3NIFB

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alphaIIB beta3
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 122
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nifB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nifB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nifB03
3F78A 1M1XA 4F1JA 1JV2B 3EH1A 3EOBI 4BJ3A 3FCSB 2VDQB 2NUPB 5KYWB 1QCYA 1IDOA 1AO3A 4C29A 4NEHB 3ZE2B 1JEQA 3IJEA 3OL2A 2VDMB 3TXAA 4IHKA 3NIDB 5E6RA 2ODPA 1CK4A 2ICAA 3E2MA 3VI3B 3EGXA 4O02B 1M2OA 2NUTB 4IXDA 4UM8B 4C2BA 4CNBA 4WK0B 1M10A 2VDRB 1U0NA 4WFQA 1N9ZA 3NIGB 4MMXB 1BHO1 1SHTX 2O7NA 4A0QA 1JEYB 1IJKA 4G1MA 4UM9B 3NVQA 1SQ0A 5E6UB 3GXBA 3K71B 3TW0A 2ADFA 3EG9B 3AL8A 4HQKA 1TYEB 4G1EA 1PCXA 3QA3E 3T3PB 2B2XA 4O3TB 3EFOA 1M2VB 4HQNA 1M1UA 2XWBF 3N2NA 4XW2A 4DMUB 4PN7A 4MMYB 5KYXB 4O3UB 5E6SB 4NENA 1OAKA 1ZOOA 4MMZB 2WW8A 3F74A 2IUEA 4Z7QB 5KYUB 2P26A 4HQOA 1FE8A 1RRKA 3HXOA 3AL9A 2UZYB 1NA5A 1U8CB 1FNSA 3K6SB 3EOAI 3EGDB 1MF7A 3TVYA 3ZDXB 1SHYB 2VDPB 1L5GB 1PD1A 2VDKB 1ATZA 4O02A 2NUTA 5KYYA 1U0OC 2M32A 3IJEB 3OL2B 3TCXB 1YVPA 2VDNB 1UEXC 3M6FA 3BQMB 5BV8A 3V4VB 3Q3GE 1AUQA 4Z7NB 1MQ8B 1T6BY 3EGXB 5LN1A 3HXQA 1N3YA 3K72A 1YUKA 1Q0PA 1QC5A 4F1KA 1SSLA 1JV2A 1JLMA 1M2VA 3AFCA 3FCSA 2NUPA 5KYWA 1LFAA 5HDBB 4MMYA 4IGIA 4UM9D 2XWJI 4JDUA 1MQ9A 2WINI 1XUOA 1PT6A 3AL8B 5HJ2A 5KYUA 1DGQA 2VDLB 3PPYA 2VDOB 4G1EB 1M1XB 3EH2A 2I6SA 1U8CA 3EFOB 3K6SA 1T0PA 3BN3A 3EGDA 2QTVA 3PPVA 2XGGA 3HI6A 4WK4B 1RTKA 3NIFB 4NENB 1JEQB 1MQAA 1ZONA 2X5NA 4WJKB 4FWWA 1YVRA 1L5GA 1RD4A 3VI4B 2ODQA 3ZDZB 3PPXA 3ZE1B 4MMXA 4K3JB 1MJNA 4FX5A 5KYNA 1JEYA 1ZOPA 1QC5B 1IJBA 5E6RB 4WK2B 2I6QA 4HQFA 1BHQ1 3PPWA 5ES4B 1RS0A 5E6UA 3T3MB 3ZDYB 3K71A 3IBSA 2NVOA 3EG9A 3ZQKA 1SHUX 3BQNB 4M76B 4HQLA 1XDGA 1OLZA 4G1MB 5KYXA 3RAGA 4JX0A 5KYYB 2P28A 4C2AA 4CN8A 1PD0A 5HGJA 1AOXA 5E6SA 1V7PC 4MMZA 4Z7OB 3V4PB 1XDDA 2I91A 4CN9A 4GZ8A 2VC2B 1CQPA 1MHPA 3OKYB 3OKWA 1DZIA 3ZE0B 1IDN1 3FCUB 3K72B
chains in the Genus database with same CATH superfamily
5BW7A 5C1BA 2JASA 1S1MA 3CK0H 5ELMA 5C0AB 4LQ4A 3IIJA 2CHWA 3HOGA 1FYXA 4LZZA 2BSTA 3E3MA 1E3DA 1YULA 3W8DA 1YE3A 4LYFA 4MV1A 1NBAA 2FSUA 2OMZA 4UQ3A 3SX2A 1JPFA 5IB1A 3MOQA 2DOKA 4HDIB 4J0IA 4RV4A 3D9QX 4C0KA 3KZVA 2MCG1 6ADHA 2L0DA 3OJDB 2I7SA 2FSIA 2UWEA 2FV8A 4EW6A 2Z8YA 4ZAGA 2UYGA 3TYGH 3WUWB 2VK2A 3DXYA 1Q1NA 3FZNA 4ARZA 1JHLH 2JGKA 1ADWA 4RGBA 3PDHA 2VQ1B 3K1YA 5D1NA 5F9AC 4RVDA 2Q3JA 3NHZA 2ON6A 3ETSA 5DM2A 2VNSA 4X8OA 2C3OA 1ZISA 4NDAA 4QGFA 4ZQCB 5FBKA 1KYTA 4I4NA 1DJYA 3RI5F 1Y4AE 4BBJA 1Z17A 4P23C 4NFYA 3OFKA 4AENB 2QJWA 3NQIA 1TEYA 2ZRQA 4LNUA 1EDQA 3EO0A 1BU5A 2JJSC 2J2ZA 4JG5A 1CDGA 1E4JA 1U7UA 1N6NA 2XCOA 4P5MB 4LCIH 4ZYYA 4OI7A 2JFBA 1ADFA 2ZUCA 1MY7A 3I02B 3BKYH 1S9WB 3ETBF 1MVNA 3GAAA 4MWGA 3NJJA 4Z4CA 3WL9B 4ELDA 3G82C 1SVUA 3WXBA 3DMFA 3FKSA 1NAKL 3CFTA 4ODWB 2PO6C 3FF7A 1X5FA 5HIJA 5D7SL 4AY3A 3ZBTA 1L5RA 2BVTA 4KKCC 1IG0A 4ZT3A 3RRMA 1LO3L 1SMDA 1ZS2A 3RA7H 1VE3A 4Q12A 1MW2A 3D3VB 5F33A 3V0AC 2Z6FA 3V8RA 1EINA 3KKKA 3JTSA 1Z37A 5B3SB 1EV2E 3RB5A 3SBEA 3KYOB 1TZIA 4HG4K 3MJ8A 2HKHH 5GGTH 2R23B 3J27A 5AK0A 3UH0A 4OIAA 4C6TA 3LA8A 2VRQA 2C5SA 3Q8AA 2JIDA 1M42A 1OW0C 3H84A 4A1FA 4TRNA 3G2OA 3HQ4O 4HGKC 4CMMB 2EEDA 5T5FA 2DTML 5DHFA 1U3ZA 2I6FA 2Q45A 4NDMA 4WCYH 4OLWH 3UROR 3QLEA 3WJ7A 4RD2A 4BMOB 5HUJA 5C8XA 1K06A 1XB6A 2Q28A 5I9SA 2YDXA 2X0NA 3GH1A 1JV5B 3DNMA 2R68A 4NQCD 3I6LE 4ETQB 2C57A 1JQDA 2FDCA 1HHJA 2JAQA 2FSSA 2J30A 2RGUA 4UDNA 3U82B 2EKSB 5LB4A 2ZBFA 3WKEA 1GUYA 3M1OA 3COVA 2AYZA 1G5RA 1VYUA 2WAOA 4B9EA 4AG6A 3ZEAA 2OAGA 2DF3A 2IKQA 3FF4A 3NJIA 1Z9LA 2YEZA 1TA0A 3QFHA 1TPXC 5CO1A 1F41A 3NJMA 1IBKB 1WDMA 1OCOB 4GRLA 2VTDA 4TLMB 2XRZA 4LRQA 4LN1A 1IEWA 1QGZA 3VO2A 4UT9L 1TCCA 5FL7A 4KOBA 4V0OA 3HVDA 2ZU0C 1Q7EA 2X70B 3MJDA 3ENZA 3NUZA 4WLFA 5AK3A 2K78A 3FSZA 2NY3B 1JR3D 3NHAA 4FD3A 5JZ9A 2UUBB 1ZLDA 1CFQB 1SOWA 2EC8A 5IT4A 2PE5A 3NYIA 3MUNA 3CDGB 1F3RB 2WGXA 2JAXA 3RLFA 1HNYA 2L7QA 1OX5A 3BHBA 4AZ8B 5E7BA 4FI6A 1FRNA 4QAJA 1X7WA 1TZOA 2H8KA 4I1YA 4MYDA 5KSPA 2PH7A 3SLGA 1E2VA 2BJHA 2PZJA 1GFIA 2WLIB 4UANA 3SSAA 3KYCA 4YBQC 1SC1A 2I87A 5K4AA 1HYHA 4JM2B 3CMOH 3T99A 2GR9A 3UAGA 4JV5B 3A9CA 2YCBA 1T13A 1J7VR 2TRHA 3HJ0A 5J4KA 2YSSA 2FWSA 1I4OA 1B0PA 2NY2C 2P3YA 2AJYH 1KCLA 4JDVB 4BZYA 4ZVTA 5F7YC 2Z7UA 1DBKH 2HXAA 5E95A 1DOZA 3HCOA 3O1HB 2YN4A 4JGNA 4IBOA 4CPDA 4RNRB 2YVKA 4FS0A 4C3OB 4QIHA 1XHHA 3H2QA 4B3IA 4X6BA 1HSOA 1X77A 2R56H 4C2TA 1MWAA 4NJMA 5FOTA 1EGQA 4JREC 1RM4A 4Y2XA 1U21A 5AJUA 1KLFA 3VHQA 4BNWA 3QVAA 3DE7X 2CH8A 1EJ2A 1Y5IA 5FPKA 5CNKA 1HESA 4XM1A 2XE7A 2OMTB 3MOAH 5JSUA 1M9WA 1KWKA 2CB9A 3QZBA 1VYHA 2F4NA 7MHTA 2CR3A 1PNRA 1BVKB 2GM5A 3V6OA 2CDGA 1SLXA 5AVQB 1JNHB 1T5WB 4HH1A 3O6LH 4XSGA 4MS3B 1BX2A 1YKFA 3NCWA 2KW5A 3SS7X 3DV4B 3LHAA 4R98A 5HGDB 2QM8A 3S0PA 3X1XA 4IDBA 1HQ4A 4QATA 3FAWA 4G23A 4HEQA 5KSBA 4XT1C 1K88A 3D6VA 3CMMA 1TDJA 1N6VA 1R9MA 1U8KA 2HRCA 3HNTL 3LKNB 2H5JA 2IU4A 1UQSA 2REQB 1MHHB 5CXSA 4F0JA 5HHPB 4XIJA 4QI3A 4O59O 3EFHA 1Q74A 3MV9B 3OLXA 1KS2A 4QF1B 3FJYA 1PK7A 1A8JH 4YXLH 1JDUA 3IR5A 1L9QA 2X6CA 2H2SD 4N1EA 4PO1A 4FGMA 4JYMA 4F3KA 1QP1A 3H42B 2FSVC 3EVFA 5EEVA 1WDTA 4UT6H 3FU7B 2ZBPA 2NT1A 1VSQA 2BSEA 3PF9A 4BP1A 3HZVA 3AG6A 5CTJA 2P9EA 4TX1A 1HR0B 1S3GA 4KFTA 3F5DA 4A7VA 1TVDA 4XGQA 2BKEA 1RU3A 5AJTA 3STZA 3VI4E 2ZRHA 4AKIA 2PUGA 3MCYA 1F5NA 4GL2A 1KTJA 3CFBA 1WUNT 5DD1H 1I9CA 1NOFA 2NIPA 1UM9B 4R1NA 1JZ5A 1E6OL 3F98A 4CIYA 3SCZA 2LOEA 4FXGA 1SMKA 2YXPX 4LX0A 1SUJA 1K2DA 5DYTA 1XMWA 2Y1XA 3LBIA 2Y06L 1WJ3A 1YYLL 4O2RA 3I34X 4ENED 1GL7A 2YD9A 3EVBA 3PDGA 4U8HA 2Q8PA 1LSJA 3EJZC 3HPRA 3PHQB 3IAHA 3BAFA 5LWYL 5K69A 4G6ML 2MOGA 1XJCA 5AAWA 2NZWA 3VRJA 1YBAA 2PL1A 3FBWA 4YWGH 1FL6A 3L6RA 3WSWA 4KYIB 3NTRA 3GIZH 2OVBA 3U1QA 4PPFA 3OX8B 4B6ZA 3MRBA 1AC6A 3EJWA 2OGTA 1KFJB 3AL8B 1VHQA 1LU9A 5J3HC 5E8PA 2R1YA 4QRRA 1ZIYA 4EI7A 1DQJA 1RNLA 4PWYA 2ANCA 2VA9A 4IKLA 2QS9A 4BS9A 1T0HB 1E18A 3GTVA 3N3AC 2W88A 3SY0B 3UYPB 4JXJA 2BGLA 4M7KL 5P8WA 3SM9A 4PJDF 2FPGB 4FJ1A 4LGVA 4N90E 1LEKA 2JI4A 2H1LA 1XYVA 2I2WA 2HPOA 3BXHA 3H99A 2ZEJA 3FQRB 3HU2A 2CQVA 3FTFA 1ZKAA 3LEXB 1VJCA 5EHQA 2YA1A 5CJOL 1EDZA 1ULTA 5I9IA 4BJ3A 1B3IA 3DMYA 3A2NA 1UOWA 3CVOA 1HZHH 1JHYA 1G8AA 3ODPA 1RJFA 1TK3A 3URKA 2NU7B 3RWIB 4OSUL 5FYJD 3VKFA 2J6BA 1G8GA 3FHCB 2M6SA 1A2QA 1Z0FA 4I18B 4ZXBD 4CMHB 2VXUH 3H8NA 2QNIA 3L9XA 5KTEL 2X1XR 4X7RA 3QCTL 3K8YA 3RF7A 2XA2A 4QRSB 1BFOA 1ADJA 1IIBA 2CMHA 3OJEA 1U6AL 4G6FB 5LYJF 2CFRA 5DCLA 3FCBA 5SWSD 4RFEB 3UTSB 2YAEA 1JIVA 3TKYA 2R85A 1FFYA 2YJTD 1ZQ9A 5TIIA 3M6XA 3G04A 5TK4A 1UPFA 3LN5B 1CTOA 4DV1B 1NGWA 1LJUA 3BN3A 2BM3A 4QELA 4KYTA 4DJJA 1KLGA 1W36D 3O4GA 1LV7A 2G1AA 3KCPB 3TASA 1R3JB 3KEDA 5AW5B 2AXGB 1PZDA 2IHTA 3C1UA 3W5MA 5A2FA 1E1MA 3U39A 3BIXA 2CDEB 1KTLB 4GUQA 2P5EE 3ZKMD 5G53C 5EUOA 3FCYA 1A3QA 3LT5A 4WVFA 4K6OA 3RX5A 4RAQA 1K6EA 4BEBA 1SKUA 5AVXB 4J3OH 1NVDA 4BSVA 2CMGA 2IPOA 3EXHB 3MAGA 2C8NA 4Y1AE 3DIVA 2ZP8A 5A2GA 1URLA 1XD1A 4KZ0A 4CFZA 4GWLA 2GTWB 5J8OA 2IYQA 4CV3A 3LCCA 1ITZA 1FX0B 1WEJL 4GPZA 1U63A 3VXOB 4ZPVB 4FCHA 4V1DB 1FUUA 4PBSA 4DQLA 3G6AA 3NPAA 5IBUB 3B3JA 1N6LA 3MRXA 2NX5B 1OV6A 1KYOK 2VBIA 3PGFL 3N2JA 4F4UA 1TFHA 3A28A 4BXVA 4UTVA 3E4DA 4M9OA 1MCFA 4IV0A 4C08A 4QNMA 2XE6A 4NRYB 2AMUA 4X7CC 1T34A 3CVHB 4HJIA 3HKZA 1NPTO 3TA3A 5JUWA 2GPJA 3D39D 4B4WA 4IWYA 4NHOA 3T0WA 1AJ7L 3HRZC 4WRLA 1FA4A 3DRTA 2Q3BA 2FEEI 4ACPA 2H1WA 1AKRA 5DUBB 2G9UA 4Z49A 1TYCA 4PD4K 2O61B 5DSXA 1RVV1 4P4NA 4J29A 4ABQA 2I32A 4Q3AA 4DBLE 4UQOA 5E99H 4K7FB 1JPVA 4BQNA 1K92A 2ZBEA 3LDBB 3CNLA 1E9PA 5CWSB 1AT1A 3PFBA 4B3BA 4M5YL 2CUIA 4QHLA 5T3ZD 2GXAA 1SLUA 3QRLA 4KZDH 2DLIA 1S9HA 4FG0A 2RK4A 4DRYA 4CF4A 3AERB 1N33B 4HBCL 3R0VA 4H44C 1KHHA 1M6HA 1T1SA 4XIIA 1B0IA 4TVPH 4ZD3L 13PKA 1HG1A 1SEPA 4N3TA 4F2DA 4QA9A 3L7KA 1JA1A 1Z9SB 5KTRA 4OLAA 2A6KA 2BONA 3T5DA 1KOGA 1KXTB 4HTFB 3MNZB 5DO9A 1LE9B 2UYLB 4D0RA 3H05A 2RFXB 4OQEA 2PMEA 2DBLH 5KTKA 4FLMA 5D5QA 1PHPA 4Q16A 1S9VA 3PWSA 4QY8A 2Z8WC 4WTWA 4JI7B 2W07A 1CYXA 2WNWA 4NOBA 4G6AD 1UBRS 2VT7A 3D4OA 1BX1A 3MX0A 4NBRA 4WDIA 1NSTA 4GM0A 2JGDB 1GY2A 1YN7A 1AHWA 2ZONA 3CH8A 3BIAX 4K9MA 2NXCA 4LGSB 2JW5A 2H00A 3DO7B 4UVHA 2KZWA 3QLVC 5GJCA 2QSQA 4UV4H 3GJEA 1YOVA 2FJUB 5DZSA 1JEJA 3HJGA 3C1OA 3KPNB 5ALFA 4HN9A 4CKZA 3WIHH 4X5WA 2WWYA 10MHA 4G5OA 2LVCA 1TJIL 2Q86A 1N6QH 4NEGA 3P19A 4G2NA 5JYMA 3GRBA 3MLPA 1XCQB 4P7JA 2OGSA 3PJSA 1TZHB 1LP9E 2AJ8A 3BYZA 5AI0A 1H3TA 1PKXA 1HSBA 3GLIB 3ZL4L 4CCYB 2Y24A 3UK0A 4CUZA 4IVPA 4WK2B 1IIKA 3UMSA 2G88A 1CLVA 2JBAB 1C8PA 3PNQA 4WY2A 5C0BB 1FFTB 1V8OA 3F3SA 4Q4AB 1P0FA 5F9JA 43C9B 2H2WA 5JTUA 5D7KE 2YYYA 1ZYUA 2HYDA 2J8UE 4JC5A 2Z8YM 3HAEA 5IV2A 3O2DA 1H8NA 4DMCA 1YS2X 5FEUA 2CO7A 4KI5C 3C3MA 3RW9A 3UT6A 2IOHA 5TDHA 4NZOA 2H2DA 2O8DA 4B2PA 5HHXL 1A9QA 1R6TA 5CLLA 4KVAA 5I9QC 4KKVA 1I3RB 3IV9A 4NHUA 1N32B 1YZYA 4G9FD 1BXKA 4EHIA 2A2ZA 3KGSA 1EM8B 4EQ6A 2X5OA 1NNUA 1PTZA 3ZNOA 2VXVH 1FP7A 4RSVA 3T2QA 2XUFA 5JW4M 4NB7A 1PZFA 4H7EA 4X99A 4KBPA 1OM3L 1FVEB 4P3YA 1IZJA 3RVUD 3UPAA 3U4EB 3A9RA 4JO3L 2NXZB 5ACZA 4K23H 2CJWB 2F6AA 3U5TA 2ITCA 1XMSA 3BHIA 2TAAA 4S1DD 5ESAB 3RGVD 1G7HA 1IHYA 2F74A 5A3SA 16PKA 5EZIH 2Y0BA 3OLVA 2N4IA 2OR9H 2I27N 1XIWD 3HZYB 2DHRA 4M29A 3LDHA 3GMMB 1H5BC 3NZHL 3H9SA 2LUOA 3VXNA 1J0YA 2VBCA 2R1VB 5HTOA 4J1SA 43CAA 3OBAA 2PD6A 3ADKA 4D8UA 3FLEA 3QE4A 3U0PB 4GOLD 3VXPA 2YV1A 3NBMA 1NJSA 2A88A 2GPZA 2GHQA 3U7FB 5JOFB 1XGZA 3E1F1 5F2NA 2IOYA 5DTIA 2RD2A 3DX8A 4KXZI 4OGYL 2TSBA 3DDOA 3PP4H 4NYJR 2HGZA 1WIUA 4MZDA 3FB8B 4BD4A 5BMFL 3UPDA 5BMVA 3ZCTA 3ESXA 2ZRDA 4A6PA 4B50A 1ISSA 2WTBA 3WFIA 2D3WA 1CCZA 4BO3A 1WZLA 1JLSA 1HZLA 3RNOA 1TJXA 2FW6A 3L5OA 4IDAA 4DGVH 2OMXB 1ARZA 4UNSA 5EOVA 1K8DA 3FYSA 1OGTA 1HUQA 2ESVE 2OD2A 5IDXA 2WE8A 1PG7H 5EC1B 3AO0B 5HTKA 5C0AD 3I6GB 1FRGH 1LRJA 1SNRA 1ZRSA 3VAAA 2Q6IA 1LD3A 2AXFA 3RRZA 1DVFB 4W93A 1PL7A 3LAFA 5E4YA 2X4NB 3ZLVA 3RTQB 5LAXA 1Z5HA 3NT4A 1UWFA 4QREA 1FLNA 5I8WA 4P38A 2HJLB 1WOYA 1AFVH 3DETD 1XGRA 2EYSA 1NZRA 4Z7VE 5GP1A 1QO3A 2WXKA 3A23A 1ZOLA 2IBZX 4JG9A 3D7KA 5K3SA 2NNLD 3TBBA 3CWZA 1EAMA 5CXXA 3EO1B 1TXKA 3PHAA 3AW5A 2FUEA 3MZ0A 3HMXL 1BE6A 1AXSA 2ZS9A 3ZYCA 2R6DA 1JLRA 1Z74A 2VQ4A 1BGXL 4CG0A 1FZJA 1DYZA 2J31A 3VR2D 1N8NA 3P26A 3UHPA 1K6MA 2AJDA 3EVTA 1TK9A 4B2IA 3U4CA 1NGQH 4KPYA 2NG1A 3TPUA 1GGBH 5IZ4A 1J12A 2W9DH 4WCFB 4HC1A 2YL2A 5CA1F 2ZXUA 3MUY1 1EWKA 3MUFA 1XRNA 2DECA 3T7EA 3PNSA 3TOCA 3DBVO 1U8HB 3DPBA 1RRKA 1IL1B 4KFRA 2PSSA 4Y6LA 2BLLA 2PLNA 4AL8H 2QJDA 3QC5X 2QRQA 2GN2A 3INUH 3ZGIA 4KKZA 1DIOB 2BIFA 2J3LA 3C2SA 2Z5LA 5K0EA 4MI6A 5DHYB 2B8WA 3QQDA 2CLEB 3ZLUA 4HD9A 1TLMA 1T83A 3D3VD 1GGYA 1F4YH 2VL7A 4KP7A 4QXUL 4K94C 4W70A 3KV3O 2GN4A 2BKXA 5KOIA 4DNQA 2WBJA 3OMWA 2FZKA 1VGEL 5EWLB 3ESPA 1ET8A 1ZMTA 4GP4B 3CHRA 4DGYL 3KYMB 4OGAC 1NKVA 5CXPA 3SDYL 4CVWA 5J1SC 2Q3CA 2DH3A 4M99A 1IZKA 5F4ZA 25C8H 4MW2A 1BA3A 3K4AA 1AGEB 3B48A 5A2LH 3B8HA 4QM6A 1FJ1B 5E2UH 2YPVH 5D7IB 1KXQE 4H1TA 1ODLA 4HUVA 4TKVB 4J7AA 5JAZA 5KNBD 3OMNB 2Z2KA 1RZQA 1X5AA 4DNOA 1RJYB 1XT6A 3LT2A 4OV5A 3T6QC 3FRIA 3RX7A 4KQMA 3ZY4A 2X6QA 1I7SB 3FI9A 2XU9A 4AIOA 1M2JA 2O54A 2QNBA 1ZHBA 2BDNL 3FPAA 3NUKA 1USGA 4LZWA 3EOAI 5JS8A 3SGKC 2PYFB 5GGXA 1P61B 3KPVA 4TTAA 1G0NA 1AKPA 2IUSA 4FJYA 2IYNA 4G5XA 4IOKA 1N2GA 1IARB 4XIGS 2FF7A 3TJRA 1UPAA 3OX2A 4AF7A 2PYEA 4IU2B 3MACH 3WDKA 1PD6A 2VK1A 3HZKA 2IV9A 1A9BA 5D5MB 1TKWB 1RXWA 2FSEB 5MEQA 2WMPA 2Z5FA 3WNLA 5AKYA 5TQ2L 3VZPA 1E9RA 2QLFA 2GJJA 4IICA 3F47A 4HJJL 5FFLA 3C14C 2XRAH 4YCBA 3KBPA 3PUCA 1KGCD 1E6CA 3VJKA 3T3MB 4HISA 3HJBA 2ZYAA 4UMSA 4P2RB 5C5CA 1BF8A 5HVGB 4OQDA 3RTDA 2R25B 3VZRA 3REFA 4RESB 4G63A 4NO0A 8ATCA 1G4AE 3KVRA 1D2GA 4FHJA 4JM2D 2E7MA 3MGBA 5KYWB 5ALNA 1VP9A 3EWIA 1VGQA 2MU1A 4MWTA 4C56A 3D50A 5C0DB 3A1UA 3VWKB 4X6UA 1OX6A 3UWOA 3N7UA 3RC9A 4RZ2A 3P02A 3GMPB 1RD6A 5E1BA 4HUUB 1X39A 4W1RA 2OM6A 4U6VH 3HHSB 2MQ0A 3V4LA 1DTUA 5K59F 3ARXA 3N44F 1F1GA 2RAVA 2IADB 1ADBA 3I04A 2YPKA 1O9VA 4WAFA 3QYFA 1PL8A 4HS4A 1NNEA 3JV4A 3LYAA 4BGUA 5JPMB 2EP7A 3FAXA 3JD3A 3JQFA 2IIBA 3UGKA 2OBLA 4JGMA 5C07B 1QAMA 5JJLA 3Q6NA 2WIIA 4P2QA 1OIOA 1CBUA 3EGWA 3L9YA 4MQ5A 1Q90A 2E3JA 1E7MA 3R06A 1SB8A 1H3FA 1L7BA 1UEXC 4EL0A 4KJWC 3RQIA 4FLFA 3QU4A 3BSHA 2GB4A 1JXGA 3C9NA 3QVOA 4S1QL 2O2YA 2Y1GA 4RGNC 2PGNA 5FOUA 4HMPA 3INYA 2W2NA 4EN3A 2ZYTX 3MRLB 3DE1X 3QIUC 2E18A 4G5HA 3GXTA 4OIFA 3DXAE 3VU9A 2X0JA 4TNVF 4Y4FA 4NOJA 1LMIA 4TM7A 2P2YA 3BUYA 5FA3B 1SMAA 3O75A 1QLEH 1JG9A 3K0HA 2O8CB 3RX8A 1RPZA 4MCYB 5IMMA 1KCWA 1GKYA 5LXTA 3SQLA 4G8IB 2X15A 3GRUA 4BJ1A 1BAPA 1WMBA 1MO6A 3R3VA 4FG4A 4HWTA 4HFNA 3ZGXA 4HS8L 5F52A 2IKSA 1Q9KB 2B3RA 4XQEA 3K4ZA 1JL3A 3MLSL 1KELL 3QOYA 3FQWA 3KR3H 3FLBA 4O0LA 4KQFA 2UZAA 1XZQA 1SHXA 3U0TA 2P8LA 1I3MA 1BIHA 2EDNA 4JWTA 4HIXL 1GPYA 2HIHA 2DWDA 3GHEH 4CKBB 1SJEA 5IFJB 4KHXH 4M1GH 3G6KA 3LLCA 1AH2A 1CQYA 3ASYA 3H87A 4NU6A 3ULVD 5D8JL 2XYQA 2DMGA 4FQLL 1TJHL 1DQMH 1K8IB 4E3ZA 3O3EB 2Q3ZA 2IBSA 4XD7D 1BXRB 3OFNA 5JXEA 2B4CH 2BOBA 1U31A 4NMHA 5IEHA 3U7EB 2RHRA 2YKLH 5I24A 1V47A 1IB6A 3BHMA 4B4OA 3VH8G 1Y0BA 3CLEH 4RA0C 1O97D 1JUFB 1ASQA 1NBYB 1M71A 4I9WD 5KVEE 1N6RA 3D4BA 5HWSA 1XZDA 2FOLA 2PCFA 1HSAA 3LEYL 5D4HA 5DBIA 4NNPL 3WG9A 1VBMA 5DJDA 2R96A 3DDNA 3KDPA 1UXSA 1SZCA 5M95B 4YO7A 5G40A 2F7PA 1MVUB 2FPSA 1DE4B 3DYVA 5JJBA 1F58L 2X2EA 4ZI3A 4GBED 3I4LA 1J9GA 2EIMB 1O5OA 4Y2LA 1W6RA 3SXUA 5LMNB 4ANUA 4N8CL 5T3YA 2GKGA 3BH8B 4F85A 1FVFA 1F3JB 5FHRA 4R4JA 1IGML 2XWEA 2BCEA 2ZCZA 1CO1A 4NM8L 4RJJA 3E5MA 1P4BL 4CM4A 3A58B 1OARH 3A1FA 3B83A 1S4MA 5JRJA 2JNWA 3I2FA 4QRPB 3L4SO 1YQ9A 1KGWA 4KRPB 1I8IA 1WLSA 2ADMA 1BFDA 4QO7A 2Y3IA 3OBBA 3KPSE 3N0PB 3QRWA 4KQEA 3BD4A 1CURA 2B6HA 3P9KA 3F7VB 4N0MA 4RTNA 4XYLA 4ERXA 4WEMB 3HS0A 4ZFFB 3QNYB 3OZ9L 1QTNA 5HKOA 1E2GA 4L4JA 5G4KA 4HXBL 3ZVKA 2FEPA 1YS4A 1WPQA 3CGGA 2IGLA 3MPCA 3IKVA 1YY9D 5IBLC 4NBUA 5K3FB 2A9MH 2XF2A 5CZVL 2GASA 4L4VE 4IDGA 1C12B 3MN8A 3LWDA 3PGLA 1Y3DE 2W8ZA 4MV6A 4Z8XA 3SKXA 2OCFD 3CSUA 2MSCB 1EO5A 5ELIA 2RHCA 1SYVB 3UFXA 2QQKL 4RH1A 3TQFA 3IT2A 5I1AA 4EB3A 1EE1A 2B08A 3IWVA 3QZOA 1NP7A 3CPHA 3UQYS 5BWBA 4PJHF 2XZQH 2OYKA 4FT4A 1OYYA 5H3CA 4GRWF 3DHUA 1YWGO 4OHUA 2JJYA 4Z1OA 3VKWA 1CDDA 1EHYA 3PPXA 4K2HA 3VAZA 3O6MH 3O9WA 4G3XA 3RWCA 5FOJA 1K98A 1Z7JA 4DIOA 4KREA 1ZSDA 1ZL2A 2UZXB 4IGBC 4EBQL 1KIUA 1B16A 5LP6F 4FCAA 1QTSA 4TKZA 4DCPA 2XAUA 4IJ6A 2GW5A 4P4UA 4NMWA 3UTSD 2RCYA 1GGJA 3NMUF 1TM3E 2OA0A 5ALOA 3WGYA 1I5RA 5HQ3A 4ZWNA 1Q9WA 1TLFA 2KQNA 4RPGA 4YDZA 1PNDA 2EADA 3T6ZA 5CBKA 3IDYB 3PX7A 3CVUA 4Q6KA 2APBA 2HMVA 3JSXA 1TTRA 2WPGA 2ZOSA 2I85A 4DSYA 1CJCA 1H3GA 1KSJA 2GITA 5FV4A 5GS0C 2AEIT 3CF6R 4U4AA 2XA3A 3B1ZA 3IE4A 4XVJL 4RVFA 3HJCA 2QVIA 1LVHA 1W0VB 3ZE9A 1MLDA 3FOLA 1IAVA 3ZH2A 3W2FA 4K5NA 2K1MA 1W88B 2GXSA 5IVXA 4MASA 3FMGH 4G5RA 3H19A 3Q11A 5J2UA 2JEOA 1KT2B 3GAFA 2V5TA 4NYMQ 3IQWA 1QFYA 3PWJB 2P4HX 1DUZB 3F05A 3QW9A 3N6XA 4LBEA 4POOA 1SCJA 1J8RA 3VZCA 4YXKH 3NVKI 3O3DB 1ZCBA 4CEHA 3DEJA 1M72A 1QA9A 1R47A 2VZVA 4YK7A 4V1DD 3DP9A 4PZ0A 3P0VH 4IIZA 2X58A 3RSQA 3ED5A 5E6IB 4JPVL 1W4CA 1ISGA 4YV1A 3RDTD 3GDFA 5LDDC 3O45B 1L7NA 4EG1A 1TAHA 3KWWA 4HG2A 4JGIA 5JW4R 5EZYA 4PLCA 3BHNA 2GJZA 2IPTH 1WMSA 4I48B 2IH4A 1YU9A 4IV5A 1XWVA 1CYEA 4INPA 5CH8A 1SCDA 1JSRA 3AM1A 1HL5A 1L4GA 5E7IA 2PQ0A 3OZUA 5K45A 1XWFA 5D7JD 1G2IA 1FFWA 1HI6B 3ETNA 3OTIA 4LRWA 1HKFA 4BLQA 4HWKA 2ECOA 3UC5A 1T2VA 5E1QA 1KSHA 5BQXA 5DHTA 1NYLA 4KV5F 3GXBA 3WENA 1REQB 2C2OA 2NAPA 2ZX7A 2C7QA 1KDJA 1RYZA 3H5AA 1V5JA 4XDZA 2Q7YB 2DJ4A 1JH8A 2DI7A 4KX5A 2IS4A 5LQDA 2WWRA 3FM9A 4XO9A 2O30A 1C41A 2Q8QA 4L4TD 4ZFZB 5DK0A 3GRRA 2O2SA 2CCKA 2CRYA 4YJFB 2AFIE 2P9TA 2BGGA 1ZRNA 3BIWA 4H15A 5EBGA 3PNWA 2XWTA 4OXXA 3P7MA 2HQ1A 2OZKA 4UTBA 4LZLA 4BVKA 3PDIA 3BXPA 4KE7A 4L85A 3WIFB 1QBML 1KGDA 3N2KA 4KROB 3JSAA 2FLBT 2XV2A 2R8SL 4ESEA 3Q3IA 1VHTA 1B0RA 4OUUB 4P7BA 5JAOA 2XQYA 1NCWL 5E8OB 1T2UA 4JBYA 1NVVQ 2J5LB 2PVCA 1ZA2A 3UTZA 4P5TC 3HA5A 1U0GA 2YASA 2OLKA 5HTSA 3MV7E 4K6GA 2XHEA 1B0ZA 4LJRA 2QUZA 3EFDL 3L7EB 3GR6A 5E9DB 2XXMB 5J59A 1EVUA 2E4ZA 3DSRA 1TJ5A 1L1QA 1B74A 3V7WA 4XKJA 1ZD2P 4MYHA 1NP6A 4BKLB 2VDOH 3CRNA 1HA3A 4JANB 3Q9PA 4ZEXA 1HXMB 2JG3A 5DS1A 2Y22A 3C6LB 1HX7A 1NJFA 2DIAA 5AAPA 4BO8A 3AXSA 3NYQA 4FYIA 4LPCA 1B3BA 3OX3A 3LOPA 1GTFA 5HHOB 1BGVA 1N3NB 5C0BD 2JCWA 3RZCC 3H2BA 3P9LA 2YOHA 3TT3H 1QPZA 1HHGA 5CGZA 2NY7L 2X88A 3DBRA 1IM9B 2YY7A 3GPCA 5D86A 2UVFA 1O6SA 2SICE 5BYAA 4PSVA 3HMKA 3FTSA 5B3LA 5K0FA 1NCAH 4JFSA 4M86A 1M7BA 2H32A 4PCSA 4WHYG 4C7JA 2UY6A 3SGDI 4U0RC 3QIWC 1NR5A 3L7MA 1GJWA 1A1VA 4D44A 1ZCZA 5AI4A 2PZMA 3UK1A 4NCHA 1MRDH 4MVJM 2ZDHA 4JPWH 5EPMB 3VRIB 5A06A 4LXFA 2AFHE 3OA0A 4PHGA 3ARYA 5HYJD 4HD5A 2WYZA 3P4MA 4FI3F 4BNVA 4CNIA 2A7XA 2NXZD 3S8FB 4K7PL 3WLWC 1U8LA 4UPVA 1XTVA 2ED7A 3QPAA 3B82A 3BPOB 2KERA 1CDOA 4HGMA 4H17A 4OM8A 4R6UA 3VX4A 4OFBA 2FHSA 3UH1A 3NOQA 2EZ0C 4P3XA 3WK8A 4OFYA 4QYOB 1CR2A 5F7DB 1IOZA 2V7NB 1TTAA 4PS1A 5J2TF 5KX5B 4PREA 5E08H 4OLVH 3AESB 4JYBA 1KPGA 1XNHA 3FBTA 3ZV5A 4Q4JB 1T1WB 2ZUUA 1SCQA 5TF1H 4OI1A 1WWAX 3A1WA 3SJVD 4FJ0A 5DMIH 1WPCA 3O0LA 3V55A 4CC4A 1BROA 2GK0B 4HDAA 4IU3A 1OWNA 4LARL 3G0BA 4R7TA 3RFZB 1A6AB 1A3LH 1PLCA 2PHZA 1YDWA 5IB4B 2VEOA 2JFFA 1LYQA 1L5FA 4WT7A 3DMMA 3AXLA 4XN9A 4RK5A 2PMFA 4XI5D 5I5IA 3ARGB 3R41A 4TMWA 2VF2A 3IBOA 3V5NA 4YUZA 3PGVA 4RVNA 1K5HA 1IFHH 2V9RA 2WIMA 2I5YH 1N7MH 2X0FA 3DV6A 1ZS8B 3EXAA 2F3QA 3AONB 1SB9A 2J8ZA 1W1WA 4EJSC 4RGOH 5KSAB 4F7TA 3T71A 3EPJA 3BRSA 5GJTL 3LC7O 2ZQKA 4LPTA 1A9PA 4R5HA 2IBTA 1F3LA 2Y7QB 1RP1A 2F8MA 1DVFD 5HGAB 1YC5A 2PV7A 4ZU1X 1VPEA 1RJWA 4POZC 4DM4A 2DYSB 1YUHA 3RTQD 3B8SA 3BAKA 4M02A 4JP3A 2Z04A 1W581 4BZZA 5FYLD 4EIUA 4L8WB 4HZGA 2PS9A 2FR4A 1DBJH 3V2IA 4L5YA 1X4XA 5L9AA 2EIJB 3SXPA 5D7BA 2P48B 5BRPA 5EO1B 5JLZA 3VUEA 4LLQA 4AVIA 3MOBH 2ADIA 5DZLA 2QSJA 3GSUB 5E5RB 1S7XB 3VAEA 3BREA 2ZTHA 5CGBA 4PSUA 2BKLA 1KR2A 3TQOA 3LZQA 2D2IA 3RGWS 2F53A 3B4NA 2MMCA 2Q0QA 2UVPB 4YNBA 5J4LA 4JYCA 1ZHLB 1B0WA 3CVCA 3CXDH 4JUSA 1N4DA 1QQTA 3QX8A 2N01B 3QJSB 3RYHA 2EINB 3WNZA 4FONA 3MOSA 1KBOA 5KOJA 4RKQA 3G5VA 1DO5A 2NTSP 3OZAA 4HAUA 2LFGA 1HE3A 4KMSA 4UYPA 4HLUA 4E4RA 1OX4B 4MV5A 2QADB 4E46A 4GO9A 4P2BA 4CEIA 1Z29A 2DQDH 2WAHA 4OJFL 2BP0A 3FUKA 1T6BX 2PRSA 3C6SB 1W94A 4PRYA 1YRKA 2X2UA 1YTUA 2RAMA 4WI0A 4ZFOB 1G38A 3KSMA 3PRKE 5C35A 1N64L 3W5UA 3OE5A 4XD2A 3F49S 3VBEA 4JFOB 3N40F 4FBMA 3A6FA 3IEKA 4PJCF 3I3EA 1X5IA 2WT4A 3KBHE 4NQEB 1XPOA 2XCRB 5CB4F 5I8OH 4R1MA 4NULA 1P1ZA 1KJVA 1JG1A 3CX6A 5HKLA 3LXXA 1NMBH 4A73A 2V1UA 3MB8A 1NATA 5EU6A 2PUEA 4O4YH 1GT6A 4G5AA 1UBEA 1BDJA 5KUTA 4OJDH 5DQDL 2WB4A 1PZ5B 3FIUA 4HFRA 3Q3GB 3V52H 2WYHA 2PNFA 1FO0H 4MOWA 2JFNA 4ND8A 3ESYA 5D2NC 3MXWL 1KMCA 1ITCA 3J2PA 1VLJA 3E53A 5EJIA 5IJAA 5JWRA 2F9MA 5ESQB 5ETJA 4PP1D 1WV0A 4YR6A 4JLMA 4AQZA 3ECSA 2P26A 2J1KA 1Q0QA 4W9FC 5EP3A 3QYMA 4K94L 1J05B 2GPAA 4GOJA 4DP5X 3PCTA 5HCNA 3EE6A 1YDFA 4JZNA 3D6MA 5K8LA 5D9SB 4DT2A 3I9OA 4RCAA 1H6DA 3FQXB 2JKNA 1U8IB 1NICA 5JW5B 3JYCA 4E13A 5KJEA 2XBUA 1V35A 3VXSA 3QYAA 1NIJA 3K9BA 1CR4A 4KWUA 2PZBA 4OHBA 1GZHB 2VQFB 3JWIA 1A7RL 1A47A 4BNZA 4IIGA 5IDWA 3A11A 3HE7C 1WP9A 3DTVA 1B9ZA 4HIIB 3QG1A 2AI1A 3OFJA 2EDWA 1AR2A 3OPXA 3JUYA 2EIHA 1MIMH 4P0PB 4DPAX 1OZ0A 1UFRA 5DJ8B 1V37A 1HY3A 3WJ2A 1DSWA 3C7KA 4GBXA 5BURA 1JJIA 5T3XH 2HFKA 3A3KA 3MV8D 4RY0A 3LXBA 3UC0L 4JFYB 3FPBA 1XTSA 1RJGA 3S35H 1TU4A 4K6FA 2BC9A 3DVAA 3L2OB 4JXXA 1NWHA 4IJ3C 1Z2PX 3BUSA 3EYAA 3GF8A 1MLCA 1JDSA 3D6TB 5EXPA 3RAJA 1PWXA 4KLRA 2PYIA 4XARA 3M6VA 3O1LA 4B33A 4UEOA 3L7IA 3QH3A 3GJFA 4F2FA 2PGIA 2FEDC 3SX4A 3IE2A 4PSRA 2LGNA 4GKNB 3REWA 4RVGA 2Z2YA 2QQLL 2ZYWX 4LIPD 5I0YA 1ZSHA 4B6EA 1NM5C 4P2RD 5AKGA 4BFEA 5J6GB 2HK8A 2OO5A 4JDZA 4JLSA 3GBDA 3QCUH 1NL3A 1V2HE 5IG7B 3HUJA 1P84J 1DAMA 1B15A 3GUCA 3MILA 2M2IA 1E7QA 1FFRA 2UYYA 4I50B 4A8JC 1BZQK 5FLEX 3EODA 2I60H 2J3JA 5I16B 4B2YA 5FPQA 3GDCA 1GTNA 3LLSA 4QTFA 2AK3A 1AO7B 3VWKD 4GQPH 1GGEA 3QU5A 2IV8A 1DJLA 3ESMA 1IC1A 1YBVA 3O6KL 4U2YA 1RWQA 1CVSC 3ITDA 1T03L 4NAUA 3QXXA 4ZCIA 4HP5A 2QVKA 3L3KA 3OXRA 3AGVA 1E1KA 1HXKA 4J0HA 2OB1A 3Q88A 2DAVA 3T2OA 1E2WA 2OMKA 2OHVA 4PLNC 3QE3A 5C07D 1OKEA 2MR5A 3JQPA 3IP5A 2CDFA 4XTRC 5L8KB 1ZQ1A 2Z6QA 1OP4A 1EHIA 1NOIA 5D6OA 3K0CA 3D69B 3M6IA 1Z0NA 5FKAA 2LR4A 1P8AA 2E5EA 2CD0A 4NZTH 3B3QA 3IE0A 1CMOA 1JOIA 3R5KA 2HLFD 4Q9QL 3JVGC 4G1CA 3WZMA 1JMKC 2R2HA 5BQ7A 4OYYA 3ZMNA 4D74A 1QVOA 3TBFA 5BXFA 5K59E 1CE6A 3QPQD 2ZR8A 3IOCA 2B61A 3S4SA 1KIQA 1CU1A 3DKKA 3HBMA 3NB0A 3SZRA 1T20B 4WJLA 5FBLB 4JLDA 3SYPA 1L3WA 4XVOA 1TUBB 1W5EA 2QVLA 4H77A 1OZTG 4U0KA 5L53A 3NCFB 3G2JA 5DF1A 5JNSA 2VNHA 1KUMA 4RWYH 4QQNA 2PX8A 3PD7A 4RKYA 3ROXA 4B97A 3EBHA 5AM4A 1ZD6A 4WSGA 3FRPA 1F6AA 5I73C 4H0CA 5JR1H 2C5HA 3KNZA 3NIDE 3L16A 2QN8A 3OMAB 1MQ8B 3E9UA 4WW0A 1JBKA 3X12A 4J4PA 4NC1C 1A7NL 3BKCL 4WNJA 4JRYB 1VMIA 1RMQA 3DYBA 4E1AA 3IDUA 2QMQA 2AR0A 3P2DA 3WLKX 1MX3A 1SWWA 1T0PA 1U5BA 4NJ9L 4LRNL 5GRXG 3N2GA 3T4UA 4OZHF 3KD4A 4D41A 4V0QA 3RUGF 3I42A 1R5BA 1BVOA 4PG6A 1DJNA 5DVMA 2GAAA 1XCLA 4Q6BA 5CVEA 3OCYA 1BVUA 4OQTL 5A7BA 4D8WA 1WEKA 5CGTA 4CW1B 4B9AA 1XF3B 1ADQA 4PX2A 4MNQB 4PTYA 2UX7A 5EF0A 2PW1B 2ZG3A 2I6SA 2XBTA 3M34A 2TMYA 2QSVA 2OXGA 1BWQA 5TF0A 3ARBB 1HOXA 4KWIA 4MR9B 2H4WA 2X7HA 4RO0A 3WZLA 3GHYA 2OSWA 1AO0A 3BBLA 1GPAA 4LBVA 2QRGA 3WSQL 2QJRA 4JRXE 4QTTB 1Q0RA 4Y2DB 3DF7A 4X62B 2H7VA 1K6QL 4PJ7F 3EYFA 2UZ1A 4KQKA 1OPGH 3HSKA 3SDSA 1BNCA 2D7PA 3LV8A 3VSEA 3RFRA 2C0QA 1QLEB 2J6EL 4AY4A 3AVOA 4B53A 1G16A 4QRPD 5GIRB 3JALA 4CAGA 4ER3A 1N2CE 5AKHA 1XG5A 1A1NB 1M6WA 1OAJA 3W82A 1N3IA 4M49A 1T6ZA 1CXIA 3LD8C 1EVZA 1ZKMA 4K15A 4A38A 1DEDA 5E2WL 3BZ5A 1Z15A 2MMGA 4LLUA 2JA1A 1SUDA 2QL9A 1D2HA 3HKEB 1CF9A 3F01A 2BFMA 1YVRA 3IJSB 1E5UI 2HCZX 4EMSA 2RGXA 1AS3A 2XZAL 2Q0SA 3F6YA 3ZTJG 2GT9B 4X0KB 2XWBA 3MBKA 2FTKE 2JBWA 3FUCA 5A1TA 3RC3A 4MVCA 3O6FC 1RI2A 2R84A 3M0EA 3DOHA 2JGEA 4KO8A 5THKA 2C9VA 1FVDA 2WD0A 2XXJA 4EPRA 3QEQE 2P2ZA 4MEBA 3QI9B 4I9NA 1FFDA 1OYOA 4O4LB 3HL0A 1F9EA 5EN2B 2EH8H 1CC3A 1JYFA 3IA7A 3EYUH 2BSSB 4F4HA 1CJYA 1RUKH 1X7SA 1WO8A 3L1FA 5KVDH 3PWZA 5DJ6B 4NJOA 1FJXA 1SOUA 3NW9A 3H13A 3PF2A 3BDXA 1KV3A 4H20H 1GYRA 3BAZA 2IUFA 1CUDA 3INTA 3AHFA 2ZUTA 1JGDB 2XTJB 1A88A 3A67L 5CN3A 3WLNA 2AZMA 4M6OH 1EZVX 1UVQA 4TV9B 3AZQA 4MA3B 4WNIA 4GG6A 3OAUL 1WUTA 3V5KA 4KLNA 3CG4A 1UA7A 3BVDB 3GIVA 4L3WA 2C96A 4WTXA 3OU6A 4JT8A 4WXEA 4D0DB 3UJIH 3NANA 4OXRA 2YWBA 2YBEA 4ECEA 4M43H 4IHJF 1OB1A 1GSMA 4UTCA 5IJ9B 3B13B 1ECBA 4ZDHA 1F56A 2JLUA 2EE6A 3VDBA 4PJHE 4DP8X 4U5QA 3SR0A 3ABGA 4X9IA 5BOJA 2CGRH 4JKOA 3WTWA 3L9EA 3DHNA 1C4OA 4GINA 3CURA 2XJKA 3KETA 2AG5A 1X9UA 3LZNA 1NGYB 1CY2A 1KFCB 5AQ0A 1VE5A 4NQCA 4GKZB 1U4NA 4AS1A 1MDTA 4L8BA 2ZCVA 2YBGA 3GXOA 2Y6TE 2ICWB 1PEWA 5ITFB 1PUIA 1H22A 1G7IB 4NQZA 5GS0L 1FHNA 4ZMLA 2D0PB 5EMKA 4X80L 3BGSA 2B8OT 2JQAA 2GILA 2OJZH 3T4AC 1TO1E 1UWLA 2ITEA 3SQOH 4C6SA 4OJNA 3H1GA 32C2B 1RPNA 5BR1A 5HI4C 4XNYL 5E6ID 2H6UA 4QARA 3R19A 1FIEA 4QTIH 1C1HA 4EY7A 4ODTL 3IT8D 2ZB2A 2A77L 2CXUA 4KFUA 3TSZA 4W1TA 1KTCA 4KXXA 4P3NA 3QA3E 3MGCA 4H08A 4BVFA 1IPHA 5L7XH 2XOKA 2H0QA 2FMXA 5CEEA 2VDML 2PS0A 4X8LA 4V2IA 3TBYA 1NQOA 5DLPA 1GSHA 3LQ1A 4RZQA 1P4HA 4ESKA 4MQFA 3O0RL 1IXZA 3UTOA 3WY2A 4XJSA 4IUYA 5DUMH 1EHKB 3RVTD 5FWRA 4IIDA 2XNAA 1JZDC 4N2DA 4LSQL 5EWMA 1K2VN 5EU7E 5DW3A 1N6IA 3MRDA 2E7ZA 3A4NA 5JMOC 4B4KA 1PJ9A 3RASA 8CGTA 5JQGA 3ZO0A 2DQ6A 3ELAT 2Y0DA 1IMOA 1C5CH 5C92A 1RTKA 4PJEA 1PTJC 2YHUA 5EO9B 4QXQA 1Y63A 4NJEA 2RB8A 3QXVA 1GMIA 2C5GA 5HFAA 2M6RA 1R8YA 4BZ2H 2CK0L 4TMPA 3R3ZA 2FN7A 3BDYL 4AVYA 1I1HA 5SX5K 3VYOA 1KO5A 1WXIA 3OV6A 1ZRMA 4GQ9H 1OPXA 2WAXA 3Q2KA 2F55A 2WLHA 3K72B 3WGTA 2JLWA 2Z2ZA 4PP2B 5TE6H 1GGFA 4KROD 4J3OD 3CFCL 2HLDD 5JVDA 5DR5L 1NQAO 521PA 1ZM7A 4KV5E 5AVWB 4W9IC 1RIVL 3DBXB 2VNIA 4XVSL 1RAEA 4FABH 3RFXA 1JFFB 4NBSA 3IAAA 4JQVC 5B3JF 3DCYA 3TW8B 2J6IA 2ZCJA 3B9DA 4D9QE 2ECKA 3OBIA 1ND5A 2MSWA 1DX4A 5DHRA 5CCXA 2HU5A 1FQJA 2VVTA 4LBWA 3BZ4A 3OF6A 1FB5A 1PDOA 4AV0A 1X0VA 5A4MS 4Z1MD 5E9DD 4MGKR 2H6EA 2R6JA 1NUGA 3TB4A 1G7QA 3DX7B 4BYGA 1NVBA 3Q72A 5LLIC 2JKLA 2A30A 2OAEA 3C6LD 1XGQA 5T1MA 4EOWL 3O31A 2FQDA 3QE2A 5F9HA 4G8EB 2W4QA 3BZUA 1YEJL 1FSPA 5HHOD 4AMVA 2PPVA 1QRRA 1DQQB 1JGVL 3PR1A 5T1DL 1GQFA 4U3SB 4HS6A 3JAWA 3CSBA 1ORRA 4TQEL 1ST3A 4II2A 3JQEA 3W2DH 4N28A 3RO7A 1XF4B 1IM9D 2ZRGA 5EU5B 2Q0HA 4P35A 2WBWB 3UBXB 1GGMA 2H6OA 1JBEA 3E05A 3OGCA 3Q3JB 1FORL 2QWXA 3AS0A 2CVZA 1VLQA 4CL2A 4PJGF 2Z9TA 4TVPD 3I3DA 1RVDA 1P7ZA 3H0EA 2MCAA 5C0JA 1WX1A 5CR9A 4OYHA 5EYPA 2WUCH 3QIBC 4NEHB 4XP6L 3CPEA 3QEOA 2EFYA 4HUWB 3KZ1E 1X80A 2XB2A 3MV01 1YR3A 1I53A 3QEGH 1A5ZA 4PJBA 1OGPA 4YDJA 4C87A 4ZNCD 1RQNA 2FPPA 4U4IA 5F7BA 2WD7A 4BQCA 3L4BC 4E30A 3NCYP 3HI4A 1RHJA 1CTNA 4I2XE 3GLFB 4YGYA 4TOIA 1D6MA 1MFBL 3VMPA 2AWOA 2GSWA 1W96A 1E9OB 4F7WA 2XVZA 4KH1A 2D3NA 2H1IA 5BRNA 1XRRA 1KFAH 4XUCA 5DJ2B 5F72S 4W6QA 2EERA 1C2YA 1AGDB 4IVQA 2X8BA 2XQGA 5AVOA 2WWWA 1BQHA 4Q6IA 3G9ZA 3LVQE 5KYUA 2VDOB 1M1XB 4HEPA 3DTXB 2Y07H 1KEEA 4NE7A 1I4DD 4LQ1A 4NENB 5L3SA 1X14A 4HI0E 4M6NL 1L0XA 1TU0A 4XMLL 4EPWA 4RMTA 1G43A 1MJUH 2EHDA 1ZO8A 5CJ8A 2VWEC 3HBAA 4O4JA 3T95A 1UH2A 3VYSB 2V9QA 4ZJPA 4FC3E 4KO5A 2XVLA 4LMQI 2WXIA 4IO0A 3FCUB 2LW7A 1UXMA 4EPSA 3PT5A 3LOWA 4FXKC 4OJEH 4PB0H 3GFSA 5MENE 4YMGA 4RGQA 4QRTA 5KZCB 4PSDA 1W34A 3K2EA 2VERA 3OKDA 1U2EA 5CBEB 3LF1A 3ARGD 1H6UA 7TAAA 3V7FA 4NDNE 5DS8B 3C6ZA 2XB8A 4XB3A 5CEZE 3MNVB 3LEVL 3R5FA 1JILA 2GYVA 5AW8B 2X9VA 4TSRA 4JAMB 5SV3A 3KUCA 1W35A 3I9V1 5KSAD 4LVNA 4AGNA 3ANNA 5J12C 3FRHA 4BJ6A 3QDGD 4IYKA 3RC2A 1Z18A 2QRZA 4NKOB 4WGGA 1EK6A 2YQ2A 1NAMH 4F5CE 4RTMA 5YASA 1KTVA 4I6EA 3DDGA 3EUFA 1LCIA 1F90L 1ZFNA 3ROPA 3W1VA 1OP3H 4DO6A 5IJKC 4HKTA 1ULSA 5BV0A 1SEQL 3V4SA 3U7YH 5IVNA 2LD4A 5IKCB 4FWBA 3OAYH 1XGPA 1HEUA 3BC9A 1J0IA 4NO5A 2G17A 3FOEC 1SO8A 3K6OA 4NI3A 5HYSA 3EEQA 4ZAZA 3TCTA 1YIOA 2ZJZA 1WV7T 2AQSA 1W9HA 2GT1A 3GFVA 3DYPA 2DQKA 2OFWA 1AXTL 2QX9A 4F15B 3QCVH 4E5VA 1GC1C 3HKCA 5CN2A 3VOTA 2VO8A 4E0BA 4KRFA 2HLAA 2I5PO 4I55F 1CICD 4P4RA 2Q5QA 1J1UA 3JU3A 1KP2A 4V0RA 5SWZA 1KVSA 4EY5A 3KPQA 4JFFA 3NTCH 3ESUF 3RU8L 2VCOA 5L9DH 1BLNB 2QADD 5BN4A 2PTTB 1J5CA 1U02A 1RLMA 3SPCA 1QUNB 1S7UA 5AW7A 1EVLA 3GC3A 3NOOA 3KV1A 4FFWD 1ZLWK 4Q37A 1SBQA 1LLQA 2CMKA 2NR6A 2X1PA 3A1SA 4H88H 4PLFA 1LS6A 3FUWA 3GINA 1Y98A 2ZYUX 4FFBB 2X0VA 1W8OA 2IGFL 3AZUA 4NQED 4GRMA 5K9JL 2KS0A 4UAOB 4YS4A 1E9QA 3KLMX 2G08A 4QXRA 2RCSL 4RMHA 4NZYA 2J7PD 5INDB 1DC5A 3HDGA 1S2MA 4ZG1A 4OPMA 1JK8B 5IFAL 1BCSB 5H9VA 2A9BA 2DETA 1UCBH 3GBMH 5HKKD 3QQ9C 3OIFA 1MVLA 2VXCA 4PC1A 1JX6A 4FFTA 2X2FA 3SPXA 1XQ9A 3GPSA 2J6WA 2QN9A 1SA0A 5I1CH 2EQAA 3G0CA 3NM6B 2Y92A 3D39A 1Q3TA 1MJ8H 5I8EA 5CAYB 4HOYA 5C37A 4L8SC 1J2RA 2FX7H 3Q3VA 4ZVSA 2VTFA 3PVZA 5EVJA 5B1AB 1GRRA 3I61A 4HZ1A 4PJCE 3KJIA 4GSDH 3JV5A 4UHJA 1QYXA 3SEAA 2R7KA 4RUKA 1MT3A 3PG5A 4GR4A 5ELLA 3GSWB 3QPXH 4XFDA 2ZAYA 3LDAA 3E6HA 1H6EA 3IPCA 4MI9A 1NL0H 1ZMYA 4DK5A 1MCHA 1LK2A 2G7MC 3BWBA 5EL0A 2FWPA 3TA4D 3OJ0A 4YX2H 3H9QA 4Y8DC 4LSVH 3NOXA 2HYMA 1VB3A 1CTMA 1H3NA 4KC0A 3WISA 5GJBA 4BCZA 3QUZB 2PR4H 4UQLA 2VABB 1C8KA 4F2MA 2WKPA 4PANA 2IQ9H 1N2JA 3ECCA 3FHOA 4FQ1L 2OMUA 5ERWB 2O7NA 4NE9A 4FHZA 2OMYA 4OMUA 2LIPA 1DAPA 4PGBB 2JHPA 3AVUA 3KJQA 2AQNA 3AGPA 2EE0A 5BCAA 3S2CA 2KSQA 3AVYA 1CE8A 3CX7A 1NDMB 5ENZA 2BM8A 3PZRA 5FBHA 4AULA 4L0CA 3VTMA 1XMVA 3I5UA 4K9SA 1TCAA 2C2HA 2CD9A 1MXDA 1FAIL 4M4RA 4DKEL 4PRNB 1GA1A 4XDGA 3T5MA 1ZDMA 4YHKH 2EEBA 5AWFC 3ZGOA 1V1RB 1TW3A 1NNSA 3JYQA 1AACA 5DRZB 1OXMA 4ZV7A 4F37K 4DIEA 3RYCB 1Z0MA 2FBJH 1M34B 2GD6A 5D2LF 2WF9A 1F2TA 4H9GA 5HPMB 1EGJH 1R37A 3HEIB 3E22B 3AX6A 3W8FA 3RGHA 3ATBA 1U58A 3ZR6A 1O0CA 4PZDA 4A7UA 4Z9AA 4WXYB 1FO0B 2BWQA 4KMLB 1QFZA 3NEJA 3OKNA 2GVDC 4M03A 1IY1A 1TVBA 4W5NA 1PX0A 3B8EA 4C2AA 2K0RA 2Q5LA 3QDHA 5JHDD 1E6LA 3KPLB 2Y9MB 3ICQB 1AO7D 3THWB 1Z38A 1WRFA 4PG2C 4ER0A 2F3PA 5I8CA 1RYDA 2GFBA 4OAPA 4I3SL 1ZU5A 1FPTL 1E28B 3FJ1A 5JQHC 1WZ1L 1QV6A 2OOSA 1AD2A 4O2AF 4JVOA 4QULA 1Z5NA 4PJFA 4LF7B 3W9UA 2WSLA 2CLFB 4IKNA 5LKAA 2QPAA 1DAGA 4BNFA 1TT6A 3FH7A 3DHMA 2AG0A 1B93A 3TQCA 4KKLD 1I8MB 3T3PB 4KKNA 1IEHA 3GA0A 3MR9B 1OWRM 4MDEA 4ZHQF 2GEBA 3WGZA 5G0WA 3DJRA 4IG4A 3MCG1 4XHQA 1L5GB 1XP8A 4ZALA 1DJHA 1FDOA 3HR4A 4RX4D 3ANSA 4PJIB 1CL7L 3ZW9A 3DDFA 2BMFA 4FG6C 4F80A 3LY9A 4OB8A 2NDGA 1DEHA 4PCVA 2NQ3A 1DRJA 3BF7A 4P22A 4C4UA 3FL7A 2CIKA 2X4UA 2QTHA 1SKYE 4XHJC 4R0NA 3P2BA 1I3CA 1I1FA 4ISVA 5F3WB 1T2AA 1NW5A 2SEBA 3O2VL 2Y99A 3PQ4A 5AOIA 3BXNA 3ZQKA 1QAWA 1XIWA 5IUKC 3M1YA 1C3LA 4ZMSA 5BVGB 1WBZA 4U33A 5L7WA 4CQMB 3IFSA 3U6RB 3E27A 2K4WA 3GSQB 4IRZH 4KY1L 1EIZA 3WN5B 3R7QA 4Z3HA 4ZEVA 2F7IA 2AXNA 2ZWPA 4I9XA 4EPTA 3A4DA 1HS6A 3D43A 5A3JA 1X5ZA 4GUPB 2W59A 5I74C 4TTVA 4OF4A 3JZMA 2OBGA 1A97A 3S88H 3MJSA 3CX5J 1T0MA 4G1EA 4MCZA 4JJ5B 1R5VB 3CQ9A 4EHFA 2G9HB 3EHDA 1IFGA 4TVKA 4MNQD 2KKQA 4ZMQA 2OK7A 3COYA 4B4UA 3BCSA 3M4ZA 2O0JA 5C7XH 3ARBD 2BOVA 5C1IA 1DBSA 3CUKA 2UXGA 2VT0A 1CNMA 4Z4EA 5I7WA 4MVBD 5EQFA 3KVQA 1E7VA 5C0AA 3SKNA 4EAEA 2DERA 1OQXA 4I8DA 3D2BA 1JT9A 3BKMH 4Y2DD 4AE1A 4C0LA 4QTXA 3C85A 2QRVA 1DQLL 4QBGB 1INDL 4UT7H 5G4OA 1E7YA 4MD5A 5KVFE 4LOUC 2V4MA 1O8CA 5CLZA 1KL7A 2ROQA 5GV8A 4D97A 2C2ZA 2PX4A 4H27A 1NC2B 4EHAA 1PD0A 2Q9OA 5FUCE 3WUWA 1OHHD 2YS7A 2QPDB 4ZCRA 4EYQA 3MTXA 4I1RA 3HLAA 3THSA 1Z82A 2YWFA 1XXDC 1J5DA 5F1YA 4JCOA 1IT9L 3PABB 3JAMA 2PBZA 2HX7A 1MRCL 2RD0A 4YQZA 4Y5VC 3P2TA 3FDIA 3HPLA 4M48H 2PUQT 4C78A 4JLBA 3VR2A 4X6CF 4TOYH 1UANA 4PJ7E 4B34A 1TJGH 4QHUB 4IOJA 2C1PA 3VJ6B 2JCBA 5BSGA 3UMRA 4AUMA 5HHQB 1H3PL 3PIDA 3TVMB 2BNRB 2Q1SA 1ENPA 3UO1L 3JWJA 1DKUA 2JD0A 5KJRL 3AF6A 1YR2A 1O0BA 1RHRA 1W4RA 4RTPA 5CJQH 3H8WA 3QI9D 2J3SA 1CVRA 1QIEA 5IF3A 3M6FA 4H7PA 3L8MA 3U37A 5JH7B 3I02A 4NIKB 3ARFA 2E1PA 2B20A 3TH3T 3WJLC 4F8LA 3K3PA 4X7MA 1AQNA 1U0JA 1Y5LA 4D8XA 4YAFA 1JR4A 2J20A 5HX7A 3PXBA 1YB7A 3EBLA 4ORGB 1IC5L 4BWTA 3I6YA 3D1MC 3IJ7A 5EDXA 1XZHA 1HAWA 4JQZA 1OTYA 5CA0F 2XTJD 3THML 1EXNA 3D3VA 1QHOA 2GMWA 3F73A 2BFWA 4N5UA 4FYQA 4AYEC 5IAEA 2IOFA 1GEGA 1MB0A 4ISBA 2BOCB 5IEBA 2WSBA 4X60A 3TJHC 4OGWA 1J7KA 1GAWA 4QLRA 3OJMB 1KC5H 2AE2A 3GXNA 4W8HA 1KENL 4XJXA 1FWXA 1FCJA 4KXFB 4N9WA 2VJOA 1I4TD 5JHLH 3R6WA 1UT6A 1MFEH 1XLTA 4J1TA 3ZJUA 2YIJA 5T1KB 2F2TA 2QGBA 3R40A 3KXLA 4MW0A 3JR3A 1D6NA 3HMQA 1N5OX 1J9EA 1HIMH 4LJKA 5KCMA 4ND7A 1X0XA 4ETQA 3QQXA 4IRJB 2PWEA 1DC4A 2EKSA 1IAQA 1OTXA 2NSLA 2F67A 1KPVB 4M7ZB 3NIFE 3QKTA 5EXDA 4EG6A 4M62L 3ZUGA 2DLHA 2IX9A 4R97B 5KS2A 1OD7A 3AT9A 4I0PD 3FMVA 1EWVA 4UMEA 4QUDA 3FU5A 4UM9A 5HKBA 1TNNA 1PZ3A 1NXPA 4Y6RA 3CR7A 4XC1H 1Q5PA 5AVSB 2VKWA 1DSYA 4HDNB 3H2WA 1PSZA 3PNBA 2W43A 3D5OF 3OR6B 5HDQL 5DFTA 3LG2A 2X70A 3EMKA 3IIMA 5MFZA 4WUKL 3FQUB 3G7SA 1GTMA 4YP9A 5DPMA 5TFSL 1QRDA 4B80A 2G71A 3RSHA 1YZGA 1J1OL 4ZX4A 4MDJB 4W9HC 4R16A 1MUJB 1AKEA 4O4IB 2MWCA 3V8QA 5BNIA 1GIAA 2CMRL 4L8YA 2ZAMA 3BD8A 2WIBA 4URVR 4R0LB 1SXGA 2VCEA 1D5BA 1YNTA 4DA7A 5GZND 4X2UA 1E8ZA 2P4QA 1TAUA 2WLIA 1SK9A 1LV8A 3TLXA 1RWXA 4Q02A 4ZV9A 1E6JL 5DC9B 2ENWA 5I45A 5HDRA 2IEYA 2CHXA 2ADYA 5I6KA 4JDVA 1LVEA 3MSPA 2GD0A 4KMMA 1U1GA 4A63A 5DRXB 1CEXA 4PBTA 4ARBA 3QHTC 4NERA 3S3PA 3CSYA 1KEVA 3NDBB 1VJRA 3I2GA 3C2AH 2J5QA 5EA2A 1HQKA 2YJ4A 5HM6A 3EGVA 4ODUB 4G70B 3ZKXB 2C97A 1LL1A 2VXOA 3F3HA 3VYPA 1F0NA 5LN1A 4KO3S 3CEAA 2IWFA 2AK1H 3GI8H 1DDOA 5F5XA 2FA9A 4JY7A 1BEXA 2G0KA 3EUDA 4J16C 3KBEA 3D64A 2AV1A 2J3KA 1EDEA 3DBHB 3VH1A 4D6PA 4I3RL 5ABZA 4OGKA 3GLRA 2DEYX 2QLVB 2WU0A 1Y4UA 4KVCH 3EQ6A 1YDPA 4NU5A 3VXUE 4OT1L 5DVPA 2QM0A 1SXJE 5IMLA 1QFWH 5ANRB 1Q77A 5C3TA 1PDKB 3BQNB 3DRQB 5AMXA 4DPKA 2CCGA 2J9YB 1UD5A 4X7DC 2Y1WA 3WTCA 1RXUA 1N5AB 1RZIB 4LXTA 1I0ZA 1Y37A 2QYOA 5AVQA 1JNHA 4OXKA 4YCLA 4MS3A 5SZKB 2MNUA 2H2FA 5HGDA 1U0LA 3GKWL 5DZJA 2W92A 2M83A 2Z58A 2CNOA 3B6JA 2PKCA 3WKMH 2GB2A 4XNDA 1UADA 2CUAA 3Q8EA 1H9VA 2JMRA 5B3JE 4BE6A 5EFOA 3DWIA 4BFYA 4K5MA 4DTCA 2V58A 4NZPA 1VCHA 3C6YA 4IGEA 1XTQA 3NJ4A 1CP3A 3M6UA 3VKHA 2Y0SA 2XWCA 1MHHA 1JPSL 4G7VH 2YMTA 2KHAA 3GUFA 4QF1A 2IEGA 1ZVVA 3IJYB 2GAFA 3FO9B 5HVNA 3R3UA 5EKDA 2QVFB 2VXQL 5KTMA 2BGTA 4MUFA 4XD7A 3TL6A 3ZOAA 1YT5A 3O3BA 4REMA 3CMCO 3A3OA 1V8DA 2YFHA 2DM2A 2W70A 4CQNA 5AG9A 2B92A 1IQRA 4ZUVA 2EDAA 3UJ9A 4L3FA 3SVTA 1U30A 4P04A 2R1WA 5BQPA 2CMFA 1I6LA 1Z12A 2WSKA 1BQ3A 3D85B 3CDYA 4BV2A 3NRQA 4BFGA 1RI1A 3V5HA 4KK8D 5A4KA 4Y2VA 3EOYG 2FPLA 4M0LA 3AM8C 2WTXA 2XT6A 2QV4A 1EJFA 4PJGE 2OD9A 1EJ8A 3SE4A 2EBFX 3PWUB 5CX1A 4DQOH 5AT1A 1DOAA 2Y2TA 2X2JA 2YRWA 3B1WA 4RQAA 3W34A 1QV7A 2ZJSH 3IEUA 4EI6A 3PHQA 2P2DA 4ZQBA 3WL8A 2Z57A 1ETZB 3PPSA 4UTPA 1KI9A 5BOSB 1C1EL 2BRRH 1JUDA 2HSZA 3MRJB 5AICA 4XWOD 3RY6C 5TMEA 2WU4A 1EO8L 3AL8A 4PJ9C 2XMBA 3MKKA 5GSRB 3L7NA 3ZDWA 2FGJA 1W5FA 3SBOA 1PVVA 4M7LT 4FCCA 4BSWB 1Q9OB 1BAFL 4Q3EA 2GZ1A 4TVSA 4M1DH 2JKVA 1AY1H 2YHIB 5BUGA 4ICWA 4M98A 2J0EA 1FBTA 2O19A 3DLCA 3ND9A 4NC2B 5KZCD 1ML4A 2CG9X 1EDBA 5JJCA 3DR5A 3FQRA 2HUNA 4U3XA 3MJTA 1N78A 3H6KA 3LEXA 4TNWF 3G6JF 2WAAA 1G4RA 5I76B 2Z2IA 3KKMA 4EQZA 2C9QA 1AMUA 2IYWA 1TUPA 3LQ2A 3QO1B 4Y4HB 1W1UA 4PZZA 1GGCH 4NX0A 4LYDA 4ODSL 1NKOA 2GDZA 2RKWA 2BCKA 1RXLA 1VFMA 2VISB 4HYQA 1YB4A 4L3AA 2NU7A 3ZDZB 3IDMB 3ZE1B 5B4MC 4FLQA 1XMQB 3RWIA 4DFDA 4HPXB 2FE4A 4GSKA 1JL8A 3NACH 2VLKE 3CLSD 5ADHA 3PHLA 1MJFA 1ERNA 1KB9J 3E9ZA 3HCDA 4I18A 1SCUB 2X86A 5DD3L 3SBDA 4O3FA 1TF7A 3ZS8A 1T4MA 5CYPA 3VFOA 3RS5A 4JFPB 4QRSA 1DQIA 2YZ8A 3RKRA 5CD1A 2ATKB 3X14B 2H3XC 4ZMVA 5GADl 4RFEA 3UTSA 5J5CA 1JIJA 4OMCA 4KXVA 4R68A 5CZXC 1W8NA 3PR3A 2FN4A 4WU7B 2J32A 5CDUA 3RY5A 4HJSA 3BMVA 3LN5A 4JBWA 2GSIB 5U1PA 1U3UA 4OBWA 5K1JA 1HTBA 4MV0A 2Q2LA 2XNKA 4B7ZA 2NY3D 4AUJA 3KCPA 1N2ZA 1RHHB 5F7EH 5AW5A 2AXGA 3LQRA 4AMGA 4Q1EA 3IXAA 1S2LA 1G9EA 1E5CA 1NUDA 3QJVB 4ZS7L 4NPAA 3E2IA 4F57H 2DRIA 1GC1L 2NVUB 3STBA 2OXHB 4AQ8A 2J3HA 4ZRGA 2YJ5A 4XVRA 3TLGA 4YBLC 4LXYA 1U28A 2QSZA 3K2MC 5J5VA 1AVTA 1BM7A 3L3DA 1NOKA 2RK6A 1PX8A 5MEOA 2QTNA 2H2PC 1M54A 4LGMA 2D1FA 5CLGA 1TGYA 4DHLA 1VBNA 2GTWA 1T7ZA 4FWWA 2PMBA 2OMWA 1HYEA 3VC7A 2AA3A 3TBTB 2WB7A 3UYOD 1SEBB 1JDVA 5ECDA 1U91B 3VXOA 4ZPVA 1N5MA 4ICIA 3MXTA 4V1DA 1KK3A 2CW5A 2EDCA 4JFZH 1J99A 5LC1A 5DRWA 2RGCA 4X50A 3RDTA 1AXGA 3VD7A 3UJCA 2JB5L 3QJHB 4ZUTA 1N2HA 1FP6A 1NC1A 5B12A 4UNIA 2DWQA 4EBBA 1NAMB 1RACA 2QM3A 3CVHA 4BE7B 4NQVB 4ID3A 3TQTA 2NM0A 4TLKA 1ULUA 3OM0A 5PNTA 1GIGL 4LNVA 4MA8H 4E41E 1Z5ZA 3STHA 4NM4L 1GFZA 5HEKA 5D7JA 1H0DA 1G3UA 5DNWA 4GRDA 1C3OA 3L4VA 3K32A 5GZ1A 2H1LM 1IBLB 1T5IA 3S8MA 1MZVA 3VD3A 1M2VB 1MH1A 1NLYA 1W7AA 1CKEA 3Q06A 1HYSD 5KEIA 1O6ZA 4K7FA 2YJ6A 3VXRE 4KIGA 3OQOA 3MRKB 5CN1A 5CWSA 1W8EA 3I4CA 3QLUC 3DSFH 2YLKA 4AVKA 4OCWL 1YEFH 2OP1A 5K0SA 1QS0A 2F1AA 3TOZA 4YX9A 5H81A 2GI7A 3AR4A 1Q72L 1RZ8B 1UJNA 3QZWB 4L4TA 4D4LA 3QUZD 4Y2OA 4D0BB 1E2ZA 4CTMA 1G3RA 5CH3A 3AUVA 1TVHB 2JIMA 1E2FA 3SDDC 4HTFA 3MNZA 3GFTA 2C3HA 4Z2AA 1PV1A 3ZR4B 4O58H 2UYLA 5AW1A 3UAOA 4JJ6A 4HAVA 4O08A 2APFA 3T65B 5B57C 4IGFA 1MX9A 1WB5A 1FNAA 2HWZL 1W4LA 5L7YA 2CLRB 1F6BA 2EKDA 2XDAA 2TMGA 2P9QA 3AC0A 2O6DA 2VDJA 2O6LA 4DLXA 1NW7A 3DAPA 3GBLA 4DUGD 2JGDA 4PIMA 1DJIA 4MW1A 4FLHA 3I2CL 4CYMA 5D51S 3M8OH 4EY6A 3MV9D 1INEH 2YBRA 3OD1A 1BA2A 2DF8A 3GMQB 3TZVA 1T7XA 4UIMB 4JC4A 5CINL 1HDGO 2W90A 3C5CA 1D09A 2KL6A 2YK1L 3ENVA 5KQRA 4PO9A 3D48R 4UEJA 2XV6B 1GS8A 3ERXA 1Z4MA 1XCQA 5CP8A 2FTAA 3EPRA 4GI5A 1TZHA 1NCCH 1R0SA 1OY3B 5JA9A 1WBBA 4K8RH 2ZWSA 2PSEA 3GLIA 4CCYA 2WP8J 4D4GA 4PINA 2J0VA 5I15H 2H4YA 5EJ5A 4W9ZA 5HRAA 4FMDB 1FC0A 4XCYB 1HEZA 2BY2A 5C0BA 3DLQR 3EZ6A 2W71A 2AQ2A 4Q4AA 4D4IA 1B4DA 1KMHB 4MVJG 5D2LE 3CHXA 1RBZA 1QRNE 1OMOA 1JD9A 3CVBA 4B3GA 2VXTH 1BPVA 2GK6A 1O6CA 4WEBH 3OUTA 2O26U 3U31A 5SZIA 4CSSA 2IIPA 2PS1A 2QLBA 3DAFA 4Z4HA 5EOQL 4L3EA 3ZSTA 3T4XA 3T94A 2I6TA 1JN0A 5DP1A 2EJWA 2P43B 5IAKA 3G17A 1I3RA 3Q8LA 3S5LB 1RS0A 5A7EA 2D03L 4QOIA 2XLLA 4BKTC 5HVHB 3KZXA 5K9OB 3C48A 4OZGF 1G4MA 2YMQA 2C7BA 1ZN2A 4MRMB 3I4FA 4C05A 3T0EE 4LRYA 4D45A 4K5LA 5HYJA 1LNZA 1AYOA 4ONHA 3ZBQA 1YJDH 4Q1BA 3U4EA 4X9FA 4IW3B 2FSHA 5AJYA 3Q5TA 1SOAA 3HG1B 3BD9A 2WYUA 5ESAA 4P86A 1U8ZA 3NGMA 3ZV7A 2D1YA 2O7RA 4W4TA 4P32A 1MJ7L 3GMMA 3K0YA 2I22A 3OC0A 2C4VA 1JGLH 4PPGA 2LCIA 3K8ZA 4CQMD 1E9AA 3AQ4A 3BXGA 4MUYA 3TPZA 1PCSA 1WB9A 2R1VA 3EQ8A 4I88A 2YXWA 3U0PA 1E3SA 3EYVB 1LGVA 4A55A 2AZAA 4LSZA 1H0KA 1A76A 4PJDE 2K5UA 1A4JB 1QSFB 3SJVA 3L3OA 4KE6A 4JFAA 2BSAA 2Q7XA 1UUSA 1QDUA 1TKBA 4G6FD 5JC8A 3K20A 1R50A 1F42A 4UNPA 1ECLA 2IPLA 3RX9A 2O8VA 4QHKJ 1WZKA 5HGBB 2RHOA 4M6WA 5CJJA 1J2UA 3MLXH 3ROTA 4GO6B 3LP5A 4R9UC 4Z7WB 4W1PA 5AW3A 5GIOE 3RRBA 3K2UH 2PGLA 1S8OA 4P5DA 1RZ3A 2JH8A 3CZAA 1R4AA 2Q3DA 5AVRB 1O89A 4R2GC 3OWXA 5GONF 2ITFA 4KB5A 4ZUUB 1CIDA 1P6UA 3MRQB 3UY4A 3EDKA 3V33A 1ZEMA 2DWEB 1V8PA 1RQ7A 3FPLA 5EC1A 3H3JA 3J81k 1VDMA 3KPOB 5COAA 3I6GA 2ID5A 3UXFA 2NN3C 3X1KA 1J86A 1U3TA 1DVFA 2BHUA 5CLJA 4GQBA 4BDVB 2X4NA 4RS4A 5KVGL 4WFFD 3RTQA 1Q3KA 1V16B 3IVGA 1QR2A 3QELA 2D9CA 2W81C 4YVFA 4RVOA 1KOJA 1TMOA 1Z62A 3SSNA 4H8UA 4QOKA 4HVBA 1G5IA 1EVTC 1CJMA 5F5NA 5JYBA 3NUQA 3G5AA 1NC2D 4JDTH 1GKIA 3DVGB 5B4VA 4R51A 1HNZB 4XPHL 3EO1A 3ZY5A 2YR3A 1U2SA 3TLCA 4CCWA 4E5NA 3DDCA 3LFUA 3L2MA 5I1DB 4NZNA 2JSFA 2NX5D 1EHLL 2DDQH 4UBDD 1DAIA 4GO1A 4IH4A 4V33A 1H1LB 1ETHA 3OE1A 2PIDA 3MJRA 3R8XA 4KGVA 3U9UB 2HF7A 4R9VA 1E3JA 2CXXA 3IOMA 3HZHA 4Q1DA 4KXQA 4EMTA 1J1XH 4JSYA 2R4RH 1YJ5A 4A2DA 3WHKA 1UASA 3TVMD 2BNRD 3EVCA 2XRYA 1JQLB 3SKJL 2EIBA 1XL1A 1VA4A 5BSHA 1KQFA 3KQHA 1Q17A 3F84A 2OFOA 1EUDB 3NHPA 2BEWB 4WCFA 4OU3A 1RIHL 2D0GA 4AJ4A 3NFSH 1WCBB 4HLZH 3DMRA 2H41A 3FN0L 1G8KA 2HMSA 3QV2A 3QEAZ 3F04A 3AB0C 4YHLL 4XX1E 5BS0B 3S2SA 1P9LA 3QUKA 5TRTA 2ZUWA 2ID8A 4C6HA 3W2GA 3G2LA 4HWBA 4LEOB 2R0LL 1F11B 1L1EA 3P0RA 5DMHA 3TOPA 1WTAA 2NTFA 3SSGA 4N48A 3EW3B 5IBTH 4WJ5B 3IV7A 5ID0B 2G7ZA 2PKEA 3RGBA 1KERA 4XASA 5BNWA 3WYNA 4NQUA 5EWLA 4C6RA 4JEMA 1DBQA 1PIFA 1NASA 1UMDB 4OLXH 4AEHH 1NBWB 3FO0L 4FXTA 4QRBA 3GLVA 3IUNA 5BQ5A 5TGZA 3VMFA 4F8QA 3IDOA 5GGVH 2AVDA 3IUPA 4W5WA 3D5EA 2Z34A 1NW3A 4M8UA 1AGEA 1JLLB 3ABRB 1LBQA 5TY0A 1FJ1A 1KFKB 2G5GX 4C89A 4DQVA 3GJZA 4L0QA 5T1KD 4BQBA 4K5OA 1MIOA 3MRIB 1PVHA 1UYWL 1OZFA 4NXKA 4TKVA 2HLEB 3MLEA 3QX9A 2FUTA 2GPNA 1QE0A 5D70L 5EP1A 4B5KA 1OAYH 2DQGH 4Y1SA 3ESRA 4CMCA 4V38A 2O48X 1E2EA 4UUOA 2FHFA 1PL3A 1I8LA 1CE1L 4YQXL 5EZJA 3Q4GA 2CV1A 1CPUA 1M6VA 1ISFA 3GVIA 2H57A 3GAZA 2ZXWB 3QX7A 4L15A 2EU8A 1FYTB 4JB0A 3S2EA 4PBXA 3A6BH 1OSNA 2PN5A 1UR5A 3I8SA 4C55A 1MOSA 3MV8A 1EZZA 1E1LA 4I1OA 1QFPA 1JV2B 2VWHA 3Q9LA 3TEXA 3PGJA 1CD5A 3V4FA 3RWGA 4XPTH 2JCGA 3AETB 2XYVA 4GP9A 5ICSA 3E82A 4GG8A 3HU3A 3UAVA 1IE3A 4Z0TA 4IU2A 3QRGH 4YFDB 4ZUSB 3QFJB 4ENVA 4YALA 4RANA 3B5TA 4WCVA 3THYB 5HDWA 1E5XA 1TKWA 2EKJA 2JFCA 1A6WL 3V6OC 4EMZA 2QV0A 2QQ0A 3MLZH 3BFJA 1QCCA 4DQUA 1JDDA 1LC3A 5LD2C 8PAZA 4CI0B 3ZDXB 2ZULA 1TTGA 1ZOIA 5DM60 1R6BX 2D8AA 1D5IL 4P2RA 2JXMA 3E3QC 1X3DA 3PUWA 4R1TA 4X94A 1KJ3L 4LDCA 2Q5CA 1ACXA 1DAEA 1C1YA 2FRGP 1P5VB 3ROMA 4B6RA 2FPWA 2L18A 3VGFA 1K6IA 3GGDA 5KYWA 1KLUA 1Y82A 2HH0L 2P9HA 3EPPA 4I5GA 5AXAA 2W2MA 5C0DA 1ULZA 4KWEA 5EWIH 3BRWD 4AU1A 4DG8A 1K8ZB 2GA8A 1YMQA 2XCIA 4P53A 4HUUA 2RJMA 2G36A 3LO8A 1T9GR 1N75A 3QQ5A 3HHSA 2V9UA 2DKSA 1Q4NX 3EASA 1RK0B 2AKEA 4MX7A 5IP4A 2FW8A 1I3OA 2J25A 5JPMA 1Z3GL 1MW9X 3FSGA 2Y1KA 5DURB 4Z0PA 1Y6GA 5C07A 3AFIA 7FABH 3AIKA 3MT0A 3VNVA 1FS4A 1NGSA 1WMEA 5I19L 3PNYA 3TJPA 4U2KA 4CETA 2HRRA 4DL9A 1B2YA 3IILA 4URHA 4E2XA 3AU1A 1O95D 1N9ZA 3A9SA 3SM3A 1JA0A 5AIAA 1V3QE 2ZJ5A 2IWRA 3MO1B 2VEDA 4Z7NF 5DHVH 4FXGC 3O11B 2SNIE 5D7EA 4RNDB 3W78A 3WMGA 4C4XA 4CADB 4JLRB 4MCHA 2EYTA 3ULUC 1KDYA 5EMHA 4PXSA 3IMKA 3P3TA 5FA3A 5HHVL 1V5FA 4AO6A 2ZCHH 2HF9A 3DE2X 3GN1A 2RHBA 1QI4A 2XIDA 4MCYA 5AAWC 5A2KH 4G8IA 1XZNA 3DVRX 2P8PA 1F00I 1I8TA 1ZCJA 3ZJTA 2VNJA 1OLUB 1J8QA 1DAOA 2XSZD 4ODVH 4OCYL 4QRDA 4ZMWA 5AB1A 3PXEA 2K2QB 3GEHA 2FLVA 1EBFA 2JANA 3MTAA 1RPUA 2FT6A 3PDWA 1G6OA 4YDVB 3T7CA 1EVJA 4J91A 3MG9A 3ISTA 4J90A 5FGRA 5FA4A 2QVTA 4M7OA 5C4IA 3OCUA 2DM7A 2V2WA 4W8OA 3MGOB 1IBRA 3O3EA 4FGSA 3B5IA 5ENDA 2FWOB 2EC5A 1KCUL 3HZMB 1F2QA 5FHAH 4OATA 2C7RA 2FK9A 3SU8A 3NA9H 2WJVA 2ALWA 5IWCA 3OLDA 2OP4H 5JADA 4XC3L 1KPIA 1A2YA 3D85D 4H7KA 2IYLD 3IPEA 4UMGA 2JI2A 3Q41A 1TL7C 4RZ3A 3R7FA 3MQIA 4LLWB 4J39A 4DW8A 1P1CA 5EE0A 2ORBH 3BORA 1MVUA 5BZWA 2DI8A 1KPUA 1KYZA 1USZA 2JIPA 1T21A 2M1XA 2Z4RA 3CN7A 1E3EA 1YU6A 4HFMA 4LIQL 1YQTA 3QUQA 4PYKA 4HUTA 1F3JA 1XNGA 2VAMA 1EX6A 4W4NA 2NO7A 2CUMA 4KFSA 3TRFA 3I04M 3U17A 4PW4A 3IERA 4S24A 4EJ6A 5DMXA 2JGRA 4QRPA 3BXEA 5NLLA 1Z6ZA 2E5LB 2FYTA 1J21A 2PFKA 3TQHA 3BWVA 4F7CB 2H63A 3GSNA 4QC2A