3NIFB

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alphaIIB beta3
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 122
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nifB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nifB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nifB03
1M2VB 5HDBB 1SQ0A 1ZOOA 2VDOB 4JX0A 3ZE0B 2ODPA 1PT6A 4NEHB 1M1XB 4HQOA 4WFQA 3BN3A 3PPYA 5E6UA 3K71B 3K6SA 1U8CB 2NUPA 3EGXA 3OL2A 5LN1A 1BHO1 4G1EB 4HQFA 3V4PB 5E6RA 3EOBI 5BV8A 3AL9A 4F1JA 3VI4B 3EG9A 3NIGB 4G1MB 1SHYB 1N9ZA 1XDDA 1MJNA 3OKYB 5HJ2A 4CN9A 1JEYB 5E6SB 1MQ9A 3AL8A 1T6BY 2VDLB 1QCYA 4CN8A 5ES4B 5KYXA 1IJBA 1FNSA 4UM9B 2QTVA 3K72B 4WK0B 1MHPA 2NUTB 3PPXA 4DMUB 3HXQA 2XGGA 4C2AA 4O02B 3EGDB 4NENB 1OLZA 1MF7A 1TYEB 2XWBF 2B2XA 1L5GA 3NIFB 3EFOA 2VDNB 3TXAA 5KYYB 1XDGA 1YVPA 4GZ8A 1SHUX 5KYWA 3VI3B 1M2VA 4Z7QB 1BHQ1 4MMZA 1MQAA 1XUOA 1PD1A 3NIDB 4A0QA 2M32A 1LFAA 4HQKA 3Q3GE 1T0PA 1IDN1 2VDPB 5E6UB 4WJKB 3ZDXB 1M1UA 2XWJI 4IHKA 5KYNA 4MMXB 4FWWA 3K71A 1M10A 1V7PC 2NUPB 3IBSA 1SSLA 5KYUB 3BQNB 4WK2B 1SHTX 1JLMA 1DGQA 2VDKB 1N3YA 3TCXB 1AOXA 5HGJA 3V4VB 4G1EA 1ZOPA 3T3PB 2I6QA 4MMYA 5E6RB 3ZE2B 3PPVA 4FX5A 4C29A 2O7NA 3EG9B 4HQLA 1ATZA 1Q0PA 1QC5A 4O3UB 4K3JB 1JV2B 3EH1A 3EOAI 3FCUB 2X5NA 3T3MB 3FCSA 4JDUA 3BQMB 1RS0A 3ZQKA 5KYXB 2VC2B 4PN7A 4IXDA 4XW2A 1JEQA 2VDRB 2I6SA 3IJEA 3K72A 3HI6A 4IGIA 1UEXC 3EH2A 1M2OA 3F74A 4UM8B 3E2MA 4WK4B 1NA5A 4NENA 2VDQB 1M1XA 4Z7OB 4UM9D 1RTKA 3EFOB 3K6SB 1AUQA 4F1KA 1U0NA 4O3TB 2WW8A 1FE8A 2ODQA 3RAGA 1OAKA 1U8CA 3NVQA 3ZDYB 3ZE1B 3EGXB 5KYWB 3OL2B 4C2BA 4MMZB 2I91A 1RRKA 3F78A 1DZIA 3OKWA 1MQ8B 1CQPA 2IUEA 4HQNA 4BJ3A 1U0OC 3AFCA 4MMXA 2P28A 2ADFA 4G1MA 3TVYA 1YVRA 2VDMB 2NVOA 3GXBA 5KYUA 1JEYA 5E6SA 3AL8B 1YUKA 3QA3E 3M6FA 1RD4A 3HXOA 4MMYB 3ZDZB 1AO3A 1CK4A 2NUTA 2UZYB 1QC5B 1ZONA 1PCXA 1IDOA 4CNBA 4M76B 4O02A 3EGDA 1JV2A 2P26A 3FCSB 1L5GB 4Z7NB 1IJKA 1PD0A 3N2NA 5KYYA 2ICAA 3TW0A 1JEQB 3IJEB 3PPWA 2WINI
chains in the Genus database with same CATH superfamily
4Z8FH 1VE9A 5D1XE 5IANA 1ND0A 1XC7A 5MEND 1I1RA 3CVHA 4HH3C 3GFGA 3SD2A 5JRDS 2J6WA 2C7UB 4YDIL 1P5JA 4MQ7B 4W9MC 5DDIP 3AEUA 5AFAA 2Y1XA 4DTCA 3QRFM 4G4JA 5CVEA 3PUVA 4PTUB 5DJCB 1MRFL 2PNFA 5F3DA 5A0VA 2CGYA 2WFZA 2FEPA 5GGSY 1P9MC 5E1BA 3GTVA 1FP7A 2OK0H 4GLLA 3RBXA 3SIKA 1PNTA 1BE0A 3D9QX 3ZXXA 3MLBA 4AUKA 3CURA 3BPNB 3IU4H 4YHYC 1PLBA 1JPSL 1CG9B 2QIPA 4E2OA 4IU3B 4MA8L 3WUZA 1HBJA 4XNYL 4WTZG 1U36A 1YIAA 3EAGA 4GWLA 1QH8B 3DL2A 5D86A 3AIMA 4P9HL 1KL7A 4ZOCA 2NU9B 3VNBA 4QGFA 3EMDA 3VU2A 2DEYX 2X1QA 4OHBA 3IV6A 3FU0A 4F5CE 4JEUA 5IF9A 3G17A 4QU5A 2ATAA 4M5SA 1ZANL 4POYA 4D0RA 3A1FA 4UIMA 3A6OA 3T0DA 2O5VA 1TVDA 3HI5H 1G2OA 3GLGB 3VZCA 5THQA 2XN2A 2PJRA 3WN5A 1Z9SA 4CLXA 1ZH8A 3KV1A 2HLPA 4MS8C 2PT6A 4EEEA 4QCIB 5DJ8A 3SPVB 3RSSA 1U2RA 2EDFA 1G3QA 1OZAA 2G0NA 2B7BA 2DBZA 3QFCA 3EJTA 3WIHA 4L8CB 4A91A 2K7FA 3S36X 2RFLA 3E2PA 3JD1A 4ZXBA 4WTQA 3LT0A 5DHXB 5E08H 3HZMB 3MA7B 3UC0L 1IY8A 3HHMA 5G53C 2WXKA 3DX0A 3OZXA 3QVSA 5EINA 3R8FA 3H84A 4X97A 3WGYA 2XXCB 1EFPA 3OKYA 5LCVA 3GHEH 1RWKA 3R3UA 3LXCA 4IUCS 1QYRA 3FZUC 3H65A 4RVSA 4ZGWA 4X9YA 4DRXA 4JUAA 1LO3H 3R76A 3AOGA 5LQBL 4AC4A 1AKNA 3ILYA 4TNWF 3OCVA 3I3EA 3BLBA 5CLIA 3IE2A 5AICA 3MYZA 1U2ZA 5P21A 1UXWA 1NCGA 2E46A 3S5LB 3T2OA 3D85A 3GWGA 2G83A 4EJ6A 4ENTA 2JEOA 4IOFC 5DTQA 3US9A 4DAGL 4MLDA 5EESA 1UM9A 1KJZA 1WM1A 1UURA 3CC1A 3MRHB 2VSOA 3IYLW 3GYBA 5HRUA 3ZZNA 4BLTA 4S1DC 1BDJA 5LYJB 1M5TA 1S96A 2DBLH 4N65A 4FQ2L 1HRDA 4Y4KB 3CJJA 2IQ9L 4M7LH 3L8YA 3WHKA 3RVXC 5IKEA 4ZAVA 2ZUVA 1GSIA 2QW8A 1G98A 4QJBA 4KI0A 1SM3H 4KWHA 2HSIA 3KEQA 2J2ZA 2JJ8A 4YI5A 1QTRA 3KR1A 3L1OL 5KS2A 4C0HA 2CO7B 4IX9A 3PHOA 4BFNA 6GPBA 4OYLA 3C6SA 1XEXB 3RYTC 4DFDA 5AKEA 3NHFA 1ZM3A 2OHHA 5BQPA 4XIYA 2QRZA 3DO6A 3CWGA 4K73A 4XIIA 5MEQA 1TO2E 2PW1A 5FV4A 2ERXA 5JRJA 5KHOC 1A6UH 2OJEB 4PG7A 1OW0A 1PZ5B 1X6LA 1FC0A 5JOPD 3AV0B 4XP5H 2HJKB 5JPNB 3HVNA 2H1PL 2OKGA 4GE0A 4XDHA 3ARQA 4HUTA 4J43A 3C5JA 3FN4A 4AUEA 4FTVD 4ODIA 3GLQA 4AG3A 1O9HA 4FMBB 2BH2A 4LKOA 1A3RL 4U02A 1WT5C 4I3RL 2OJZL 3V5HB 3SBOA 3FJTA 1WMDA 1KAHA 3HZKA 2IHJA 2PUQT 4HAGA 3L5OA 1E6UA 2VSYA 3QA3E 5CS7A 1CPUA 2HRGA 1NUDA 3C5ZA 1TYDE 4U1IB 4H2DA 3OJMB 2Z93A 3PX7A 3HC7A 3T6XA 1FFPA 1F18A 4C4PA 3F9IA 5MHSD 4JPIA 3GB9A 3G8YA 4TF4A 4TQEL 2PSSA 2AVFA 3FZGA 4NECA 2DTML 1ZS8A 4FU0A 3ZKNC 5EJEA 1QMUA 2Z3ZA 4MUHA 5AJWA 5CJPA 1BSVA 1OB1A 1Z2AA 5AENA 4R7NB 1W5EA 1ADFA 4JHXA 4FE9A 5CLWA 3K3PA 2VYND 1DUIA 3L3DA 4ME6A 1CZNA 2X5PA 1RCUA 3U4QA 3QIBD 3Q5OA 4HZLB 2OV6A 4CV2A 4HEA1 3PWVA 2WLNA 3LZ6A 3ZV4A 2ZJ0A 1PQ4A 1K0UA 2AXNA 2H2DA 3DVSX 4XRCA 3KJHA 2EKZA 5EHQA 4F33B 3E2MA 4JFYB 5DZNA 4DJJA 4MDYA 2EX4A 4EPXA 2XHNA 1TAGA 1WW2A 3CBKB 3MRDB 1J0EA 3IDJA 3GFVA 4U2EA 4Z7JA 1TXKA 3QDGD 1ZLVK 2R7EB 1WK0A 2Q4TA 2Y0CA 3APMA 1AGDB 5DEJA 1E66A 1TF2A 2R60A 3K70C 1BCIA 1QP7A 3SCMB 2Q1EA 4P2OA 3QKRA 4IICA 3VX1A 2QSYA 1NJ9A 2PR4L 2JD0A 1UZLA 3S3SA 5GWXA 1AY0A 3M17B 4YEEA 5LBUA 3LD9A 4XPAH 5CGTA 5KPDA 3LUBA 1ESMA 2A6PA 3NWPA 3KM2A 3PTAA 4MA5A 1ZNYA 5EKDA 5CLLA 3RFVA 1KYYA 3ZZ1A 2B5VA 2F17A 3IO5A 1ZMXA 1URLA 1BWMA 5EP4A 2CUNA 2EQ5A 3RI3A 3H9UA 2SEBA 3W2IA 1GS6X 1XAUA 2WIBA 1FU8A 2JHGA 2XECA 3LNHA 1U6AL 4X9GA 4K46A 4RAOA 4P2RA 4OGWA 1RJ9A 2WSSA 2HW8A 1FX0B 3NJIA 4YRPA 5AZEH 4MZ3A 2XDAA 4Q16A 2JLUA 1UQUA 2DY0A 3EE6A 4DMGA 4AJ0A 1MCCA 2ZD0A 2X4QB 3WBBA 1SHMA 1ICIA 4PGMA 2FB9A 4RAVA 4WNSA 5K69A 2XUGA 1CUIA 3OZ9H 1ODTC 2L18A 2FEMA 7FABH 2Z35B 2YPKA 1L0BA 4EARA 5IJVA 2R25B 4EDFA 2JCCB 1MW3A 2VHYA 3C3WA 1KEMH 1KYFA 3MNDA 4PV9A 5F2EA 1HE3A 1H15A 2GY5A 2GRAA 4UU9A 1LE5B 2B0CA 3U9LA 4EO5A 3HKZA 2R97A 3HHEA 2ZWKA 4WI9A 4H31A 3RRJA 2W2LD 2HXAA 1GGTA 1J09A 5ARBA 1M2VB 1XCQA 3V9EA 2ZB7A 3UMSA 4HNUA 4YRGA 3IR7A 3EVEA 1EEYB 1X1EA 4PU2A 2MKWA 2OZLA 1F17A 3PGCB 1C3XA 2ZE7A 2OLEA 5EOQH 1PFGA 3T61A 4DCNA 5MN4A 2EJTA 3FLMA 4DPMA 3DV6A 3AL8A 3IBTA 3NBQA 3DOUA 4KLRA 3N0AA 1X3DA 4FN0A 4L6AA 2Q4OA 3GLEA 4UKDA 2DQYA 4EVRA 2PUVA 2NY1D 4Q3AA 2VO1A 2JLWA 1T7ZA 1BQHG 3TXAA 5I5RA 1WMAA 2AZTA 4K1LA 5IT2H 4YJFB 1HH6B 1ZKDA 5DMJB 3Q7PA 1FHGA 5IMLB 4IEFB 1FYHB 4OGLA 4ZHQF 2XY4A 4MB5A 1ICEA 4PUBL 4TMVA 1W8EA 2ZVQX 4TNVF 2AMVA 1H2HA 1PLKA 4AJPA 4N8PA 1MFEL 4OT1L 2AXJA 1S7UB 1XWFA 3CSPA 2ZQYA 5LXTF 2AYZA 3OX4A 3L46A 4CEJA 4YFDB 4UUQA 4A6YB 4XCNA 1Q7EA 1OZHA 1RPQA 2WDPA 3LDHA 3GBLA 3RTEA 1F7VA 3HTXA 3OGOE 1ZSHA 4AUJA 1L9XA 4CHGA 2FWUA 2PXCA 4XP4L 1FNAA 1YQGA 2RB4A 2FRDA 2X6TA 4I88A 1YY8A 2WJYA 4CV1A 4JN1L 5INCA 5T6MA 4O02H 3PVCA 4U7DA 1ZMRA 2E7ZA 4FW9A 3B34A 2ZJFA 3W1WA 3CNEA 4XP9L 2JD2A 5LMCA 2XFXA 3ZXSA 3IRPX 1T1YA 1Q7RA 1L9NA 4AIEA 2LTAA 4DLZA 3LX8A 2YV4A 1DQMH 3K9CA 5BQ7A 1ZVYA 5BXFB 4Q21A 4C6TB 1S6YA 3EK2A 3JQQA 4AL8H 3ABGA 5B3AA 3ARGD 1Y8RA 3VMPA 5DT1H 4D4IA 2PXAA 4LLQB 2O1AA 1NEPA 1E0SA 1FRVA 5U9CA 1YI1A 4DWHA 2BHLA 3C3EA 3CMGA 5JHDD 3NIDB 1M1NA 3L4YA 1TO6A 4R7DA 4TTDD 3H1EA 5FDFA 3LMJL 2I34A 4PJCB 3KQQA 4KR3A 4RIHA 3QWBA 4DV3B 4M89A 3NHJA 4XGIA 1NJGA 5DRXA 4Y2GA 1NR5A 1I10A 1PFCA 4M3KB 2YGPA 4ETYA 3WK6A 4K3EL 1DG9A 1U1IA 4P92A 2WXLA 3I01A 3GRKA 3HZVA 1ZA6A 1E42A 4L4TA 1B16A 3PUJA 2HTFA 3HNTH 5CSZA 1B7GO 1DUVG 3ZN6A 1KYIA 2FNBA 3M6DA 2W6CX 3WWCA 2B4RO 4HUUB 4EI6B 3OPXA 2QT9A 1R37A 4B41A 1WTGT 4FUQA 4LLYA 2IDKA 4ORZC 1O77A 1IEQA 3Q3VA 5BV7B 1NCCH 5KDOA 3E6HB 1MX1A 4FT2A 4AVIA 1DIRA 1VJ0A 1PG7L 2ZJ2A 5IKOA 4KKAD 1THMA 3LP5A 4AJ2A 3K71B 3IAUA 4JG0L 2YIMA 4LCIL 4MLSA 5I1LA 2WJ6A 4EBQL 5KQPA 3HV0A 1TNNA 2V0AA 1KGSA 3ULVF 2F19L 4OJQA 1MW2A 4COKA 3JWNH 3LYAA 3QE5A 4BX2A 5ARCA 4CN8A 3T1OA 2ZI5A 1EUCA 4KIGA 2EEPA 2AGJH 4ZMOA 4IJ6A 2FEWB 4EENA 2GJ6E 5T57A 2RGGA 3KGUA 3DMMD 2C5BA 3IGKA 2G2RA 1HHHB 1S7VB 1X7YA 1H3PH 3GRGA 1THGA 3RAPR 5T3ZE 2Z31D 2C1OA 3LDGA 3TA3D 4RTPA 2HFGH 2HT4C 3G6AA 1K2WA 2Z0UA 1G4AE 4MV4A 5FKAB 2W70A 1A7KA 1TJXA 1SXJA 1UT8A 1UOEA 1HI9A 3CPEA 4EY5A 3CZFA 4G8BA 1MO2A 1PL6A 1BEZA 5LQUA 1M6OB 4M93B 1BX1A 1HY3A 2MRYA 2YXVA 3B3IA 3FN0L 1IEWA 1JG9A 1OTYA 4NS0A 2O30A 3OLWA 1YONA 4YJKA 3W9BA 1PGNA 4N0PA 4BLSA 1X1CA 3WS6A 1KMNA 4D9GA 4N5DA 1WWCA 2JKTM 3I9AA 1WXIA 1IXKA 1B6SA 3O8RA 2PP9A 1CQIB 3CN1A 4N0EA 1FZJB 4DLUA 2VJBA 5KVFH 2PUDA 2AQPA 2B94A 3A2NA 3DMTA 4V39A 4LK3A 4XI5D 2KDYA 1E64A 4MDJA 3RVBA 4JWKA 4M5ZL 1IT9H 2G88A 1NJ2A 4KRNA 2E4XA 3HI1B 1GRWA 4X6UA 2DTSA 4LLMA 1MB3A 3KLQA 3MXTA 4EZLA 3M9WA 2WNHA 2WXMA 2DQJL 3UXMA 1L0YA 1IHDA 2EYTA 2JNZA 3CZKA 3FPKA 2GTZB 3N53A 4RPHA 3D4CA 2VMFA 2I07A 4O2AB 4QNMA 3KXFB 1MAKA 3PQ4A 1JZTA 3KAQA 4PGBB 3SZRA 1QHHB 4KKCD 3EUFA 4HYQA 3EVDA 4I36A 3BMVA 2MNWA 2E7LA 3NTXA 4NLAA 3H6AA 2VITA 3ZJUA 1Q0EA 3E7DA 3QXVA 3FONB 3K9NA 2LR0A 1ZAKA 3RSOA 4G85A 1KCRL 4OF0A 1IBMB 4BLPA 4RF4A 5I76B 5DVNA 5BURA 4ZAZA 3UJ8A 1SKMA 3HVHA 3SZ6A 5HI3C 2H5JA 4HP5A 1JGVH 1TETH 2Y6VA 1VGKA 1TGVA 2ENUA 4P2QD 3HG1A 4GIPD 1Z4IA 5CCJA 3J81A 4XX1G 3WHXA 3AUXA 5I16B 3FCCA 1ZK5A 4H8PA 3ZLBA 3EYAA 2B30A 1R66A 2JGFA 3R7AA 1G3IA 3V9CA 1KV7A 1GL9B 3R09A 1IBGH 4Z8XA 2B34A 5DEFB 4OZFH 1ZPDA 2P6NA 3LPLA 5KNDA 3A28A 5JE8A 1KPHA 4PSPA 3CLTC 2HTLD 3JASA 4N6QA 2OHJA 4IEIA 3CVHH 3KD4A 5K9JL 4XX1E 3OEEA 43CAA 1U80A 4EKJA 4FRWA 2AJVH 1R3UA 3UBXI 3PXUA 2VN5A 4W4OC 3P9LA 2I22A 4KDWA 4QRSA 1E6MA 4FQIH 5F2FA 3GRBA 4ALAL 3SSOA 3L5JA 3R1GL 4L1BA 2Z7YA 3ARBC 3GGCA 4NRXA 1YA8A 4RPKA 5KCMA 4BO2A 4G0YA 2IG2L 3LUDA 5A5DA 4D3XA 4K5OA 3JQ9C 4NFCA 5GHWL 1O9GA 1W0VB 2D1FA 4Z0PA 3MWGA 4RHTA 1PD1A 1NTRA 4YGAB 4G5RA 4URFA 5EO9A 3KKOA 3OKFA 2C94A 2JJUA 1U1CA 1EDEA 3CLWA 1MCWM 4X6CF 2Y1DA 3LPFA 2HK9A 1RRCA 4OKVB 1Z6AA 2ACEA 3GSVB 4G0VA 3DO7A 4W9ZA 3THWA 4TWAA 2EH7L 3MRJA 1A9ZA 2QTVB 4K9NA 3I12A 1P9WA 1SZPA 3PJFA 3L8EA 2ZIXA 4CQMB 3LEYL 3L1JA 3T6ZA 1O6GA 5AW7A 1VLXA 3ZHSA 1Y3AA 4K3JL 3CT4A 3NH9A 3OQBA 1ZTXH 4JFZH 4BZWA 3AKZA 4PIVA 2QV4A 3S2GA 2UZXA 2O3TA 2AMYA 2WQ6A 1EO5A 4IZIA 2YPLD 1MCBA 1RLWA 2Y36L 3BSZL 2QLVB 4L5BA 5TGBA 3T8MA 5C8JA 3MS4A 3HFGA 5BOSA 3FCTA 4L78A 1W2KT 2PA3A 5M94B 1FLVA 4ZVUA 3MG9A 3WIHH 1DQYA 1X1TA 3CFKA 3IETA 1XT6A 1Z0UA 3F3SA 4MPPA 1DUSA 4L9LA 1X2BA 3WL9B 5TQVA 4PJXB 2K70A 5ITZB 3LRPA 3NP4A 2NX5D 4N47A 5F3WB 1L5SA 3LP8A 1ZHBB 4FKHA 1HYSD 3U61B 1QO3B 4JM2C 1JHLL 2H9IA 1NF9A 5CJ5A 1NDGA 5ESXA 2H4YA 5J8OA 1EO8L 5LCVH 5A71A 3WG7B 1FVEA 2VW6A 5I18H 1J9CT 1ZD3A 4GXFA 1H5BA 1V5JA 4JI2B 1ET5A 4QYIA 4C78A 1RXVA 3M46A 4UU1A 1KP9A 5IMMA 4ASUA 1QF6A 4LXXA 5EO1A 5LDSA 3FCEA 2E74C 2RG7A 2XZDA 3HEAA 4RWEA 1F60A 4OFQA 4TNGA 5JZSA 1QP0A 1NNSA 1NL3A 5I4BA 4D8PA 4GYBA 3MRKA 1Q95A 2XVAA 1OGTA 3DE5X 2X14A 3TRJA 5K93A 4L3ED 2ZG2A 4NJOA 4LPKA 3N50A 3FDWA 3FQXA 4CM6A 2OCCB 2F1OA 3THRA 2E6UX 2WE8A 2ZXQA 1A7AA 1VKHA 2AWOA 3A1TA 4ACTA 3SQNA 2ITDA 5ECWA 1WCWA 4HDMB 2FWOA 4NWUH 1M8GA 1LWOA 4S1RL 4G1UC 2FQWA 4GW1B 3SKUD 4PZCA 3HR8A 4UJ5A 4NI6A 1EEZB 1O58A 5FNZA 1QF9A 3ICOA 4NN5B 5E70A 2H4WA 4A37A 5B21A 4GM1A 4PRDB 5B3JE 1SEQH 1KETA 3COYA 2YJ3A 5E5MA 1N4XH 1CNMA 4M5YL 1Z9PA 1O6BA 3IDIB 1GZ6A 5D7JD 2WRZA 1ZU5A 4J28A 5BQXA 4YFEA 3BIKA 4N12A 3A7EA 1XOIA 3ODGA 5TFSL 1P9NA 1RFDH 1OKKA 4RZ2A 1WSWA 5DWQA 1JGUL 3TS8A 1KARA 1QSGA 1EB8A 4F7PB 1FP1D 3SFVA 3VWJB 4X5XA 5JORB 1PR0A 5E8NB 3RU3A 4JS7A 4K7PH 5AW6A 2F7IA 3IIKA 5LP6A 3HBFA 3FFOA 1L4NA 3MX0B 2R84A 2VDUE 3TFWA 2Q2VA 1GGFA 1U91B 3VVMA 1MHTA 2QA5A 4HFRA 4B09A 4ITRC 5K3CA 3BAZA 3PWZA 4RX4A 2OTWA 2XMDA 3NIFF 2OFXA 1K8ZB 3I1YA 6YASA 3BP4A 2R4QA 5AVZB 4NT6A 2CHEA 2B61A 5HHMB 4O4HA 4NZRL 2CK0H 4XNXH 1P5VB 3EUUA 2XVZA 4HSGA 3BJMA 1DRKA 3OZFA 3QTTA 2NY5H 1JIBA 3Q8MA 4FNLL 4EG3A 3KJZA 4JBSA 5DK0B 2P0AA 1KUMA 2XR1A 1H66A 1ZC3A 2XSZD 4C3VA 3NK3A 3CUPA 1UA6H 1HH9A 2AW3A 4D3FA 1UUNA 4W1RA 3EJUA 5JQIB 5FOUA 3L84A 3VU9B 3RL2B 1UEYA 3LZFH 4OH7A 1S7QB 5K9QI 2AR7A 3X11A 5EBMA 1C0PA 1VCNA 1DCFA 4JAMA 3DBSA 1DBML 5DNCA 3L4BC 5IOKA 1U4OA 5BWCA 2JIXD 2IC2A 3ZCPA 3WHLA 5IOPA 1G5TA 1SEVA 1Z2EA 3PQYB 1D7CA 3TLRA 3DHUA 1EP3B 2OCAA 4AO8A 1YEHL 4APQA 3X3HA 4UYQA 1T36B 4ZREA 4HWZA 1NJ5A 1Z2NX 4DOMA 5ALLA 3UAAA 1V95A 3WMQA 4NHUB 5FTWA 5IQ7L 2QQ0A 3RGBA 5F5NA 5DM60 2IZ5A 5I1CH 3G88A 4GYKA 2ZRMA 3DWEX 3K1AB 3QYJA 1MIML 5ICMA 1E7UA 4YBQD 2V7WA 5B4UA 1PVOA 3MLVL 1A8SA 4MR7A 3D3VA 2PIDA 5KWVA 3O47A 2DJ4A 3CFEB 1NFDA 4ZICA 2NQCA 4ZMTA 2OO3A 3TMAA 3H42B 1A6WL 2A8YA 1DG3A 4Y1AE 2DIBA 4PB9L 4H8UA 1UQSA 2C5DC 2J5QA 4RQBA 2LW3A 4C4SA 1GGBH 4AFNA 1PZUB 3PCXA 1QSFB 1RRFA 4L3OA 5F96L 4HO1X 4BCYA 1YZUA 4UTZA 3QI9A 4YRAA 1DQTA 2PMZA 1YEDB 1NRXA 4CKZA 3E7XA 4X8CA 2WV7A 2X6BA 4P7JA 3ZTCC 4X99A 1I4DD 3II3A 4G2AA 1NNUA 3GRCA 2CFOA 4ES9A 4IIQA 2XWRA 3N2LA 3D4YA 1WXGA 1T1WB 5FHBH 2AXHA 1GHTA 5INTA 3SZOA 4QUEA 3ZVVA 4QGBA 1A77A 1YNTB 1EBFA 4S1NA 2W9LA 1X7SA 4BZPA 1MHPL 4YJ3F 2GYWA 3WSQH 2J59A 3DDZX 2ARKA 5BW7A 3V0VA 5FDWA 3L3JA 5IVXA 2PX6A 5IDVA 5BUAA 4NPKA 5IJ0B 1KK2A 1UWCA 4LY9A 4P2GA 1TZ8A 2IH8A 2AV7B 3TVMA 1WZEA 1EAMA 3MGOA 3A0UA 3GZTB 2VMEA 5C07A 2WFLB 4PV1C 2C58A 4HQFA 4GRWF 16PKA 3U7FB 5FO2A 1TVEA 2R4UA 3NHAA 3EG9A 4XD2A 1XGRA 5EDSA 5EE3A 1GGJA 3R7NA 2HMYB 5FYJL 2NYYD 3A26A 1I5EA 2GEFA 2XAAA 4P9MH 4B5LA 3MFFA 3NW9A 2AV1A 3BSGA 4FHZA 3WB9A 2OPBA 1ZJ5A 1NBZB 4XO5A 3JYNA 1XTQA 4QT0A 4WL0A 3K8ZA 4M9SA 5IG2A 4HQKA 1T6ZA 4JROA 3LKNA 3Q7SA 4BRZA 3KZXA 4XYEA 1BVNP 1NU6A 5LAPA 2WD7B 3W9SA 2CSPA 5LA6B 1G7PA 1LWRA 4HXEB 5SYNA 5C8XA 4MW9A 1EMTL 2EIMB 4YDSA 4FXKC 4LKXB 5K9ZA 4P46D 1FXWA 1LO2H 4BVHA 3V6OE 4DW2L 1CBVL 1UF9A 4DNFA 4ZO6A 4OZIF 4KMSA 1EK2A 3H7AA 4LE8A 4XLLA 3RWFA 4NCBA 3VXRA 4D7BA 2EFJA 4GBGA 2QTMA 4HBQA 1V3KA 1I80A 2NSJA 4LLWA 4RCZA 4TSBL 2BNQD 3UO8B 2EQDA 4KXVA 5BUQA 5GGXA 4JHWH 3GJ3A 1TF5A 2XUKA 4P4KA 5FBKA 3BVTA 4BRWA 4NPJA 1VG8A 4JJ7A 3CLSD 2CFCA 1I6WA 4X7PA 3ANMA 2VDOB 3W5AA 1KELH 1YEWA 3KAPA 2ZR9A 3AHFA 3UEOA 1VPDA 1N9GA 2JF1A 5EF0A 3QOYA 3RB5A 3R0NA 5CD5C 1M0TA 5D3KA 1W36B 4FT4A 4PJDE 3SKJH 2PGXA 4IJUA 4NO2A 1J88A 2UYLB 1QTIA 2JDID 5I30H 3VM6A 4AQ8C 2WD8A 1TQBC 3KPPA 2PU5A 3I75A 4QXGL 1GNTA 2ZRCA 1BZEA 4DXDA 4F46A 2Q8AL 2C7QA 4BNZA 4JJGA 1PDVA 1NMXA 2QE7A 1A5ZA 4BK5C 5C6TH 4AJVA 3R0ZA 3MLSH 3SIXA 4AP9A 5BV2P 4L05A 5IHWA 4LSQL 1P2CB 1ZSDB 5C8YB 3SLKA 3GSQB 1ATZA 3N8KA 3RFZB 4R7ZA 2QLBA 3B2MA 4INJA 3E9UA 3POCA 4IZHA 2BFFB 4ZQEA 5FUXA 1XGQB 3JZYA 2PUTA 3OKOB 1K3ZA 5CEZH 1ZEJA 3K9WA 5AK5A 1TZKA 2H51A 2WJWA 2V7HB 3JQPA 1RZQA 2O4UX 4P7FA 3DUFB 3MBXL 4P23A 3RKRA 2OHVA 4RD2A 5KWEA 2C04A 1V16B 4ZVVA 5CLYA 2K45A 2PBFA 3QJGA 1ORTA 2I4MA 3G23A 3WGZA 1ISMA 2XJLA 1ZLWH 1EG7A 2IV8A 4JY6B 4U1MA 2UXFA 4IGBD 4R4FH 4ODBD 2FD6H 3ARDD 3ETJA 5C3TA 3H7BB 1ZP6A 1LLDA 2V3WA 4ZQTA 5E95A 3VGFA 2EX1A 4RGOH 3ASUA 1JLRA 3V52L 2JJMA 1N1EA 2OCGA 1JKFA 4ZDHB 4AIXA 4MYHA 3DV0B 1CNEA 1F1BA 2IMNA 1MFNA 3QKIA 3MWYW 1W48A 2GBTA 1R4MB 3AAZB 2AQHA 3MLTB 3QAQA 3L7IA 2ZJBA 3RGVC 1QP1A 1IBCA 4Z9BA 1XRLA 3IIJA 2APXA 3IDAA 1CMOA 4G59C 3UTTA 1Z9NA 3QZNA 2HADA 4U4BA 3ROQA 4KN6A 1H2RS 2OCIA 4JFDD 3OKDA 4E2FA 1N0UA 3CZCA 3FWKA 1DWOA 1K9TA 4EITA 2IUTA 3E1SA 3H1GA 3ISYA 5EEZA 4KJQC 2I66A 1SUCA 1GM5A 4DR7B 2F8MA 2PWAA 2XMCA 1SCDA 3AREA 4PAGA 3SJUA 5LQCA 3PUUA 2BM3A 3EXHB 1XR9A 1JE6A 2O1XA 4NFLA 3R0VA 4LDAA 4QFDA 3DZBA 5HDQH 3UUFA 1GSMA 2EO1A 1NKTA 4D9IA 3CNQS 2NUAB 1QYGH 2ADJA 3ALWA 2ERCA 1G7HA 4Q02A 4PZPA 4F11A 3KPTA 2NZJA 4XWGL 1PUIA 5T3XH 2HRLA 5ALTA 1MJ5A 3S7TA 3JQEA 4EDHA 1PD0A 4JE0A 4DF9A 2VJDA 3R0XA 4D3ZA 3ILEA 1JPNA 3ZE7A 2OW6A 4NBRA 5A3QA 5JY1A 1BWSA 1AS0A 2X8JA 4KUCD 1HDMB 4M86A 3ZD8A 5HKKD 1OC2A 2Q3EA 4LSUH 4BBJA 1Y0LA 2TMDA 4LXQA 3B5TA 1S2LA 1RW4A 4CPDA 4OAQA 5GS0H 1A6AA 1MUUA 2VVTA 4MQSB 1N9ZA 3L7BA 1WABA 1S9VB 1YRKA 3D08A 3NGLA 4TRPL 4KMRA 3HDYA 2R2EB 3NNDA 3QUSA 2ZYSA 1QR1A 2H47C 3G6JF 4U0RB 4NKOB 1GITA 4HN4B 1I7TB 4W5NA 1YJDL 6AT1A 4DV0B 1PEDA 4PLOB 4R1QA 1LPMA 2H00A 4Z9XA 4JB9L 4P4LA 3VSTA 3TH4T 3UAJC 4YFYA 3AADB 5IYZA 3OUTA 2PF6A 4AAYA 1BPLB 2PMDA 4DS3A 3LPGA 5CFLA 3S34L 3SE4A 2ORED 3H1AA 1IL1B 5FTMA 2A86A 2VF4X 1F14A 4Y1TA 3I5UA 4QRPE 3TFKC 1FSSA 4IBYA 1WR8A 1ZD1A 2XOKD 3H8VA 4QY8A 5AW4B 1BJMA 3KYMA 1PAUA 1CY8A 1NWHA 1IVNA 2XWPA 4TT3D 4NN6B 2XA3A 1LDMA 1NUGA 4JYPA 1DX9A 3GEPA 1SFHA 3QP9A 4RXTA 1YZLA 2JKYA 3ZTWA 1XH0A 1K6JA 5KNDH 4AKPA 3T7RA 4BSWA 4P4SA 1IBDA 1LWHA 1IGMH 2UYGA 4OLEA 3NM4A 4CKVX 2ADIA 2IZ0A 3ZWKA 5AKLA 3MINA 1ADWA 4GLJA 1U7XA 1A4CA 3QHAA 2WXRA 3MEQA 5CH5A 4Z49A 4ILDA 4AYTA 2OZ4L 2NNFA 3O2QB 5BV8A 3V5DA 2WXJA 1T9GS 3BAYA 1BBJA 3DQPA 3F4KA 4WHYH 3VFGH 3QDJD 3ZTTA 5BT8A 2YV2A 2OUKA 3ZDRA 3N40F 4ZYKB 3ZL2A 5F9WB 4OA5A 3VXTB 2NQTA 1CS6A 4L4YA 2AG8A 4PW4A 3DTYA 2OQJA 3QU4A 2ENWA 3OTHA 1EX0A 2HLDD 3UTQA 2NYRA 5ADOL 3U16A 2BT4A 3DDCA 2OTUB 1P6QA 2AOXA 5D7LE 4TV8A 1JV2B 3OG6B 1BRTA 4FYJA 3DMGA 1ET8A 1ID2A 4JRYB 4EN3C 4XKJA 4QOKE 4QJ4A 4PQRA 2QQGA 3OWEA 2ZZKA 4CF4A 2ERYA 1YJXA 5CPBA 3MRCA 3NBMA 3DBXB 3ME5A 2NXZC 2Z58A 2RHWA 3T2NL 5A2FA 2Z8WC 1W9XA 1E9RA 3RYCB 3KYCA 1ZJBA 4Z8YA 4V1DB 2F8VA 5AVJA 1LSSA 3IUSA 3QCVL 1S3KL 1EE2A 4Y9DA 5JO0A 2WZ0A 4WGWB 2IV2X 3ELWA 2P9CA 2ZSVB 4Y7MA 3RX7A 1NOKA 1E7VA 5T67A 3DZCA 1BRMA 4PS8A 1UBFA 7GPBA 1YMQA 5JG7A 2VAVA 5KBLA 4GI8A 4ZDWA 3EGXA 3UADA 3GRAA 3L92A 3MJ7A 4G97A 1KSFX 1GQSA 4Y5XB 4B6OA 4C47A 2OKCA 1P8JA 1Y9AA 4F7MB 1YDHA 1JEYB 4QYOA 2FSSA 4NJ9H 1QRDA 4GPEA 3VA6A 5EZ6B 1I4FB 1T8YA 1SM4A 3GJFH 2LABA 5GS2D 4PVLA 1UK8A 4LBWA 1ZM2A 3TDNA 5TGZA 2ILLA 3SDDB 4KHPB 2IYTA 2XUWA 1UCFA 2QRVA 5JLZB 4LTDA 3OETA 5D85A 2QUZA 1QFOA 5IBUG 1XMQB 1XP8A 3ELBA 3QZWG 1L3CA 2DFTA 2HX7A 1T0PA 1KENL 2CNLA 5LWHA 3RVQA 4U1KB 1SUBA 5CYFA 2P80D 4WI8A 2C5HA 3HCBA 2FJSA 4B9GA 3LOQA 3OSKA 1V8DA 1XDWA 1WEJH 2X0JA 3HRKA 4WNAA 4JGIA 4HJ0C 3QJHB 2PK3A 3GRWA 2F15A 3WIEA 4E7OA 2NTFA 3QQ4A 1YXMA 2DMCA 5BUCA 5G0TA 1PZ2A 1YQDA 1K08A 4FYYA 3ARFA 1NKVA 2XJKA 4ENQA 4DPAX 2ZB3A 5L2KB 4AF6A 1A8ZA 5BNZA 3DTVB 3MOGA 3B1JA 1FL5B 2MSWA 3SDYL 3QZBA 1VHDA 2HXSA 3CZRA 2ZGVA 5IAEA 3TLBA 1JDJA 4B6PA 5F3HA 1K5DA 1UC9A 5HKOA 3N44F 3QUZD 2BY0A 2ICEA 4KAAA 1A9RA 1POWA 4EZEA 4IK6A 1GZ3A 3MACL 4RFOH 9ATCA 4RJKA 1XCXA 2ZWMA 1HSZA 4OA8A 3J8F7 3R9XB 4L22A 4U00A 5GRUH 2ENSA 3L48A 3BKYL 2DFDA 4G9FA 2Q6LA 8GPBA 5GOTA 3ZKQD 1F8TL 1QW8A 2MSCB 5F88B 4WACA 3LIIA 5MFZA 1WZ1H 1WY5A 4YHOL 1KMMA 1ZHNB 3A27A 1XMOB 4M62L 4RL6A 1WFJA 2UXDB 3FLAA 5DUBB 5I6KA 4GZ6A 3NWOA 2FBOJ 2CMDA 2NYUA 3D7SA 3CSBA 3ULVC 1KC5L 4NOFA 1FNMA 1ZRMA 3VUEA 1UD3A 3IJ7A 1T5BA 1ABFA 1VACA 4GZ3A 4PBTA 1FTGA 5JQGF 2CYBA 3BD8A 1MCPH 3MNZB 5AAMA 1XDTT 2BMJA 3A37A 1L4MA 3ZKWB 5A6SA 1WIUA 3T5TA 4LCCB 3T7JA 3IVKA 4ZYWA 1EVYA 4WCDA 5F1YA 4RTLA 1BDIA 3F7KA 1JA9A 2X1WL 4F9FA 1JX6A 5G41A 4QGTA 3ASWA 3WWZA 3U0WH 1R4XA 3OHMA 3U4CA 3DMNA 2A57A 3D39E 4NYLA 2O0JA 3AEXA 1MVUB 1RY7B 2H31A 1TJGL 1TIUA 4E5XG 2WZQA 3WYBA 1SHXA 1P1ZA 1Z62A 4L0MA 1YDFA 4B31A 3KYKL 3RC8A 2FEKA 1JALA 1YRYE 1FQKA 4XVHA 1CETA 2HFJA 2FZ3A 2YBDA 1EGMB 1IPEA 1P2BA 1LSJA 2G5BB 4UTOA 2AEEA 2ADYA 2X4IA 1OBOA 2ZRIA 3E7WA 2A84A 3SE8H 1UD2A 5DLML 5DXAA 1OB0A 4YHKL 1YU6A 3N1PC 5AOLA 2QP3A 3L79A 5FOBA 4PY7B 2P3YA 5D1QE 3MELA 5EN3A 1D9KA 1G9NC 4HUQB 2BS71 3I6SA 5AI5A 2J20A 3LB6D 3GRRA 1L7EA 1S8OA 4HX5A 3L5WA 2XKNA 1OCCB 1GOFA 3HMQA 2FNAA 2QQFA 3MQ4A 2C59A 3C5XA 4PLPA 1GXEA 1Y1QA 4WFHE 4TQGA 1PUXA 1P0MA 1QKZL 2J9XB 5HXMA 3VPXA 3M45A 1RKBA 2B2NA 3PI7A 1XF4A 4ATNA 1AIFA 4QXPA 2HK7A 3GKZA 3STTA 2CG9X 3EHDA 1A2YA 2ZBDA 4N40A 3TTTA 4ESKA 4MKTA 2GTIA 3M82A 2VAWA 4KDTC 2DBQA 5HKBA 1OV4A 3ORSA 3LQRA 3O9WA 2AK3A 3PF2A 2WNXA 2Q8NA 2FCBA 4CDNA 5J89A 3COZA 3EEBA 5F21A 1HL7A 1Y3HA 2LAGB 3WDSA 3CVWA 1JIUA 4GS7B 3NCXA 1B14A 5I9NA 1SC6A 4R9HA 4NRZB 3D0LB 1CF4A 4BFIB 1P1IA 1OE0A 2H3EA 1Z0JA 1CZRA 3SDZA 3OE5A 2EGHA 1UDXA 3QUMB 1QANA 5LZ8A 3TMKA 4RF2A 3TZCA 1QLFB 1VFAA 3NGBC 1VBKA 5B4TA 1M6NA 2GXAA 2NW6A 4I4TA 1AQLA 4IMKA 4R9VA 1Z8FA 2FIKA 2Q9AA 2VQDA 5CR1A 2ZJZA 4H3VA 2AD1A 3T3GA 4M6OH 4ZU3A 2QB5A 4AYGA 1EBUA 3Q7QA 2PO6D 4K94H 5DK2A 1TCRB 5G3YA 2DBYA 2BOBA 1WD8A 4EO7A 1Y7VA 3QVMA 2E9JA 3F7VB 2AJ3A 25C8L 3DECA 4LL9A 3PJGA 1Y9DA 2O0HA 2I5PO 3RTDA 3EWNA 3BT2L 3U4AA 2XV1A 3IEAA 3DKVA 1E9OA 1OTTC 2NU8B 3AUFA 1SQ6A 3WKDA 2LDBA 4BNXA 3AW5A 3QDMD 1A1OA 2PLFA 2FZ4A 2P5WA 1BQ5A 2VDLL 4JPKH 4JSTA 1OCEA 4X7SL 4O2EB 5BT9A 4ODHL 1HWYA 5DI3A 1C80A 3PTZA 4RLSA 5EWMB 3ZWOA 4R0MA 4ZMNA 1QFUL 3W5UA 3MYJB 2FHSA 2YRXA 4WHTA 1YFZA 4GI7A 3QUYA 2NP6A 3UGUA 4GAAA 3KEFA 2TECE 4DNXA 1VFBB 5G0VA 4I2XE 2XB8A 5B1DA 4QELA 3CZJA 2C7PA 1P1KA 4KZEH 3BHJA 4N2AA 2QRKA 3R7RA 2CB9A 5C09B 3OIDA 5E9DA 2YXLA 2B8EA 4JCCA 4EKGA 1HNGA 1E5DA 1Y4DE 3DSRA 3JWGA 3WCYA 3CFCH 5TE4L 5CLJA 2JCSA 4LI3X 2AW5A 4KRMB 1J0ZA 1KCUL 3KR3H 1HT2E 1E3IA 1J8HD 3GMRB 4K8RH 3CHOA 5GIPE 1W76A 3QX8A 4YIKA 3SM9A 3RHZA 2HZ7A 1IHYA 3WGOA 3OKKA 2WANA 1BAPA 1RQRA 4OHWA 5ER6A 4KO6A 2XQGA 1WBZB 5HCIA 2F1BA 4ZOAA 2VRWA 1IHPA 5HP4A 4LP4A 5GSRA 3E6FB 2VTBB 1P0SE 1UBRS 3PR1A 1Y1KE 4CKCB 4WU5A 3ZTYA 1BGWA 3JX9A 3SFTA 1DKPA 4RLDA 1NURA 3OSUA 4HVTA 3A1NA 5EC2B 2JJ1D 1VL8A 3H5TA 5DQDH 1JFLA 1IM8A 5E0OA 3HGQA 1MH1A 3H83A 1TT7A 2NV2B 1K06A 4GAJH 3FPXA 2UDPA 4Y6QA 5AG8A 5EKUA 3AS0A 3O4VA 4HDSB 1I01A 5B55A 4PJFF 2W2KA 1I3RA 4FB5A 4D41A 2X19A 4ZZKA 2Y93A 3L3OB 2UAGA 3DXAE 1YKSA 3S99A 1OAXL 4F3TA 2JJWA 2NR6D 4PG9A 4M0UA 4TTQA 2GC7C 5T5FL 2Y06L 4BGLA 5BVGB 1E96A 1E98A 3TLCA 2DLFL 3T0VA 3HJBA 4B53A 4NZNA 4M49A 5K1NA 5C0CA 1MCQA 4TUUA 4OGQC 3TX4A 3DPBB 4XLTA 3ZLQC 4G9DA 1TI7A 4U2CA 2QKSA 5BNTA 1P80A 1OYVA 5D7IF 4M43H 2HPVA 2Q99A 3ZVRA 4CM1A 2LRHA 1HFKA 5KSYA 4G5FA 1TZHB 3DJZA 3QS3A 5AALA 2IU4A 3UJNA 1TJ5A 3A8TA 4MWBA 3TJHD 3KAKA 4B74A 4LJRA 4JW3A 3WMSA 5GJBA 4FNMA 4MSWB 4G56A 5EMHA 4FB4A 2R2BB 2OL3L 4RU1A 13PKA 1QWHA 5C0JA 5KJEA 2BMKA 1NATA 1DX4A 3U2SB 1U9JA 3SG0A 3SDXF 2BDUA 3VAYA 1NX9A 4E5DA 3FPAA 5C8DA 5FLEX 1F97A 2ADMA 3G5UA 3CEMA 3DE3X 4KKZA 2IE0A 2FSPA 1C9SA 5B3SB 4EQZA 1JR3A 2MR5A 1MO4A 3O1HB 4Y0VA 1NGXA 3NFSH 5JMTA 3AM8C 3N75A 4P2AA 1LBSA 3BMWA 5H81A 2ZYRA 2GBAA 2JLCA 3TTUA 4G8GD 2BCKA 4LF3A 1KT2B 3AF6A 5KB3A 2PBRA 5SYMA 2ZT7A 4ZVTA 5A04A 3DA0A 2XUJA 3N8DA 2ZXUA 1DVSA 2B14A 1I8LC 1T04B 2WIGA 4D0NA 2VZLA 5EORH 1A4BA 1I0IA 4G2TA 3HB7A 1DAPA 2CNOA 4GAGH 3WRYC 5FPHA 1RHJA 1G0XA 3IKVA 3KYOB 3DX4A 1RC8A 2D13A 1IBRA 2X7LA 4H6WA 4B7CA 1NXXA 4E42A 1VL0A 3BSHA 1MFZA 4DJDC 2N0KA 5CB4A 2F53B 3BEWA 1YE3A 5D2NB 1TEVA 4HWUA 1TYBE 1RJZB 3P2OA 3L7AA 1WKVA 1FNEA 4F8OA 2PZFA 4BZXA 4EG4A 2LU4A 3BFWA 1U3HC 4Z1MA 3UO1L 4Q7QA 3GMQB 3OG9A 3UN1A 3AF3A 5GONB 4LV5B 1I7SB 1BZOA 2WVHA 1OA0A 3TQRA 2DMBA 1W1IA 2FZGA 4F57H 1JPEA 2VHQA 1A88A 3TL6A 3PL6B 2J7KA 5H4GA 1AZCA 2W8BA 4B7XA 3DFUA 1Q0UA 3C08L 4MDIB 3DLAA 3QNXA 1W5FA 4AN0A 2P42B 2II6A 3ICVA 5IQLA 5AHXA 2EC8A 2OXGA 4UVEA 4PXAA 3L4KA 4OZHB 2H1CA 3FB6B 2BSRA 1HINL 5H0IA 5HYVA 2VXQL 3MJWA 2L42A 3QITA 1YY9D 5EMNA 1XH3B 4Q3DA 1QBML 2OMYB 2GETA 3UK7A 3AMLA 4RFSB 1E6JH 3ABMB 2H1XA 4DVGA 2OG2A 2C3GA 5J13C 2ETVA 2EEXA 4YAQA 3EFEA 4G9EA 4UBKA 2YUZA 2R39A 3FMPB 4JH0A 2DEXX 3ZWCA 1JNNH 2BCMA 3Q10A 3TQQA 3HLKA 4CUKA 2AJYH 1Q94B 5L7XH 4OI0A 4OF8A 4X44A 3U49A 2VM3A 6PCYA 4MNGE 5AWFC 1I7UA 2QQQA 1G4RA 3PEFA 1KOGA 4U5QA 5LYJF 1KGYE 1GDTA 1OP3K 3FUMA 1GIAA 4LSSL 3OURA 1TE2A 1AKJD 1WHSB 3GRFA 3VXUE 2QRGA 2N4IA 4JXJA 5JHAA 2DUWA 3MZGB 1SK9A 1ECGA 3JAKA 1J5PA 5FFOA 4MR9A 1XPJA 3S6JA 3TXXA 2BC9A 3L4XA 5GJSH 3E9YA 2FGZA 1XR8B 4JCOA 3IAAA 5FLVA 1E2KA 3HEBA 4CNIB 2J6CA 2KL6A 4PGCA 2BGNA 2HC9A 4GWKA 4IQGA 4U3SB 3BGOS 4JG9A 3A31A 4QJ3B 4ZAKA 4QZVA 4IH4A 5J6GB 2EJCA 3UPUA 3I3DA 5HIAA 4AJEA 4BSJA 2GJZA 3A23A 3PREA 4W9LC 2QZ4A 2Z98A 2X0RA 2FY8A 2Q87A 2EJBA 3GHEL 2J9FA 3TTYA 3HUJA 2X12A 1EM6A 5IF0B 3PUCA 4BA8A 5F2NA 3NRQA 5AYVA 4H60A 1IULA 4JI7B 1R46A 4IWNA 3HBZA 2XA2A 1U2PA 2RHEA 1R2QA 1U4FA 1IO4C 3WNOA 1KAQA 3NFRA 1NM9A 3V00A 1VE5A 1RFLA 3AETB 2FF7A 1R17A 4ZRGA 1ULZA 3SDAD 4DEWA 5EN2A 2WUDA 1MJJB 1EJOL 4PTZA 1QNFA 4AM0Q 1USUA 3L16A 1VG0B 2VYQA 3NJHA 1B0RB 3KL3A 5JIHA 2YWJA 4X9HA 2NNXA 1LLCA 2I9KA 1RU9L 5FM5M 1P74A 1OP4A 3O4LD 4GRLC 3A3OA 1TX4B 5TC4A 4IM7A 5LYYA 1ZSYA 3NEEA 3QULA 4G0MA 4IJQA 2XNHA 1QUNB 1SKAA 3SPCA 2V7PA 4HQRA 1DBQA 5BS0B 4UAGA 1NIEA 4KHTH 1MCNA 1WLYA 3AVWA 1U8NA 2ZRNA 1OGAE 5DHYA 4I13B 3IURA 1B42A 3WLAA 3OE7A 3T3EA 5JMOA 1AX9A 3CRMA 2AZUA 2HSGA 3B3FA 2Z8ZA 5CVUA 2GI7A 1NAKL 1BXGA 4Y1RB 4MEAA 5ICYA 1JMXA 2PR7A 1KJMA 3ZHQA 3CJRA 3C6BA 4PJIB 2PNJA 3PHCA 1BWRA 1E2BA 2B21A 1G19A 5EJ8A 1Y9JA 2IVZA 5C8VA 2FWJA 3K09A 5AJZA 5JPIA 1U8CA 1ZD6A 3MROA 1A9SA 1ZPUA 4RVBA 5BN4A 2VP5A 5DGHA 3WR5A 4OJAA 5CA0A 4EZBA 4X66B 2WAXA 4HH0A 1SRQA 1ETJA 5CTAA 3Q88A 3UH8A 4BLQA 2WV9A 4XCYB 4QO7A 5FJIA 3RUGA 4NQCA 4M0DA 2UXVA 3E5NA 2Z5GA 2Z91B 1DJPA 1D1SA 5EKTA 3OZAA 3WUWB 1LDEA 1M8FA 3AR6A 3R5JA 2E27L 2ID4A 3ITKA 2V6IA 3IPBA 3ZTDC 3DIFA 1DV1A 2Y77A 3A6CH 2LGNA 4MAYD 1B6UA 2WXOA 3Q3GB 3OOYA 1I9JL 3IT2A 3VV3A 3K73O 1F11A 2E89A 2YWHA 5EU3A 3FSWA 1JNHB 2D2OA 3AP1A 4NZYA 1E1MA 2PGOA 3UG4A 1JERA 4MDRA 3A9SA 1M33A 4XH2B 3I9V1 4Z7WA 2D2VA 3E8SA 3M4YA 3OC5A 2NTJA 5KYYB 2ZBVA 2BMVA 2ZOLA 1AR2A 1YMHA 2J3EA 1T24A 2LBPA 3UJTH 1G9HA 4KLCA 5GINE 1U9IC 1MCEA 4BEIA 3TFQA 2AVGA 4IU2B 1MCDA 2ITFA 4Q19A 4U1LA 3WJAA 5FW8A 1KGXA 3ROMA 3GRWH 2N7BA 3P0VH 2H9GB 5JSKA 4YUAA 2QADC 3TASA 5GS1B 1A7RH 1GDDA 1CIJA 1Z0DA 2WOBA 2ZDQA 1IRXA 4E9TA 4V0OA 3T1TA 5SWZB 4AURA 3OZIA 3A3KA 2M6LA 1VPLA 4B9JA 4PS4H 3NV7A 1YF3A 2AFVA 1X7XA 1KTRL 1CJYA 4RCYA 1ILWA 2IYFA 3EO9H 4KVZA 3GMOA 3QEQB 1TMYA 3IGUA 1T9BA 5KVEE 3B6IA 4KAJA 3O41B 3T6QC 1T0MA 4JL6A 2P49B 4TVKA 5SWSE 1NIDA 5AOVA 4XPAL 2VXUH 4JO5A 4P04A 3O45A 2FLVA 1FIEA 2XMGA 4ZVPA 5K0FA 5T8KC 4K9EL 1T2FA 2BP7B 3NG1A 3CSUA 2D3NA 1QDUA 5DC4B 1PU0A 3I9JA 3OQ3B 4J3XA 3BZEB 1SHJA 4H3SA 4OIIL 4D7AA 1YCSA 4UINL 2V4UA 4A26A 5DSCB 2FR0A 3CDZB 1DIGA 3LEVL 1DVRA 1CW2B 2DFVA 2QZSA 4TPRL 2R0WH 5TH2B 2PZEA 3IPYA 1UHVA 4C7XA 2DHRA 1NXOA 3AB0C 4BO3A 3O26A 1JRHH 3VXOB 4MA7H 1HL5A 1RZVA 1N2SA 4HGYA 3DFIA 3FXAA 3EXG2 2UUAB 1UP7A 4GOMD 2MCFA 2EZUA 1PKQE 4HCFA 3S4SG 5EQTA 4EVNB 3G08B 4RDHA 2Z8RA 1YNKL 4OLZH 5MENB 3PSAA 3LKSB 5TMBA 3CW8X 3QWRD 3P0GB 3MJRA 3Q9QA 2YQ2A 3FN3A 4NI5A 5SY6A 4BK8A 2BRRH 1MIHA 2DDQL 2B99A 3RV4A 1NR1A 1ZHKA 4U1GC 1R8XA 3D8NA 1YS4A 4TS9A 5JLAA 5KJ7E 1FFRA 4XZ3A 5TDPB 3IDNA 1XZAA 2OCDA 3KJNA 3RIXA 2P41A 3BCFA 2V65A 3BM5A 1G94A 1XT5A 3PIQA 1XX6A 1P9RA 4ZD3H 1RDFA 4YVNA 3W9EA 2JIOA 1QRKA 2O2SA 1QO0D 1AZBA 1T8RA 1P69B 4TVPL 1OIWA 3M5PA 3MCKA 3W1VA 1V1RA 4Z53A 3UNXA 4LSTH 1VRCA 4YJGA 2ZITA 3WK5A 3BYZA 5B5SA 2SCUA 2WXIA 3EIWA 2MOGA 3QNZA 3CSYA 5PNTA 1MREH 5K6TA 2V7QD 1Z5LB 5DYYA 121PA 1I1YA 4LSRH 1GY2A 3LGSA 4LGCA 4BBAA 1JGDA 1BF5A 1ZNZA 2FWIA 3SF8A 2Y6SD 4GZ8A 1KERA 4QSMA 2R15A 5F1OA 3AWEA 5ABZA 4TLUA 1ULSA 3C8KB 1M10A 1CICD 1XTTA 5GIRB 3M2PA 1ECZA 2DIJA 1GVNB 1AQNA 1H6EA 4ZKEA 4KROC 2AZAA 4XMPH 4KR0A 2R29A 1BMFD 2HLAB 3SLGA 3FK3A 1RKRA 2JHAA 2YIVX 1Q9WA 5IHZA 5DHSA 3TW8A 1UP4A 3TBWB 3DBRA 1V26A 1XMEB 3DK2A 3V6BR 1P1CA 2JIRA 1YKFA 4X6LA 4KXXA 4NNPA 4ONGH 4K5QA 1S7SA 3R7SA 3Q41A 1E9VA 1YACA 4P5TB 3LZPA 2X5JO 5JSFA 5JCJA 1SBSH 5CHEA 1WC7B 3VDAA 3VD4A 1JVOA 1OI3A 4B5KA 1RZJL 3B1VA 3SQRA 3G7NA 3MTGA 5DDHB 4XJXA 4NARA 2D06A 2HMID 3W7VA 4CMCA 1BFSA 1OWOA 3K0HA 4XUCA 4XPFL 1G42A 4I3FA 3TS1A 4KGVA 2INGX 1Q9LA 2XTAA 3FY4A 4NEHB 3RPIA 2HV8A 5KSBB 4H1VA 4E5YA 4B9IA 4N24A 5FL3A 5E4EB 1C8PA 2PKWA 3W82A 4G6FD 2PYEA 4FG6C 3QKSA 3WTVA 1NVGA 5FWRA 5FV7A 4HSAC 4KCGA 2Y27A 4ZEWA 1XFPA 1GU7A 4MVJP 2AIRA 3GJ0A 1JS1X 1WVZA 5HTSA 3UGEA 4X4YA 3WTWA 2EXTA 1J0DA 3M89A 3QV1A 4UQAA 4H16A 1J2YA 3FO2B 2VT3A 2V5AA 1B1CA 4XYGA 5I1IL 1E4WL 1EFXA 2C5AA 1T7WA 3BK1A 2MINB 4MQ5A 2M1KA 4I55F 1UOVA 3X12A 1GPOH 4E0RB 4DCGA 2X6VA 5ADHA 3FVWA 3U7IA 1C7IA 4UQ2A 2WOJA 2R1XA 4CR8A 2QT6A 2ANBA 5FIUA 2WLHA 3M3PA 1UKSA 3D07A 1RHFA 4PJHE 4LHYA 2QD1A 1V96A 2VDML 2BVPA 5BSMA 3FOMA 2QMZA 5FO8B 4F9PA 2KQUA 4ZBJA 3T1NA 4KIJA 4TV9F 4Q0XH 4X6EA 4BP1A 2VDQL 1WWBX 4MQXC 1V3UA 4OFDA 2BR3A 5C3LD 2XI9A 5I73C 4PHHA 1A9XA 4H8WL 4G81A 1VMAA 1W47A 4QRTB 2K78A 5F7NC 3HBJA 3V5KA 3RT9A 1Z9MA 2JI6A 4ZI7B 1A14H 4G8JA 3C60D 1G17A 3LBHA 1CCZA 1IQWH 1UT6A 4C4YA 1FNGB 1OB2A 1BKYA 4I2NA 4RSHA 1VB3A 4O2BB 2D31B 3U1SL 3GMIA 5BNIA 3KTFA 3DAHA 4FTVB 4I46A 4P22A 4JUTA 4D8YA 2B3DA 5EULV 2MCAA 4CHTA 2ZIEA 4CC4C 1RAFA 3DHPA 2ZXEA 2FV8A 3NTQA 3VFWB 4FGUA 1OAKL 5KI6A 5ITBL 2F3RA 5DX1A 4BFRA 2O0KA 4JDTH 5ALVA 1P1JA 1AGBB 4FNGA 4BD4A 1G6RB 1FMTA 3IMGA 4NQSA 2MQ3A 1HDOA 3FOEC 4UVIA 3ZR4B 1HPLA 1ZK2A 5A7GA 3QBVA 2WTXA 3KRTA 5IBTL 4BFFA 3M3HA 5F7OA 3KT3A 4GBXA 4IBUA 4DT1B 2E48A 2QMQA 4FSXA 5L4IA 1R3DA 3WP1B 5IVDA 4E9XA 1OASA 1N77A 4EVQA 1MJ8H 1NVTA 1SKYE 1NX6A 1B2YA 2WHVA 2XN9A 5DOVA 3HV2A 5GP1A 4P1ZA 4H7PA 3S3TA 2NY2C 1A8IA 5CGYD 4NQVB 4CMHC 3K0BA 3WTCA 5AAPA 5KHAA 4HULB 3NXKA 2C0PA 1KLUA 4M02A 3MGTA 3B2NA 2GERA 1CYXA 2Q3BA 5HDRA 3QIBB 3RZCD 1H23A 3WFCH 1XK7A 1HDEA 2IU3A 3QVTA 3ZDYE 1IT9L 3E48A 5AT1A 4E4YA 5JNWA 5FPIA 2ALWA 5LZ5A 3X1KA 3G5YB 4DEPC 4FN5A 1XTKA 1KXVA 1VJSA 5JO5B 3MLZL 4DMCA 3QVJA 3CG8A 2OX5A 4TVPD 4OCSL 5IQ9B 3JW8A 5F2OA 1E3MA 3JV6B 1W30A 3Q2CA 1YBHA 4O4JF 3DV4B 1UGKA 2QKIA 4LL4A 2QRHA 2YR0A 2IODA 4XE0A 5SICE 2C61A 5C0NC 3P3UA 3T7SA 3QDGB 2X0EA 4NQQA 4NBVA 3GLFA 1FS5A 4YTEA 3LTEA 3UY4A 3U7GA 2QV2A 4LE2A 5JXAL 2R2AA 4XPHL 3ILPA 2FO4A 1ORSB 3ZGXA 3GBSA 4PCTA 1XZBA 4Y2XA 2X77A 1TPZA 3GPLA 2GK6A 1TETL 1NPNA 1QB7A 4HS3B 1Z56C 8CGTA 1KI9A 2YUVA 4IGKA 2G04A 3BVXA 5I0ZA 1ZOIA 4JFFE 4MB6A 5DZPA 4GC9A 4Z4IA 3RY6A 1T1EA 1O0BA 5BNFA 3WGUB 3IEPA 1JQBA 5KYUA 4BFOA 1F4VA 2GN8A 4IGFA 3Q2IA 2PX5A 1CT9A 2IWHA 1IVLA 4RKRA 3IS0X 1IFGA 2IDCA 4FVTA 5DFVC 3H85A 4FCWA 3ORQA 3OICA 1U7HA 4EG5A 1Q1PA 4UFNA 5J9FA 2BINA 1GC1C 5E8PA 1NCDL 1DWPA 2FAUA 2V5VA 1OAOA 1AHPA 5JC8A 2OAAA 4X00A 4M8NE 4DO4A 2JXMA 3GVHA 4LCWD 1KYTA 1O95A 1Y6MR 1HDZA 1STOA 1LV7A 1H8HA 1OD9A 5AB0A 4OTXL 1TK9A 3X3FH 1D4ZA 1SCIA 3H04A 2ZPKH 2R3SA 1CLZH 1PG5A 4AF7A 2B4AA 3L3GB 2Z2XA 1WBYB 4YZFF 1YVEI 3FF1A 4MKRA 3PABA 2GJ9A 4HJIA 2GPYA 1UJMA 2ZNWA 2WHYA 1I3OA 3QARA 4GRMB 1UFUA 3IJHB 1Q83A 1Q3KA 1JHDA 3BWSA 1RKXA 4YDVB 2IGTA 3L6FB 3OIYA 5D1ZA 3H9SD 3GIZL 1OLUB 1MX3A 1P61B 3NDPA 4NYJQ 3ZVKA 4P4GA 4C1BA 3VDQA 2X58A 4JZJB 4S04A 1N5RA 5GGRA 5D2CA 3UICA 3EPJA 2XTJB 5KSOA 1ZEAH 1N2CE 5IK2D 1MZZA 1UBHS 2YOHA 2VR6A 1TL7C 4C05A 3OUZA 1GGIL 4HJGA 2NY1B 3N0VA 2CNKA 1JSRA 1WW3A 2UVPB 4QPJC 3IVMA 4FONA 4QUJA 3KOYA 3RCBA 3JWIA 2VYRE 4WA7A 4AKGA 4Q6WA 1QRNB 5DCLA 2FN7A 3MRBB 2O2CA 2ZTSA 3C3MA 4JSYA 2PMWB 4FI6A 5HYQA 4YP1A 1OAZL 3WS3B 3ENNA 3W9DA 3FI9A 2ROQA 5HS6A 3N07A 2GYVA 2N9UA 2ZTUA 4FIZA 2VYVA 3FE2A 4GMKA 6Q21A 4MXQD 3BB1A 4PHGA 3QLEA 1AHWA 4JB3A 2XWBA 2QD5A 2VLJD 4ZAGA 1FA4A 5FOVA 1G2IA 3K72B 1YB4A 4G09A 4C14A 3EB9A 4WHCA 3KCPB 3LQKA 4LYHA 1DQVA 1AQKL 1P7VA 5CJOL 3NT4A 3GWZA 2OXEA 3L54A 4FFDA 1Y63A 3M1BB 2OBGA 3SOTA 4HN2A 5EC1A 2XKAA 4Y2DD 1F2TA 3RHFA 1WD5A 5ESQB 2NUPB 1K85A 1X7WB 5C08B 4B9YA 5IJKC 4AT1A 2JQMA 1IC4L 2IY7A 4R1MA 3VYWA 4N3GA 3T2PA 4QNPF 3ZW7A 3GHPA 3UAWA 2ZS9A 3H9YA 5AVWB 3GWJA 3FMGL 4D79A 3W5DA 3I74A 2B25A 3A10A 4XCCL 3MHPA 5EUKB 2NCEA 3W11C 2WHQA 4ZW3A 2E47A 4OZ4A 3GJZA 3GU3A 2XB9A 3QLJA 2WQUA 3ARGB 2V7XA 2TSAA 1ISJA 3WGMA 4D3CH 1RYNA 2OZVA 1FNCA 1MAUA 3MV01 1KEGL 4KNWA 4M46A 3QUXD 1OWPA 1M53A 1N34B 2FX2A 1FJ1B 1T3LA 1SYVA 4ODVH 2JBWA 4UAHA 4BZYA 5JHDB 2QHRL 5EIIA 3O3DA 3TN0C 2ZUDA 2YXEA 4PJ7A 3S3BB 2J6HA 1IIIA 3GZPA 4TTPA 1F3JB 1Z35A 5BW8A 1J0XO 2GCYA 4CQNA 1G21A 5CAEB 4JJIA 4D96A 3MRIB 1C30A 1SQSA 2O3JA 3D2UA 1OVZA 4B95C 4HXYA 721PA 5JPMA 2ZREA 3P0YL 2ZP0T 4LJ9A 3OLGA 2CGRL 2GUYA 2C34A 3X1EA 3WO4B 2ZQKA 1TQWA 2Z5LA 5GM2A 5T1LB 5GRVL 2V6FA 2WD9A 4K23L 3AMKA 2Q1UA 1XTPA 3CX4A 4H1HA 1COWD 4N25A 4Z7IA 3PEVA 1X9QA 3FUWA 2QR0A 3RSLA 2YR3A 2DQTL 3NACH 1BEEA 1V3LA 3AH8A 1QFWH 4WNYA 2DEWX 2YV1A 3COJA 2IALB 3EXFB 3D9AL 4RJLA 4MUBA 3WLBA 2P7IA 3O0RL 1N36B 4LVOB 1A5SB 4FLOA 3R3SA 5T5QA 2A5FA 1PG7W 1DPFA 1X5KA 2ZS7A 1RFDL 1GY1A 5HI5C 4PR3A 3BXOA 3LZCA 3SY0A 5D1XA 2PPEA 4MTMA 3SDCD 4YDKH 4WX2B 2A5GA 3S5ZA 2ZBUA 3WICA 2AABL 1BVHA 4FR5A 1Z0AA 4RXUA 5EU4B 2RAMA 3ZNQA 1UADA 1L3WA 4RMGA 2GO1A 2WNGA 1VL2A 4JJ5B 1ZT1B 3P4UA 3V1NA 1FGNH 1CFQA 4EX7A 4Q6KA 2X0KA 4NYIQ 1TMGE 2BVTA 4LY0A 4HGNA 1ACLA 3SBWA 1QU2A 4HKZA 2G9HB 3TZVD 2WAOA 5ABPA 2AJLI 4FP8L 1J7JA 2Z1MA 2BDNH 4C6SA 3ELYA 3JVVA 5ALMA 2WAHA 3VSAA 2GJRA 4AX3A 2ZCZA 1D0IA 1M9NA 5B7PA 4BGDA 1EVKA 1WKBA 4R96B 5EIHA 3O6KH 2YKLH 4ND4A 2WP3O 5FYKU 1NW8A 1O7DE 2B1GA 4I5FA 1R10A 2VR9A 2DJMA 1CC1S 1EEQA 4BYHA 2HWZH 1H2XA 3T0ED 4KR7A 1KJIA 2C4KA 4HWEL 4L6IA 3J7AC 4FXGB 2CVQA 3ZDQA 3QMWA 5EHIA 2FHPA 1FORH 5ESAA 2VNKA 3BLKA 2NY6B 3IMBA 2ADGA 2DWUA 4RJIA 3VB8A 4TKZA 1YEGH 4HSCX 5K3BA 4WTZA 1YNLH 3LZRA 2UZYA 3ZCRA 2WI8A 1DQDH 5TF1H 2AI3A 2PYZA 3I52A 3QEHB 4ORGA 2QVTA 3ZWXA 3CINA 1F0PA 2Y67A 4UQEA 2HRCA 1KQGA 2EZ9A 3VXME 3CH1B 3E3LA 1N7ML 4CC0A 3SN6A 5D2LB 1O3YA 2QSCL 1GPLA 4REOA 2XXAB 5E1DA 4ZD6A 2X22A 2QN1A 1X9RA 1Y8QA 5K6RA 5EHFA 1CIUA 2VDMB 4RMQA 4X83A 4ANUA 4KACA 3UJJL 1SCUB 5TF4A 2W00A 1YNTF 1J6UA 4P80A 3FQRA 3C6LC 4PWGA 1FDTA 2YK1L 2WZCA 5K0SA 2O05A 5DI8A 4QHMB 1NZRA 5BWMA 4XMLL 5IMBA 4E2WA 3A21A 1NVBA 5BYKA 5HKAA 1ZGZA 1DKLA 2TSBA 2VZEA 4XVRA 3JTTA 3UJCA 1MCOH 1E2PA 4CL7A 4PEVA 3UVEA 1OI2A 4P2BA 4OM1L 1NGYB 4F58L 3H5VA 4M7OA 4A5SA 1Y1PA 1SOSA 3MLRL 3ARUA 3MWEB 2L7JA 3UAVA 5DEZA 3ZHRA 4HDCA 4FGMA 1I14A 1QHOA 2EIKB 2YXMA 4B48A 2C78A 3EIFA 4DREA 2WHPA 3FETA 3RUDA 3VYUB 4P2QB 1NY6A 1GGBL 3U5TA 3WK7A 1U8JB 4CKWB 3K0YA 5DHQA 4ZXBD 2DQCH 1R0ZA 3UKOA 1QSVA 1CXLA 3FO1B 4OQTA 4ER6A 4XN2A 3FNIA 3E5MA 1AXIB 5D4JA 4WY5A 4A7TA 3VC3A 5JCOC 3S4YA 4RH0A 2WT9A 2E4ZA 2N3ZA 4UEOA 3VMNA 5LA6F 1GSKA 3WE1A 5AHWA 4YAOA 2GBVA 1FLRL 3B2DC 4HK3N 5GZOA 1NW3A 5D84A 2XFGB 3M4ZA 4O2FB 4V11A 3E1GA 4DJEC 3IPCA 4U1JB 2ZU0C 4FDAA 4NCDA 4NV1A 4PPNA 4XVUA 1EJFA 4JPVL 2NY3C 5KKCA 1V2GA 2Q5IA 1E1NA 2NY0D 4UE3S 1FIGH 2PLTA 2NIPA 3W5CA 4TPKA 3QMPA 5BN5A 1OF2A 1MNQA 5EQDA 3ATFA 1KTBA 3W0LB 1NW5A 4QTFA 5TF0A 4ZOBA 4LVCA 1KG0A 4AKQA 3QISA 5A3VA 3RF6A 2O59A 3D85D 4BMSA 2BJHA 2Y2YA 5K9OB 1NGSA 4N8CL 1OA1A 3JZ7A 4TYUA 1S8AA 4NPCA 5ALSA 4N9OB 2ZYWX 4Y4FB 2I7XA 1A47A 2FTAA 3THYA 4YX2L 4U1SA 3U2QA 3QR2A 4CF3A 3A4IA 2I3GA 3MRNB 4X5LA 4B4DA 4HWPA 4PY2A 1JZFA 5AESA 2VERA 2J8UF 3CNKA 4PC7A 3BULA 1MHHA 4PS7A 2B4TO 2CLFB 4NMXB 4OLWH 3PNBA 3OMXA 5EWJA 1DEEB 4JVSB 2CKDA 2GMWA 4O1MA 4PO1A 3E9RA 4EW2A 4U7JA 4EYSA 2WYVA 6CHYA 2O61B 2FECI 2E9GA 1R75A 3OMIB 2ZAHA 1GPWB 4CGZA 1B88A 2E85A 3BZDA 2P2YA 2A1WL 4YBLC 4WBXC 5JHMA 2XDQB 4MLZA 1XCGB 4I81A 2CBMA 2R29H 4FNRA 4YHNB 5C8YF 2JFYA 3RTAA 3FSEA 5JW4M 2PKCA 4D8VA 2PGIA 3BPCA 2YPLB 5DS2A 2V98A 4F9TA 2RAPA 3H2GA 1UMCA 2OAP1 1V5EA 4R0LA 1ECLA 3ZDAA 5HGDB 3HXPA 2SICE 1GAFL 4MSUA 4NNPH 1E0KA 3F83A 3E2HB 3HMXA 4X1YA 2IQ5A 4F2ME 1L7NA 4WBNA 1H5UA 1P4JA 1V7CA 3A4EA 4JB2A 2YSSA 4YCSA 1Y37A 3C5ZD 3EO0B 2MH4A 3P4YA 1EFKA 3GSUA 4RGNC 1EFRA 3EZ7A 3W3ZB 1DQQB 3BZ4B 4AI7A 4KFSA 2KZ1B 2NX5B 1TYZA 1A8QA 2ZSFA 2OMUA 1XVIA 2KH2B 3IBEA 4ADIA 4JLRA 2Z3WA 2AP2A 4G0NA 4XUEA 2WHEA 4EEZA 4G43B 2EABA 4TS1A 1RLTA 3KJGA 3GF8A 3AV3A 1XCMA 3GAFA 2JFBA 2CLVA 3U7JA 5KJFA 4BV8A 1P84K 4L8WB 1NYTA 4F7TB 2K6ZA 1Z39A 5JSZB 1IGYB 3N1FC 4ZYXA 2R6AA 5C6TL 2OMWA 4H0GA 4WV1A 3EFOA 5IJ9A 5JADA 4PLFA 4NU6A 4OU4A 2HT3C 3MOQA 3CIAA 3OTQA 4HF7A 3QZMA 3I64A 1NICA 4MMXC 1J48A 1MNAA 3H2PA 2E9SA 3EIHA 4B3XA 3V55A 4BO7A 3GEFA 2HLHA 2C8VA 1TU2B 5AUNB 2EO7A 2DQDL 2O4CA 4A8PA 3JWDC 1KY6A 4A1RA 5IWLC 2Z4QA 5IJCC 5AUMB 1RHQA 5C0DB 2LV8A 4FILA 2OAQ1 1T5WB 3LCMA 2ZKWA 4FEGA 3NN8B 3E38A 1TM7E 3KKQA 1NEUA 4Y88A 5E8RA 2LUOA 1F6FB 1TLMA 4JZOA 4FLEA 4Z7NF 4GDMA 2EXWC 1V3QE 5DUML 4UZFA 2P4SA 1QRRA 3ESVF 1LD9A 1SB8A 2FR1A 3OI7A 4DLTA 1DAFA 4IQ4A 2FZVA 4QUOA 4C5AA 2HVKB 2VH5H 5AKXA 2FD6L 4HWNA 4JFHD 2ZJYA 3AY3A 3U0PB 3ATBA 4JDZB 1T0BA 3ZS9A 1LP9E 1O6SA 4P2OD 5KCZA 1JBJA 4FD2A 1PSKH 1MEEA 1UZGA 1QI3A 3PX2A 4XWKA 2WSYB 5D7JB 1ZPLA 4HGWB 5BYAA 2FPGA 4FNSA 2WM8A 4S0SD 4ZI3A 4YY3B 3VSVA 2FJFA 2GABA 4ZTEA 4IL5A 4JXXA 5LN8A 1F1JA 4UT9L 3MMNA 5AVSA 4JQCA 3AVEA 5CX4A 3T3PF 1V9CA 4MNTA 1AB6A 4CQLB 1GYUA 3O3AB 1T4GA 2EDHA 1SJEB 2DPXA 3CCFA 5LGJA 2A5YB 3PWPE 2CQVA 1T6XA 1KNXA 2DLTA 4FZEH 3KR9A 3BXFA 3S2SA 4NC2B 1NBMA 4P2RD 2O5XH 1FQ9C 2ODNA 5HY9A 4YUWA 2P91A 2XIDA 2NNAB 4DGVL 3ZV6A 5C7XL 3VNUA 1CCWA 4LC1A 1E4HA 4L9DA 4PV8B 5HDQL 4RNCA 4NM8L 2HREA 4FJZA 2QE6A 3WFHA 1GTG1 1DKOA 3PWLB 1K5HA 4KK4A 1H3NA 1UC8A 2F58L 1XNHA 5I9LA 3QHFL 3UJIH 4J03A 2FATL 2UZ1A 1ID5I 3EG5A 1EWTA 3HKBA 2JATA 2X4UB 2GBUA 2IP1A 5E99L 4BPBA 3KW8A 5K8TA 4WKNA 2CLZA 3A9TA 4I18B 1Q4NX 4MCHA 1PEKE 3L7DA 1WCBA 2X4RA 4JBLA 4JT9A 3TIDA 1ZUHA 1V25A 2FGWH 5HGBA 3N43B 1PLJA 3IEUA 2WP3T 2GM5A 2VSQA 4GC5A 3MV7A 4GWGA 4JHLA 4YE4L 1DBWA 1X5XA 3VBEA 3CUTA 2R4TA 2ODBA 1QG2A 1FPTH 1FBNA 3DMFA 4LYGA 4OB6A 1QQ7A 3TWOA 3AL9A 1BQHA 1XK6A 5E1QA 1X2EA 2ZUQC 3FXIC 4LKRA 3K2KA 3WNNA 3FTNA 4RAUB 2DECA 2C7VA 3EJPA 4DP6X 1IY0A 5DJ5A 2WO2B 1L3BA 1IBFA 2F9BT 2C7GA 3AUJB 3OAAA 1O5PA 2QRMA 1KPUB 2P8MB 3SYMA 5LQAA 2PW2A 2W71A 1VZHA 3JAWA 4WNQA 2C7RA 3NCCB 3AEKB 3PIDA 5D5MB 4MD5A 4ZFZB 1W8IA 2RGSA 2HHJA 4XIGS 4PWEA 3OJVC 3MCLL 3CS3A 1L9TA 1NCAL 2PEZA 1CF8L 4JFPB 4K3JB 3E1ZA 2OFQA 3JALB 1GKIA 4U6YA 4HP8A 3SEFA 1DSFL 5G0WA 4AYFB 4PD4K 2V33A 3IJEA 1RWPA 3CQ9A 1W73A 2G4EA 1AGNA 1W581 3PQ8A 4MDHA 4DETA 4PJGE 2WEKA 1JRHI 2QXTA 4E41B 5KAPA 3SC3A 4CMIB 1TQHA 5DO9A 2H11A 4RFVA 2YEZB 5AHKA 1AZZC 2J1YA 2XVBA 2VXYA 2QY9A 2C5EA 3LRGA 5CK4A 1UJTA 4OF7A 2QT1A 4N5UA 2W60B 1EINA 3QFDB 3ESZA 5ICGA 3M4JA 2WKSA 2PCPB 3KPNB 3ZUCA 4N0FB 2X2IA 1ZV9A 5F9AC 1AGCB 4NNOA 3UYPB 4JYMA 2H4JA 1DVXA 4A0SA 5TVGA 3CDYA 3FT1A 1DSSG 3EVFA 5I6PA 1HR0B 4QX6A 4TLEA 3VBCA 4Y7DA 1UJ2A 4AIIA 4H8HA 3QJTB 4N5ED 1UJBA 3OXRA 2J6EL 3UM9A 2CEKA 1TQ6A 3MAWA 2Q1TA 2D0HA 2GYYA 2O23A 4NC9A 2EZ4A 2FX9H 1SXBA 3FMIA 4IIUA 3DSFH 3UGXA 1GPAA 4L3FA 1QI5A 5IFAL 3SODB 1PLGH 2QN6A 2LLNA 3ORYA 2XV3A 4NZ8A 4ROTA 2XV2A 1NDTA 4KQ0A 2B69A 1XQYA 2H1WA 3G9VA 2WIAA 5KS9B 3B6SB 4WI3A 4QFMA 3ZVLA 4Z3HA 4C59B 3DUUA 2V17H 1F5NA 4ELME 5LDHA 1YTLA 2D3WA 3JTSA 2RK4A 3IFLH 1K8IB 3JAMA 4JQXC 2EBUA 3V1TC 5MN6A 5DNYB 1PJZA 4JDEB 3CCHB 5KJ1A 5HGHA 3GMPA 4ZMLA 4ZJPA 5IC5A 1JIQA 4TYWA 3ND5A 5AKJA 1PZBA 3BAEH 1FVXA 2I03A 4MEJA 1LLAA 4JVMA 4OZGA 5MP6H 3P11H 3N41B 1EVIA 4X94A 3FUUA 5KHLB 1CRQA 5JXEA 3BF8A 3FWPA 1Q2UA 3OP1A 2HU5A 1GQRA 2QF7A 4O2CB 3A1VA 2GX6A 3RRYA 1NLDH 1D6VH 3HCVB 5EJ5A 2BY2A 4L8YA 4E7PA 4NJ9L 4C58B 1ZD2P 4P46B 4ICIA 1KTKE 1D07A 2IY8A 1OFUA 2V03A 2L17A 3OGCA 5B2ZA 2BKLA 2GD2A 1NW4A 1JP5A 4DLPA 3ECWA 3UHAA 1DP0A 1TVKA 1XDGA 4NJEB 4U7PB 1GNLA 5FUCC 3OM8A 3S37X 5FD8A 1BHQ1 5HDOA 2J1ZA 4X6FA 1L5QA 3P4LA 3GJRA 2ALJA 3LHKA 2BNQB 1JV5B 4G7SB 4X71A 2IRWA 1TFRA 3K94A 4V03A 1CR6A 2PBZA 1W6WA 3TBSA 4QXUL 1IBYA 5FBZA 4X6DB 1EGQA 4K6OA 3MREB 1N3NB 1E1DA 3DRQA 3DEKA 3COOA 1SXJD 4PVCA 3APNA 1I7ZA 4LIPD 4S1VA 1X38A 4JFED 3LPOA 2ERJB 3DYIA 3PUIA 3H75A 1VADA 3CHQA 3TLGB 2QX7A 4GOJA 1V54B 3LH2L 4OUKX 2LE0A 3VH1A 5KQGA 1U90A 1XL4A 1UYWH 4A6DA 5JHLL 1IB0A 4PZ0A 3BGMB 5AVKA 2W6JA 4ALLA 3B7RL 5DLDA 3H3JA 1OQOA 4ZARA 2C07A 1B2RA 3L08A 1DFXA 4UMFA 4UUJA 3DYPA 5T3XD 4AT6B 5AKIA 4CR6A 1HG0A 4MROA 3HQ4O 3U7EB 3LTVA 5ALXA 1T8PA 1A7OH 4J2OA 4HG2A 4FC6A 3DCNA 3EGCA 1WSBA 3DOSB 4YL9A 4XGQA 5DTJA 3RBZA 3PE4A 5EFIA 3L6DA 5C0BB 2ZETA 1XZHA 3OAZH 1CUWA 1D1PA 1K0FA 5GS0D 4ADGA 4XDZA 5G1OA 4CEIA 4OAWB 2E3JA 4J6IA 1T9AA 1Z12A 2A59A 4X62B 1MB2A 5CD1A 2G5GX 1UZ8A 1SPBS 3CE9A 4PTLA 1QFHA 2B16A 2O5CA 5TVKA 1QHQA 5BRJA 1MCPL 1NIJA 1RZ8B 3DVGB 4N9GB 3LHSA 3P4NB 4GBJA 5I15H 1XIWA 2JRLA 4NAVA 4W5WA 2R0KL 4YT8A 4M1DL 5DJYA 4IGBB 3C3JA 3ARDB 2HBQA 1FZKB 3U0TA 1HHJA 2C2BA 2BI8A 2J88H 3CSGA 3DETD 1M2OA 4XX1A 3RVNA 4BMOB 3BIOA 5EIAA 3FU3A 3HEMA 2CCGA 4P7GA 1EFTA 4H0FA 1E27B 5E6IB 4QIRA 7AT1A 3VPBA 2B8WA 4XVCA 1CI5A 4XOIA 3ZQUA 2YQBA 1A1NA 3HG1D 4LHEA 3GLHB 3CC5B 1QPXA 1FLTX 2QLLA 4LOVA 3SE8L 4TTGA 3FOLB 3QNMA 4DGYL 2AG6A 4AJ1A 3F5FA 2FQEA 3ADBA 1R5BA 1NQBA 2Z7ZA 3AU1B 8MHTA 3ZE1E 5KNDD 5AM3A 4D2NA 5GS3A 5HRCA 4YWHA 4IJVA 4OHOA 5D4HA 3QPKA 2J3JA 3AXHA 2VN3A 3OEED 2YUXA 3MYRA 4DB4A 4HF5H 2XKBA 1U02A 2BEJA 2C4MA 3DGGB 1FJGB 4R90H 2ZU6A 4OGAD 2A9NL 1DU4A 5JOFA 3ZE2F 4AENA 5HQ3B 4PNZA 4YOKA 1WP9A 3L8FA 4JFRA 5CT8A 4QTXA 4MFHA 2ZAMA 1Z6QA 3JQFC 4M54A 2VQEB 4UUAA 1E4EB 4NQEE 5UKDA 4HBCH 1BYIA 4KZDL 2HMWA 2FB4L 3MLYL 4PLWA 1E4XH 1AKUA 3ZY4A 1AOHA 2JJSA 3FQNB 4A15A 5E6YA 4N3BA 1FPMA 5H8WA 3F8TA 3HYCA 4IHAA 2IUFA 4KKXB 3PYMA 4F3FB 4BFCA 4QO8A 4DA9A 4Z3KA 3W8DA 2WQZA 1DFHA 4Z3FA 4X8HA 5CHYA 3Q43A 1H6DA 3T7CA 2P24B 2QTAA 4OD2B 4RK1A 2O0MA 3GIVA 3MI6A 1N59B 4AMVA 3PJNA 3ODPA 2ADFA 4RHFA 4RMUA 2ROXA 1V11A 4WWPA 2EATA 3V4LA 2R6FA 3L3BA 4U1NA 1KYQA 3CDCA 2Q3XA 3BYTA 1CR9L 5BRNA 2WWRA 3H5RA 3QOXA 1O97C 2QDWA 2Z8VC 3FAWA 4K94L 1HQ4B 5DD6A 2ZB2A 2AW2A 4R1LA 2XNSA 4KRPC 1Y7TA 2ZYGA 3PWUB 3OWXA 5DLQC 4K9PA 5IUJC 2YMMA 5KX5F 5C0FB 4OEHA 2PVPA 4IIJA 2IKQA 1OGPA 1DBPA 3CUUA 2OSBA 3O2WL 4WEEA 1MGPA 5KEZA 4FNTA 3W81A 3HE7D 2V5UA 4L8SC 3WNJA 1CXIA 1GU1A 1NOAA 1DOHA 2D1TA 2AKRB 4HCRL 1II0A 1Y4AE 5DPMA 2L0XA 1MFCH 2MHCA