 1GRWA 3W2DH 2IOFK 4XNXH 5FYJH 4PS8A 3ZGHA 4B7IA 3EIUA 4Q1VA 2LFGA 5C9ZA 3FTEA 2UUDH 1FFWA 3B3AA 4CEHA 1VLXA 2E3VA 3WGGA 1JIKA 1T5WB 3A05A 3CCHA 3S34H 4F8QA 4RE5A 4FNLL 2OMZB 3PWNA 4TWJA 4CQLB 4JKMA 3AL3A 1SU6A 5T1LA 5GGQL 4I1NB 4N0MA 3EXFB 4BQCA 3KNBB 1K2VN 3KEQA 1KMHA 2A58A 2EDYA 4OMFG 2J3EA 1OCWL 3NJIA 3PGMA 1KPRB 2C8KA 5C52B 1XCGB 4XVQA 3EOZA 3ZWNA 4TS6A 4DK6A 3T52A 1K5WA 1P3Y1 1F2DA 3H2QA 3E6AA 4G36A 2ODPA 4M6WA 4QWMA 1AURA 4ZYUA 2CIKB 2VABB 1Q9WA 2Z6UA 2VUUA 5T33H 5EIXA 4G5QA 3RB5A 3AETB 3PC3A 5L6LB 3AEXA 4YAGA 2I6TA 2O8BA 1E1KA 1T13A 5IHZB 5GQSA 4RS4A 2FO1A 2VJAA 4PJGA 1IAQA 4UHJA 2VDWB 4RMQA 2OW7A 3GLTA 4F33A 5K6TA 1NP7A 2ZG2A 4MQUA 1VI2A 3TLXA 3A0OA 1E7YA 2L0DA 4HUQA 4CTJA 5G41A 3DECA 4NVRA 4XB3A 3HVIA 1YNKH 3QUMH 4EE2A 1CIJA 1H1TA 4OGFA 3EY9A 4XCEA 4OV6B 2Q5JA 4FIDA 1IC5H 3M7IA 5AK5A 5HDRA 1W2GA 2PO6A 2OJEB 3VYOA 3CFBA 3RWEB 4LJSA 3IXAA 2VSKB 4FQCH 4LB8A 1KJYA 4MUAA 2CUIA 5ELXA 1N2GA 3STZB 4GPD1 5AW3B 4RGQA 1GFSA 1YS9A 5IW6A 5K3CA 4BZXA 3OCCA 2CL7X 3EVAA 5JSZB 3IVMA 3RX9A 3U1VA 4NC9A 3FSOA 3K8QA 1NIEA 4ONGL 1CRPA 1QE0A 3LXBA 2Q07A 5CSZA 5IQLA 4L5CA 4R31A 1MQ8A 2EKDA 1NVXQ 4IYJA 3RWOA 4CVXA 3ZQ6A 4W9ZA 1UD5A 1FX0A 4YJHB 3JAWB 1AO7B 4KO7A 3ULUE 5ICFA 3ZBUA 4GJTB 4Y2NA 5ERWA 1XF2B 3WGOA 4Y4KC 2ZT8A 2QTVB 3LNFA 1NBYA 3ZDZE 4JKLA 2D0DA 3LNIA 2Y7MA 2NPOA 1XB2A 3RVKA 3UAJA 2D2IA 3FUKA 2ADGA 4RFEB 4K5OA 5G0SA 1FS4A 4G6FB 3WJ2A 4WK4B 1XNJA 2VVTA 1X7DA 4IHKA 2M1ZA 2FW9A 3U46B 1G0DA 1UGKA 3GYRA 3AXTA 1WTGT 2H1WA 4DGVH 3KE9A 3HLAB 1REQA 4WSOA 3CU7A 2OMBA 2IEBA 5HI3D 4O3FA 3VFOA 2L04A 3G2LA 2IDKA 1KOFA 2VLKD 1T1EA 4X1YA 1PT6A 5JYMA 1ONNA 4OHXA 3UYKA 5GJSH 3FU5A 5EN2B 1GSAA 4TQEL 2LR4A 3TVYA 3MCAA 3ICCA 3TRKA 4BNYA 1FL3A 4I1YA 4G59C 4M1CD 3MBED 3GXIA 3N1MC 3TTUA 2CM6A 1RPTA 4LSQH 3T1TA 5ESQA 3H4FA 2HN9A 1WHTB 3M1AA 1YZKA 3MZTA 4GOLD 4XBEL 3HN6A 2BISA 5BV2P 5IEHA 1CL7H 4J1TA 4YLBA 4J1TC 4LEEA 4TTAA 3H7BA 3B13B 1I7DA 2R56L 3WLOA 5JECA 3LMJH 3O3MB 2XTJC 2QQ5A 1JHAA 2V4ZA 3U30C 1OA1A 4FFOA 5AK4A 2GD1O 4GLFA 1ISPA 3UEOA 3SODB 2VKXA 3QYAA 4M00A 1KVTA 1AQKH 2YO3A 2LGNA 1UFRA 3RUGF 2X0WA 3ZWYA 1BKDR 4L9LB 3H7LA 4LCIH 2FJHA 3W05A 3TTSA 5DD0L 2NSLA 2C92A 1AHPA 1N5KA 3IBFA 2BEKA 1JBKA 1DQRA 3L84A 2KMLA 5L2KE 4EKGA 1XPOA 2QQLL 3PXBA 4B0MM 1IE3A 4NZDA 4C59B 2NY4C 4NWUL 2Z2JA 2XQKA 1R3LA 5ALPA 5FCDA 2EEBA 2PXYC 2P3LA 4N6GA 3DYOA 5IYZB 4EVIA 5K33A 3VFUA 3FYHA 1JZ2A 4CKWA 4EUPA 4O58L 4EHKA 2UU9B 1KU0A 4OD3H 1KA9H 4FC7A 4B46A 4GRLB 4DIFA 1V7QA 4TVPL 3CSBA 4FS3A 5FQOA 1UOQA 1FP6A 4AVYA 3KVOA 4TS4A 1BHJA 1EHIA 5B3JF 4K7JA 3PU7A 4O9HH 1KIUA 3PUIA 4PIPA 4HZLA 1FSSA 1T2DA 3NH6A 3G5XB 5DHAA 5E38A 1VDGA 2LE0A 3VFNA 1U9IC 2OHIA 5A4AA 2A4MA 3CEPB 3W5NA 5K0TA 1TENA 4EB0A 3UBGA 3V97A 4WWPA 2XE8A 2VTBA 1AS6A 2BNUB 3Q3GE 3P9QA 4OK3A 5FM5O 1ZS8A 2WWKO 4BPRA 5CMLA 2HYMA 3CM0A 3LA6A 3H84A 4E70A 4UBLA 4MYTA 4K6HA 4M48L 1INEL 4GXVH 2UYCA 3L7FA 2Q3BA 2C4TA 1FFYA 4FQQB 1DAIA 2PBFA 2ROYA 4PRYA 5LHDA 4NQCD 3DSNA 2X89D 4BLRA 3PS9A 3L0ZA 1E18A 5SWSE 5GONB 4WSJA 3O8XD 1PJQA 1LO0L 1T6NA 1SQ0A 2FH5B 1DHKA 5JW3L 1U63A 5JYCA 1XGTB 3BCUA 3PNKA 5IG2A 4JO2L 3VTKA 1U2TA 1YN6B 1YI1A 1KLUB 2VSCA 3L49A 4GR9A 5DEZA 2C2HA 2O93L 2O6HA 1EWKA 3QUMA 5C8YA 4F04A 4S2EA 3E9YA 4KK6D 5KOMC 2X0UA 2HG0A 1XTLA 3AKYA 1Y34E 3IELA 4GG6B 1S78D 5E2VH 4AT6B 1XR8B 3OKYA 4PV8B 2O0MA 2ZJ8A 3CW9A 2X4TB 4AJLA 4CPDA 3NDBB 1PUXA 4H40A 4FM9A 3IDGA 5EU4B 1IAIH 4NNPA 2B59A 4FD2A 4JXKA 4JI4B 2C9OA 4IMPA 4CC4A 5BUPA 1D5IL 2QL1A 2G5PA 3UW1A 2WLJA 3EJJX 4CC4C 4JGUA 1MLBB 1DFBH 4YO0A 1XGQB 1U8MA 4EHIA 3ZTJG 2JQMA 3I61A 1FQKA 4R0LC 2VDWA 2RB5A 4PRIE 3GJ3A 3JZAA 4PW9A 1NGPL 4ROTA 4YAEA 1I3LA 4IUDS 1GPAA 1MLBA 4DQOH 4N0UE 4WY7H 1WDWB 1YS1X 4JX0A 5E6RA 1P5UC 3KPMB 1OAQL 2HMWA 1A8UA 3S3SA 3DMFA 3G2QA 4RDBA 5B3JE 4F9FA 2A1IA 3FPEA 4MDHA 3VD3A 4M6AA 3GT4A 3R44A 4TN5A 3QJGA 2DQIL 5CCEA 1TKRA 5EZYF 5IJWA 1YN6A 3WTCA 3GXFA 3H5AA 5KTEH 3FT4B 4MDIA 2WABA 4ZO8A 3O1HB 5MF6A 2KBGA 3DVRX 1G3MA 3S1AB 1H3PH 1YMHB 4QJBA 2J4CA 2G1JA 1LLAA 4OFPA 3UJ8A 2WLMA 1UZ6F 3P5SA 3ZW3A 2DN7A 1UQRA 1H0HA 2F15A 1DDTA 3MV8B 4JKIA 1U5CA 4K23L 3C09C 3Q3IA 5E8DL 2XPGA 3PC8A 5KYXA 3PBKA 3JTSB 4Y6OA 2I9LA 5HHMD 3GHEL 4P4SA 4R1TA 2RHBA 3WMPA 3MQ4A 3QUXB 2FEEL 1ETZA 1MH5B 1U36A 1VB5A 2DYPD 4FVTA 4EHJA 4TRPL 2R29H 3LKVA 2QLYA 3EYAA 3CFBB 2MYUA 2VA9A 3AY6A 1JXFA 4MVCA 3EJZC 4AK1A 2OBBA 3K73O 4XGQA 5IB5A 3OICA 4I36A 3F6SA 2HU5A 4PNZA 5I8PA 4D9MA 1IARB 4L74A 1SYVB 4JFAA 5CA1F 5AVRA 4O6VA 4NN6C 3T3PF 1Z29A 1WG8A 3DZIA 1E90A 3IMKA 3QCUH 2VERA 5D1ZA 3VKFA 2QJOA 5A4KA 3AT0A 5GGQH 3BAEL 4FUQA 3ZO0A 1OAYL 5DRNB 4DF9A 3EZXA 3H2HA 2NQDA 4YJ3A 1IN6A 2AG6A 3ARFD 2XOEA 1G8YA 3BWCA 1BVNT 4L05A 3X1ZA 2KYIA 5INDB 5I8CA 5FADA 5I6NA 2ICWA 5DOZA 5CINH 5LJYH 4K5NA 2WIJA 3GHEH 3WNKA 4UBMA 1WQ1R 2BS9A 1TJIL 1PJWA 5IULC 3S7TA 3DM5A 1L9PA 2A6JB 4MRSA 2PBRA 5AI0A 1A9BA 1TCMA 1J0XO 4MD0B 4K5QA 3Q48A 5B36A 1BQRA 4LOKA 2WZPD 3UGEA 3IVXA 5GM1A 1JZTA 4OZIF 1Q0PA 1N0LA 4KQMA 2F43A 3VDMA 4K15A 4XNQA 2B1RA 2JHFA 3LV3B 4WCFA 2H4YA 4JT9A 5KX5F 1RP9A 2VJXA 3FMGL 4QTHB 1O9WA 2ZTLA 4KI5E 1TO5A 3NEEA 4AIZA 5T64A 2IAMB 3O6LL 4X7PA 1UK6A 3UWKA 3EPLA 3NBKA 5T1MA 4NJOA 1CQZA 3OIFA 4AMBA 4MCYA 5L4IA 2V8BA 2HT4C 2R27A 5AVTA 1NLYA 5K45A 3W0WE 4ESKA 3DVGA 4OD1L 1CFZA 1USUA 2PKQP 5A2GA 3R06A 1EM6A 5T3XH 3MPCA 3ZC3A 3N40F 5EHXA 1M0EA 3ZKNC 5M34A 1QI5A 3YASA 3SGJC 1WQ3A 3ROZA 4NKDA 4MI1A 4RTMA 3PRHA 1W52X 5EYPA 2HXSA 1BHQ1 4UOQA 3HJUA 4LC9A 4N47A 2ET6A 4QPCA 1K2DA 4PRIB 4FFYH 3I9GH 4N25A 3D39B 3S36H 5GRUL 5I4CA 2PUVA 2QRGA 2Z4TA 3CH5A 4UE6A 5TE7L 3IPYA 4YUEH 2ZTMA 5FOXA 2WJ5A 3QJUB 2IYTA 3FDJA 4MKHA 1P6AB 8AT1A 2VJ8A 5BNXD 4U7KA 2HMYB 1WS6A 5LBSA 4AIOA 3BPLC 4OI7A 1MNAA 2G0TA 4X3CA 1OYOA 4HH1A 2A14A 5KVEH 3EHDA 3ULVE 3AIIA 1U6AL 4HT1H 2GBVA 4B9KC 4ARVA 1NKRA 4R41A 3WWZA 4ERNA 5CFAA 3QNYA 3PE3A 2C00A 2JJQA 3VXME 1T5LA 5EZJA 4B82A 2VNIA 4E5XB 4X41A 4P23C 4AW7A 3ZKWA 3A4YA 2EKBA 1BD3A 5AM1A 4UT6L 3W9DA 1Z9SB 2XE4A 4CM1A 4I5EA 1J8HD 2PO6D 2PD4A 4F4FA 4Y1TA 3PGLA 3F7OA 4V0OA 3QIVA 3VRLF 1RMFL 2WGNB 3BXPA 3EFOB 3TV3L 4BVEA 2YXVA 1J1IA 4BXOA 4IOFC 2XH8A 5CIQA 4XWGA 5I6OA 1T3GA 1NQXA 5CNHA 1U2RA 3AM8A 3PF2A 3RVUC 4NK5A 4Q9KA 1MHPH 3WP0A 2IPTH 2OLDA 1ILUA 3G5UA 3LA8A 1VGEL 4MQEB 5IGXL 1MVUA 4PUBL 3C6BA 3UJ6A 1AMUA 2VXTL 5KG9B 1SUPA 3S3CB 1B7GO 4PVDA 2I2BA 2P44B 3P69A 3ROFA 4F06A 4PGHA 4R2GC 4UV7H 4I1IA 4ERSL 4K71C 1YDMA 3OMIB 4KP7A 1EZLA 2R1XA 1X7GA 4HKXB 3HA0A 4DYDA 3DP9A 1M6EX 1T10A 4R4JA 5D7LE 1YCDA 5IVZA 5AVXB 4QXOA 1AGEA 4BZPA 5K2OA 2LTQB 3JRWA 4PLYA 4R26H 4NKMA 1EXMA 1HYSD 3QW9A 4IGBB 2LLLA 4UANA 1E3MA 4P2RB 3VZBA 4XD7D 2PWFA 4BCDA 3II6X 4PQYA 4F4IA 1GGIL 1U8TA 4XRCB 3B5JA 5EQTA 2QPTA 5D7JA 4AJVA 1NUGA 2DQEL 3RWIA 3GTTA 3BWAB 3HJNA 2L3BA 4K5LA 2CDCA 5D6NA 1QK3A 4CQMA 2F1KA 3WN5C 4W6ZA 1I75A 5ANME 4HKBB 3EAQA 2VL5B 2OAEA 3BB3A 3EIHA 4ZAKD 3OWEA 4TVPE 3X1MA 1YNKL 3ND9A 2ZSBA 2JFHA 2DLCX 4QOGA 3H5NA 1DBIA 1ZLWK 5I3CA 3QXSA 3ECUA 4UF7C 1EFHA 1GZQA 4OCZA 3OH8A 3WUWB 4PRLA 2D3LA 3I2IA 5F96L 3ENVA 1IAKB 1E4WL 3LXAA 4BB9A 1BFOB 1XHHA 3K0SA 1NMXA 4OQLA 5C09E 5HK8A 1TVMA 4DDHA 2X9YA 1F6DA 3CNHA 3GBPA 3WWYA 5AVXA 4KXLA 3K9HA 2YD6A 4S0SD 1VLZA 1CLZL 5CLJA 1BN6A 5AYUH 5J13C 4FHCA 3D4BA 4KQ3H 1XIWD 5AB2A 5HYSG 1F1AA 2I24N 1DSWA 1SNRA 3ECWA 5IHUL 3NDYE 3RC7A 2UZPA 3GUVA 4P80A 4U2GA 8FABB 5K9JH 1W76A 5JWRA 3GY0A 4J94A 3EZJB 4YGVB 4U3SA 1BZ7B 1UM5H 1OUMA 3WHIA 3PNVA 5ANRB 2VPXA 3LRHA 3UTSD 2VT2A 4P4KA 5THXA 3X3GH 4I4TF 3S2FA 5FYKE 3UENA 4QEZA 4YXFA 5BQPA 1RIFA 3MILA 2HFEA 1T7ZA 3HSKA 3Q5GA 5IDXA 2Q3JA 4WZBB 1FBTA 2ZGVA 1B0GA 3GXDA 3TD2A 4M6ML 3F74A 4BTEA 2A0UA 3PHAA 3EIWA 4FYIA 1F4AA 4NESA 4HEME 1M7BA 1JECA 1MB0A 4B3XA 4IRSA 2DQCL 1GQRA 3UXEA 1RBYA 2RONA 1CUCA 4KJQD 1HHGB 2OTPA 3M7FB 4FCCA 2GXSA 2CO6B 4JQYA 1MU0A 1HN1A 4HXAL 2GFBB 1JHMA 5C2BH 3KTAA 3SJUA 5C09D 2XHZA 3BIWA 5MHSD 4C5BA 2Q7YB 5J5EA 2X2PA 3UBXG 2NZ2A 5CITA 3WXVL 1SHJA 2V5AA 2P6MA 1IK4A 2IUUA 1SYSA 4UM8A 3V48A 1IHPA 2NY0D 3JQPA 2YUIA 5BT9A 2BKEA 1TUBB 2OJZL 4DXHA 4HW6A 2NW2A 1SHLA 2WFZA 2VB5A 2PX0A 1NBHA 3EDCA 3U4BH 1SCBA 4PYKA 4MVJG 3U9TA 1LX6A 4MLPA 5IFKA 2YAHA 4H26A 1F4VA 3ESZA 5FX2A 4I5BB 4JGIA 1YS4A 3U0TA 1KJNA 3ZO9A 2I2DA 1XN4A 1SIWA 4YQEA 3KV3O 3CKLA 5IBPA 4WESA 4XFJA 2GN9A 2ZWNA 5T1KD 3D59A 3GIWA 5LQRA 2J8OA 2CHWA 4QXVA 4MA3B 4HOZA 2XWTA 3BSGA 4OJQA 4MWGA 4J12A 3PDCA 2CYAA 2PAFA 2PWAA 4I55F 3PFQA 5BXYA 2X70A 1VE7A 5ECYA 3T2LA 1FRNA 1GDTA 1GVNB 2Y4OA 3DXXA 3WGKA 2UX6A 1YDFA 4DW8A 5FPPA 2JDID 3CDGB 4O33A 3OKFA 1Y33E 4OZFB 4Z3FA 3DBHB 5IB2B 2YXFA 3OX2A 3OPYA 5EUCA 3H8JA 4OLXL 1AV6A 5C0CA 4OP1A 1ULUA 1EWQA 2Q3FA 2AUTA 3VFWB 4AIZB 5AVKA 1YYCA 3DPSA 5IH3A 3THMH 4FHBD 2CHZA 1KEVA 3A4IA 4DPAX 5IMKB 2I3DA 1QD0A 1Q9OB 5IV2A 3SLRA 2HNBA 1WJGA 1S02A 1MRDH 4MQTB 5HHQB 2XKNA 4J16C 1AC0A 5JCOC 3EODA 2J8ZA 4KQ4H 4FHZA 2BZGA 5DRZB 4B0OA 2WXOA 4DR1B 4FXTA 3AITA 1VGQA 2ZIFA 3ZE9A 4FEMA 1SCKA 2J1WA 4UTXA 1LQ2A 4KXNA 1KRWA 5ALUA 1NVBA 3LW7A 2AXWA 4GQ9H 5DWUL 2VJDA 3RG8A 4BZ2L 4UU9A 3WLRA 3N44B 3WXWH 4NSKB 2C9SA 1COBA 4A27A 1W80A 1ZLDA 1WCBA 5TE4L 4ELKA 4XBPA 2E89A 1UP7A 1CXKA 2CEKA 4RF3A 2YARA 2DYPA 4JQIA 4BZWA 1W25A 4UQCA 3RR2A 3H65A 3TLGB 3V1TC 4EECA 3K2UL 3D6UA 5D00A 4FYVA 3MV8E 3D6AA 1SJEA 4DS3A 3QOFA 5EI5A 5E9AA 3H16A 2H07A 2HO5A 4A6YH 1G7JB 4I3HA 5CNIA 4J3XA 4JFFA 4RPCA 4M76B 3LPGA 4UUQA 3K9FC 4NG4A 2QZJA 3DZFA 4MNHA 4X85A 3OKNA 5IJKC 3G2JA 5GSVA 5AD1A 1JZGA 3AETA 3A3KA 3NA4A 1NBVH 3SIPA 4IWXA 3BJLA 4FQXA 3HCOA 1YNSA 1H8EA 3A7DA 3KIPA 1VE6A 3JVIA 3I6GB 3HDJA 1NUFA 3AQYA 4JXXA 3FO2B 3EDMA 1I6LA 5L0QB 5KSVB 4GMTH 2EG9A 1TEVA 4AQZA 1VAHA 3WV4A 3W6NA 1CFVH 3BGOS 3O4LA 1WUHS 3DZHA 5F9AC 5HOQA 5FPSA 4U0QB 1G6OA 2D59A 4FQ7A 1MAKA 3DGFC 1X5ZA 4GLLA 1YZHA 5IESH 1T5XA 1EFPB 5I8KH 3OB0H 4M61B 2MMXA 1P1CA 4YAWA 4S10A 5EZYA 3FZGA 3PNSA 1HX7A 2QM3A 5F7MC 5K4GA 3VX4A 2A6IA 2VCHA 1FLDA 3KFXA 4U3HA 1E64A 3N8DA 4IMKC 1LDBA 5EU3A 2IHNA 2V1UA 4WMLA 4FGKA 3MGOB 1OHHA 3IDMA 4XT1C 5D7JB 4DDWA 2X6QA 2BFDA 1OPOA 4AYEC 1F1BA 4E9SA 4X0NA 1KFKB 4R7XA 3EEBA 1C9DB 4JNKA 1RJLA 4NNOA 1L4EA 1E2VA 1D5XA 4EQZA 3P40A 1PR2A 4WIAA 2Y67A 1UVQA 3AREA 3D0AA 3CZUB 2AYXA 5GGTL 2CLHB 3DVAA 2D73A 5E6IA 2OM5A 3FOMB 4ZS7H 3GK8H 4IICA 4HSGA 1JE1A 1EX0A 1WV0A 2Q76B 1N1GA 5JQGF 1BQKA 3AEQA 1K9TA 3ZXXA 1BF5A 4K9KA 2ORBH 1WPGA 4NNYB 4L72A 1USVA 3C87A 5CS7A 2QADD 1B2RA 2OCCB 1MEEA 1U2YA 4KZPA 2DY2A 2CHDA 2C8NA 2VH2A 5FPKA 1KIPB 1TW3A 4IXWA 5LP6C 1KQOA 3LUKA 5AVRB 5MP6H 3UT5B 2GEEA 4ITRC 2FSEA 1REQB 5AW6B 5A06A 2FLVA 3DHNA 3NOOA 4D4IA 1GUDA 2WWHA 1Z0NA 4GRLD 3HPLA 2PJZA 1QR6A 2JIRA 2VAWA 3U4IA 5D7BA 3ODPA 3MA9L 3NN8B 4AICA 1OXKB 1NLUA 4DLBA 5KINB 9GPBA 1M71B 1KIQB 4M7JL 4RH4A 4Q4IA 3PEVA 4PXSA 5DVZA 4PZCA 5CA1B 3EAKA 2H3XC 1S8OA 4KI0A 4ASUD 5KMGB 4X9BA 4XNUH 3RTBA 1KAHA 5I66A 1R9FA 1JQAA 4LYFA 2SICE 1LXCA 2ZSWA 5TDOA 4M8NE 1UOWA 1E3QA 4M8KA 5JW6A 2GYYA 1A95A 1EUCB 2WICA 2EHDA 1F3DJ 5CLXA 3VZQA 5HDQL 4F3CA 4D0DA 4A6EA 4F27A 1QE5A 5HHME 3IAHA 1M9NA 1P5VA 3VVCA 2XRAH 4AGQA 3UC2A 2XYQA 3R7BA 3T3HA 2ZWOA 5C7IO 2AJTA 3N8IA 3APDA 4I4TA 5C8JB 4H6XA 2RHDA 3PG5A 1A7KA 4GXNA 1KTJA 3H11B 2CXOA 1D7OA 3MIIA 1GNRA 4HZAA 1IKNC 4JOQA 2PUAA 1CR4A 5TT0A 3NLLA 3UTDA 4AKEA 2IPLA 1OGAA 4M4SA 1GA4A 4R7ZA 1BM3H 3F78A 1IY2A 1W72B 3HDQA 2GPBA 3DUFA 1MHEA 3EXIB 4IHJA 1XEXA 4E9VA 5KX5B 3SOPA 1ENYA 1RURL 3AJ9A 2BP7A 4O2CA 1FVCA 4GPBA 3Q3VA 3PDDA 5FHRA 3Q2IA 3EH2A 3HUJE 4JNCA 2F2TA 16PKA 4XCNA 3VX1A 2NU8A 3SR0A 2EVFA 1BWMA 3TLBA 4HNUA 5E03A 4QHKI 4MCYB 4ISVB 3WGLA 5FBVB 3CS3A 1JJAA 1DVFC 1BNCA 5ICYA 5L2JB 2EYTA 1PSKL 2OTWB 3NHUA 1DQKA 1RUAH 1MPTA 1T1YA 1IAIL 1G2OA 5DTFB 2FR1A 3KJXA 4M9QA 2RAMA 2JJYA 4JL1A 4MW1A 4PQEA 1R3KB 3U9UA 1OI7A 5LP6B 4AS1A 2KZBA 3UQZA 5CGYC 1E3JA 4Q6WA 3BPOC 3FF8A 2Q7YA 2QPDB 2WG2A 3H9BA 4MLCA 2ICCA 4DR4B 3IE9A 1R3DA 1XXHE 4O4LB 5EEHA 2FDCA 2Y7OA 2B21A 2ARJB 2E6PA 4RVFA 1DZBA 1W581 1S01A 2FKNA 1R66A 2OCIA 3EGOA 4KE8A 1GGBL 5DHPA 4IS2A 2CHXA 5KEZA 2ENYA 3CUPB 5D1QD 3RS9A 1RLIA 3EYUH 3AR5A 4JL5A 5DQJB 1D9ZA 4LHZA 1WT5A 5A03A 3NCJL 1HMYA 2HJLB 2E47A 2FGKA 1IGFH 3QBJA 4OAOA 1LE9B 3BKYL 1M71A 1NFIB 4W8GA 3ROEA 3DO3A 4Y4HC 2WSBA 3TM4A 4XOIA 1BJ1J 4GR4A 4HV4A 4F9LA 4Y0NA 1YVLA 4PHCA 3S96A 3JTTB 1ZOPA 4PRPD 2JCXA 3AWGA 5BUSA 4AGNA 1L6ZA 1QC5A 5I7HA 4OM0H 1WPXA 2A74A 1NXOA 4L1SA 1TUGA 2CR3A 2WSYB 3KWTA 4HNQA 3V1LA 1B9ZA 4JM4L 2ADYA 3ZRFC 4G6JH 2NY0B 1ZNZA 4GAJH 2AD5A 1UPCA 5JS2A 2PKDA 1QTQA 2E0PA 2DD8L 3C9NB 4O8CA 2VE6A 5CLHA 2DQFB 3KYMA 5CILH 4RETB 2O1AA 3AKDA 3CLUC 1IZ9A 4CIWA 1S7VA 2XV6B 2F53D 2M9MA 1ZSYA 4Y3UA 3ARGD 5KTKA 4KKPA 2VAVA 2X9VA 1LVHA 3SICE 1NJ9A 3FTGB 5B3NA 2Q8PA 3SYCA 3P2JA 1DIBA 4Q24A 1EXGA 2WLLA 4WASA 3E7XA 4I0PA 3ZJ5A 2GK3A 4I3GA 3FVWA 3PAUA 2JCCF 3O1LA 1PZGA 1OBVA 5IYZA 1EXHA 5DYGA 4LJAA 3GUTB 3LCMA 4QXWA 1ZTMA 5CFLA 4RAQA 4MGXA 4IQ4A 2DBVO 1PGNA 3KVNA 3LKDA 1M3JA 5IAJA 1DJMA 4NN6B 3C3EA 3KZ8A 3IDJA 2A77L 4BIMA 2WFLB 5IZCA 2L2QA 1A6ZA 1EXUA 2LKDA 4Q9QL 3RAGA 3TPZA 3M4JA 1NAMA 2VLKB 3SYAA 3SBEA 2Q3ZA 4WSKA 5LJLA 3G9AB 4Y2OB 2YRZA 5DK0B 2NY5L 4AWBA 1SUWA 1DVFB 4EM6A 4F37K 1USQA 2VTKA 1JFHA 3ES9A 4NENA 1UPAA 2RFXA 4F2DA 4B3MB 2WZ5A 4NZ8A 2E27L 4LGRB 3ULUH 2BFEA 3JASB 2GK0A 2NZJA 3FHLA 4YPJA 1JAXA 4Q9JA 3DRQB 1OZGA 1Z32X 2COEA 3NACL 1G8KA 3EUFA 1CRLA 4E11A 1IC6A 1QTPA 4P2QE 1YIDA 3D39A 1SZPA 1L8AA 3FTPA 3RIFF 4EEZA 1OO2A 3L92A 4LGMA 1DLFH 1GUYA 1Y3BE 3I3SR 3RSSA 5IVXF 1KQFA 2HK7A 1CUZA 4B6FA 4GOSA 3EUDA 5IREA 3KEDA 2XWSA 4FYRA 2H7VA 4BNIA 4FYQA 4KK5C 2OV4A 3KWJA 1EP1B 4QU9A 1XF9A 2J72A 3AB0C 1Z38A 3WKNA 3VAEA 3U5ZB 1E5DA 4MAUH 3NP9A 4UTNA 2DAPA 3UUFA 1XZ8A 3F8TA 2BDNL 3KL2A 4KRFA 4BJLA 1V05A 3VI3B 3H6GA 1IFHH 1I3OA 2WYIA 2MNJB 1AF7A 4FERA 2O54A 1CTMA 1PRYA 2YOHA 2GCOB 4LZJA 2V6GA 5GRXG 2EYSB 4FP8H 2VF5X 2IX3A 1OQOA 3P9MA 2ZSFA 5EWJA 3JZFA 1WWCA 3WE1A 3V5HB 3I6MA 3I6ZA 3FUUA 4Q4HA 1QHIA 2BSTA 5BZDB 5GGSA 4MITA 4LKXA 3LO8A 5LWYL 1R4AA 4IDHA 1BXKA 3ZWVA 3QSYA 4AG4H 2BFBB 2CSXA 3KG5A 2KJQA 2EBFX 4E13A 2A67A 1UBGA 1TZHB 2I2FA 2I8LA 3VA7A 4GLRI 5BZZA 5SX5K 2RHMA 4EOGA 5HPYB 2XWRA 6CHYA 3C1UA 4YWHA 4YIQB 4JVNA 3WS6A 3BN3B 2KS0A 1QOPB 1WCQA 2HXGA 3OEEA 1XEUA 1N6QL 4L15A 4BRWA 4XO3A 3FPBA 2W98A 1ETA1 2VXOA 3RJMA 5GIRB 1YRQA 1UDRA 4UT7L 1E1NA 1JDAA 1RUKH 1ZYUA 2EUXA 1UEMA 3DSRA 1AO7A 1C0IA 4QYMA 1PKEA 1XDWA 1UH4A 2YVQA 5ICGA 2BMEA 4FIZA 1O5IA 1JE0A 1E6KA 1K7EB 4EQ6A 3HBGA 4OTXH 1Z12A 3HY6A 1EFVB 1Z2CA 3B2PA 1Y3CE 4QBIA 4OATA 3GO4A 1S9YB 4BX9A 2ZDQA 3KPOB 4FI7A 1JZ7A 4LMRA 3CXFA 2O5VA 1NOLA 3WK7A 4QODA 2NT3A 1VOTA 2NTFA 4G1MB 3DX9B 2AI0L 2DHQA 4XWYA 3SE7A 5SZJA 3SDCC 2Y36L 3TK1A 3R1GH 2P28A 2DEWX 2QRKA 5DGHA 5FH9A 5D96B 4BS9A 3BAZA 4P46D 1MY7A 1GCOA 3RL2A 2WU1A 3ISYA 4KR9A 1THCA 1I8IA 1SUHA 2Q9BA 4FFVA 4W9IC 5CAEB 2IWGA 2QDXA 2AEPH 1DEEB 3HH8A 4FDAA 4MBOA 5FFLA 5L3QB 2R7LA 1AC5A 1GZVA 4PJDA 4NBTA 1ZK4A 2VXQL 3IWUA 1P6QA 5FBQB 4W1SA 3ZUCA 4N8CL 4Y4FC 4PLKD 1KH1A 3OEWA 1CTOA 3B1XA 4I5BA 4K8RD 1U4SA 3ICQB 1BOOA 1C1DB 3NIGB 4HCGA 3A58B 1E7SA 2AV1A 4M5SA 3TPUA 4QULA 3BIBX 1S3IA 1JALA 1WU7A 2UY6B 3RANA 1SUIA 5L8LB 2PS1A 1YT5A 5HD8D 1M7DA 3WOVA 3RV4A 1AD0B 4K71B 3PY9A 4ENSA 5H7XA 3U3ZA 3HP7A 1UANA 1XBTA 1H15A 2QPOA 3RVWC 4KUCD 1E3DA 2VYND 4DZRA 4FNQA 1CQYA 4LCUA 2PTTB 1MC8A 3U7GA 2Q8NA 1JZ5A 3U4QB 4UNNA 5I75B 4LARL 1WEJH 2G1PA 4IJQA 2O0JA 4C1BA 3DHPA 2Z8WC 5AKVA 3R5SA 4RK0A 2F18A 7REQB 4KSCA 3GUZA 1SC6A 3IBOA 2PE5A 2XNCA 3SPGA 2FMFA 1KN4H 4ZXBB 4M1DH 3M6IA 3DX4A 2ZBVA 4U4IA 4KMRA 1QSEB 3CU5A 2Y06H 3T08A 3MINA 4HJ1A 3UTQA 2F4NA 4H31A 4MHOA 4DDVA 4R71A 4BGLA 3A1WA 4HBZA 3U7QB 2GZ3A 2X2UA 1HTBA 4KEAA 4X5QA 4RZHA 1D6SA 3W6ZA 4YSAA 3FYSA 1VE3A 3P3SA 3V1UA 2PNDA 3NCTA 2HTKD 2XKUA 1BEEA 3JQBA 1FVCB 1EERB 1EJBA 2I7XA 3OF3A 1K88A 1DX9A 3LI2A 3LPLA 4MW4A 1EDEA 3VFGH 2E4YA 3MROB 1ET5A 1MW0A 1SN2A 1ZQ9A 5LQBH 4OHVA 1ZLUH 5F1OB 2FSGA 2PVSA 1TKBA 2IMMA 4LRQA 3QORB 1ET8A 2CF5A 3SC4A 3LBFA 3V9EA 4I9FA 5CGZA 4WZ6A 4QM6A 4CF5A 2XN9A 3CINA 1VFPA 3MGAA 4DT1A 2Z65C 3PWVB 1KEKA 3K70D 1R17A 2CLIB 3BE4A 4WIQA 3SFTA 1KELH 1QLFB 1PZHA 4CF6A 5A9SA 2FJGA 3F6BX 1DRVA 4PV7A 1D03A 4YHIB 2IZ7A 3KJGA 2WYZA 3CX5J 1P4RA 5D7SL 4EMSA 1RIVH 3IFPB 3CVDA 1OZAA 2ZTBA 2D7PA 1HL3A 3OAZH 4OF4A 3MRBA 5DTEA 3W8RA 1CURA 2HC9A 3BMNB 4YNYB 3O6FD 2X4PA 3VC3A 3FT2B 1I85A 1BFUA 3HG1E 2QVLA 4WDIA 2QADC 1RE1A 1YHNA 4JU8A 1FO0L 4ZUVB 2J85A 4RZUA 2XMBA 3KZMA 4GIOA 5GS0C 4N6RA 3ELUA 3UTZB 1CYXA 3E8XA 4F8YA 2NXZD 1HE4A 1MW2A 2F3PA 2YUXA 1H9DA 3ERXA 1V1RA 2K3TA 1WA5A 3JQFA 3TYGL 3VPFA 3G5XA 5ECDA 4OUUA 4GYYA 1DIRA 1BCRB 2D4DA 5E0FA 5D72L 2RR3A 3F00A 5I5MA 1X44A 2CNKA 4X97A 4EJSC 2QQGA 2C3XA 1MO6A 4WFJA 3MTAA 1HTWA 4RM2A 1KYAA 1ZCJA 3B48A 4S1SL 1P8JA 3V0AC 3CJTA 2PG3A 2QR0B 1CFNB 4GX2A 5F1SA 1PS9A 1C5KA 2N4IA 5KOHB 1J2YA 3ECBA 5D7NA 3ZE2E 4M49A 4KI5C 1HWHB 1PD6A 3G8CA 4NZOA 4Z1MD 3AVXA 4AQAB 3F4BA 1MWAH 1MJ8L 4YDMA 1KLFB 3X2SA 3EA5A 4BAGA 3U9PH 1C0LA 2QWXA 2PANA 1JIBA 3LPDA 4I9WE 5DD3H 3MJDA 3DZBA 3W77A 1NFIA 3KPLB 2YN2A 2HJGA 4IM7A 5IP4A 4RCVA 3EN0A 5AUPB 2ID4A 3CZGA 3D3WA 3NHKA 4GOOD 1TT7A 1FE8L 1JHKH 1QVOB 3PCYA 3LGXA 4KJXA 3NHWA 3A6HA 2MCPH 3EF0A 4RRPG 5JEEA 4C4BA 4TVUA 1EUYA 3BW9A 3QXDA 3VXSA 2EXYD 5IBUG 1K98A 4KK5D 2GQ0A 3TB4A 2BGLA 4ZPTA 3MYZA 2A92A 1QYGH 3AVPA 1NQAO 4OGYH 1Z33A 4HAKA 4I3SH 4KRMB 1VG1A 1UWEH 2Y1AA 1CVLA 1LO2H 3KU1A 1GCFA 4S1NA 3MB5A 2O8EA 2A4ZA 3WTWA 1XKQA 2V6IA 1SFHA 1TU3A 4EUHA 7GPBA 3RS2A 3MSPA 3AINA 1KTRL 4KPHH 3RS7A 3RNKB 3SDXF 2BHZA 3GRAA 5HYJE 4TNEA 1EEYB 1E2HA 1VXRA 1ZCAA 1EWTA 2GK6A 2W9EL 1DKQA 4HTFA 3HZVA 4L3ED 4R0VA 4B4WA 4NUGH 3EBOA 2WP3T 4INAA 5HGBB 1TK9A 4K94L 1FUKA 3GFSA 1DO5A 4U3SB 1JNHB 1J70A 3MQIA 3SPXA 1C7IA 1CX9B 3OY7A 5FOVA 2CVZA 4DZ8B 3ZYCA 5IB4B 1RKQA 1GZSA 3T4AC 3PGKA 5IW8A 1Z0KA 5TMEA 1W35A 2MIZA 1APBA 4J27A 2H7XA 1NC2B 4MWBA 1QRAA 4H7VA 5BYBA 5CCKH 5CFNA 3ZOZA 3VJRA 3L17A 3T99A 4B27A 4GM4A 4B6JA 1S3SA 1J97A 3RTQD 2VJMB 4BNGA 4YMHA 2VWQA 4FOOA 5J1TB 5EEGA 4E4RA 5EIBD 5L4JA 4UUPA 3LX5A 2HO4A 3PTAA 1H4SA 1EUCA 3VX3A 1N77A 1BAFL 5BQ7A 3QBDA 4ZRDA 3R23A 5DI3B 3I3EA 2C9RA 2ACVA 1HRDA 4NBRA 3GNMH 2GPWA 1KCRH 5E8EA 7PCYA 1BDIA 3E7WA 5FA6A 1MI5B 3T3ME 3WLMA 1ULAA 5JDCA 3MZGB 4U2EA 1S9HA 4A0FA 4AMKL 1OCRB 1MFDH 1OPRA 1U80A 5I6MA 4I7ZC 2IPKA 2A38A 2ZIAA 2NDFA 1OZHA 3OXRB 4RLQA 4R8WL 3RILA 3U44A 3KLPX 3LWZA 4POZD 3MD9A 1E5TA 4E03A 4Q16A 5DHSA 1CD0A 3H6AA 2H6PB 4XR9A 1H9BA 5IMKA 2AEIT 3W1EA 1C0EA 2YQ3A 3ORJA 4A23A 3IILA 3D1VA 3Q6NA 3X1FA 1F8TL 3FT9A 1OAXH 3GJ0A 3I01M 2ZSVB 1FI8C 1C16A 4MS4A 3UT5A 1G5RA 2A2QT 2AQSA 4XPTL 4NQUA 1P69B 1IKOP 4AM0B 1KORA 4MOWA 4G25A 2FR8A 1WBXB 2O8CA 1EM8B 1YNTB 2APBA 2JJSA 3E0GA 4WHTA 1I3KA 3LDGA 4OLXH 4KQFA 3OTGA 3RIHA 1P31A 5AVVB 4RLDA 4GSYA 1NBEA 3L41A 2WHPA 5GGXA 2Z43A 2FYVA 1CG6A 5BO0D 1MMFB 1WBJB 3AC0A 4DO5A 2OGSA 1NFAA 3T38A 3C5JA 3EVBA 1XEXB 5BR1A 3F6JA 5DI9A 2R8PA 3ANNA 2W2KA 3AFMA 3UYLA 1E4KC 5CJBA 1T9KA 3GLHB 1CYEA 3BWUC 2H48A 3T4EA 3NHYA 4WU7A 3QJHA 2I3GA 1WYJA 1EO5A 3IQGX 3QKIA 4M55A 1MO4A 1JGUH 4DVBA 1F48A 3DWIA 4RMHA 4TULH 1VSCA 4KY2A 1C4WA 2JGRA 3WXBA 3KD2A 4OUDA 3ROOB 1PWXA 5IMMA 4NHCL 3AFLA 2N1BA 4GX0A 1ES0B 2KLRA 1V96A 3BDVA 1IGTA 5CP3A 3ECCA 4OF5A 3VD7A 4G6KH 4MA7L 1IAMA 3R4RA 5KBMA 1X3DA 2PZAA 3ZKMC 2GVDC 4GKSB 5AW9B 1Y4ZA 3FCEA 1JF6A 4LLYB 3QPBA 2AXJA 4M6OH 1UFQA 3RPKA 3JAWA 4GAGL 4POAA 1GFIA 1UMDA 2A4EA 1EESA 5CA0F 5HFJA 1K5PA 1QKZH 1UEIA 3WK4A 2V0GA 3DTXA 5AW9A 3RDTA 3V5DB 1I5OA 5J1TC 5ALDA 5D1QE 1ZEMA 3O4LB 1WA0X 3B5TA 1U0JA 1YJ5A 1EMTH 1Z6JT 5JCXA 4KKCD 2VP2A 4IJ3C 4YBRA 2XEXA 5FTKA 3AW8A 1V8HA 4MR8A 3WL3A 1F4YH 4B3FX 1AKJD 4AWAA 2HLAB 5ER9A 4LQ4A 1W6LA 4I6EA 4F5YA 4RQQB 4GT0A 2Z31C 5F23A 1Z37A 2FQQA 4RVDA 4NRDA 1WNTA 5L7YA 5JFGA 1RJDA 2JHAA 3FB1A 1Y7TA 1N6OA 5D2LA 1NU8A 1RPJA 5BSFA 3RZWA 5DM60 4QO1A 1GU0A 2NR6A 1VRCA 3IURA 1P60A 1R8JA 2JJ2A 3ND8A 5KNDD 5C0GA 1LTXA 5FR3A 2XWQA 2JJTA 4KRPB 4PCSA 3ZLBA 4APQC 3HCDA 1ZCBA 3T5AA 2R6FA 4HPYL 3AG1B 3ZZTA 1F4WL 2JH3A 2XNDA 2C99A 1AUXA 1WH0A 5F7DB 3SDBA 4ARBA 2IIPA 4RPGA 4V33A 1AACA 5HZHA 4PJ5D 5FK9B 4Z7NE 1YJBA 3ZWQA 2XHNA 1M2GA 2C82A 4P04A 5BZXA 3GFFA 3HMXL 2AOTA 2FPUA 4FXGA 3IKTA 1RWPA 3PL5A 4NGHH 1XPJA 1CPUA 2OCGA 2BBSA 1V7MH 1TTFA 4YSUA 3NZEA 1ICEA 4GXUM 2QG9A 1WB5A 1L3CA 1OK0A 4AAYA 3N0PB 3HDGA 1GFWA 3L0CA 1IQ0A 1SJHA 4C3UA 2OT3B 2QKYA 3QIWD 1MNQA 2CGYA 2BW4A 4YFEA 5CMAB 4BVGA 2HWXA 5FWYB 1XFAA 3W9BA 4CG1A 3PYLA 4FYKA 2KHAA 4NAMA 4QDJA 2O19A 2YXLA 821PA 1ZEAL 4JB0A 4W5NA 3PNWA 1ZIBA 4IF4A 3A1SA 3WHXA 3M07A 4CKCA 1G6VK 2WNSA 1KH3A 3D0VA 1PR1A 3OCZA 3M4XA 3LYHA 3R7LA 4YMSA 3GLFB 4YJ2B 3DHYA 3OAYH 1CDJA 3QFCA 3L4BC 1Q74A 2X8JB 4CA4A 3R5JA 2HF2A 4LLVA 3LN4B 3H5IA 2C95A 2DH3A 2NY2C 4W5RA 5DJ8B 3A36A 5AENA 1FCGA 4X1YB 5F2FA 4IRSD 1NM5C 1OCEA 4LDZA 1LP9A 1UFKA 2Y5TB 1Q2UA 2W65B 5FL7D 3VO2A 4ETNA 4DQUA 2FZ3A 4Y16A 3BWBA 1XNRB 3KHUA 4RD4A 4QY8A 2QDWA 1DU4A 5E4AA 1NYTA 3W5CA 3HG5A 1NINA 2EVWX 3B7WA 2ONJA 3T9FA 1B3RA 3HA3A 5J43A 1BXAA 4Y2VA 3B3GA 3SQBB 1UK9A 5D93C 4GMHA 1NGWA 1K27A 2ADOA 4Y2DC 1DUZA 3NH9A 5HZKA 1IBYA 1QXSA 4QNRA 3Q9QA 3MV8A 1P7KA 4MZRA 3QMMA 4X1OA 2FG6C 3ROGA 4TXHA 4AY0A 3U4DA 1DAGA 5HBGA 3UV6A 5IROA 2P2SA 2WKPA 2O2CA 2J0VA 1RHRA 4QPDA 4C7JA 2KSQA 4PHFA 2RH0A 2JAUA 1EHCA 2XCUA 4IZIA 4N4AA 1B88A 3IE2A 1EMDA 3B9KC 4QRPE 3WV0A 5HHQA 1CGXA 1QHQA 1MZPA 3R0NA 1SD5A 2OSLB 4BXVA 3M70A 4Y98A 2K2QB 5TS2A 3CLKA 4KPUB 3OURA 2VM9A 3OR6A 2XG5B 4QZVA 1V3MA 4YLEA 1JIVA 2J20A 3JQCA 4HAUA 1KIAA 1Q6ZA 2PXXA 3REQB 2VK8A 1A5FL 4PTLA 4E5YA 1UAAA 5F9HA 3KLAB 4WK2B 3VH1A 2BIOA 4HUQB 4ZC1A 1FNAA 2Y24A 4Q6IA 3QYFA 2VHTA 1ZM4A 3ME5A 5AW0B 3IQHX 7FABH 1O96B 3PQ7A 2FRXA 3W5AA 1JWMB 4KE7A 3NJHA 1PNDA 3C3AA 3SE8H 3HJGA 3SYMA 5HF5A 1ZHOA 3A6KA 1HEZB 1ECZA 2HIAA 2DQHH 5IFHH 5GXBB 1EXDA 5EKUA 1PFQA 1Y6JA 1HL4A 1KZ7B 4AMWA 3W7VA 3LZQA 3C12A 1GGMA 2EX1A 1QBLL 4Y19A 1EHXA 5BS0B 2VM3A 1QCDA 2FA9A 2X4OA 1NVMB 2PH3A 4MV0A 5B4MD 1I14A 3BQMB 2NY2B 2YWDA 5J9FA 5JNTA 5FOWA 5KNBA 1V1RB 1PQPA 2X1WL 5KOYA 1H2AS 2IUSA 3BXOA 2VSNA 2PTTA 2VDOL 2G2RB 5DXFA 1T4KB 4NABA 1GNPA 3NFPA 5BYAA 4FWTA 4A2PA 1MHCB 4H77A 1VG0B 4LLUA 2YOGA 1NBYB 5DUBB 3OMNB 4GI2A 5HKBA 4G1EA 2UZAA 4UQDA 5JHHB 3RFZA 1Q95A 4JUTA 4XMZA 4PRPA 3UYPA 3FVVA 3G7SA 1W8DA 1E1MA 2XFXB 5DT2A 5KSAB 3I1YA 5JSKA 3BWAA 3N41F 2DD8H 2QTEA 5FUZL 1THMA 2AQ3A 5BQ7B 3T35A 4YSEA 1NCJA 2AJVH 4E46A 4RHUA 4FFWA 2ZBEA 5JI2E 1T89C 3H2PA 5F1KA 4B4UA 1CVRA 2JB5H 3K9NA 2XOKA 1MFAL 5TE6L 5J57B 1T0OA 2M98A 3WELA 1VPTA 4EO5A 2Y66A 3WN5A 1WBYB 1HR0B 1D1SA 1D9KC 1FDIA 2W2PA 1Z08A 4LXYA 2R2AA 1S7XB 4RTQA 1AJEA 4QDKA 1N5IA 3TEWA 4ZT1A 3N28A 3FTGA 1TJIH 1KXQA 4KZDL 4L22A 5D3QA 4ENPA 3TQFA 1OZUA 1QO7A 3WEAA 1JLMA 1YPZE 4ANFA 1TQBC 2ADFL 3RIYA 2WV7A 4B73A 2AFIB 4J3OC 4UUJA 5LQCA 2GJJA 4DPBX 1B4LA 2A0KA 3FN9A 3UEQA 5BR7A 1TQ8A 5A5EA 3T34A 1L4YA 2A9RA 4YVUA 1ISHA 2IFFH 3ILSA 4RPKA 1EJ6A 1Z74A 3MN1A 4EF4A 1GD1O 4WTXA 1R33A 2HAZA 5GRJH 3BSZH 2Y6TE 1EJOH 2DT5A 2P5PA 2QVKA 3L3IA 3WYAA 4FZ5A 5IAKA 3CMMA 1KSRA 1NZFA 4WNYA 4G3YH 2I7SA 4ODVL 5F5LA 4HHGA 1JL8A 4P4KC 4C7MA 4F7PA 2EDEA 3TO4B 4G9BA 3S44A 3VU8A 4K7PL 4ZMTA 1QIIA 5TQ2H 1I7UB 3SNHA 1FPTH 1NVTA 3QV1A 3QUYA 4PWHA 5GS0H 4UQAA 2ZJAA 2VR6A 1FNLA 4LVUA 1K6QL 1BA3A 1CQXA 2HEIA 5EEZA 3B9KD 4ZT7A 4D43A 3JBG7 3AU1B 1F1JA 3B6EA 3EOAB 3CK0L 4KZEH 4C4AA 1AFVL 2X09A 3ETDA 4KHZA 2MPAH 2P4UA 1UWGL 4IIXA 1KEEA 3OIUA 2HHAA 1X5KA 1D09A 4KRGA 1JF5A 1FA9A 2WW8A 4HEJA 3QS2A 5BSWA 3E80A 5JROA 1IT9H 3IAXA 5DD3L 1M1NB 1J2JA 4K9MA 2CF6A 3PA8A 4O4YL 3VXRD 3N43F 4UUAA 3AM1A 1H3VA 5D7KD 1PF7E 2V9QA 1VB9A 3FYUA 1E7WA 3W56A 1JI0A 5FO7A 2HVJB 1PT9A 2OULB 1WFIA 4OB5H 1UP4A 2FXIA 3QW4B 2FPIA 2QT6A 2WJHA 1DJQA 4PJCA 2A57A 2Z09A 5JYBA 4LXTA 3FYEB 3NCHA 1MJ7H 1K3TA 1J24A 2XNAB 3CX6A 3TONA 3IF1B 1YZGA 4KLCA 4PJ7F 3VC1A 1E2JA 2R97A 4RKWA 1F45A 3Q72A 1VG9B 4ELMB 5FFMA 1UCBL 5HHVL 2Q2OA 3ILHA 2FLKA 3CSUA 1HNFA 1RIHH 1YPZF 1CDDA 4Z3OA 2MCFA 3NORA 2MHAA 2Q6IA 2VRWA 1XCTB 2HT1A 2FPWA 9PCYA 2VYFA 4RGND 5AW2B 2NZXA 2JGEA 1YAHA 3FYDA 1QPKA 1E6JL 1TK3A 3RUEA 4CZ2A 4DR5B 1I9JH 2UVFA 4G7VL 1GAXA 1FJ1B 1ZMTA 2QEQA 3GSWB 3LVQE 1MCKA 2PGOA 4D41A 4KMSA 2YICA 5K9KA 4LLQA 3TBFA 1EXNA 5TF1L 2F8IA 4N28A 2YWBA 3QE0A 2YDXA 1JT2A 4YRDA 5BURA 4RS3A 1FXUA 1CJUC 5IMLA 2E4ZA 1M10A 3QH4A 4CBPA 2JPDA 2VPPA 4HB3A 4JJ5B 5DCCA 1JZJA 4LJRA 2F53A 2A9JA 4BE7B 4MZ3A 4HDAA 4J4HA 1YEDB 4Q0MA 1BZOA 3TT1H 3D69B 1D9KD 2H1PL 3EXJA 3HCVA 5E24E 1AGYA 3RVMA 4HRXA 3D3EA 2UVPB 4L9AA 3EGXB 2JJ1A 4Z3TA 4J0DA 4LBZA 1Z2EA 3LG2A 4JROA 4BEJA 1QHOA 3F3YA 2R4UA 1N7IA 1G1YA 2CDFB 4J16A 2FWPA 1YJDC 4WKZB 3D48R 2L69A 3M2PA 5KSAD 3LECA 1E40A 3IEAA 1BEYH 1EVJA 1QAMA 1M5UA 5I5IA 2E76C 2FSEB 4JKWA 3RWGB 2WQ6A 1QIJA 3TM6A 1TAUA 5DNAA 4JLBA 3O4JA 1PSDA 4IRJA 5BUAA 1THGA 3EA0A 1XCTA 1HDIA 1YUKA 4FNRA 4F1JA 3IO3A 5IJVA 1GWNA 1XVVA 3AUVA 3RUDA 5T3YA 3PKZA 3NBUA 3MRCB 1YZNA 4G6ZA 5CO1A 4C4YA 1A7PL 2Q10A 1WHSB 1G19A 5JO5B 2NNAA 4NJ9H 4OYRA 5ANMA 4ESHA 5P8WA 3B5EA 3F2IA 3HXKA 1B90A 5GGSY 5D7LD 5TPWA 1YJ8A 5C0EB 1PG7L 4RDQG 4PJXA 1GHFH 1T5HX 3PQYE 4JBGA 2E6QA 3E3OA 5DMGD 1RQNA 3L5HA 3KDMB 4P2BA 4HAGA 1QPBA 1G3QA 1XGKA 2IK8A 2GM9A 1HS6A 4EY4A 2Q45A 3EPRA 4XPFH 2HLEB 4PSDA 4Y9FA 3CZFA 5G3YA 5IJKA 3L8CA 1NUPA 3PDIA 3VKWA 1QSVA 2P42B 4PJFF 5TD4A 1TCCA 2V7EA 2H57A 1NCUA 3FNQA 5JW4Q 2LLGA 1YL6A 1OAZL 4MINA 1MCOH 2C03A 4S1DD 4W8OA 4PO3X 2YIHA 4RQUA 4N0UB 1FBNA 5JMRA 2ZWYA 5BJTB 1CE8B 2YUZA 4JO3L 5KN5A 4XNQB 2OHHA 3ESOA 2G3XA 2FOLA 3F7MA 1W91A 1SF5A 4AZWA 3RVVC 3I9FA 2XFGB 1UOKA 2GK4A 4YC2B 3FQWB 2IQ9L 1NY6A 4DIUA 3HM2A 4L2IA 1YBVA 4FDMA 2XWXA 5KS2A 1KEUA 4ZK6A 3UMFA 3Q9NA 4YYEA 3FCBA 1DBML 2WTOA 1HLGA 1ITBB 3BSFA 4AIRA 4LPVA 3CVHA 3L9EA 3H54A 4UILH 3BPNC 3C3MA 4OSEA 3NTCL 3ZDDA 3EFBA 5HFAA 4UQIM 2YW2A 3ZVRA 2XDHA 4O2AF 2LQRA 1SBYA 4JFVA 4AG6A 4QD3A 2C9ZA 1V5IA 1F02I 3I32A 4QRUB 1WHTA 4TKUB 3ROTA 2J5BA 4BFEA 4KPYA 3TQCA 4I4WB 3BT2L 4XBEH 1OY1A 4C76A 3ULVD 1RZ7L 3VI4F 4E94A 3KVDD 4DWWA 4MLIA 3IJSA 4KXMA 4BP3A 2WUVA 4K3JL 4BRUA 1OH7A 1LRLA 2J3SA 3QPQC 2COUA 1P1ZA 5DKFA 4L1HA 4YHYC 2I91A 4YUYA 3HGQA 3GMTA 3CN4A 3SJCA 5IT9A 2QR3A 1DVSA 4O5AA 4RUKA 3WDJA 3ALWA 1Z2DA 4ZI2A 4J0KA 3GEGA 1DTWA 2FHSA 1NC1A 3MMPA 5C7LO 2PZ8A 1OE0A 5HYFA 3QQXA 2PCJA 3OZTA 5KQMA 2EERA 1HEHC 5TGZA 3SNKA 1GJRA 2VN3A 4C56D 3AQZA 3SPVA 4X4ME 1AXEA 5KS9E 4UV7L 2BFFA 2WIAA 3MAGA 3IR6A 5DM0A 1T0PA 3KZCA 3O4LD 2EDJA 4HZGA 5KTNA 4BE5A 3AT1A 3RDTD 1YVPA 1GUZA 4NOBA 4UC0A 3IPEA 3KG2A 5GV8A 1G5PA 2JFCA 4QJ3B 2J3LA 1OIXA 5D3KA 5DYYA 3RTEA 3VRJB 5AUMA 3HG1A 5HHOE 2FQDA 1T3ZA 2X28A 1Y6ZA 1HYQA 2B1AL 2MQGA 4WFED 1ESEA 2JKWA 5EIIG 1FLNA 2IGBA 3ZUGA 1KEMH 1SVLA 4PBXA 4UV4H 2OZ4H 2WLNA 1JYNA 2B8JA 4CG3A 1HFUA 2IYVA 4TYQA 3GD1C 4QUAA 1P7WA 1V16A 5AM0A 2G2NA 5AQEA 3PHHA 2VYRE 1RS0A 3FWKA 1IQDA 2VJ0A 3RK4A 3E1ZA 5IM7A 1XF4B 3SCZA 5A7FA 4HWSA 3AI7A 4UUOA 2WFAA 4FFSA 5E1DA 1GN9A 1GRVA 4HDMA 1CF2O 4WJ5B 3UTSA 4JFWA 2Z4RA 3Q7EA 4AROA 3WTSA 1P0MA 5HBBA 2AIRA 3SBXA 1O6TA 3TC9A 1Z6TA 3H5OA 3QFRA 1ILSA 1QAOA 1BCSB 2OQJB 2YDYA 1J4AA 3SKJL 4Q9CA 1AKRA 5JRZA 3E5RA 3UBXI 3FQ2A 3EJSA 1FO0B 3V7YA 4GP4B 4WO0A 1WXFA 1CDYA 4LECA 1WTLA 3ZVKA 1FMTA 4I48B 3DLIA 2YV4A 2OAGA 4RA0C 1X7TA 1JNYA 4Y4FA 4KX7A 4RK7A 2DWDA 1AHIA 5BOSA 2I4LA 3S5LA 3AZPA 2GK0B 5CEZE 2HRGA 4F21A 2X9WA 4AXWB 5CT4A 3FBWA 3R7DA 1L0YA 4BV2A 2FFQA 4WI2A 2C9UA 1JSLA 4FFVC 5E08H 5B3SB 3W8FA 2R6DA 5CCBA 3EXFA 3R3UA 3WIFB 1VI6A 3RLIA 5LGKA 4BFYA 3D05A 4A8JB 4PSKA 2W9DL 3NNDA 4HK0B 5G0VA 3GSOB 5ARBA 1A4JB 5KVDL 3GGPA 3OIDA 3FRPA 1XZGA 1U8PB 2C3WA 3VXUB 1N6KA 2AQPA 1WFTA 5J56B 3I6LD 3ZJTA 1P7QB 2B77A 4ZAXA 3TMKA 4IYKA 1MO5A 3ADBA 3S0PA 4MJ7A 3HN7A 1ZS9A 4OLFA 4ZVTA 1IBDA 2A7BA 1H8LA 3ZV5A 1WVGA 4BFWA 4A7GA 3C0KA 3HFJA 4PSRA 3MV7E 2BHTA 3PITA 4Q9RH 5KOJB 2G4LA 2JLAA 2VHCA 2ZE7A 1Z2NX 1HCYA 1A8HA 2NXNA 3MYYA 1F86A 4HJGB 3RSQA 4G4IA 3AVEA 1B14A 4CWAA 5IJVB 4KDTC 1HXKA 4F20A 1FK8A 2VN5A 3BSZA 1CF4A 3EXG1 2DIEA 5DS8B 2IWRA 4F85A 2EDWA 1H0RA 3K6NA 1XRSB 3VPAA 1DS6A 3GI8H 1FDTA 1R74A 5TF4A 4M7LL 3VG0L 2H2SD 2IHBA 3TEYA 2CWRA 2EQAA 4YHOH 1YB7A 4RYDA 2G40A 3LRTA 1XL6A 3AWFA 2Y05A 1BD2A 4E36A 1CDBA 4E2WA 5AB0A 2A9QA 3EYUL 1ZJYA 3E05A 4XTCS 5K3FA 4B87A 1S7TA 4E5UA 4DA6A 1U31A 4D6YA 3SS9X 1RLJA 1XH1A 1IZKA 4R2HA 3CZAA 2XQ0A 2BHFA 2ICEA 2JKJA 3VXUA 3KS9A 2B1HL 4KXCA 3ZYIA 2NXZC 1G8HA 5IJ9B 1U4NA 5DSTA 3KUCA 4HWZA 3IXTA 1KTVA 1QQ5A 1I1FB 2VDJA 3D7RA 5H94B 3V7NA 5B58C 4NN5C 4QATA 3VPHA 2WYUA 1GOFA 3OPMA 1ZMYA 2WLIB 4YRBA 5KQLA 2PPCA 3CR7A 3ARTA 3ASVA 3T0FA 1NZJA 3B6MA 3MBXL 5E5RB 5KHOC 2AJ3A 4J3OG 5KJCA 4IQHA 3AG3B 4IHOA 5FYKD 1ASPA 4JV5B 5I0WA 3G9ZA 1GG9A 2OP0A 4QLWA 1I9JL 4G7VH 4H3SA 2NV2B 2PUCA 3ALXA 4EBFA 1GEGA 4BN0A 4X9HA 2F8XC 4F5DA 4BMNA 3O21A 5KAQF 3ZTJH 2Q7XA 2JJWA 2DLHA 4KQ6A 5A4DA 3NOXA 1P2VA 1G0YR 4A3SA 1TXGA 3L48A 1SCQA 1A7BA 3UKDA 3C5SB 3S4SB 1L9KA 3RJZA 5EIIA 4K8RL 4PLOB 2C7FA 1UP6A 3Q1SH 3QJXA 1B0ZA 3C08L 4LFBB 1BDYA 1X5IA 3OTTA 5CLYA 2H2PC 2P6UA 4MW2A 3JVUA 4B74A 1JLLB 1OWMA 3IE4A 3LPWA 4UINH 3AL2A 2REBA 3BD6A 4BLQA 3LIZL 4WRRA 3EPJA 2RHRA 1KN2L 3U79A 4LXQA 1WZIA 3D2CA 1NGZB 1P6XA 3GBNL 1QE3A 1O9ZA 1U8HB 3QZMA 1KFJB 1ZLYA 3AF1A 4BX2A 1DBAH 1JPUA 4WO4C 1UOLA 2OMVA 4AGLA 2NNLD 3NEPX 3ESUF 4KUZH 3U36B 1ZC4A 4X42A 3FTYA 2NX5E 1DKRA 5ICXA 1ODKA 4QRRD 5C0BE 5KG9A 5A5GA 4ND2A 3P9KA 1KENL 2DBQA 4YR6B 2O57A 3S5YA 1HXHA 4M7KH 1OZ0A 1MHHA 4FQLL 1CJCA 2NCMA 3AR6A 4FYTA 3IT1A 5I7FA 4EEXA 4YDSA 2AG5A 1BQ5A 1N64H 4I0CC 4BWVA 5FDWA 3KKLA 3DBRA 3PGJA 4HX2A 1JLRA 4CJXA 4EATA 1MRNA 3E9MA 3SVTA 5ID1A 1JV2B 3U49A 2AKRA 3OWXA 4HJSA 1QH8A 2Q7NA 2E6UX 1UB5A 1ORIA 3C60A 4FJZA 3GZ4A 3V9AA 4LXHA 4S05A 2B7CA 3T3PE 2KW5A 1OAJA 2Y0SA 3L5WA 1CIPA 2JFWA 3AF5A 1VIVA 1H5BA 4CSPA 1FNEA 2XSKA 1EP3B 3FWZA 2HQBA 2A86A 3NCBB 1PZ5A 5F2NA 3DIDA 4UTBH 1ZO8A 4CBVA 2BO0A 4NCBA 4PQXA 4PGEA 1YYML 3EYQC 5E1QA 4NNJA 3QM1A 5EMJA 4GKSA 3L6FA 1TLTA 5GGTA 3CFKB 5EJ6A 2VH5H 2ORIA 4QU0A 2RHEA 3ACDA 5JDJA 4D56A 1LDEA 1Y8AA 5MP6L 4KWEA 1RJ9B 2FUG1 2EU8A 1LNSA 4RNCA 5CFPA 4QT5B 3ACBA 1F90H 3RIFK 2WD0A 1CJMA 2JKLA 3BP5B 3GRFA 3L3GA 3DBIA 2EWWA 1KB9K 3BZDA 3SOBH 2ITDA 3CLFH 4YDJA 3A2KA 2WQRA 2H1HA 4Y1RA 1M2OB 5ALTA 1JAIA 5BYJA 2XSZD 4P9HC 2WAAA 4X4XA 1ORVA 5EYPB 3IGUA 5AI4A 2HWYA 2A0LC 3TJPA 4UREA 2OAQ1 5L6MB 3Q3HA 1LBTA 5F72S 3LQ2A 3FAXA 2XZDA 1I8KA 3BD7A 3MCVA 3V8PA 1VFMA 2IHVA 4CAGA 4KB5A 3SFZA 4AQ1C 5I30H 3SDDA 2A3TA 1XZEA 3NO4A 2QDKA 3GG9A 4KJYB 4U1NA 4K3JB 3TZHA 3LGSA 4R0MA 4U3CA 4YRLA 2VITA 4JC0A 4ZYWA 3MMXA 3UOGA 4I6JA 4EQ3A 1QSED 3OT1A 4DIKA 2IU6A 2PX3A 2LVBA 4CMEA 1WVIA 3CDZA 4QQFA 5ITSA 3B7SA 5T1JA 2Z91B 1SHTX 4L9WA 5EG5A 4PGEB 3DVNA 2HPVA 4Q14A 1FIGL 5E99H 2HSZA 4OOFA 1GQQA 3LH2H 2AXFA 5CX4A 3H42B 4JUAA 2ZP1A 3II1A 4QSHA 1GT6A 1P9OA 1ISJA 5DJDA 3KLBA 4N0YL 1NZRA 1TT5B 3ZU3A 1IULA 4EHLA 4QC2A 2OBXA 5TGBB 3BHNA 3HNTL 1JA9A 1JDTA 2YGQA 4CGYA 3C39A 1DL5A 5FECB 4D9NA 4QYSA 1JXDA 3NU1A 1WM1A 1WOYA 3KPPB 2AQKA 3SPIA 1NSNH 3EGIA 3POCA 2DHDA 3TRJA 3BKMH 2CIIA 1CDHA 3H0EA 3IAS1 5IT4A 1OLSB 4A0RA 4FGSA 3ESAA 4QPNA 1PUJA 3CDZB 1YONA 3CLVA 3T3MF 4TUYA 3FSWA 2X5KO 4QG7A 1PDOA 3WDMA 5KC9A 2AC0A 2X4DA 3WRYA 2QFPA 2NTSP 4DTCA 2EEPA 3MWYW 5SWQA 3H9SE 3MJFA 4KTEH 1I0ZA 2Q1SA 3SDDB 3HDHA 1PQ4A 1WLSA 1JFFA 1XTKA 2XRFA 4KREA 2PZLA 2VTFA 2X5PA 5HRCA 1SD1A 3MRVA 2QELA 4YDQA 2W90A 3SC6A 1FTWA 4PTZA 1MY5A 3PENA 1RXSA 1QQAA 4EUKA 4Q4AA 4CUKA 1OB0A 2VCEA 1XF4A 4DW2H 3WGUA 1RULH 4K9RA 1NYRA 4NK4A 2CCVA 3VWKD 5IVKA 1I9GA 4JFQB 1LTQA 2XA3A 5KTOA 2HLAA 3WA7A 1YEJL 4NI6A 4TTVA 3U2QA 3K5PA 1FIUA 2RI6A 1X5AA 5BQ5