3NIFB

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alphaIIB beta3
total genus 122
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nifB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nifB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nifB03
4MMZA 4O3UB 3FCSA 3K6SB 1JV2B 1AOXA 1PCXA 3PPWA 4XW2A 3OL2B 3PPXA 4K3JB 1SHYB 3OKYB 1DZIA 1JEQA 2WINI 5E6SA 3BQMB 2VDLB 3IJEA 1PD1A 4PN7A 1U8CB 4NENA 1DGQA 2ADFA 3ZE0B 1MQ9A 2O7NA 2VC2B 3PPVA 5BV8A 4Z7QB 4WK4B 3K72B 1BHO1 1IDOA 3ZDYB 3F74A 1OAKA 4WK0B 2ICAA 2P26A 4F1JA 1QCYA 3BQNB 3F78A 1SHTX 4M76B 4DMUB 1M10A 5KYYA 3EG9A 3NIGB 1JV2A 1SSLA 2X5NA 4HQNA 4UM9B 2UZYB 4MMXB 2XWBF 2NUTB 3EGDA 3N2NA 3ZDXB 1ZONA 4MMYA 4A0QA 1QC5B 5KYNA 4O02B 1AO3A 1BHQ1 4F1KA 3HXQA 4UM9D 3VI4B 3TCXB 4HQFA 3EGXA 4HQOA 5E6UB 2QTVA 4CN8A 1L5GB 5ES4B 4Z7OB 2NUPA 4C2BA 1PD0A 1FE8A 3TXAA 3EG9B 1MQAA 1PT6A 1MJNA 1IDN1 5KYUA 4FWWA 3NVQA 3EFOA 1QC5A 3NIFB 2XGGA 1RRKA 1SQ0A 1T0PA 3VI3B 4WJKB 4G1EB 5KYXB 1TYEB 1Q0PA 5HGJA 1AUQA 1T6BY 4Z7NB 3V4PB 3OKWA 5E6RA 3ZQKA 1U8CA 3E2MA 2B2XA 4UM8B 1MQ8B 1YUKA 1ZOPA 2ODPA 3EH2A 1M1UA 3TVYA 2I6QA 4HQKA 3K71A 3V4VB 3FCUB 1FNSA 1MF7A 2XWJI 1LFAA 3EFOB 1ZOOA 2VDOB 3EGDB 3FCSB 1M1XA 2NUTA 1XDDA 1M2VA 2P28A 3BN3A 3AFCA 3EOAI 3Q3GE 3T3MB 1ATZA 3K6SA 3EH1A 4MMZB 5E6RB 4HQLA 1YVPA 3T3PB 1JEQB 2NVOA 3HI6A 3QA3E 2WW8A 4NENB 4JDUA 5KYWB 3IJEB 3EGXB 1CQPA 3IBSA 3K71B 3OL2A 2VDKB 2VDRB 1NA5A 5E6SB 2VDPB 1U0OC 1L5GA 3EOBI 3PPYA 4C2AA 4CN9A 5HDBB 4C29A 3K72A 2VDQB 1RTKA 3ZE1B 1V7PC 4JX0A 1M2VB 3AL8B 4IHKA 3AL9A 1SHUX 1JEYB 4NEHB 3ZDZB 1RD4A 2I6SA 1UEXC 1OLZA 3M6FA 4IXDA 4G1MB 4G1EA 4FX5A 5KYXA 5KYYB 3GXBA 1N9ZA 1JLMA 4IGIA 5LN1A 1XDGA 2I91A 5KYWA 1IJBA 1M2OA 4O02A 4WK2B 4MMXA 2VDNB 1MHPA 1N3YA 3TW0A 4MMYB 1IJKA 1CK4A 3RAGA 3ZE2B 4WFQA 1YVRA 1XUOA 3HXOA 2NUPB 3NIDB 3AL8A 1JEYA 5E6UA 2IUEA 2ODQA 4BJ3A 4G1MA 4CNBA 5KYUB 1U0NA 1RS0A 2M32A 2VDMB 1M1XB 4GZ8A 5HJ2A 4O3TB
chains in the Genus database with same CATH superfamily
3ZGYA 2O06A 4LP5A 1P7BA 3GLTA 4S1QH 2GVYA 4B76A 2D6FA 4DLKA 4F3YA 4IIHA 5MI0B 3RF7A 4Q37A 5LAPA 5CLGA 5IM7A 3VYSB 2ZRLA 3WO1A 5I9IA 3JR7A 2PKYX 1I8MB 3F8TA 5FFFA 4REOA 3DXAA 4JS7A 3TGLA 2HREA 5FAAA 2BM3A 1LWRA 5FQOA 1OV4A 2NU6B 2E4VA 3D4GA 2Q5LA 2YNMD 1Z34A 3UG4A 4NZRH 4D3SA 2H85A 2WQAA 1I3RA 1GGIH 2NY3D 1JERA 4GL4A 1E7VA 3R8CA 3OZRA 1FS4A 4Q9QL 5H2BB 4JFQB 1AS2A 4MPDA 3A21A 2H2WA 3LK7A 1AMXA 5IG7A 3EMBA 3VNAA 1IGIL 4KV9A 4BWVA 3EH1A 3S37H 3IVGA 3TQOA 3FPBA 2YARA 3ZHXA 1GNPA 2JHCA 1C80A 1ZSNA 1M33A 4YRFA 3IDAA 5DPMA 3K71B 1AN9A 3CLEL 3HRIA 3JXAA 5DTIA 4EPSA 1QQ6A 2O20A 3H3PL 1DL7H 3EWSA 1F1BA 4EO5A 4DNOA 2RB5A 2FE1A 4FXOA 2PTVA 4HC1L 5IB3A 3ETCA 5IJAA 3F96A 1MHPA 2OTPA 3IJHA 4XZ3A 3SQNA 1BIFA 3V9EA 1PSZA 4WADA 1FDTA 3OXRB 5BZDB 1I9RH 3QQ9D 1SFDA 2PUTA 5FO9A 1EFDN 4KZDH 3P3SA 1KO1A 4LRNH 5FTLA 1ZTMA 3U4EA 2A5FA 1YRKA 1BMZA 5BR4A 4M86A 1MG2C 2GKGA 2FW6A 1SHKA 2H18A 1F00I 3ILDA 4DUWA 4X8HA 1ECZA 3GQBA 5LXGL 4AJLA 2ET6A 4GBJA 5I3CA 1EVQA 5DYYA 1BHQ1 5IZ7A 3AABA 4BJ6A 1GDTA 3P45A 2HT3D 4OD2A 2VH5H 3WGUB 2VEOA 4PVDA 2ZS7A 2JSFA 5I9BA 4E6PA 4FFOA 3NYKA 5FPIA 3KL4A 5D7IA 4IEFA 3BTOA 2J67A 4AUNA 3P20A 5JIPA 4ZYTA 3A5VA 3UWSA 3KLAB 4NG5A 1NJGA 3CT6A 4DW8A 1M6OB 3ZDZE 2VBFA 5JHDE 4WEOA 1QP1A 5CNJA 2AA3A 2V6FA 2E2WA 4MW6A 3DECA 3O0RH 4IBTA 1JPVA 1LLQA 4BEVA 2DBYA 2J3MA 1EHXA 3F5QA 3DGDA 4I88A 1KY2A 5JUEH 3IP9A 3BOSA 3P9NA 3D6FA 1DXYA 1MJ7L 1XTQA 2BHSA 3M81A 4U3SA 4X8LA 3FJYA 3KBHE 4A9AA 2VYRE 4OU4A 1CNMA 2HWUA 1MSPA 4AL8H 2H2DA 2ZNWA 1CG9A 2JI2A 3BH8A 1TKCA 3WGHA 3A1DA 3ZOZA 3NJJA 1E2VA 2DX7A 5TF1H 3T34A 4AKOA 1VOTA 2WTPA 4P4GA 1KGXA 4EOWL 4HG2A 5JUEL 2W92A 5JFOA 2CPCA 1C30A 2JEYA 3P2OA 2EX4A 4D9CA 5I75C 3S96B 3M1CA 4MEJA 5ECWA 2WLIA 2D8KA 2TAAA 1G4UR 3RR2A 4FNRA 4TOYL 2I4IA 2F3TA 3CGGA 1RZUA 2N3ZA 1KKLA 421PA 2F1IA 3RASA 2QL7A 1Z9PA 2YGVA 4F9FA 3Q8MA 4URTB 5L53A 4RWYL 3T7EA 3LS2A 4RA3A 3QE0A 5EIAA 5FAXA 5T1KA 2QG6A 3B6SB 3AREB 1QSFD 4ENWA 4WSJA 2B30A 1PZDA 3ESAA 2HWXA 1H93A 1FG9C 1DCFA 5E1QA 1TVCA 3QKRB 4AZUA 1FFGA 4Q18A 4FWTA 1EFTA 2X6UA 2DQGH 1FX0A 3E58A 3D0AA 3FPFA 4RE6A 1IIIA 2E7ZA 1TCRA 1QQDA 3LNFA 2E4UA 3KELA 2XWJA 4CMIB 4FOLA 5F9JB 1XE3A 1UL1X 3IX7A 3WJLA 2YBGA 5HIJA 1LPBB 4CA4A 1ET5A 4JLBA 4F97A 1EEZB 4QYSA 4MWEA 3JV6B 3KYMA 2KX7A 3K2BA 4MJIB 3PGJA 4KTTE 3JQ8A 4M5SA 3GYGA 1MG3C 4PGBB 3OPYB 3WYBA 3JVDA 2BEWA 1EK0A 2AI1A 1RP9A 3O6ML 2R8ZA 3VYPA 3G6AA 5HYQA 1RJGA 2XYHA 4AZWA 3GHBL 3GHHA 5AW6B 1BGXL 2DWUA 5FWYB 2NDGA 2E4TA 3V2UA 3L7EA 4AKGA 1N7IA 5F1OB 3A70A 2R1ZA 2UZIL 3KPSD 1CNFA 5B5SA 3H18A 2NX5D 5ALXA 5JLZA 1P29A 1DSFH 4RPJA 2X41A 2HDOA 1RXUA 4C87A 3N0VA 3DBLA 1NC2B 5DVKA 3NQ41 2NU9B 2HX9A 3GTVA 1N2RA 1UD6A 2FPGB 3C6ZA 3Q13A 4QECA 1F0NA 4A5OA 3PL6B 2IV9A 1G41A 1ZL0A 4IHBA 4O1MA 4FDVA 2XV6B 4U2FA 4C2TA 2PS9A 2KLRA 2YPLD 1PKOA 2WZ5A 4KQ3H 5CFQA 3D6UA 4DGUA 4NZOA 2LU4A 4Y0GA 2Y0EA 4H8VA 5ALTA 5INCA 4IRUB 3SSMA 1FU8A 2IEGA 2OBXA 1W1WA 4R7LA 2R2BA 1FFYA 1EIBA 1BXKA 3V8MA 2Q49A 5CGMA 2C2MA 4L7QA 2R4UA 4N0UB 1X44A 3IDQA 2ROYA 4FOMA 1DBBL 2J33A 2IYVA 4MA7H 2FQDA 1U3WA 3VWKA 3HJUA 5JNUA 4WKZA 4NYIQ 4L1LA 3TXXA 3PXDA 2W4QA 5HBGA 5AM4A 4HLZG 4YUEH 2Z6QA 3AGPA 4RVGA 4HIXL 1PR2A 1TQVA 2PT6A 2X0DA 5AZ2H 1S1MA 2EQAA 2CBPA 3NESA 1GGHA 1KA9H 3SNHA 1PF7E 1QAWA 1MREH 1V3QE 4FQXD 2R96A 4NBXB 1VA9A 1H6UA 1EGAA 3FR7A 5JAOA 2OL3L 3MWDB 4PJ7E 1LK2A 4OVKA 4BUCA 4WO4A 5BV7A 1Z4MA 4BO6A 2P9JA 3WLWC 2JAHA 4CU8A 3CNLA 1ZJZA 3FDFA 2EIZB 4FFRA 1KELH 3IHWA 4LNVA 4EVNA 3CMOL 4ZNEE 4KRLB 2L82A 3OT1A 1EEUA 4BS9A 2O4EA 2Q6VA 1NMCB 1QZXA 4LVOA 3VR4D 1FX1A 2P0YA 3GNLA 1MOZA 1BDJA 3L4VA 4U1SB 1U93A 1OWPA 1D03A 1MZYA 2FGKA 4UASA 3AXHA 3KCPB 4ODHH 2PV0A 5ITFA 4U9IS 3M9WA 4A6DA 1DOHA 3ZBQA 4DB4A 2D3WA 5FYLE 3FUKA 5FUZL 4F96A 3BLKA 2FHSA 3O90A 1YN7A 4U6YA 4MXVF 2O8DB 4CT0A 3LP6A 3SDSA 1MCCA 1W6LA 5TT1A 1M76A 1Y5IA 4EYOA 5DJ6A 2IMMA 1SK8A 1B76A 4NX2A 2WLZA 1WA5A 1XDGA 2ZUDA 4GIAA 1A3LH 4KI5F 1AO7A 1TAHA 3PL1A 1ENZA 1XCTA 2PS0A 3HRKA 1HOTA 3R7AA 1X3LA 3RC8A 3PHQA 2K9UA 1VHJA 3BSGA 3H85A 3G68A 3VUFA 2HJKA 1Z25A 2H1XA 5B1DA 1WICA 1M7HA 2C0CA 1TQHA 4AENB 5C0IA 1ZRHA 3BGMB 1JGDA 2NX5A 1XCXA 4O4HA 5BURA 3IDNA 2XQJA 3QXXA 1O6CA 5LBSL 4NPCA 3LPPA 4E5KA 3CX2A 2CUMA 3CZAA 4DWJA 2I4RA 2P8JA 2CCWA 3VPGA 3UCEA 3QLJA 1OY1A 5D2LE 5I1GL 3Q3CA 3PHIA 3IF1B 4NS4A 3NOVA 3T5BA 3MLUH 3NG1A 2V3CC 3N42F 4GUQA 3O3CA 1QIMA 4FHJA 2VDRL 4C54A 3KLHC 4XI5C 1NW6A 2PWDA 1IE5A 4C4PA 3NCCB 1NCCL 1A7UA 5DDIP 1MXFA 1TU2A 4QO8A 2Q3BA 2VJXA 4R5TA 2R11A 1JEJA 3AQDA 5KX5F 4DT1A 5EXTA 4R4JA 2W81C 4IVPA 1ZA6A 1Y1RA 3W8EA 4ABUA 1T0HB 1IM9D 1CXKA 2Q9OA 4Z53A 3CQ9A 3C8DA 4MV4A 2VS1A 5CAEB 5HRAA 1Q84A 4PRHE 5CFZA 3GZ4A 3DUUA 3ARFD 4RSMA 3Q5TA 3MCZA 1XBDA 4BJ1A 2XNAA 4OLFA 4JLJA 4YZFF 4HLEA 4J7RA 3TPFA 5TJWK 3N9GH 1AC6A 5JYDA 1U81A 1SN0A 1GKKA 3JQBA 4FINA 4EG5A 1CZRA 3U4DA 4FMCB 3MF4A 4NLLA 3MWGA 4MPTA 2PNJA 4YJDA 4F6RB 1BXRB 4L5JA 4MAZA 1DUIA 4Q02A 4MO2A 3H5WA 3G02A 3NI2A 1OZUA 2D4HA 2ZOLB 3FSVA 3OL2B 1ZHBB 2OGTA 4LG1A 4L8VA 3PQ6A 1Q1EA 1OAYH 2OP0A 3SKVA 4IBYA 1WHSA 4J3OC 3MTJA 1UAGA 5TF4A 3MCG1 2EHJA 1FP1D 3GJ3A 3N70A 1VLXA 2C8NA 2HVBA 1UM4L 4ZDKA 1OTTD 1BRTA 1A2KC 2VJ8A 5IBLC 4AIRA 2NP7A 2LBPA 4NDNE 1FZMA 4U7JA 3NLLA 4G63A 1JWUB 1RCUA 2BFNA 3AOGA 3VWKB 5K6AA 1Q0YL 2IA5A 1NOIA 3RC3A 2W65A 1EZ4A 1SU7A 2VAXA 2XD4A 3TJZA 3WLHA 2OSVA 3ISYA 1KS2A 5FF6A 3GFGA 4PGDA 2FU5C 1N25A 2AVNA 2O05A 4C6SA 4MVBD 1IZ9A 5IWCA 2CO2A 2W91A 1BVKB 1NBMA 5D5PA 3QYPA 2WE8A 5L0QB 1CGSH 5MENA 5K0JA 1PS9A 2UYQA 2MU1A 2FX3A 1RZ7H 3FD8A 3NHMA 4YDQA 1PFGA 3CX5J 1A5SB 4N8VB 1Q15A 1YFKA 2Y6VA 4KUCF 5DSTA 4GBXD 4QTHB 4Q3DA 1X5HA 3QZUA 1S7UB 4NRYA 2PLWA 4IJ3B 1B42A 4F4DA 4PRBB 3M2PA 5T5FL 1KL7A 2QR2A 3W8NA 3Q9LA 3PU7A 2ZSDA 1N7GA 3C1UA 2VITA 3F7QA 5D6OA 4EJFA 1QSZA 4JJKA 1IJKA 4GMFA 1EFXD 4PJ5B 1ZVSB 2WC7A 1JV5A 3VFGH 2X88A 3NZHH 1EVYA 3DEJA 3RS2A 2VDMB 5J3JA 2DRUA 4LLVB 4V1DB 3HBJA 3HPLB 4XVJL 1CICA 4N39A 1IC7L 5BNWA 2PYEE 1RC1A 2WMPB 1D4OA 4GICA 2YAOA 3IHTA 1WBJB 2E21A 2IH5A 1N5AA 4LEXH 4KQ6A 4MCIA 4NV3A 3ABKB 3PUXA 4YSCA 4OEHA 1GCGA 5HYEA 4ZMNA 2QAGC 4HIIB 4PSRA 2R1XB 3BVUA 3KK0A 1BHJA 2NTVA 1GDDA 2NYZA 5SYAA 3PL6D 3TOZA 3L9RB 5KNDH 4MQ7B 5IDQA 1SJVA 1VPEA 4QRPE 3L92A 1BQHG 4OM0L 4UARA 3NWEA 2BKVA 3MBXH 1N9KA 1P84J 2CRYA 3W82A 4LXGA 2R8SL 3UTQA 4R7DA 4CI0B 2YBDA 1G6RL 1M54A 3CF6R 4F7WA 5IFJB 1V3LA 3Q48A 1FL6A 2MNWA 5KO2A 3DDOA 4Z5XA 3IKLA 1QLEB 2DMBA 4MKTA 5MN4A 2ERCA 2OR8A 1FDWA 3IK2A 2QRMA 4N18A 4X90A 1MT0A 3WLLA 4FYPA 5BW8A 4BU0A 3AR5A 4UVGA 4PJXF 4ZARA 1F4HA 1K6IA 4BMYA 2F8LA 4HWGA 4KR7A 3PS9A 5GAJA 4PLPA 3OEHA 4D81A 1EI9A 3NBQA 1C1DA 2NXNA 3EVAA 4NQRA 3DWIA 4LE8A 3K9GA 2VLMD 1PLLA 1R6UA 2YMOA 1COZA 2PD4A 5HYFA 1XLWA 1QSFE 3VWKD 2ZG1A 3I9NA 3FBWA 4FSDA 3VI3A 3PIQB 4L6AA 2RC6A 4FYSA 5JR1H 1T5OA 3S96A 3SQBB 1QOZA 3KPRA 1VFNA 4KBYA 1MVYA 5CHNA 3NRJA 1ZICA 3DONA 3IJRA 3GD7A 2VWHA 4JC8A 4O4IF 3F46A 3ZK0A 1HNZB 1RJDA 4B9IA 2BTQB 3F8SA 6FABL 3ETBF 3GS0A 3USZA 5EF0A 5ALMA 4DANA 16PKA 1CG9B 1NGYA 3W5NA 3CCFA 3BAXA 3ASVA 3FW1A 3UJBA 3QA3B 5BQ3A 3TH5A 3AU1A 3DOIA 3FPCA 4HVBA 3ZI0A 3ZYJA 4QTXA 5C09E 2FYVA 5DIFA 3NN8A 4NKDA 3AF4A 4M37A 5CIWA 3KYMB 1UD5A 1KIQA 1T4CB 4H3SA 4IGBC 1WMAA 4XXCA 2O3JA 1N6QL 4L27A 5F1NA 1E18A 1QRAA 3ZWNA 2Y9RT 3ZE2F 3FNIA 1QIDA 3CCBA 5EPMA 3V7AE 5DQ9B 4LZNA 1MFCH 1KIFA 1RQ7A 3H0TA 2QPSA 1FZOA 1E6EA 3LCCA 2LLLA 2DJIA 1WCXA 3QQ4A 3M9XA 3AVEA 5ESRA 3RAEC 2X15A 3T4YB 4R7ZA 1JTTA 3HKEA 1G0YR 2C9DA 2VLRB 5HDBE 3H2JA 3IV6A 1USKA 2VIRA 2PMBA 3QW2A 2BHRA 2MMGA 1RHQA 4PH8A 1EO7A 1KGIA 4Q52A 5EESA 4CIWA 3HS0C 1RS0A 3VDRA 4KE8A 2YZMA 1MV5A 5DGDA 1ULBA 1SU4A 2O7QA 5TRTA 1QGED 1KE2A 3F7YB 1DAGA 2WV9A 4X1OA 1DJXA 4OGXH 3ACBA 2JJ1A 1YEKH 1YUKB 1EHLL 5CLWA 5FKPB 3NEEA 4LHXA 4ZEOA 4ZUVB 5G4MA 3ZCUA 4IBLT 4AJIA 3IWUA 1NYLA 1CFTA 3IJHB 3QX8A 3OT4A 2PXXA 5E6UB 2CKBB 5CJJA 2WCSA 4U3XA 3P0RA 2FMTA 2X14A 1EZVX 4UM9A 5FEUA 4TTIA 1WA2X 2EFYA 5KQRA 2BY1A 4BQIA 3AINA 1ZJWA 4JLRA 3REVA 4ALAH 4WKGA 4UMEA 4ZI8A 1DSYA 2A5LA 5E23A 3VE0B 3B6KA 1FI8C 1B8NA 2FW7A 3DROB 3L4WA 4EI5D 2B2NA 4PJCF 1R3UA 4CN1A 1EZZA 4JUBA 4GXQA 3LUHA 4IXWA 2V7XA 3RZCB 1KPGA 2EQDA 4BKUA 3POCA 2QXYA 4ZQTA 5MGNA 1KYAA 3NBMA 4YLQT 5T3ZH 1WCIB 1PVHA 3PDJA 3UA3A 1VIYA 1RXWA 1W9HA 3QPXH 2IBTA 1OGAD 3LJKA 4PRHA 4JKWA 1ESMA 1VHTA 1XH2A 5ALHA 5L4LA 1DRVA 3GRWL 4PJGF 3TT3L 4ZX5A 3ANXA 2VUOA 1OU0A 1MFEL 4POZC 1LS1A 3MWLA 3WDKA 3E7FA 3MTQA 4DF9A 3L6RA 3RWIB 4Y1EA 5I9SA 4EIWA 3U1SH 4H1HA 3MA9L 3W5SA 3C5SB 5E6IB 2QTHA 3FHTA 2YD7A 5EF2A 1T3LA 4GT7A 3B9VA 1RIHH 3QISA 1AE6L 3FT4B 4HGWA 1Q90A 4EZLA 1YR6A 4XFKA 1NSNL 2VERA 2IP2A 2WD9A 1NJ9A 5E8EA 2XWBB 2WNGA 3IPXA 3SIXA 2GCGA 4YDLC 4FHKA 4RRPM 1MHPL 4BNXA 2P0AA 1QBLL 4EI5C 4KVAA 1CFTB 2Q7NA 2VDPH 1DVSA 1RPUA 3GAFA 3E1KA 3SE4A 2IUTA 1XGYL 4RETB 4CVXA 3EZ9A 3ZZNA 5DYNA 4TUUA 4K9PA 3K71A 1G42A 2JGJA 5KTOA 2DUUA 4ZZKA 4HSCX 4RGBA 3AR8A 3WMQA 3SU8A 4K5LA 3PHCA 5I1CH 1QU3A 4MUAA 3WELA 4LTNA 2HPZA 4MVWA 5ESXA 1H9BA 3SOZA 3EDJA 2G4GA 3T5PA 4J2OA 1TT5B 1YZVA 1UJ5A 2PUWA 3OX8B 3EFHA 3KTAA 1IZJA 3N87A 4I7ZC 1IM3D 2LVCA 3OETA 2WYWA 4O2EB 4INJA 5TF0A 3QPUA 4YHPA 5C0ND 1KTDB 2WLYA 4DQDA 2EYSA 2A58A 3QXDA 1UA6H 3Q1SL 3HJEA 4B7AA 3BA6A 4LF9B 4W5JA 3WHE1 4ONGH 1JF1A 3G6WA 1M6VB 1ZLUH 2ICWI 3K80A 3MRSA 1J5OL 4BLRA 3OQOA 3GMMA 4JT2A 1T2UA 3I05A 1OQOA 3TJPA 1MZVA 4U7TB 2K4WA 4Q7JB 3LMJL 1A8PA 3P19A 3L4UA 4NQVB 1LV8A 3BUDA 4NRDA 3OX2A 3SE7A 3EZYA 2F00A 5JIHA 5KSBE 4LSRH 4JFOA 2BT4A 1QTQA 3O2VL 4B9JA 3TCNA 1ZNYA 1SVKA 4H25A 3GXTA 3WTUA 4MZ3A 3B7SA 1G6KA 4BO7A 1FFAA 1WXWA 4RLFA 1QNLA 4KXYA 2P4UA 1V7NL 1WAAF 3A22A 2A6KA 1NLMA 5JATA 2JCVA 3PWPD 2ODPA 4WEQA 4WNSA 3IIEA 3NSXA 4J23A 1Q19A 2H2PC 2KT6A 4YEFA 1TZ8A 4DIDA 1KBOA 1HBJA 1XIVA 4YLYA 4KRYA 3WXWH 3QEGH 4ELKA 3HB7A 1DLFH 1QI5A 2DYPA 1PZHA 4OXIA 1T8UA 5E9JA 5LB4A 3AVPA 5E5MB 4KZKA 4N65A 4WNCA 5D96C 4O4JF 3UYLA 4OGXL 1UOVA 4LARL 5EOCL 2B0SL 3I6GB 1UK7A 4WTZA 3VRIA 4A1RA 1MF2H 2GN8A 1D5CA 1K97A 2XOKD 2X23A 3DTXB 3FSZA 2C9CA 3TQFA 1LL1A 4N2LA 2OMXA 4MD0B 1UR5A 3WFCL 1MO5A 2AQ3A 3U7HB 3I9GH 3SS9X 1X7ZB 1EFPB 4JT9A 1LNSA 1V10A 4G1FA 2LDXA 3H75A 4H1LB 5DNVA 1II4E 1W4RA 2XX0A 3U09A 3M4XA 3KHUA 2H3EA 1NMBL 4JENA 5AKYA 5H59A 1IC4H 2ZS8A 5J40A 3AHCA 4PRZA 3EZXA 1CV2A 3RTEA 2VHEA 3PITA 1G8HA 3SEFA 2IK8A 1T2NA 2R6CA 4CMHA 4JQVA 3RI5K 2BINA 4YRBA 2G4CA 2IY9A 3NDRA 1W0WB 4H40A 4OAQA 1X6NA 4FTDA 1CR9H 4JY4A 3L8YA 3LO8A 4XSVA 1YBMA 2FPKA 4R26L 2HNKA 3ND7A 2DYRB 2WVTA 4PJEF 4QJ5B 1PIWA 4OHPA 2LV4A 1OZGA 2VNJA 3QUXA 2V3EA 2HU5A 4OGAC 1DZ3A 4WFJA 1JEOA 1XL1A 2QL9A 4ODSH 4X44A 2HUHA 5F9DC 4XASA 3AI2A 4LLWA 5C7XL 4DEPB 3NBKA 3OIWA 3GLSA 1C5DA 4S2SA 1ORTA 1RXCA 1YO6A 4XM1A 3BF8A 2JIZA 2H2AA 4I87A 3HNTH 3HA0A 2ZX9A 4JI5B 2RHBA 2YFHA 4QHSA 4LBZA 4XMLH 2P2NA 4ANKA 5MHSD 3A67L 3LKVA 3II2A 3PCXA 2PTUA 2DQ6A 2MPVA 3CYFA 4WNQA 2ADFL 2AXWA 3DOOA 3C98A 1VCOA 4NS1A 4M8LA 4TSAL 3GMLA 1Z83A 4KV5F 3HUJF 2CVFA 3GDCA 5J1SC 2P65A 2PJUA 5JASA 2HSIA 1U5BA 3LJ3A 4C56B 2XMQA 1E42A 1UQSA 4DYVA 2EDOA 2JKSA 1NKOA 2H06A 1L4KA 5AK3A 4FYIA 3ESRA 3KTFA 3OMLA 2BL4A 3DO5A 4D02A 1UENA 5B1JC 1XNJA 3LH8A 5AJYA 4TXHA 4UTRA 2QZ5A 1L6ZA 4OF6A 6PCYA 8AT1A 4L0ZA 3E9RA 4U7GA 2UUPA 2CKNA 3MUHL 3TI7A 1X7YA 1BW8A 4GQQA 4IHAA 1I7ZB 2PRIA 3F7OA 5BW4A 2YAHA 3T7IA 1XGTA 3UNXA 4QUGA 2XE6A 3C6YA 5FDWB 3VRLE 3QIWB 4ZT1A 3G2QA 2FLRT 4TSBL 1JI2A 3OQ3B 3QYJA 4BMZA 3LEXB 1HQ4B 1SGWA 3DTYA 2QVCA 1NULA 3ZCRA 3SQDA 4MAYA 3V8CA 4OQYA 3GSUA 3EVGA 1XZ8A 1NEUA 1T8WA 1QF6A 3Q5YA 3ZQXA 3QEHA 1U3HD 2C77A 5HIKA 5KS9A 3F71A 2RCSL 4N5LA 3T61A 1R3LA 4NYMR 2NY6C 1QPBA 5I3ZA 3H6AA 2Y5EA 1I8LA 2HTKC 3H4VA 1H6DA 2FR8C 1NKRA 3FT2A 5I6MA 3TO4B 3PLYA 4YZWA 1IEVA 2LLNA 4KKNA 2FPXA 3T0FA 2P6UA 1NMAH 3BKYH 3RWJA 1OHQA 3E4CA 5KBDA 5D3MB 1M1YE 2Y93A 2D7TH 5C09A 4GEGA 3JWNC 5L9DL 2Y7QB 2D0FA 2Q2VA 3NKFA 3C3DA 4XPBL 4YXWD 3MJ8A 4JYAB 3I5XA 4MAAA 3DIFB 3ENKA 4DLBA 1L9PA 1GTFA 4M60A 2GTQA 1M9SA 3B34A 4JLWA 1UTDA 1AMUA 2C9QA 4B32A 1F2XK 5IVKA 4YR7A 1O96A 2FNWA 4N0CD 2W5PA 4FMFA 3GNMH 3UTSE 1MR3F 2HBZA 3GF4A 2F54E 4XOBA 1ENPA 3O75A 4DGQA 1IAVA 4LDZA 1EUCB 4WE3A 4CDGA 4J6EA 4BNUA 4OQ4A 3EA4A 1BQEA 1RP8A 3BZ5A 4YMSA 1Y3BE 1FV1A 3ANYB 3ENQA 1CUWA 3MMPA 1OD6A 2BHZA 3I4LA 3WKBA 3WP0A 5HHQA 1MHHA 3AZQA 4PAWA 4N5MA 1U80A 1ASOA 1IFGA 4OQTL 5FKAB 1N2ZA 2MJWA 1YC2A 2ADJB 3CKKA 1OTSD 4O4LA 4AM8A 1IWOA 1NUTA 4I48B 4ZT5A 4DAEA 3JWNH 1IY2A 4PLZA 4AKIA 1D0SA 2QQEA 3BB1A 2IYYA 3CUSA 4JREB 2F1OA 5ITBH 1SD2A 4QVGA 2BP8A 3T1OA 4MTCA 4ER6A 4CU7A 4PBSA 2J7PA 1ISRA 4FQQA 4NF2A 3LK6A 4ONOA 4II2A 5EUKB 3IB4A 3AIOA 3ULUF 3L1UA 1N3YA 3B7PA 4BMPB 4ZU1X 2R7KA 3LUKA 3LZ6A 2J2ZB 3ME0A 1KJ2L 1PK7A 2Y0PA 4XAKD 3WGTA 4Q9QH 4O58L 4RDCA 2VF2A 3S6JA 4JELA 3OX1A 1KXTA 2J6EL 5KIAA 2CFCA 4MV0A 1UM4H 3D81A 2YWGA 4FXPA 1TVBA 4WK0B 1J0XO 2JD2A 2EEFA 4AG4H 4H6PA 3SBQA 1H1TA 1UCBH 1JDSA 1ISSA 4YAEA 3DOHA 4PJGE 5CR1A 3CU1A 1N7ML 1XF4A 1AI1H 1MQKL 2OCBA 4W9NA 2YA2A 5FI0B 1B2WL 3FMOB 4D79A 2VN7A 1K8IA 1X2BA 3CH7A 5D1ZC 3V4PL 5TDHA 1SPBS 1F6WA 1Z6YA 2JHAA 3WB9A 3U3KA 4KTDH 2H1RA 1W59A 1K5WA 4PSCA 4WJLA 4HQKA 4CTNA 2FMHA 3L1VA 4J1UB 5EU6B 3PX2A 3F3SA 1UXGA 5E5RB 3GB9A 4L0QA 4BP3A 3WUZA 4PYHA 1QYVA 1A1MA 1QV7A 1IKFH 2WA2A 3FG9A 4ND6A 2BLNA 1K3IA 4KTYA 4LVNB 1X13A 1MEEA 2E55A 1VYVA 5JARA 5EJ5A 4M46A 5DD6A 4U7WA 2JIXD 2OMXB 2OORA 5FW6A 2Q4EA 5CBEA 2PLNA 3S2UA 2KKQA 4XO9A 2XN9A 2Q4RA 3BMCB 3HKDB 3EQ8A 3I2CH 1EXVA 4FYXA 3PC4A 2HLAA 2R6AA 5JIBA 2NVUB 4P0TA 4MJ2A 1P6FA 4PJDF 1P0SE 3D0RA 1SBTA 4FG6C 2F3RA 4ZNEA 4NJEA 2Y0SA 3TPCA 3B6JA 3QIBB 4YMWA 4RXTA 2R48A 1R5NA 2UVDA 3ETDA 5CINL 1C81A 2QW1A 4JLMA 5K0ZA 4A8HA 1Z68A 4KRFA 5IXSA 1FS5A 2J8UF 5F7EL 5BV8A 4I6JA 3LWBA 2DR3A 5BMVA 3ZNQA 3CO0S 3ZTEA 4MJ7A 4B60A 4P9HH 2GBUA 3OR6A 4EO9A 5ALDA 4OBSA 1FL3A 5K9JH 3R7NA 3DKIA 1UOLA 1C8QA 4LJ6A 4WRRA 1L0XA 4ZXBD 2ZT8A 4XVUA 2I1WA 1H5BB 3K16A 1XA0A 4REQB 2AKRA 5DYWA 3RSLA 8FABB 4OLWH 1G9HA 3FWKA 4TN9A 4G1BA 1E58A 4OD1L 3S36X 1G7LB 1RWMA 1S7SA 2PO5A 1JS1X 4BO0A 5TEWA 3GO1L 2Y3IA 3EJWA 1Q0PA 2O1EA 5JO0A 4ZOQI 5I1JL 4Q6WA 3R9XA 5EEHA 3NHYA 3FTZA 5DA0B 3T0WA 2J6BA 4K3UA 4LC0A 4CQLA 1Q11A 1QNZL 4YBHA 1JEAA 3G5TA 1M71B 3FS9A 1DBWA 3GMMB 4AWAA 4JFDD 1TC2A 1MB4A 3TN0B 3OZXA 3J27A 4WSKA 4Q6IA 4R1LA 1QTNA 2BOCB 3IV7A 4JOQA 1ULSA 1U9ZA 5K1JA 3DTXA 4FCHA 3OO1A 5COBA 4JKKA 4APQC 1I3VA 4HB4A 2WHPB 2PMZA 1CTNA 3CW2A 3EIXA 1VPDA 1X7GA 1FFQA 4DP4X 4D0DB 4BP1A 2D3TA 4BZ1L 3HR6A 1NMXA 4MJHA 1OH5A 3L93A 2PWBA 4FE7A 5DTRA 4LV5B 2O2XA 4UQOA 5M29A 2F90A 1FE8H 3S40A 1SOVA 4OYRA 2Q1EA 4RK4A 1XMVA 2EP7A 5KNDA 1LEHA 3ERXA 4FOSA 4WASA 4YLGA 4LEOA 1U8TA 4XC1L 1XC7A 4MMXC 2I60H 5TQ2A 4RHYA 4S10A 3KWJA 3L2NA 1IEBB 2Z9DA 3NIFE 4OLUH 4FU0A 4YUXA 1SDDA 3SKJH 2CLRB 2AN5A 2VISA 3K6RA 3WLAA 3CY6A 1DEEA 5I7VA 1NEZG 4UUPA 4BFRA 1OSPL 4IDJH 3GJXC 1X80A 4BXOB 4IJWA 4HIPA 2XC8A 1PD0A 4L8LA 2F61A 4OAPA 3TBCA 1FIUA 3SD5A 4XP4H 2BH9A 5DS2A 1PTZA 3Q1SH 4G8DA 4DL9A 4X6FB 3U16A 3DBOB 3AJ7A 3I6SA 3UZEA 2XVAA 4LE2A 4Z9YA 2JZNA 5BCAA 4M48H 4GNKA 4PG6A 1KERA 1IWPB 2PM8A 3HL0A 3KS0H 5KMGA 3H8NA 4ZPTB 3JAWB 3GFSA 2VW7A 3VNSA 3IIMA 2I2WA 1H3VA 3FUHA 3RI3A 3P0JA 2IAMB 1U0EA 3PYXA 2ONKA 4Y8AA 4NQTA 4JZJA 1WPRA 5LZ7A 2JB5L 2XB2A 2WZBA 4IRXA 2ZG2A 4M1ZA 2Q7YB 3H17A 2G60H 5G02A 2E7DA 1YO4A 2Z4SA 5L3SB 1B3BA 1F1GA 3OPNA 3LXCA 1K5DA 4HLZH 4GKNA 5GS1A 4Q5IA 2BFWA 1RU9H 1EQWA 4ZCTA 3PUYA 5JNSA 5LGYA 4G5GA 4WGKA 4ARZA 1IN7A 4JAMB 2E7LC 3OP4A 1D4AA 5B3KA 4QHMB 3FUWA 2WBJD 4R3UC 1JLLA 3L1KA 3D52A 3HS0B 1Q57A 4KI0A 2A77H 1OLUB 3R9XB 1J86A 3JZIA 3MA7A 4NCC2 2VWEC 1AS8A 3SCMB 4AJJA 2LIPA 4M6AA 3QPXL 4UTXA 1BKYA 5DBOA 1DCMA 3UMBA 3HMQA 4B0OA 3BQUD 2BH2A 1GCFA 2I3ZA 2X7LA 4AM0B 3DVRX 1KJ2A 3EDMA 4G5RA 3NJMA 1N6KA 2I1VB 5F97E 3ZH2A 1F12A 2VDVE 2BEUB 1L7IH 1E8ZA 1YNTF 3DX0A 2J41A 4ABVA 1HINL 2EYQA 1K92A 3GU3A 3PQ4A 2C9BA 4BX2A 3C60C 2E6UX 4HIJA 5F2KA 3RSOA 1V7CA 3VNBA 4HDOB 5FO9B 2V17H 4XB3A 3ZKAA 3I0ZA 3J81A 2YWDA 5DNAA 4F15C 4TQUS 3DEHA 1TYZA 4JM4H 1OAQH 5IBTH 1MFAH 3E1GA 1XLUA 4GB9A 2AMFA 4NM8L 5AJWA 2QUJA 5DRYA 1WWKA 4BFUA 3L77A 3EO9H 1MCDA 4UU1A 2Q4BA 3A4IA 1AR1B 2PUJA 4DR5B 3KE0A 2HA4A 2O1SA 3GRCA 2QKIA 5A7BA 1YFJA 3S3TA 1IUNA 2GFIA 3QLEA 3AVYA 1Q6YA 2B8TA 1B6RA 3INYA 1I6KA 3F4BA 1EFVB 3VGHA 4DG9A 4F5ZA 1OAZH 4PR5A 3OCXA 4GW5B 2BC4A 5E4YA 1DWOA 2I4TA 2BY2A 3MOBL 4M6MH 5LQSA 1SVOA 3UGTA 1JSLA 4L76A 3U2QA 1R3JB 3GARA 4PX2A 4WKOA 3IJSA 3P26A 3ST7A 1O5DT 4X83A 4CVZA 3AB8A 3K0HA 1PIGA 1VJSA 2QMZA 1XR9A 5LWHA 4RK5A 2YJNA 3FF8A 3O4OB 3O0DA 5DSCA 1D5ZA 1JHXA 3I2JA 3CLVA 5A6MA 3DV0B 3H1TA 3OU2A 1TAGA 1RZFH 3BAKA 1DRKA 4W9EC 4XKJA 4M6ML 4PVLA 4U9UA 1FPTH 5DK6A 4ZDHB 3QEKA 2FOXA 2PZEA 3EDQA 1I7NA 3BD6A 3TW4A 5ALYA 3I75A 1XEWY 4G8GD 4UDTA 1JU9A 3IT3A 2YFOA 4CC0A 1MB3A 4PCTA 2HH9A 2YNMC 4GI7A 1C08A 4PJ8C 4QDKA 5EFIA 4NGHL 3T3PF 3FU7A 4B6GA 1SKAA 3LA8A 4PLGA 1E9BA 3WLSA 4XX1G 4Y2DC 4RV9A 3C6QA 3Q7JA 4GE0A 4WZAB 2NN3C 3RSGA 3JYCA 3HE3A 4NCAA 5LXTB 3AEKA 3R5JA 1R5WB 1KKUA 2WMDA 2C4FT 1UEIA 3UG7A 5AKRA 5HF6A 1QP7A 4AG6A 4EY4A 2XNDD 1KK3A 2FEPA 4HWTA 1JI0A 3OQNA 2VE6A 3SZ3A 4GQ9H 4HZUB 1YQVH 5C51B 3A9VA 1EMTL 1TJXA 1DEDA 3NHKA 1QGOA 3HCDA 5MGBA 4UUNA 4ZU3A 1FNGA 2ESVB 5CEZH 2VWGA 3T0XA 4CKXA 4DP2X 4ZEVA 1SBYA 1YCFA 4X4MA 4L18A 1X9UA 4L75A 2YGNA 4NT6B 4AGMA 3V6ZA 3JCZA 5JHGB 4PP1D 4NNXA 4CIBA 4M4PA 1L7TL 3ZHBA 4ETNA 1PR3A 1BHGA 3U26A 1NGXB 1X0XA 1W25A 1ABFA 3WWZA 3MRJB 4F8JA 1V45E 4U4BA 4XCCH 4ZAKA 4CR8A 3P2EA 1FFRA 3BQUA 3I04M 3HIZA 4FG2A 3V8PA 4W9ZA 3V1MA 2EDLA 3MKGA 1HRDA 1HDMB 4B2LA 2WKQA 1N8SA 4UIMB 1BX1A 4EKNB 1JAEA 2HX1A 2XU9A 3C7TA 3L40A 1RJ9A 3N2KB 3VGBA 3OM0A 2D59A 4LLVA 2GTPA 1JGEB 2FJPA 3BFKA 1UKCA 3CSUA 3ZIAA 3RDTC 3U4GA 2O3QA 2QHRL 5C86A 3O2DL 1VGRA 5DRZA 4KI1A 1X4YA 3RLIA 3P0HA 4Z86A 3QC5X 3RVVD 1IEHA 3GMRA 2VLJE 2Y7OA 4XWAA 4R7GA 3SEZA 4D56A 1NBEA 1UPCA 5FO8A 4QY8B 5I5IA 2XPGB 2BBWA 3LEVL 3QX3A 2QQ5A 1BX0A 2LCFA 1NFIB 2E6PA 1FBTA 3G0IA 2LD4A 3GRKA 1E1LA 3KHTA 5L2KE 4K1LA 2Q46A 3WKDA 4ZTPL 3MGCA 3QXSA 4NFLA 3A9UA 5J9PB 3VD9A 2FZ3A 2YV4A 2COVD 3CVWA 2JARA 2NO6A 5IUSA 1H5QA 2OYCA 5KZCD 3L3DB 1MG0A 1JWLA 5LXVA 1XQ6A 3JQAA 4C20A 1JZ8A 3MU3A 1CYDA 4YHBA 3DRTA 3BZFB 3TCLA 4BQEA 4C56A 4X94A 5HDQL 2P3YA 4S1WA 3GLZA 3V80A 1CZNA 3PFIA 4TVPL 5DV9A 4LCVA 4WFFD 1P0CA 3VWJC 2HFEA 4NMHA 3TU6A 4BEBA 4X20A 4TUOA 3V8NA 2FECI 4KZEL 3BX7C 4HJ0D 5WRFA 5FCDA 1DQDH 4OP2A 2WWMC 2WXKA 3SPHA 2NQTA 1KGSA 4W5WA 3BORA 1DKNA 1EQ2A 4G71B 4RF3A 3L5KA 5EUCA 1J05A 2J0UB 5AXAA 5C1BA 5K9KB 3OC0A 5K51A 5KAMA 2Z8WC 3MRLB 3ULAB 1KYIA 2HTLC 3I3SR 2H7CA 1U3VA 2I87A 3WDLA 4JB9H 4P3NA 1PTJC 4LRIC 3ZYZA 4RA9A 2P8LA 3B2QA 4KWHA 2XN0A 3B8HA 4QHUB 5L4SA 3IOBA 1EG2A 3DCJA 4GT0A 5ESVA 4C5AA 3WJ7A 2BFDB 3M6UA 1W0WA 2JAUA 3COVA 4LVHC 4XPTH 1G4HA 3F97A 3O1IC 2ECOA 4U2KA 3R3YA 5HJBA 2Q07A 1FYTA 2HTLD 3UEQA 2YV5A 2XSZA 4DQVA 2VXTL 2D7QA 3GJ6A 4BTVA 1UM5H 4ZHQF 2PLFA 3I9V1 3IXLA 4XUEA 3CLEH 3DLPX 1HL5A 1VIWA 2B9BA 4TTRA 2O2YA 2CHNA 1RMFH 5AW0B 5IW6A 1HDZA 1U9JA 4WGGA 1QQBA 3GBSA 2DQFA 1J8HD 1CZLA 2GBGA 5NULA 3RV4A 1VBFA 1ZOPA 4HGQA 1T4BA 3TC9A 1F8UA 4RPGA 1NM4A 2EZ4A 7FABL 4UQBA 3RP1A 1SN5A 1T7WA 5E8OB 3KZOA 1SJHB 1TEHA 4MIEA 4H27A 4TV9F 1AO7B 4ID9A 1HQRB 1QCDA 1VJDA 2A6DA 1GA2A 3GELA 1UVQB 3EYFA 3RY4A 3C5ZD 4D3ZA 1RUKL 1CXHA 3SDCD 4BZQA 1JYFA 1FXSA 1RSYA 3FRPG 3QX7A 4HQ0A 4DRZA 3HA7A 1FU7A 3ABQB 1FAIL 1FO0H 4COKA 2FUNB 3H9HB 1SELA 3KCQA 4M9OA 5L7TA 3O8XD 2R6R1 4MGKR 1AUOA 1F4AA 5BWOA 3IT8D 2XNHA 1ZFNA 4OFWA 4FZJA 4G6FD 3BT7A 4GDMA 5GZND 4BFFA 3KVNA 3P9LB 4BSJA 1ECGA 1TKAA 2X9LA 3FYDA 3SDXA 4D7AA 1T24A 4TMFA 3LV3B 1JQLB 3TX4A 1OFVA 2C20A 3EO1A 1Y5LA 1XPJA 2RHMA 4YDSA 3W0WD 3NONA 1YRHA 1S9YB 2YR3A 5FYLH 1IL1B 3R8FA 1CYEA 5IUKC 3GPLA 4LLAA 3SY6A 4Q3OA 4C4YA 2NR6C 3E9DA 3HI6H 4RE5A 1WQ3A 3CSYB 3GXMA 2Z1MA 3PQFA 5EV7A 3MZTA 1G9SA 1Q7RA 2Z5GA 3F6IA 1J88A 1MX9A 5TF1L 3SYOA 4X9BA 4O58H 3HG3A 4Z2AA 4L0CA 4EF6A 4R40A 2ZEJA 3BHIA 2Q8QA 4N9GB 1FMCA 3CZFB 5IRCD 3U7WL 5DJDA 3VXPB 1CVLA 4ATTA 5IEBA 3EEYA 3ZWXA 1D2RA 2PCPA 2Y7MA 1USWA 2EAEA 2FVYA 4R96B 1A2YA 1PBNA 1W72B 4H7KA 3B78A 2EEZA 3KVQA 4LVNC 1HFJA 1U0GA 3WV5A 2ZXFA 4FEYA 4K3EL 1I1RA 1ZA2A 2F7OA 1ULHA 4JU8A 2VPYA 1YN7B 3K20A 1MXHA 5HQ3B 4LC1A 4G42A 3FJTA 3ARGA 2WIFA 4TL9A 3WYNA 5AZEL 2IQAA 4WCDA 4A15A 2GRUA 1JWMB 4WWNA 3IJ8A 4YUWA 1BMDA 2J45A 2WOJA 1UWFA 4J0EA 4MQ6A 5H35B 2B4CL 5IROA 1OYVA 2VJKA 1SD5A 1VIAA 3MGTA 1UCBL 4AQEA 3QWFA 4RMSA 1IQDB 1KS9A 3OFJA 1R3HA 3C7CB 5CNIA 1H9VA 2HA0A 2MH4A 4X0KB 4POYA 3C1TA 4B2YA 5E4OA 3ILHA 2MTAA 3HUTA 1TUEA 1PVVA 3B7GA 1CD8A 4Y4FA 2YHAA 1M57B 3RUGF 3U4QB 1PX2A 3MLVH 2BGNA 4DG8A 1E9PA 3BH7A 2EC5A 1I33A 4Q14A 3K1YA 1KGDA 2NU8A 2VRCA 4EHNA 4N5IX 1ZHHA 3C5ZB 4G5ZL 5A4KA 1AGXA 2DEYX 4FZEL 1W8IA 1GHFL 1VLLA 1VGQA 4CHGA 3BE1L 5AKTA 3ROFA 3UX9B 5MERB 5GRWA 5IUJC 2YVUA 1Z88A 3X3GH 2PEZA 4ODVL 5AW6A 4J0FA 4CGUB 2Q7DA 5FDWA 4F86A 4X8JB 1OAQL 5IBTL 2EDKA 4HNQA 4A0GA 3ZO0A 4P54A 3SODB 2NXEA 3LZOA 4NZ9A 3HI5L 5CINH 1V54B 4N01A 2GT9B 4R05A 3SAJA 5IB5A 2E7CA 5CCEA 4YVFA 4Q0XL 4FGJA 3GSWB 5FUXA 5EZYA 1OTUD 4ODUB 1JHDA 3EGSB 3QVJA 4BN0A 2IPLA 4CVNA 3BVPA 1ZLEA 4GGOA 2ZYVX 5J23A 1T13A 1L7AA 2EDCA 4DPKA 4M4RA 4JI8B 2A5UA 1KRXA 2YZKA 4DWOA 3WLTA 3CHRA 4GSDL 3AM4A 3QU2A 4MW0A 1U2TA 5C0DB 3DT9A 4GWGA 4RLHA 1A6AA 1QDUA 1AIPA 4PTUB 1IY1A 2F53E 4X7FC 4KPYA 2CBZA 2IOYA 1LK3H 2XQGA 4PJ7B 1CUIA 3AFHA 2QRJA 3X44A 4E9YA 5JJKA 3OXSA 2F53A 3LX5A 3IE0A 2Y4NA 1LHZA 4ZD3L 3BWCA 4LOEA 2V0NA 3UPAA 2EO7A 5CEZD 1W2WB 2WQXA 2XYBA 4X7DC 2WLIB 5EI5A 2R8XA 4NPJA 3QZPA 1SVBA 1NXXA 3U37A 3P02A 1E67A 3G6AB 1KJ8A 2A3NA 6LDHA 1RAAA 2GUYA 2O93L 4PNZA 3D1LA 1DLHB 4NZNA 3DHYA 1IH8A 2Q3HA 5FOBB 5GSRB 5LUMA 1QOQB 4MJIA 1B3IA 4JWTA 4OF4A 3AH8A 3QFDB 3QQ4B 5C80A 2ZONA 1NPUA 4R7NA 2R8OA 5IM4A 3D0OA 1FFPA 4U3JB 3IBEA 2WVJA 1BEUB 4K71C 4LSVH 1B3RA 4AF7A 5DQ9A 1PU2A 2RSLA 1GUDA 3DYMA 1Y1KE 4FXKB 7GPBA 1D5IL 2F5AL 1SBNE 2C78A 2LFGA 3GQVA 2ADFA 3CM0A 4ANFA 4B9EA 1QFJA 2EVWX 3G7SA 4RNCA 4QBHA 4IOSD 3OLZA 5FOTA 5I8OL 2PUCA 2BTEA 4PGGA 3ZZ1A 3BX1A 4G97A 5M5BA 1UUNA 2GEVA 3VSCA 2VHWA 1Y7VA 5AVKA 4RUKA 1P9NA 3TSOA 2PY6A 3HL4A 1NGSA 1UIRA 5DK2A 2QR3A 2DLHA 4FXLA 3GQBB 3FBQA 5JJIA 1I2DA 1XTVA 2B8EA 3QFGA 1SQ0A 3B2NA 4BFZA 3B2MA 2PYEB 1V55B 4DT2A 3FUNA 4HEMA 1OOEA 4F8EA 4GXUM 4ARCA 3VTFA 1TDJA 4M99A 2H3XC 1JIIA 3DKRA 2PYEA 4UZFA 3KXDA 2AV1A 1QTYT 4AV0A 3US1A 2OTCA 4QRRD 3UO1L 4XNQB 2Y1VA 4G0PA 1HKLH 1JXQA 1U42A 1ZVMA 2PGAA 4EY8A 2VZ1A 2CLFB 5JLJA 4QUIA 1EX9A 1OBVA 5DGRA 3UMCA 2DTSA 3QLVC 2V97A 5KNBD 3FX2A 2G1KA 4B8YA 3UTTA 1XCQB 3L7FB 1Q1GA 1JR4A 4LBYA 2OJ1A 4LCEA 1KTKE 3KU1A 3SQXA 4BGEA 3FUDA 3V5HB 2VABB 1PK8A 4UE6A 3RRXA 2YY7A 4W1TA 2VSYA 3ZH9B 3HZYB 1G5PA 3P11L 1ODUA 3UA4A 3IDXH 1EGVB 3RS4A 5CJBA 3NZEA 2P5YA 2YAPA 2YD1A 1RWKA 5DU7A 3Q6GH 3K3PA 5FOUA 5DI3B 1C16B 3BXNB 3NHPA 3DYOA 3HJNA 2GAOA 2OECA 2UV8A 3WYGA 2WANA 4GAAA 4PY8I 3RVMA 1KYDA 3TL6A 2BEVB 1B6DA 5D7SH 1W19A 4LJ7A 3AY0A 2ZPAA 3ARRA 2D31B 3P3UA 2YPLE 1CQXA 4J16C 3K9HA 1IGFL 1YDEA 2F19L 3RRFA 5I82A 3PWLB 2FUCA 2HPHA 4PZ0A 4CGYA 5FPHA 1EDHA 2Q0SA 5D1ZI 4RL4A 1FF5A 1BCRA 4X8OA 2APSA 4HHAA 2VNAA 3ARDA 5IOKA 3VFNB 3NASA 4R0LC 3MGTB 1QJ4A 4TLCA 1PV4A 4YCSA 3CNBA 3GUFA 3V6OC 3SBPA 2PIAA 3IQGX 2K5UA 1OSZA 4WW1A 4U63A 1OREA 4PGDB 2WUGA 3Q9QA 4EB6A 4YMUA 3HR5A 4BZ1A 4KH0A 1J2JA 3AEYA 3RG2A 1PEZA 3QKTA 3FT4A 3CFDA 5MEPB 2VSMB 3E84A 5DFWH 1UT1A 1UADC 4HSQA 1DFBH 1B0PA 4DTCA 2Z4QB 2P8SA 1JV2B 3FNKA 1UPXA 2O9JA 3I39X 4RA0C 1EO5A 5AAMA 4KAFA 2K3TA 4LDQA 1C1HA 3BJRA 2PYDA 2CO7B 4KJWD 5F71A 1AB5A 3TOXA 4MS8C 3C45A 2H9YA 2MCMA 1GPWB 1O5IA 3ZVLA 1TEYA 2PWZA 1LP9A 1Z9OA 4HG4J 2OK7A 3HVUA 3SE6A 3IEMA 4KCGA 4YGAB 4KRXA 4QGBA 3Q2LA 2I32A 2YC4C 2ZJ1A 1YJCA 1F0YA 3MCKB 4OGWA 2R0KH 4H4DA 2J5LC 4BBWA 1XTPA 4CCWA 3I61A 2GSMB 3BQ9A 3W2IA 2F7SA 2HO5A 2VAPA 2SBTA 2O7SA 3QCVL 3BE8A 2AXQA 1BE6A 2GYYA 1FVFA 1WTAA 1NAMA 4XVTH 1NCIA 4ZCPA 3C3JA 4Z78A 4RX1A 5IBCA 1L4NA 2HN7B 4KXFB 4ONEA 4JFZH 4QA9A 4NWTH 1QGDA 3DVIA 4DREA 4LMAA 5I6DA 3JTEA 2AS0A 4GRMA 4QOJA 5DEIA 4S35A 2I8LA 3FRUB 4QRTA 5A4IS 5HDBB 3U30C 3PZBA 1FZKA 1E9PB 1JIJA 4LGSB 3AJRA 1AT1A 2C99A 1OP3H 3TNMB 3S4SB 3IETB 1BDBA 4B53A 3CPSA 3CN3A 3LX4A 1Z8NA 2W6MA 2Y06H 3RX7A 3L3JA 4NO0A 3VKFA 2Y1WA 2XRZA 4MNQE 2E1PA 2R97A 2CGZA 1ETZA 2H51A 5H3LA 1ECYA 2JIBA 4BHUI 2EH8L 4ZCMA 4B7CA 1PGOA 2VA8A 2X6AA 3T1FB 5TDNA 2NNXA 1JDCA 1A6VH 3U9WA 4AN4A 2AYXA 3KJHA 1ZNQO 1SG6A 1C9JA 4HD5A 4PPNA 5JNWA 3L5HA 3TA3B 1F90L 3Q72A 3BBLA 2J12B 3QFTA 2Z65C 2P8MA 3THML 2OFWA 3NV7A 1CLOH 3PC7A 3UKDA 2GHRA 4ASUA 3HXQA 1UQUA 4NPYB 3OAAA 3JZMA 1N6UA 4HAYA 3U6BA 5EP3A 1KGUA 3LQKA 4MHHI 2OFPA 1OH7A 2BFVL 5E6IC 4NKQB 4ND7A 2R1WA 4OZGA 3FFDB 1EHKB 43CAA 1R8YA 4WY7L 3LHIA 1H19A 5KU7A 2OKCA 4YXHL 3OIDA 4DQXA 4X1IA 4Y2VA 1L4UA 4LVEA 4Y2OB 1K72A 1KCRH 3FR8A 3SOPA 2BGGA 2XQBH 3RAJH 2GTWB 4N4YB 3C1OA 3RSCA 1YVPA 5BN4B 3A3PA 5F7NC 3OKKA 1ES0B 4N5ED 4HK3N 3PE3A 5DJ2A 5D84A 1I5OA 1KTVA 1JA0A 2FJGB 3NXSA 1TO2E 5D2LA 1WQVT 2FMKA 2I6XA 1PU0A 3AF1A 4FWIB 1T2EA 3QT2A 3OR6B 1OO2A 1K6QH 3NUQA 3ZQ4A 4L8YA 3G08A 1CY0A 3HI1A 4P3DA 1TLTA 4PZLA 4DQKA 5LMCA 1COWA 4YJ2F 4WU7B 2FW0A 4OX9B 4X1KB 3IPLA 4EVNB 4IQFA 1K68A 3QB7C 1L4HA 4R1NA 2NT4A 1DDOA 2J5BA 1KLUB 1C7ZA 3VXUA 3CZRA 3F5WB 1XHEA 1V5EA 2PUGA 3IUMA 2BMAA 4M7LH 2H3HA 3RJMA 3VO9A 1GYAA 1ILWA 3B43A 2RI0A 3UTPE 3PU6A 5KKAA 1WAAE 1XDZA 3NEXA 1ZN2A 2R27A 2VDLH 5K1ZA 4FQPA 1HQRA 1OT1A 1QIKA 4Y4KC 4ND4A 1M1YA 4IRJD 5C07D 2OJZH 4TS1A 3P4NA 5CSZB 4EAQA 4GI5A 3RGWS 4ENTA 4GR5A 2WE7A 1MQ8B 5SV2A 1IHYA 3RG8A 5F3RA 1EGHA 4JLSA 3AKEA 1MWOA 3QJYA 3SQOA 3AS2A 2ASEA 4X6EB 4X98B 2GBLC 3CX6A 3IB3A 2I9KA 1KZQA 3TSAA 4ILEA 1YA5A 3V4PH 4NZRL 1IN8A 4UOW0 4C7OA 1KFAH 4MLPA 1GGUA 5I66A 3DE1X 1LD3A 3BGVA 3MODL 2LU3A 4HVTA 1L8QA 1MPAL 4MR7A 4QYIA 1NC3A 5A4AA 4S3MA 1KTJA 1SQGA 3NZHL 3BHBB 5GRUH 3F5MA 4KE6A 2GJZB 1T43A 2CJPA 2V2XB 1K9SA 4JFYB 3UC9A 3UK1A 1K7XB 2RA1A 1FYFA 5FCSH 4B3MB 3FTNA 4FLRA 1HG0A 4L3VA 2TSAA 3P9XA 5AUNB 4F60A 3BFVA 1J05B 5B3LA 1QS0A 5AI4A 4C7VA 4Q3AA 4OYYA 3RC2A 1HAWA 2B4TO 2JHPA 3TG2A 1BEYL 3ZY6A 5J59A 4EG3A 4P84A 1MELA 3R06A 3DHNA 3HG1D 3RNQB 1PFUA 4MEBA 4KZPA 2WUVA 3ARQA 2JAQA 3OE7D 4DKEH 2ILLA 2R2AA 1R12A 2DPMA 3MYYA 1A8ZA 4KK5C 4MQXD 3G1TA 1KVQA 4A5SA 5JYMA 1DC7A 5EXEA 3NIGE 3E23A 3HPJB 3A4TA 1Z3GH 5FV4A 3WS3B 1Q0LA 1E0SA 3WQHA 3K0WA 4MZIA 3KAQA 4PAGA 3OIGA 4A0HA 4ETWA 1RI1A 4US2R 1IKNC 1FCGA 2EXWD 4LDLB 2VZVA 4I1IA 2ZUYA 2PR4H 4HC1H 1XNGA 3FQ4A 2EGUA 4N41A 5G41A 2EUXA 4L9SA 1B74A 4W1QA 4ZUWB 2XWXA 4FVTA 2C9SA 4LCCB 1Z32X 1N0IA 3CZQA 1DLJA 5FO1A 2AITA 3KBOA 3WKQA 1HYGA 5A9RA 2V5VA 1JHLL 4QRDA 4FCVA 5ECGA 4FMPA 4FYYA 1QHNA 1TTFA 2WINA 4RGOH 2BEKA 1WXQA 2JFHA 3RS3A 1P60A 3M8KA 1VJ5A 3NCYP 3AAZB 4RAVB 2ZRNA 1CEYA 1JAXA 5DLQC 5KJCA 2J2ZA 3FLAA 3GFPA 2JJQA 3PGCA 1A1NB 2UKDA 3MLWL 2WO2B 2QAGB 3ULVE 2M26A 3ECUA 4M93C 2IAAC 6FABH 2OXFA 4W7SA 1V8OA 1H4VB 3TO4A 2RACA 2VPPA 1P1IA 3R6GA 4B3DA 1L5HA 3TR0A 4P3WA 2PXYC 4FJYA 2YUVA 1W5EA 4ESKA 5I8OH 3V4LA 2NTFA 4NOJA 1RMYA 5JS1A 5D7IE 3PWSA 4JBHA 3ZDWA 4J0CA 1GYUA 3GNSA 2XZZA 1U91A 3CF4A 2H8KA 2R2HA 4GAFB 4XC1H 3EULA 1GUAA 4GRWE 1ZDQA 4I48A 4RTMA 3QR0A 3CMGA 3T38A 3N55A 1JHKH 2Q3JA 1OPGL 4BDVB 2CGEA 1COBA 4R3SA 2LW3A 4ZQEA 2Q9AA 3BUPA 4OYLA 2YPLA 2E27L 5I7RA 5H80A 4HDKA 4H2AA 1XF2B 2ITEA 2P7TB 2C9ZA 2QKYA 1R3JA 3VJ6B 3PFHA 5BUPA 1WU8A 1FFEA 3PNWB 2X4LA 1KAQA 2I80A 1P7VA 4J4PA 1BPLB 3I9IA 3SEPA 4YP5A 3O3MB 1UFRA 2ZUWA 2AEWA 3A4MA 2YQ5A 4G6AD 1PZ5A 2XTJA 2IXDA 3AUJB 5LKNA 2RE8A 5H94A 4WT7A 2YRLA 4QJ4B 4RESB 5KJEA 5BUZA 3QJGA 4OZFG 2IIQA 4EHAA 4L1TA 3LQFA 4M7KL 3T3ME 4CKBB 5JXEC 3UBHA 2X0RA 1A71A 3UC0L 3BSSA 4PN7A 4QWWD 1JWSA 3ASOB 5CXXA 4OY9A 1AKVA 1KZHA 2YZ1A 1YQTA 2AFIA 4HWEH 2JCCB 1A9BA 4RORA 2B16A 2G2PA 3K1ZA 4J2XA 4QGSA 4P4KC 3EXLA 3KE9A 4WNAA 3V32A 3S5JA 4D9BA 2IDCA 4YJKA 2YW9A 3I5YA 5AOMA 2GJJA 4NM8H 2QV0A 4XEHA 4V0QA 1HKLL 1TQCC 5HD8D 1TQWA 1W9XA 3FU7B 1DEXA 1KYTA 2FPUA 1XIWA 2WBLC 3S35L 1T5WA 4AIEA 2FX7L 4HS3A 1MG5A 2YC1B 1V27A 1NASA 5G3YA 4NXNB 3EF4A 3LRKA 3S5LB 1JJBA 1BCSB 3I4FA 4IYKA 1YCHA 2GQHA 4HV8A 1SK9A 4ASUD 4Q8BA 1L5FA 1AKEA 4X6DF 5DBGA 1H0RA 1AHKA 2P5SA 1D5MA 2OTUB 3PPEA 3JYNA 3OLXA 3ORFA 4GUCA 3EYVB 1F11A 4NJAL 3M0EA 5KHAA 4LPTA 1V7PC 3NA4A 3AZPA 3K9CA 1YJDL 4M0FA 2O2DA 3WLNA 4TKUB 5H2BA 3A3KA 5K0CA 1B2YA 3DMTA 1WNFA 3LZNA 4X6EA 1YYLH 1C3XA 5DWQA 3CFBA 5J6SA 4EZKA 1DTEA 3QARA 4AI6A 1RQ5A 3ZW3A 5GPRA 4Z8FH 4V0LA 1HSOA 3PHAA 3H55A 1AYOA 1SHYB 3ZE0E 2A9KA 4H1WA 1XH3B 1K0FA 4ZAZA 5T3ZE 2VJYA 4MS1A 1FRZA 2GI7A 4PJXB 3FOZA 1P61B 5IXYA 3AT0A 5A5GA 4LDPA 3DUSB 1RZRD 1X7QA 3NJFA 4HETA 5KMGB 1O5OA 4LNHA 4EARA 1SCDA 3ZXXA 4BC0A 4YL4A 3BIAX 2GARA 3VH2A 3GLGA 4KVCL 2K70A 4H88H 3FQXA 1XZ0B 1CQWA 4XTRC 3LOPA 1J10A 2Z57A 4QTFA 3U7YH 1XZEA 1EHIA 3BIKB 4ZXBA 3CX4A 4OJFL 2J88L 4BMCA 4J0IA 5KWSA 2XN2A 4MYSA 3H9SB 5DVMA 1HF3A 1MRFL 3QRBA 4YT4A 2EC9T 4OGAD 1RPTA 1F8XA 3V0WH 2ON6A 5IKOA 5JHDA 4F38A 3MXOA 3FPAA 3SCMA 1U5AA 3QUHA 5LNGA 1Z5WA 1S2DA 5IU6A 4PU2A 4QJIA 4KAAA 2AE2A 4UDXX 2I0FA 4FEAA 1FDSA 2C1PB 2X7LB 3MJDA 2GJSA 2G5PA 2QZJA 3DMPA 1AS6A 4OZGB 2CKMA 3MNZA 2QX8A 3ALWA 3I84A 1L7BA 2A6IA 3RTLA 4XWGH 1ENOA 2X5KO 3GINA 1U95A 4IMLB 3T8MA 5IYZF 3HZRA 1VE1A 3KOWA 1FDRA 4FCCA 4PI0A 1DOAA 5EG6C 2JJVA 2F5AH 5CGYC 4NN5C 4NC9A 4JYBA 1FFXB 3U36B 2H2SC 3GF8A 4IIYA 5ILTH 4RD1A 2FXIA 2K2QB 2JIXA 4HWUA 2GSIA 3K72B 3FTPA 4DHLA 1MAWA 1W49A 4XMKL 4LQLA 2R1TB 4BFVA 1I6WA 3ULUL 4AJPA 2E4ZA 3TN0A 2NGRA 5IAKA 1VDGA 1QQAA 1W46A 3QAZC 2ZX5A 2RAVA 4AMXA 1XTSA 4Y2LA 5KZMB 1CJCA 1YR2A 1A6TB 1DHRA 4PJ6A 4O2EA 3SJVD 5L8LB 2YS4A 1CF2O 5AD0B 2WP3T 1A65A 1EDEA 3NAAL 1QOKA 4IGBD 1K8RA 4TMXA 3L0OA 2SKCA 1FLRL 1HUQA 5C8YA 4LGYA 4FM9A 2XBUA 2AJCA 4PRAA 1HSBA 1CCZA 3DLIA 5CT8A 4OUDB 1N6IA 2Y6TE 1MF7A 2ZZKA 1XQYA 4LFHD 1RWVA 4LCYB 2XQ0A 3I1JA 4LYDA 2NXYD 3ZVMA 5C2UB 2KE5A 1KB5H 1JIKA 3DIVA 4YA6A 1GR0A 1XZQA 2VDKB 4LZAA 1KEUA 4W6QA 1OGTB 4W1PA 3QLUC 1LO4L 3AK4A 4O0MA 1K2WA 4E15A 2FW8A 3OZLA 1AQLA 2FUG6 3OMXA 3JWHA 2JLPA 4WEEA 4BRUA 1KIRA 3LRHA 2A1UA 3RYIA 1MFZA 4H7JA 4JV5B 4LHUA 1OF0A 3GJ7A 2X89D 1KIPA 4Y2OA 3EA5A 2DL2A 1MO6A 4LSSH 2QENA 3OTIA 5LLIC 4HSEA 1FDIA 3HACA 4CIAA 1WZMA 4HJSA 3NBAA 4BO1A 2XDWA 4J29A 2BGWA 1LU9A 1FDUA 1JG6A 1I1AC 5IAJA 1AZRA 3BDBA 2OMNA 3ELDA 4PYMA 4F21A 4IIJA 4WL0A 4Z0NA 3D4LA 4XB1A 2ODHA 2IJGX 1JPTH 2JJTC 1P9MA 3ZTYA 4IMPA 5SV4A 4C3VA 1OAKH 2XH8A 1Z8FA 4GOJA 4P2RA 1OXKB 1JFQL 4YV1A 2Q87A 3Q9NA 2O3TA 1PT6A 1DX6A 3P9PA 25C8H 3C2AL 2HLHA 1ZI6A 4EZEA 2X2JA 5FO0A 1IGFH 5BT8A 2ZUCA 4QHNA 2GBFA 3SHSA 2QVIA 4JFPA 1ETZB 3KT6A 4PJIB 3CXDH 5ETUB 3DX6A 4P2QA 5JZMA 5E8DH 1XF4B 4PMFA 4ZUUB 4RH0A 4BFNA 4HS9A 5NLLA 2CXNA 4OBWA 1XDUA 1DVFC 1E6MA 3QJUB 1MREL 5IVIA 3SIWA 4RFEB 2VRKA 5D7HA 4YXWA 3R20A 4YDNA 3S48A 3NWPA 1EERB 3HZMA 4C55A 1Q8MA 1F18A 4WK2B 3PUZA 2VDNB 1WCWA 3WGOA 2PW2B 1CGSL 1NOJA 5ICYB 5DI3A 1HLDA 2H7XA 4W93A 2OV8A 4L5IA 1PW3A 1S8FA 4TXMA 4PRIE 2AI3A 2GTZB 4CVWA 3G8BA 4NICA 2BP8B 1UZGA 4UT9H 2WJJA 5JPNA 1ODIA 4QYXA 4XM0A 2EEAA 2KUTA 2QGDA 4DY4A 2VLRA 3WXVL 4MMYA 2ARKA 4Y1AE 1KTLB 6AT1A 3S5LG 2JDIA 1YC7A 3B1KA 4LI3X 5EQJB 3N9IA 3H9SE 5JXED 4PRKA 3GI9L 1KG0B 5H94B 1D2OA 4CL7A 1CGYA 4WI5A 4FEMA 2AJZA 1E2KA 1RI8A 2C31A 5EJ4A 4WFEE 1E6OL 1KEKA 3RFCA 2W2XA 1JK8B 3KL2A 4DCJA 3QYFA 2OZEA 2QX7A 3VCLB 1JPST 1BLIA 1U3TA 2IMNA 1J09A 3MLYL 2A7BA 1JQDA 1YRWA 2PL1A 3H7BB 4AQ1C 5E7QA 3WKNA 4RVFA 3MLRH 2IWEA 3TZHA 2CKBA 2N9UA 2PMKA 3RSQA 4BX3A 1OPOA 3A4AA 5IHBA 2PGDA 1FIEA 3SYLA 4HJ1A 3CVOA 1KC3A 2J5QA 1HURA 1U8OA 3I6MA 4IU2A 3TW8A 3NVMB 2FUG1 2PT9A 3CU7A 1NCAH 3L7BA 2ASVA 2XCTB 5BYJA 1TVBB 2H9GB 2WJ6A 5EUKA 1Z26A 3CVHB 4BFWA 1TJIH 3TLBA 5CJOL 1PSKL 1BQHA 5AW3A 3CPUA 2YIMA 1F2TA 1PS3A 4H0FA 1CGUA 2FSDA 3BT2L 4B0PA 1AD9B 1VHLA 2ZCZA 3FDZB 3OTHA 5IVXF 2PR4L 3WL4A 4XOIA 3LN9A 2F1JA 1GT6A 3VPCA 4UTOA 2R59A 4F9LA 3FYEB 2OG1A 2A5YB 1OTXA 2HRRA 1ZVKA 2DLCX 4BQNA 1BEEA 3CR7A 3HCVB 3D1VA 2FZWA 4PGFA 4FXKA 5KBYA 2I6FA 3AB3A 2A0LC 1XCQA 3L7FA 2C2WA 2Y1AA 5BVHB 4KNVA 4TTAA 4U3JA 2DMRA 3AUSA 3DZIA 1GGCL 4TQPA 4MPPA 2YJLA 3RUGB 3SQOL 3T4AB 4JQXC 1GN8A 3IGAB 3T7JA 5GV7A 4U2EA 1OXSC 4DJTA 4P2QD 5G55A 4IRJA 2B82A 4LYJA 3O82A 2G6TA 5D1QC 5IZ4A 2F6RA 4R8LA 5EMJA 4X6LA 3I5AA 2BMFA 2QLBA 4MYCA 3TTWA 2P6MA 3DBVO 1JYEA 1ZDSA 3UPTA 3B9KC 1DVUA 1ZHLA 2IV3A 3CINA 4R01A 5B1BB 3N07A 5FTMA 2QTVB 5CLYA 3GFFA 2RH5A 3E3MA 3QUYB 5FWQA 4CCAA 5D86A 3RPKA 3QNZB 1EG7A 1M7XA 3ANLA 4PJEA 3JBG7 4ZK8A 1CFVH 5KS2A 1ID2A 3ZDYE 1QR1A 3UHJA 4XGIA 2VTKA 4O2FA 2HHCA 4H31A 1QR4A 1IARB 2YPVH 3HE6D 2R29L 4KMRA 2A3TA 4NRXB 1VJ0A 3LKOB 5A2AA 5DLEA 2ZTUA 5AFAA 4PLVA 5JEDA 4GXVL 3QQ3A 2JJ2D 3QMMA 2VITB 2J55A 3FB7A 4TKWA 1RWQA 4Q4LA 2A9JA 3EOZA 4ZXFA 1HE8B 4F8QA 4I50F 4JFYA 4NDMA 3PV7A 5LCXA 4LY6A 1T3TA 2RGAA 1Z39A 4YRCA 5ENWA 3V1KA 3N04A 4IBOA 5BQDA 1ETB1 2XYPA 5HGJA 5L6YL 5EWIH 4HMDA 4KRMB 4M9UA 3PWUB 5F9OL 4NWUH 3RWCB 4NSKA 3RWEA 2OZ4H 3CB2A 2P0EA 3AR7A 2IAND 3KWTA 3NEPX 1FHGA 2A2ZA 3RTCA 3QVSA 5EVJA 2X3YA 4EEXA 1IMJA 3N2ZB 3KDPA 4CMHB 3ARFA 3VH8B 5E08H 4WJG3 4KWUA 1LNUB 2IG2L 2BZSA 3HMXA 4M43L 3EQ7A 1ZUNB 5LJYH 3QIWA 4AQDA 5AKKA 1W91A 3PXJA 1T26A 3UYOD 5ER6A 3QORA 3AG1B 1VRSA 4QDTA 1D8TA 3D8SA 3E9UA 4R4FH 2N7SA 2XDQB 5JQGF 2ICEB 4OHOA 4R2LA 1DTWA 3Q15C 4I7EA 1ISJA 2XW6A 4AW7A 4X7TB 5FYKH 3QBEA 5CJXC 2KB0A 2J21A 5HD8C 4NM4H 2ZE7A 5JAQA 1P8AA 3EH3B 4KQ3L 4J6IA 3EDCA 3TWOA 1QRDA 1YBFA 2ZI7A 1ID8A 5LLTA 3ADDA 1MQSA 1VL1A 2DWEA 2PWEA 2PFSA 1MOQA 4P3OA 1Z47A 3NPMA 4RTPA 5EIIA 4G8JA 5IDYA 3VTKA 3IFLH 4EW3A 4KKLC 1XRQA 1UT6A 2V17L 3NJKA 5HILA 4QEGA 3ISRA 1W73A 3FTGB 2XZPA 3JTSA 4EI6B 4BBPA 2FFRA 4P07A 4JDTH 1XCGB 3TS8A 1WT5C 1ZMTA 1IU9A 4WU7A 1TK9A 5HP5A 2PX2A 1KDYA 4UNQA 3NPSC 4CTMA 4GUPB 4CKQA 2AF4C 1NAML 1G7IA 4G9FD 3I1FA 5F7KC 3EYSL 4OJQA 5H35A 4G6AC 3N53A 1E5YA 1EZ1A 2W8BA 2QTAA 5EH1A 4MWGA 4L0PB 3RPBA 1XAUA 3DARA 3FHQA 5M7QA 3OMNB 1UC9A 2C3MA 1W16A 3E7JA 3ELQA 5DJAB 4NZYA 3QUZA 1CQPA 4ZUSA 4URYR 5KPDA 5F7YC 1WZUA 2XVLA 1PUXA 1YZGA 1YJBA 2OPBA 2WF6A 3WO0A 2OS7A 2G8NA 3L0ZA 2CDGB 2GYUA 3V4RA 3GSXA 2PWHA 3GG2A 3EW7A 1FY2A 1YRAA 2BDTA 1N2IA 1NAKH 4I18A 3BAJA 4NONA 1AACA 3M6VA 1ZPLA 5FUCE 1U3ZA 3A9CA 3CA8A 1GCUA 3MBED 3AESA 3QZWB 2CL7X 3MSPA 5DUML 3DL2A 3K5WA 2A2QT 5HDLA 4MWCA 2YHBA 1S9WA 3BA1A 1HH6A 4H1LA 4MIYA 2BI8A 3N59A 3JQGA 1FJ1B 4BKLB 1RPKA 4J94A 1JF5A 1DLFL 3AQYA 3BXEA 2P90A 1YTUA 2NSYA 5E94B 4OREX 4MWBA 2R0ZL 2CD7A 3ULUH 4XNMB 1ZJ4A 4RZHA 2NZ1A 3TW8B 1OYOA 2AABL 3TONA 4NUJB 3S3DB 3L18A 5M04A 2WJYA 5C7IO 1PLJA 2JFWA 3K9FC 3VXME 1NE2A 4BFCA 3C5JA 3TL3A 2IQAB 4EUPA 5BQ5A 4DABA 3SBWC 3UUEA 4Z18A 2CGRH 4PS7A 1NJ9B 1USIA 2OFQA 4TNWF 2NNWB 4FQLL 4K15A 1X94A 1MAVA 2D4DA 2FZGA 5CWSA 1XIWD 2NM0A 3E2HC 2YRWA 1G21B 1N6QH 1MFUA 3P52A 4HGNA 1USZA 1EAJA 4BN4A 4CRWB 3UUFA 2FG5A 1QJCA 1ONPA 1JGDB 1YEEL 3FFDA 4JFOB 2RGNC 1TD1A 1Z7EA 4P23D 2Q5BA 4I0PB 3S8GB 2C9OA 5C4GB 1ZTXH 3AHHA 3OZ9H 4FLFA 1U8UA 2CJUL 1NF9A 4YBQD 3PXCX 2GXUA 4BIMA 2QBWA 2P9CA 4LOIA 5ALCH 4JVPA 1L7VC 4AJ1A 4UTBH 3W6ZA 4ODXB 3P73B 3OD1A 2R9HC 2CRIA 3V7MA 5JQGA 2AXEA 3H1AA 3V6FB 5FM8A 2HYIC 4N0CC 3NQKA 3NFPB 2YK1H 2POQX 4B84A 3B20A 4X9FA 3I8OA 1E6WA 4YP1A 1TQCB 4PS4L 1S7TB 3KKKA 4KJWC 1ABEA 1JZ6A 5E8NA 4B3BA 2C8KA 1K7CA 3PBKA 1SB9A 2PH5A 1LLDA 4MR8B 3KZKA 2RGYA 3EYWA 2NNAB 1HE7A 4E41E 5EDXA 2FLVA 5AVQB 3M6LA 3AM8C 2DY0A 2BMWA 4NESA 3MGOA 2RHOA 1XSEA 4W8OA 4C3ZA 3WXWL 3FTGA 2P28B 1RAFA 3VDQA 1L3WA 3TR6A 5KSAD 3WNOA 3FZQA 1G20E 3IQEA 1XV8A 3PXXA 2Q7OE 1O2DA 1LNZA 3RWOA 3ZDBA 3RYTC 3O41B 3W5CA 3GJEB 3WEOA 1P4UA 4JG5A 1DV1A 3ICQB 3UJ3X 1JLKA 2R85A 1ZLSH 2IY8A 2P35A 4N7BA 1XEUA 3QIUC 1UZNA 2CHGA 4PWIA 2ZCLH 2PPLA 4AV4A 1QSED 3QI9B 4ZICA 3ZUNC 1WK0A 1L4MA 5KSBB 1SVZA 3S2ZA 5I01A 5DUPL 1M1XB 1JJIA 2CCVA 2EUZA 2OXCA 3QNYB 3EWAA 5LXTF 2IEYA 1BWPA 3WA6A 1YI1A 5E2WL 5CDSA 2CLDX 1LO0L 4WEBL 1WU7A 1FP2A 4ALAC 1B26A 3LTEA 1CFZA 5I7WA 1NPDA 1CB7A 4RULA 5J1AA 2QD3A 5I1DA 5EINA 4DHEA 4QKQA 3T8XA 1MW0A 4HF5H 1ZAKA 1X5IA 5EE1A 4HNUA 5EU7C 5AM3A 1UBLS 2FX5A 3EVFA 2WHRA 4CMCA 3RVXC 1PJ2A 3X2SA 2IH4A 3QEAZ 1QBBA 3NN8B 4IHJB 3WG9A 4LLQA 2O0JA 1UZAA 5B58C 5K8VA 2EJWA 4WJKB 1JRHL 4ZYKA 5SY4A 1MJFA 1N9PA 3RKPA 3KVOA 5EGNA 2GBPA 1KV3A 1CFBA 4ETMA 1YI8A 3VFGL 3FTSA 3PIDA 2H1FA 4TUYA 5I7OA 2WB7A 4OF8A 3RTQB 1HFWA 4U0RC 4F45A 4MAYD 3CFMA 2ZAMA 1S2MA 3QDMA 1HH4A 4PRPB 1C0PA 3DO8A 2I7OA 4HAKA 3L49A 1JOIA 4OKVA 2W2KA 3KVPA 4TQ8A 3L7IA 2VQ3A 1Q9OB 1NCDL 2GF9A 2WVGA 1V26A 5I5RA 4DLXA 4B3SB 1XEXA 1L5RA 3U9UA 4O2FB 5TPWA 3ARUA 4C0BA 4CNQA 2V9PA 4A55A 5HMLA 2TMYA 4HQOA 3WB2A 4DTGL 4F1WA 2PUFA 3OZTA 2FWBA 1FNEB 5E2JA 2DUNA 1JQAA 2F08A 3X1GA 2VZ9A 2BVQA 5DHMC 2P3SA 3VGFA 5K3CA 2FEKA 5HGGS 3BZFA 4KXCA 3SE8H 1YV9A 2K4MA 1N2CE 5EPEA 3NIGF 1H9DA 3ZU2A 2WIMA 4TVOA 4ECAA 4DC1A 4YP0A 3JD0A 2WBWB 3ZHZA 4IH1A 1MDBA 3BUBA 4G8EA 2VJLA 4LZJA 4F92B 3M3HA 4PHFA 1NKVA 2XN9D 3VJMA 5C1DA 3EZFA 4M1MA 4G81A 2XQYA 4ZW5A 1NVAA 1T9DA 4JGJA 3FDWA 1J8HE 4F2EA 1Q94B 1FJ2A 1VKHA 4K46A 3W4KA 2D1SA 5BR8B 2COKA 3CFNA 2ZG6A 5DJ0A 2OO5C 4FCWA 2LCIA 1W581 2PT7A 1XWWA 1HKUA 4HPOL 5HK8A 2WMPA 2NV6A 3S2YA 3RKRA 1N77A 3HNSL 5CD3B 1H6AA 2E49A 4K23H 1E92A 3DXAD 4UUAA 5KANG 1Y5RA 2QLYA 1YS9A 4X6XA 3VXNA 4JCCA 1DDTA 2E9JA 5DK2B 3EF0A 1KI2A 1O08A 1I1AB 4OZGE 4APQA 3SZMA 4R81A 4GKSB 1JEQA 4E09A 4J4TA 1FW8A 1A0QL 3GMPA 4TVPE 3NXKA 1ZOIA 5GGTH 1MDTA 4Z2YA 1ILEA 3R41A 1M8GA 1C41A 4MLSA 1SHTX 5CLJA 1A6ZA 3WV0A 2IZOA 1TMCB 5DCCA 1FLVA 3ILQC 2FSSA 4HWBH 4HQRA 1Y42X 4RLDA 1OA1A 2IKSA 5LDGA 4HQFA 4DV6B 3V6ZB 1JFFB 3G6DL 3QQXA 2EFCB 5AOLA 3OJEA 3PCRB 4N8CL 2GH1A 5ALOA 4YRGA 1BKSB 2CNBA 1ZGLA 4EA6A 1OPRA 1KTLA 3GMQB 5FOBA 4PYNA 4EUPG 3CEJA 4GW5A 5JAMA 3WQQA 5F0LB 3F6SA 4QOHA 1SXHA 5TGBB 1AZTA 2BE7A 1M1UA 4R16A 3LKQA 2W48A 2YV2A 3T8XB 5H9VA 4TM8A 2IYTA 1HY3A 4JJEA 4X9IA 2G07A 5L8VA 1UCTA 4G9FB 4NLAA 1CFQA 1U3GA 2LTQB 4X7EC 4B74A 4QHLA 2C8LA 2Y7NA 4WI7A 3OB0H 3MNWB 1WXXA 2ORIA 1CBJA 4HAVA 3BAFA 1RC0A 3DBRB 4ZG1A 4L22A 1NIFA 1Z2EA 2J9YB 3G6JE 1QYDA 3FB4A 2NO5A 3EGOA 1MCQA 4K3JH 1RZ8B 2RIKA 3TPUB 4FUTA 4EHIA 4Y8VA 2OP4L 4FILA 4OLXL 1R37A 2WLSA 3C85A 4TL7A 4B3CA 3OAAD 2R60A 5F3FA 4JZOB 3PWJB 4Z7WB 4DWVA 3VRHA 1XP5A 5LQMA 1QMGA 3ZY2A 1CVSC 2VJMB 3I9FA 2QIOA 5CAEA 4WAFA 1ITBB 4LC9A 1RUAL 3SLKA 2GXAA 2YRFA 3ESDA 3LUAA 3TQQA 1R74A 1TYDE 4NYJR 1YHPA 4A2DA 3WIHA 3B89A 2V5TA 1KE1A 2W00A 1K75A 4BZYA 1FYWA 3WSVA 5CMLA 2ZJFA 1UKYA 3CXHJ 3AR4A 2JAWA 1WR8A 2PUBA 2OQVA 1K98A 4AB1A 1HH9B 1FSPA 1FJXA 2WTXA 1SVIA 4JB3A 2VXVL 5EOTA 5I1HH 3V5NA 1T0OA 5JSYA 4B7IA 4EHDA 1ATZA 4YAQB 4AYTA 1C3JA 5DD5L 3LUCA 4YRZA 4Z4CA 1IC5H 2GHTA 2Y1KA 4JE4B 4PYKA 4C4OA 4EHBA 3RUFA 4QDUA 3WL7A 3FZYA 4X6DA 1BIIA 4V38A 2J71A 3HCFA 4OKDA 4ZMTA 3ULUD 4KLRA 4ACAA 3SC2B 3C6LD 4F7PB 4UHJA 4EJ6A 2ROQA 1A50B 2XKU