3NIFB

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alphaIIB beta3
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 122
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nifB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nifB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nifB03
1JEYA 2VDMB 1SHUX 3VI4B 3M6FA 3V4PB 3IJEA 2ICAA 2UZYB 1QCYA 2O7NA 2WW8A 2VDOB 1PT6A 1ZOPA 4MMZB 1AUQA 5KYYB 3NIGB 1L5GB 1U0NA 1XDGA 4BJ3A 2ODQA 2X5NA 2NUTB 4MMZA 1OAKA 3EOAI 4HQFA 4XW2A 1L5GA 3EOBI 1FE8A 3ZQKA 5KYYA 3NIFB 4IXDA 3OL2B 3AFCA 4A0QA 3HXOA 4O3UB 3EGXB 1JLMA 1BHQ1 3OL2A 3FCSB 3V4VB 3K6SA 4CNBA 3EGXA 5KYNA 1U0OC 4JX0A 3FCSA 3IJEB 4UM9B 5E6RB 2VDRB 3K71A 1M2OA 3TVYA 5HGJA 5HDBB 1JEQA 3QA3E 3ZE2B 4C2BA 4CN8A 5E6RA 1M10A 3T3PB 1XUOA 2ODPA 1CK4A 1YUKA 4O02B 5KYXB 1YVPA 4WK2B 5LN1A 4CN9A 2XWBF 5KYXA 4HQNA 4O02A 4NENA 1IJKA 4G1MA 1SSLA 3NIDB 4Z7NB 5KYUA 5HJ2A 1BHO1 3BN3A 1DGQA 3AL9A 4JDUA 1M1XB 3K6SB 3OKWA 1IDOA 2NUPA 4F1KA 1MJNA 5KYWA 3RAGA 1JV2B 4GZ8A 5E6SA 4NEHB 1M1XA 2NVOA 2I6SA 1AO3A 3TW0A 3ZDZB 1JV2A 4HQKA 1T0PA 1Q0PA 3PPWA 1MQ9A 2M32A 1U8CB 3K71B 3PPYA 3Q3GE 1IDN1 3NVQA 3HI6A 1JEQB 4HQOA 4C29A 2VDNB 1OLZA 3T3MB 5E6UB 5ES4B 1U8CA 1ZOOA 4WK0B 3EG9B 3EH2A 4Z7OB 1DZIA 3E2MA 1PCXA 1RRKA 5E6UA 1CQPA 3TCXB 4C2AA 3EG9A 2VDLB 2VDQB 4NENB 4G1MB 1YVRA 1TYEB 1ATZA 4UM9D 1M1UA 4K3JB 2XGGA 4MMXB 4UM8B 1AOXA 3F78A 5KYUB 4FX5A 2NUPB 2WINI 3AL8B 5KYWB 1NA5A 1V7PC 3PPVA 3HXQA 4MMXA 5E6SB 1LFAA 1IJBA 3EGDA 3F74A 1PD0A 3BQMB 3AL8A 2VC2B 3VI3B 1MQ8B 3EFOB 2XWJI 4WK4B 3GXBA 1RTKA 2B2XA 4HQLA 1N9ZA 1SHTX 4DMUB 5BV8A 1MF7A 3EH1A 3EFOA 4G1EA 3PPXA 1PD1A 1UEXC 2VDPB 1T6BY 2VDKB 4M76B 1SHYB 1FNSA 1MQAA 3N2NA 3K72B 1ZONA 4WJKB 2P26A 1RS0A 4WFQA 3FCUB 3OKYB 4PN7A 4MMYB 2IUEA 2ADFA 3K72A 4IGIA 4F1JA 1MHPA 1N3YA 1M2VB 1RD4A 4MMYA 3ZE1B 2NUTA 3TXAA 3ZDYB 4IHKA 4O3TB 2I6QA 3EGDB 2I91A 1M2VA 1QC5B 1XDDA 1SQ0A 3ZDXB 1JEYB 2QTVA 3IBSA 2P28A 4G1EB 4Z7QB 1QC5A 3ZE0B 3BQNB 4FWWA
chains in the Genus database with same CATH superfamily
5DJZB 2ATPA 4HIJA 3TEFA 2J45A 3K2KA 4P4GA 3NM4A 1N5MA 3GZNA 4OI0A 1X15A 2APTA 2CFOA 5CA1B 1ADQA 4NCC2 4BUZA 4H1TA 3RAJL 1QLFB 2WBJB 4G0PA 4BJ6A 4RGNB 3U7EB 2VTKA 1QWUA 1NXXA 4CWAA 4YXLL 5L2KD 3NHRA 1G6HA 4JK0D 1ACMA 1EE1A 2XAAA 3TRIA 1NC4D 2HSGA 3P9KA 4OFYD 3DP7A 1MXGA 4LIQH 1CV2A 1A21A 3SDDC 3KYMB 2I3GA 1R4AA 5CM9C 4F8JA 1S2OA 2HJLA 2OJEA 3K8MA 3HKCB 3FNKA 5D7IE 3O1HB 1CJCA 3MV9B 1T0MB 1C3OA 5AI0A 2Z30A 5JDCC 2NO5A 5KX5F 3PLAE 4R84A 1OX4B 4IQ8A 2X14A 4BMCA 4DEPB 3UZUA 3ZV5A 2DQTL 3RYHB 2VRQA 3L3JB 2NSLA 1P7QB 2VABA 5MEOA 4YSRA 3A3PA 5F7YC 1EK6A 5LXTB 4ARCA 3EXJA 4ZU6X 2C20A 2ZTVA 1XLUA 4RFNC 4PZZA 1MEJA 4MUJA 4WHMA 4G7VH 1I4FB 3LUAA 2X1OA 5KJRH 1HK6A 1XAKA 4CADB 3NM5A 5KMGB 3B7UX 2EJWA 1W85A 3O2QB 4ZNCD 5JLZA 3SOBH 2CN1A 3HVKA 3NORA 3GDHA 4UE3S 3QI9B 3SIPA 2I3DA 4FEYA 4L57A 3NFNB 4FW9A 4IDJH 1AC5A 4P3YA 5FLXA 4NNYA 1XD2B 1H5BA 3OL2A 2NY6C 4RY0A 4H0HB 1V8PA 1RRFA 1QU2A 3KAAA 4H8PA 1PJ4A 2D03H 2F8LA 2YNMD 3FW1A 3PT9A 4HLUC 4QODA 5H3CA 3MCUA 2P1DA 4DN4H 4RGYA 1BN7A 2C5FA 2CO6A 3GMNA 5CBAB 2X3UA 2EDYA 3VV2A 4WJLA 2PXYD 4DA6A 3SC2B 2ISSD 4LYJA 1G55A 4KUCF 2E59A 1IAKB 2BBOA 4N85A 1YZYA 2WVAA 4A8JB 1BS2A 3EHDA 2QMHA 3IO3A 4GR4A 3CXDL 3EJWA 1VCAA 4AJYV 3VGHA 4Z76B 1ICIA 1B74A 4MA8H 2V33A 1K2VN 4Z4HA 1NDGA 2OE2A 4YSSA 4EI7A 4NN5C 3L0ZA 5E1BA 4CGZA 4ZUSA 1N4XL 3HJHA 2FLBT 2PBLA 5CD5D 4O0MA 4KPYA 4YFLF 5ICMA 12E8L 4DDTA 1EVZA 4YRCA 3MX0A 3MLTB 3LIZH 4MDRA 3NA9H 4RFEA 4EL5A 4FFZA 2ZJBA 2G8LA 3N86A 2HJFB 3D3WA 2I8AA 3C48A 4J1SA 2X2UA 4A0GA 3QLJA 3OZWA 3CF6R 3EK2A 1WS8A 5DRYA 4O4IB 4AG6A 1R9JA 5IVNA 3PXUA 4FGZA 3KSZO 5HQTA 1MCCA 2G30A 1R1CA 4FTVE 2HTKD 1ZPDA 2J9FA 3PUJA 2VN3A 3IURA 4F3CA 5FUVA 3P3UA 2ZJZA 4REQB 3K94A 2V17L 4ESVA 1ETUA 3R3YA 1O7SA 3RU3A 1AZTA 1P2TA 3FO0L 5JH7F 2IEGA 4M8VA 2R29L 5KAQF 2PXXA 5GV8A 1ZUNB 2R68A 4AQAA 5BCAA 4F2DA 1JB9A 1BX3A 2W9EH 3WFBH 2R69A 3WIHH 1NBME 3TNNB 2QSTA 3UBXI 3B34A 4FLQA 3IFOA 3SZKC 4X54A 3C75A 2DQIL 2XTAA 4Q3AA 1D6SA 1EDHA 4I55F 3VO1A 3QXDB 2JFPA 2EYTA 3WYNA 2NG1A 3TCKA 3H42L 1FNFA 1CZNA 1Z2EA 5INTA 5SWQB 2BL4A 2YV2A 2W58A 1Y5IA 4OF8A 3HC0A 4MLPA 5K3FB 3ILEA 4I4NA 2CT8A 3AU1B 1S3FA 5F88B 1TF2A 3FTNA 3GLHB 2B0SH 5KDLA 4QYOA 3E5NA 2EBWA 1GGUA 1DFIA 5AXAA 4F9FA 4KDTC 4RULA 4IHBA 1IXRC 1ZHHA 1ZGLM 4M99A 4FUTA 1FYXA 3L6UA 4JFUA 5DYOB 5LWHA 4HAXA 3STVA 2F55A 2OG2A 5C07D 5J4YA 1LK3L 2DAVA 3TCNA 2V7BA 3SR0A 5CEYA 4ZI5A 3WSWA 4NN7C 3LVBA 1N8ZA 3EYWA 3M6MD 2BTQB 1CGVA 5KSZA 1P9RA 2NT1A 4QRUB 3P9LA 3RADC 3ZUPA 5F7MC 1L9SA 3DT9A 4WOPA 3EPLA 5IAOA 3D5EA 2ORVA 3RPEA 3DUHA 1H2RS 4OCSH 3QWRD 4LJAA 3GQBB 2EC5A 5AK5A 5JY6A 3NCEB 5KSBB 5JOPE 4MQ7A 2IF2A 5FYJD 2ZI9A 1HY3A 2HNKA 4HL6A 3FFBA 5L8LB 2EZ4A 1NCOA 4WBNA 2AJTA 2Y7SA 3QHFH 4P7JA 5JIMA 4UD6A 1D5XA 4I48B 4AI6A 1W36B 3VR1A 2GYUA 3VFSA 2HWZH 3AW8A 3AG1B 4AYGA 4IIQA 5FO7B 2ARKA 2NM0A 4FADA 5E4EC 1E9EA 4F8PA 4P36A 3AS2A 3T2LA 1PG2A 1Y1UA 4Y2SA 3NZ8B 2GJSA 3P3RA 4FXTA 3P2KA 4BN5A 3A3NA 2H4FA 2ITEA 3J2PA 1QQ5A 1KGXA 3WNCA 1KY2A 1EVKA 3QYPA 2XFXA 1VL5A 5ACMA 2ZT5A 1YUMA 4P38A 4ZDWA 5EZIH 3G85A 5JADA 2VF2A 2ADOA 3QCVH 4Q9NA 4IQFA 4GF5A 4WFFD 2BR4A 4BVEA 2FKNA 4IZIA 1DQLH 4XRGA 5TMPA 1S89A 2BTOA 2JH9A 2C5BA 4YRIA 1QP8A 2AQKA 3J7AC 1XLTC 3U1SL 4DAGH 3ZTDC 4LSRH 4NO0D 2J8ZA 3DLAA 3HZOA 1P7WA 1V5JA 3E80A 1D5CA 3V1TC 2JQMA 4F3NA 1N5IA 4GWLA 1ZMYA 1A5FH 5EZSA 2RHGB 1FC1A 1C3EA 4Z9BA 1ZESA 3QE0A 2WF6A 5A4AA 4D9RD 4WVLA 1RJFA 2X9VA 3OFSA 2O5YH 5IHHA 3GRWA 3VWKC 1Q9LB 1BX2B 4XYMA 2A99A 1E7VA 4GAJL 1AO7A 2NY0D 4UFNA 3QZPA 4HNVA 3RB5A 2VISA 3KKQA 3KLAB 2EX1A 4DSNA 1YUHA 4IOSA 1O96A 1CQIB 3WYFA 4NXMB 2W6PA 4NLHA 1ZW6A 4JI3B 3Q11A 5EPMB 3SBOA 1N64L 2DLCX 4FXGA 1CZRA 3ANMA 3EZ9A 1ESEA 4LL4A 1UXMA 3HWWA 3QEKA 3O6MH 4P84A 3C6KA 3DGFC 4XP9L 3RTQC 4C0BA 1KNOB 4PY8J 3QNYB 1UK9A 1S9DA 3B85A 2P9HA 2UVPB 4EBBA 4ANKA 2PUBA 4MS1A 2GO7A 2BE9A 1GA4A 1U94A 4Y2TA 4GI7A 1FSKC 1SU7A 4F2MB 2YKGA 4YHLL 4OCWH 2I7VA 5EE5B 1D1SA 3DHWC 1GZ3A 4LHWA 3G0OA 4YDIL 4PBTA 2RHEA 5B53A 3SWWA 1HTTA 4PTUB 3JQBC 3ELBA 4PLJD 3RBXA 4YK4B 3V4UH 3E6HB 1VC2A 3GAAA 4B84A 4EHJA 3OF6A 1W5FA 4RCVA 1A7QH 3DA0A 3SDDA 4RCAA 1ACJA 3QPXL 2CXGA 2IA5A 1PLBA 3QVWA 1V9CA 4ZZFA 3SDZA 3NDPA 4OZHB 4F91B 5JDCA 2JQZA 2EHDA 2YZMA 3DP9A 4DKEL 2FH5B 1Y4DE 2JJMA 3VHRA 3BYYA 3W8EA 3G82C 6ABPA 3LKOB 3HR8A 4YDJB 2AEEA 1I1CA 2BFBB 5FV2A 2DQDL 3CU7A 2J88L 4F9PC 3QLTA 5K8JB 4GR5A 1U41A 5DHTA 2ZTMA 5JNSA 1CY2A 4Y0VA 4XOEA 4JZYA 4JXJA 1EFRD 2DY0A 5HZKA 4Y16B 3ARGB 1M2VA 3DOIA 2JLPA 4ELKB 3KGTA 5FA3B 4MUKA 2DTXA 1MCQA 4IXMA 3O03A 1FG2A 4DLBA 1LP9A 5DJYB 1E5YA 4WY7L 4HLUA 2VTVA 2FE0A 3O90A 4FXKB 3OTTA 3OFKA 1MC4A 1N2SA 3FBQA 1TZJA 3I42A 4HFUH 3K5IA 1S7VB 3ZTNL 4MITA 4EG6A 4W5NA 3R9XB 3M4ZA 4UIKH 3QZUA 1VDMA 4C55A 1A4AA 3B6SB 5ESVB 4WKZA 1PQWA 2JGJA 2EZUA 1OPGL 2EGHA 4Q4JB 4ZUVB 1JAYA 2XX1A 1CY7A 5BZWB 1WQ1R 1X7XB 3BIJA 4FNTA 4GR9A 3RJDA 4NAJA 1SB8A 4ALJA 1Z66A 2ADMA 1RZKL 1BJKA 4Z78B 1QYWA 1CIDA 2B35A 4GBGA 1OZHA 5DJ0B 5IBTH 5JZVA 4YONB 1HFKA 1T1IA 4N8PA 3OJMB 4XX0A 3ZDXE 5GGXA 3KHOA 2V55B 5B38A 3QMVA 2APJA 4YDKH 1XT5A 5JHAA 3OE4A 3EZYA 3V52L 1NUQA 3GZJA 4GAFB 3OM0A 5J3HC 2CEAA 2OLKA 3ARBD 3SYNA 2WKSA 3OM1A 3VPBA 4G8GB 1E96A 3S70A 2N1MA 3OEHD 5I6LA 3U1BA 3P2OA 2WM2A 4ORZC 2IBSA 1FRQA 2AJYH 4GI9A 4U31A 2HAEA 5I9TA 2O7RA 3HPLB 3ULUC 5BORA 4IDAA 1P7CA 4Z49A 3QZBA 3FYCA 2PO6C 1LKZA 4Y67A 1QAQA 3FUKA 2ZJ3A 4CEJA 5GXBB 1PEDA 2P2GA 5J13B 2ZWVA 1QFUH 5ID1A 5D2LE 1XTBA 2BM8A 2QRMA 3BUIA 5A7HA 2WOOA 3VYWA 2NADA 2R65A 4PIMA 3Q3GB 3KVNA 4TTQA 3SZ3A 4BXOB 4I46A 4CL2A 2ZCLH 3SQOH 3RM3A 3RKDC 4JLPA 4ZXPA 2ZUWA 2W70A 1E3IA 3BAEL 1N5JA 2E7ZA 3R1IA 3G7SA 4W9EC 1CICB 2VSQA 3GCXA 1TAGA 4KV5E 5EN4A 5LR6A 2I5YH 3QLUC 3ZKQD 5BN3A 1VKXA 2RBEA 4AULA 2VT7A 5ICCA 2NLJA 2C5LA 2A84A 3NUKA 1GVIA 3KVPA 5AB0A 3BUYA 3NZHL 2QNBA 1V26A 3ARXA 1HWYA 3L4SO 4A2CA 4OSUL 4TNVK 4GUOA 3ZVNA 5JIBA 1GMEA 1NWOA 4EFLA 2CLIB 3TZKA 3HYRA 5LKAA 2OGZA 1UKQA 1H6FA 1R6BX 2V0AA 4KDTA 2QN6A 1ZJ5A 4GMTL 4YEFA 2AOXA 2C4KA 1MCOL 4U3SA 3GO1L 5ALMA 3FDWA 3SQBB 4NHOA 5LGJB 2OS7A 1YC7A 1T5BA 2R5FA 3TQRA 2VLKA 5CDGA 5DNDA 4Q3KA 3T6WA 3ONWA 5GRJH 5BNWA 3QS3A 2FUG1 3ZJ4A 4ZJ9A 4HS3A 1DLFH 3GLUA 1NY6A 3WLFA 3OFNA 1R34A 1ORSB 2UXCB 3ZL4L 3LY5A 4U4IA 4LP4A 1A4RA 2GJ6A 5KS9F 1U2QA 3FOCA 1A7NH 4P81A 2I54A 5DB4A 4LSDA 4WOKA 3VR0A 3TFBA 1KF9B 1BGXH 3RC7A 2VQ4A 1Q3KA 3OCJA 4BKSC 1KDVA 3X1BA 3LUFA 1XPJA 3S2ZA 3DX3A 3FAZA 3TBTA 3DX2A 4G4GA 5DD0L 1A4UA 1JQBA 4L5BA 1YKSA 4C2BA 3CT6A 3P4MA 3TQOA 4U8HA 4A7TA 5C3IA 2C3XA 4JB8A 4HIPA 4KR0A 1QWOA 5GSRB 4KJXA 5IFHH 5JT1A 1MVNA 4XPGL 1JF5A 2WJVA 1MA0A 5I1KL 3O45B 3CH8A 1QO0A 4UHDA 1J39A 2YD4A 1XF4B 4KXZI 5IVXE 3B48A 4CUCA 4AMBA 5ALCH 2BEUA 3BQUD 5DURB 1SOSA 1JXFA 5AOZA 1IIBA 5F9WC 5KBYA 3WUWG 1FV1A 1TO5A 1NBOA 3L4BC 2W95A 4AV0A 1QO9A 1VSCA 3CG8A 4MAUL 3WHKA 5F3HA 3SC4A 1T5XB 3LDHA 3RVVC 5GS2H 4O4JA 2YWHA 3QIVA 4KWUA 1WYJA 4JRXA 4RDQG 5HKAA 4UTCA 4IG9A 2NZJA 5FV1L 3S4SA 4FJ1A 5MEND 1WZLA 3EJRA 1D7OA 4GI6A 1II9A 1ULSA 1IEBB 1JTEA 1EWHA 4NL4H 4Y2VA 1JE0A 4QHPA 5FBWB 1B8NA 1IBMB 4OQYA 2R96A 4N5MA 2H0RA 2WPGA 1B0PA 4MYTA 1XLTA 2FPGA 1L5GA 4HBCL 3SDAB 3QXXA 4PP2A 1P2GA 3FGPA 5FYLL 4LZLA 1MKFA 1QBML 3IE1A 3FOFC 3DDCA 4X1OA 3KS9A 2BCGY 3VXME 3MZ0A 5FOSA 1LL1A 4TLEA 3WYEA 3GDBA 4OCZA 3OSUA 2R0ZL 1IFHL 2H1SA 2HVKA 2YQ3A 1Q0SA 2XDHA 1BFSA 1XXHA 3K4PA 1TETH 4UTRA 3RHWF 1N7GA 3VWKA 2AN4A 4D8WA 3V2GA 4WZBE 2VJOA 4ALMA 3MHZA 2Z57A 5HE9A 3EQZA 4TUUA 2WAYA 3H7BB 7MHTA 2QQ0A 1SHJA 2ID7A 1H9CA 3JYOA 2H0FA 5F35A 4DANA 3SKYA 2JH3A 1UZMA 1CRLA 4C2AA 3UTTE 5L7XL 1VZ3A 3M1BA 4MNTA 1MCBA 1F6DA 2FZ4A 5I6PA 2QE6A 1OVMA 5KSVB 3PJDA 3MOQA 5TPWA 3C8MA 3RTQA 2FEWB 1OGTB 1WCWA 3UTPD 2D2XA 1XLWA 2DW5A 5BP7A 4LJ9A 4NY1A 3IVXA 1DINA 5FT9A 4XBEL 4UQOA 4X61A 4A6YB 1AV6A 1U0GA 4I81A 4Y19B 2CR6A 4LPXA 2GY7B 3BTSA 2K1MA 4U7MA 2B5IB 4JS7A 4ZV4A 2VAPA 2J08A 3ZKWB 4KKCD 4R7NA 5IHBA 2C94A 1I8KA 2YJ3A 3W8DA 3T4YA 2UUBB 1GPWB 1ZMTA 5B1AB 4RXUA 2GFBB 1FDWA 4U6XA 3ZLJA 4OBSA 5IB2A 2J1LA 3JQBA 4Q6IC 4IQ0A 2JAXA 3HVRA 1P29A 1UK6A 4DILA 3HJGA 3TUJC 2DI7A 4B2LA 4BEVA 1OLUA 4OZIF 4B3MB 4JHZA 1YRHA 4L9DA 4QSHA 4GLBA 5EDSA 1OXTA 3T5CA 3X14B 4TN1A 3POHA 5E6YA 1XF3A 2F7IA 4LXGA 4Q18A 3WE6A 2NV6A 1HLFA 1UACH 4HN4B 1PYWB 4ZYKA 2MKLC 4OA8A 1P53A 4W68A 4PIPA 1CZ8H 2V7NB 3DVSX 1KCUL 4P5RA 2YXPX 3D48R 3IP3A 1XCTB 2IOQA 1BH2A 1B23P 1ZCJA 3ARFD 3JU3A 2WZPD 3NHUA 3TO4C 4LPTA 4BKLB 4F9PA 1IB6A 2Q8NA 3L4XA 1FPTL 2K87A 4FFSA 2KLSA 5JJIA 2FP4B 4Q9CA 3ORFA 1GTSA 1YB4A 3BD3A 1TK2A 4G09A 2F6RA 1KJ8A 2XVKA 2FWOA 4A8PA 5HZGA 5DUPH 2O57A 4UFPA 3QHZL 2O5ZH 2NSXA 4DLAA 3RR2A 2Z35A 1DCLA 3FPCA 3AUTA 1RWWA 3K0BA 2QRKA 3L3GB 3BOSA 1XFDA 4MASA 2YZNA 4B33A 4HPOH 2XUOA 4BX0A 1G18A 3O6FC 5E9AA 2BNRA 1IFGA 1W1WA 4XCCH 4J3OC 3KCPB 3SOTA 2PFSA 3QIUD 3M6FA 4YREA 1DDHA 3SE4C 3G59A 4H9GA 4X7RA 4O51A 4C22A 4E9QA 2DPXA 2ZYDA 3KE9A 1OFUX 2EZ0D 4FFOA 2YXEA 1OARH 3LPPA 4HGMA 2Q76A 4EHLA 2ICWI 5FYKD 3DKVA 3GOQA 1AXGA 3VNVA 2P9CA 1ERNA 2YQ4A 5EOTB 4LLQA 3MLAA 1EBBA 3BO8B 3DEFA 1W1UA 2V6GA 1Z2PX 4RNRA 1VGQA 2ZRCA 1P1ZB 1U9JA 2QPLA 3BXZA 4Q2ZA 3TEYA 4HAWA 1E2WA 3QFFA 1Y82A 3EAQA 3RHFA 3KOOA 2GF0A 2L17A 2OMYB 3QYAA 4PN6A 3EZ8A 3B1KA 3VH8G 4S1TA 2YD9A 1EQWA 3GMOA 2BP8B 1L7OA 1F0KA 3VRLF 1F6FB 1EIWA 1MFVA 2B5VA 1YQTA 2B2CA 2OK0L 5CCBA 4IH9A 5DBFA 4W1RA 4C56B 3TA3D 1IEAB 3QCTL 3AXLA 1NFDF 2GZRA 3I9KA 4XB6B 3PE9A 3V4OA 5D7JB 4DP6X 4GOLD 1IL0A 1FNSA 2PO6A 3D0QA 3T1OA 4EXKA 2GCIA 4ODWB 4HEJA 1E5XA 1KULA 1KJ2A 1KEGL 4KWCA 3OPYA 3DI2B 1M1NA 2AMUA 4JG9A 1UJ3B 3INRA 3MJWA 1GARA 3LYRA 3QJYA 1R5NA 5EIQA 4Y2OB 4K9EH 1KJMB 2X0VA 1YVDA 3A2NA 3EIEA 4NUJB 1G8HA 3QLUA 4XRCB 3GCDA 2IY9A 3BL5A 4LFCB 4MPTA 1FGNH 4GYKA 1E0JA 5ABPA 3MA7A 1RJLA 3GBVA 2Z93A 5HBRA 5ALSA 4IOLA 4XQCA 4TTJA 4WLUA 4JJ4A 3FTYA 3NHMA 1M7IA 5FKPA 1X9HA 1VPVA 3H8SA 1AP2A 3GFUA 2P27A 4D9HA 3KB6A 5KYXA 3ES9A 1T4KA 1A7OH 4NYIQ 1PFUA 3KL2A 3T3DA 1BX0A 5HDQA 4U6HB 2PMCA 3INUH 3P4NB 2P8LB 3NG5A 3O4FA 1B90A 5EYPB 4BWYA 4N1CA 5AVYB 3KL0A 4Q48A 3MRVA 3UXEA 1E2ZA 3U79A 3FNEA 3AQZA 5H8WA 1AY1H 2HJ9A 4ERXA 4N26A 3B60A 2I7TA 4LIQL 5BV1A 5KNDA 4BQBA 4DDVA 3QEGH 2EFCB 2E86A 4MR9B 4E9XA 1F2XK 4HH9A 1BEYH 3VMOA 4DLZA 4HMDA 4UTNA 4BRVA 3ZKAA 4MS3A 2H2DA 1WETA 2J7PA 3IEPA 4M0CA 1I3VA 5A1AA 2E56A 4ZHQA 4X4ZA 5DEGA 4Z1OA 4X98B 4I5BA 3MT0A 43C9B 3SE6A 5HHVH 3O3AA 3EBAA 3P4YA 4DCTA 1QRAA 5E2JA 4LQ4A 4HKXB 1GGNA 1F38A 2SICE 1HQKA 2RC5A 3ZW8A 2BS71 3PDCA 1DJGA 1O5DT 3G1TA 3MWDB 1FFQA 4Y30A 4JDZB 2BBTA 1OB2A 5DRNA 3LCVB 4NEGA 3MWEB 2NDGA 3FOMA 4XWYA 5KJRL 2GM9A 1HYHA 1JBKA 4UOJA 3EARA 4NSNA 3KUCA 3R2JA 4C6TB 5SWZB 3SOBL 1I7PA 3SEPA 4RFSA 1WSAA 4D1YA 4PBRA 2RGNC 1KYWA 2I22A 1J8YF 4ASUA 3RYIA 4UZEA 3MN8A 2FKAA 2HPVA 4Z3EA 4JUDX 4IDJL 5A16A 4Q4DA 3L5HA 4A03A 3KETA 4PWFA 3QR0A 4NJEB 3KBPA 4B5EA 4IILA 2GHTA 4H8WH 4HQNA 2N42A 2KC0A 3Q40A 1BDYA 2Z2IA 1SMOA 3M4NA 2D03L 3WNBA 3L4BA 1U0HC 3B9VA 1CR9H 1A47A 4DN4L 3FUUA 4MUXA 2H5IA 3FLAA 3GFQA 3N28A 4JPWH 3JCZA 3LPLA 3P3SA 4XAKE 4YHYB 1EHIA 1P75A 3WLWC 2JIOA 3VOAA 1RUKL 4CU8A 5FA8A 5EIFA 4JUTA 3ZLTA 4YR7A 4MA8L 4GXVH 5CLJA 4FCWA 1H2BA 1TMOA 3OEEA 4OXKA 3FAWA 5IQNA 3GMLA 3HLAA 4LEOB 2KMLA 2UX7A 3F73A 8MHTA 2HF9A 3QWOB 3VFRB 4L73A 3VWJD 5JARA 1C8LA 2ON6A 1YACA 4DGUA 2OMWB 5LG6A 2A7QA 3VXUE 2A6PA 2AXGB 1IBKB 5T1MA 1J97A 3LIZL 4HWPA 4RQQA 1N68A 3D4YA 3NA9L 4E9WA 4OY3A 2IXQB 2XG4A 4AG4H 4JJAA 1Q15A 2GM5A 5C7LO 4U1IB 1WB9A 2XY2A 3RVXC 1JPEA 1OD7A 4X6FB 2GJZA 2NQ8A 5AXCA 4XZUA 1HNNA 4N8VA 3GN1A 3HNTH 2AXHA 2WN2A 3SDXA 1Y4AE 4ATNA 1H9AA 2AQRA 5THXA 5A71A 2F0CA 1X8JA 1IN1A 3A36A 1WUKS 1KO1A 5I8EA 3DRQA 2K5UA 4NZZA 4P0QB 5CP8A 4Q7QA 2BKAA 2COUA 2VZ1A 1E9VA 2W9EL 3WFBL 1J8HE 1L4YA 3WIHL 2BMDA 1H3VA 4L29A 3WNMA 3PX2A 4MYUA 1TM1E 3F7YB 3UNXA 3E8MA 1GU7A 1YDWA 4MA0A 1DRJA 3JTMA 4G5RA 2F9BT 3DTDA 4MAYB 5E1OA 1RPZA 1CUBA 3ULSB 4DJTA 5DHYA 4Q6IA 3R4VA 3CLRD 4PC2A 1N6KA 3C70A 2RHBA 4TVSA 1TCRA 4Y9FA 2B0SL 1YMQA 1FYWA 3AGWA 5DASA 3K32A 2XKJE 4XP4H 1AVTA 1P61B 2REOA 2HQBA 3GPCA 2N1TE 1XGYH 1G4UR 2ZVQX 2H3NA 4K40A 5KNBH 3MCTA 2WAMA 3VQTA 2DBYA 1TQWA 5A7FA 3BFKA 4DCQB 4AN1A 4JOSA 1A8PA 4DTIA 3Q8LA 1KI6B 4UM9A 1IJFA 3CR3C 2N75A 1XL1A 5F6IB 1QABA 1DEDA 2CHGA 2DOKA 3TO4A 3LAWA 1LSUA 4CRPA 1RLUA 4Z0PA 1KEKA 4KQ1A 4ZMPA 2B4TO 2ZT6A 1C7RA 4KZCA 3A11A 4UUMA 4W6QA 4OCSL 3OQIB 4FKBA 1I3OA 3R5HA 5DNAA 2R1XA 4IKKA 3TBWA 5AW6A 3H55A 1RZJC 3AIKA 4IXWA 2C9SA 1HG1A 3HDHA 3B1XA 3O6FA 5BV8A 4BWVA 5JQWA 3AC0A 3BUDA 3A9WA 2Q2OA 4ZO9A 2DQZA 2HJWA 3QHFL 1FVHA 5HYQB 4JP2A 1N8NA 4GAGL 2F68X 3RWDA 3SE4A 2HWZL 5B7FA 1TMYA 2JATA 2NX5D 4RK7A 5GS0C 2E74C 4H8UA 2WTUA 2H48A 2OI9C 4X85A 4IY1A 1UT6A 3CX2A 1C1DB 1GKEA 4IJ5A 4LY0A 1U0NA 1UBTS 5DMXA 3KS0H 3QDJA 3BF7A 3K15A 2OV6A 5EP1A 4TSRA 4IAOA 4CVUA 1A1OA 4Z3IA 2HT3C 3VD0A 3O3UN 1X1AA 2CE6A 4HOZA 3UTZA 5EZIL 3FUIA 3VNYA 2SNIE 2NV0A 3QCVL 1LDPH 1O6ZA 4A04A 1DQLL 2DWUA 1C2TA 2NWQA 2ZUCA 5DC0A 4HNSA 1UUFA 1VL1A 4TLSA 4KX7A 1U8KA 2FD6L 2XX3A 5KYWA 3EVCA 2FFBA 3PDDA 3WLOA 1UBFA 1KBKA 4DAGL 1IN6A 1R8XA 3EUWA 4BRWA 4LSRL 4Z1MD 1GPJA 1GRWA 3FFDA 1TQ6A 2ZM6B 1X5XA 2FNWA 4MRPA 4F2FA 1A5FL 3SKXA 4MGXA 1IXZA 2JD2A 2O14A 1P5VB 3MYYA 1JBQA 1LRLA 1MX1A 4Y8VA 2A5UA 5C9KA 2EE2A 3CC5A 2Q6TA 2C26A 4OQDA 2O5YL 1G1CA 3HCPA 4XCFH 5FFLA 3WJMA 2E0PA 5FPQA 4AMZA 3HUJA 1KGJA 3FFAA 1A8IA 1TX4B 3EFEA 2V8OA 4AKPA 3EEIA 4QOSA 3UMYA 1N0UA 3WMQA 1J8DA 5MEQB 1EH9A 5EUOF 3O6ML 3NRCA 3K74B 4KJQC 5HPOA 1DRWA 2PV0A 3ZLUA 3L0DA 2WTNA 2O2SA 4MD0B 3ZQKA 1OAAA 1QW8A 3MRIA 2PM8A 4WI6A 1HYBA 1NCCH 3K0SA 1PG7H 3TJHC 1WDKA 3MPOA 4RPCA 1KBPA 2O6DA 1G5PA 4OCWL 4JY4A 4CN8A 2BHSA 4PJ5D 3TSZA 3W3ZB 5DNYB 2H8GA 3WO0A 3HN5A 3NP3A 4N0UE 1EEZA 3V0WH 3S2UA 4U2BA 4G89A 3P9NA 4GFTB 3PQ4A 1F1JA 5KJ1A 5I30H 4Z54A 3MJEA 3EEYA 4G43A 1F11A 3V4UL 2RACA 5EUKB 3FYDA 1A7QL 3W9EB 2XEDA 1ZOOA 3ZT5A 3NSFA 2FLKA 5CGYD 1OHZA 4CKVX 4FINA 2J5XA 4V0NA 2HMVA 3CVUA 3ILSA 3P71T 1KPRB 2LUOA 4F5CA 2HB0A 1QAMA 1R8JA 3PGXA 3ND6A 4QFBA 3WYGA 1U7WA 3UC9A 3DMMD 2VLKE 1QLRA 4HJXA 1DLHA 3W34A 2ZICA 3JRWA 1RVFH 2FLVA 2CDEA 5HYJB 1QH8A 1VFUA 4HD8A 2HU8A 3U0BA 1R3LB 3MPUA 5GJWC 2I62A 1YE3A 3QQ5A 1FZKA 3CZ9A 5I71C 3DDOA 4JJOA 1KBOA 5A7GA 3QU4A 1J0BA 1M8GA 2QV2A 2XXMB 3FNHA 1U91A 3ZE0F 1E79A 1PZ5B 4M3HA 2VA8A 1NI5A 5CCGE 2RGNA 3OMNB 1JF8A 3VR6H 4QPEA 5ESXA 1MDBA 4NC1C 1KJNA 4OJKA 2G4CA 2WJHA 2L3BA 1WCIA 3IJSB 4K9PA 3CK0H 4TX1A 3F7LA 5JW4R 1CFSA 1ETHA 3MOIA 2ADGB 5J7CC 5DPMA 4AQ7A 4LCIH 3QSGA 3UXYA 5E94A 3PB3A 3IPCA 1KKMA 4ZVRA 1M6VB 2AXQA 1F1AA 3E6FB 2DE0X 4I9WD 2O3TA 2IHTA 3T1VA 4JMNA 4HFUL 2Y7LA 1EV2E 2P5WA 3QY9A 4Y1AE 1NCUA 2WWMD 1GIGH 1VSUA 3S40A 1OMOA 1O7VA 4RLQA 3SKVA 1B8VA 2Q2LA 4M02A 1TUIA 2XUFA 4H3VA 4UIKL 4PRIA 2SODB 3H5WA 4PJCE 1OFUA 2CNKA 3WMPA 3PHAA 1R17A 1W88A 4B7AA 1ZMBA 4D6PA 4AJ9A 2B1RA 2HJKB 2DKSA 4HPJB 3CH4B 1TYZA 3G9UA 1XOIA 2OL3B 5IBTL 4EGJA 2VLJA 3R6LA 4MGEA 7GPBA 1N3LA 5DVKA 4XNZC 3NDJA 1TPXB 3MTJA 1G87A 3DAHA 2AS0A 2FW0A 1E9PA 2JIZD 4N01A 1KGDA 2DQEH 2F3PA 4E14A 1PG7W 3JVEA 2F53B 5A2GA 4OHRA 4XOUA 4QBTA 4OHMA 2PKQO 3QULA 3KEGA 1PLGH 5LQAA 3MYJB 2AJYL 3RSFA 5EKDA 2M26A 5LFAA 1KOJA 1P45A 5DH9A 3EQ7A 4HEPA 4NKMA 3LH5A 1NPTO 5A1JA 1RLTA 4AAYA 1RI1A 4EZKA 5CAEB 2Q6VA 3KFXA 1F8YA 3AHHA 2YQ5A 4V39A 5D93C 3HL4A 3H5AA 3QUKA 1NW8A 4HFNA 3B6KA 1UMDB 2FUKA 4UC0A 2VLRA 5TDHA 4N7JA 4YJHB 1DE4B 1M6NA 3GQVA 4O1HA 5E4TA 4JUIA 2ZCLL 3SQOL 2IDFA 2R8SH 2VJDA 4QHKJ 4KXXA 1VI2A 2DC1A 3THYA 1XCMA 2IXTA 3GRRA 3LT2A 3V5KA 2YMPA 4NFLA 3SYKA 4BP8A 2YYSA 2VF5X 2IXBA 1U5BA 1KC1A 2MTPA 3ALWA 1NG1A 5IFLA 6LDHA 3JWDC 2I5YL 3DOUA 4KMSA 3UG6A 3S1LA 3HO1A 1S6YA 2R7AA 1YMVA 2X8LA 1GQFA 3D18A 3WE7A 4CSZA 4PJHE 2ODNA 4KOAA 4GIAA 1YN7A 3MMEB 5IFJB 3RF7A 3BWEA 2W0LA 4V1DD 1ZK0A 5PGMA 2NY1D 4HAFA 3HS0B 1SC6A 2H26B 4NXNB 2D0GA 1G19A 4KQEA 4F2HA 2RARA 3KR1A 3PGDA 1UH2A 3CJTA 2HQOA 4X62B 4CEIB 2J8OA 1DLFL 1QANA 2YAMA 4DP9X 3KBEA 3NJXA 2KQNA 4BTEA 2VL7A 1MFMA 3KGSA 3F04A 2RI1A 3KPUA 4MEAA 4KI7A 1DV1A 4KNQA 2VA9A 3I73A 5B7QA 1U92B 4TVUA 3U46B 1A7NL 2GAIA 4ALKA 1FGVH 2H1FA 3MEQA 3MREB 4WL0A 1BGXL 3RWJB 2J67A 5GZOD 4WINA 1QQDA 1VG0B 3UMCA 4DDHA 4FQCH 2QP4A 4PWJA 2A1IA 4GPEA 3PRJA 1T2FA 1MCZA 2CV0A 4TKZA 1E61A 1JLRA 2MQ3A 2J85A 2J12B 1FFRA 3TF5A 3IS3A 4UREA 5GGVY 1HVXA 5IFHL 4KROC 5EZLA 5HDBF 4L8CB 2WSKA 3TEXA 1TJPB 5F9FA 4GQZA 2A1UA 2JCCB 2DUUA 1KI3A 5HUJA 1YAZA 5A6LA 5DJAA 4DMLA 3BS4A 4ZUUA 1R4NB 2DJIA 1Z18A 3NIGE 1NUNB 5G1OA 1COWD 1WKBA 1RXSA 3T38A 5LUMA 1GOTA 4BP9A 1KIPB 4EN3B 5CLHA 2V2XA 3RLIA 4UTZA 3WIEA 4QIHA 3VXQB 4XC1H 2IOIA 4XVUC 3M70A 4HX2A 4E11A 2P8SA 3RRMA 2O59A 3SQNA 2X70B 3C6XA 2APBA 1QIFA 3T7KA 5ICZA 1XNGA 3CCCA 5LDGA 4AVHA 2Y22A 2ACWA 4RGQA 3A6GA 2V03A 4HXYA 3ONEA 3FHEA 1B0RA 3T7AA 3MV8B 3L3IB 4NMHA 4OQNA 3NSDA 3Q6FB 1SLWA 4YHZH 3LA8A 4IZ6A 3GLVA 5F97E 3TNJA 4R0NA 1E28A 4EAAA 4Q7DA 3A1VA 2B8NA 3CUUA 3U4KA 2VZ9A 1S4MA 4DIMA 3E0XA 1J7JA 4AYWA 2OSXA 1UT8A 5CB6A 3VBEA 5L6YH 1OE2A 2M83A 4JN2B 1RMYA 2GIXA 3IR5A 3D85D 1DLIA 3CFBB 2FDBP 1UZGA 3H0TB 5EJAA 1JGUH 2W38A 4YZFF 1MCSA 2H92A 4KX5A 2X1LA 3OMLA 1G3QA 3GS0A 2PD3A 4DO5A 4IV8A 4XNMA 1JPJA 4BO1A 1TETL 3PP3K 2C2GA 3DKKA 4R2GC 1LPOA 3ZN6A 5F89A 9MHTA 2OBLA 1JFSA 1X7ZA 1B8OA 1ULBA 3I3BA 3UZEC 2I9TA 3Q2LA 3GJ7A 2WQXA 4L08A 4ZMBA 4Q1DA 4UQDA 2APVA 1A8SA 2RG1A 3AJRA 4PO8A 4PLNC 1RU9H 2WZDA 1T5WA 4TL8A 5I8ZA 1JIQA 1KEVA 3TSYA 2OMZA 1YOVA 3EULA 2QZPA 3GSWB 3OKMB 1H3TA 3UWMA 2PUJA 1TJYA 1UBJS 1Y0BA 5IR1B 2IADA 1SPBS 3M6VA 3W0WB 1IC1A 1UINA 4G9EA 4PYIA 3K8LA 3L4VA 4X1YB 1CXEA 3V6OE 4CVNA 4G8EB 4EHHA 2QSVA 1VE5A 2QU7A 2Y2TA 3IRPX 1ECFA 4MOWA 3HZKB 2OQRA 2IAMB 1CXZA 3UFIA 1BXRA 4KKVA 5D1ZC 4QBKA 3F62A 4WXYB 2PU5A 2DFTA 4PO3X 2PT7A 3PKJA 2Q0SA 5EWLB 5DX0A 3DGEC 4FYKA 1NC3A 3V6ZB 2FA9A 3QPDA 3LKZA 1C5CH 2IHZA 3R7AA 5H37A 3UM9A 4GAYA 2YWXA 5TMDA 4YJ2F 5F1PA 5HFAA 2VYRE 4N2HA 2W43A 2VG8A 2RMKA 4IBUA 3UJJH 2PXHA 3FM9A 3TVMB 3M17B 2MU1A 3UMFA 4JVPA 3KQSA 4RVBA 2GEQA 3NIFF 4NEHB 4LY3A 3TZCA 1E1NA 4JB0A 3ARVA 4RISH 1QP1A 4KQWA 4AW7A 1R3DA 1I36A 2MMGA 3HE7D 3SS7X 1UACL 4KPHH 5D4IA 2H08A 5EXTA 4LPVA 2W92A 1N33B 4IH4A 2KPOA 1CZ8L 1BJRE 4GPD1 2COQA 1M76A 4QHYA 4YBHA 1DU4A 1M0EA 3UL4A 4HAUA 1QSEE 1KDTA 4CQMA 3L2OB 3IWUA 2FEAA 4GQAA 1EFXA 1Y6MR 4Y6RA 1I1AC 4NGHH 1I0IA 1JHQA 1CUVA 4Y1FA 4Z4CA 3P77A 5DUPL 1FHGA 2W6QA 3FSOA 2O5ZL 4KHXL 1SMKA 2C9RA 4NRXB 3DMDA 2NVUB 4FDMA 3BBPA 4HPOL 5A6SA 5IZ7A 2WI8A 1WUYA 2IVZA 1IFXA 1TW2A 2WFLA 4ONHA 4MQSB 2GWRA 4DV0B 35C8H 3LZCA 3W2GA 3QE2A 4XCCL 4ZFOB 3F7KA 2O05A 1N3BA 2NZ9D 1ZJAA 4KFRA 1XZ0B 2NW3B 2A0UA 4GI5A 4YRRA 3CEPB 3FAKA 1U3UA 1AKUA 1OARL 4ZZ1A 3NJ4A 3CUPA 1YVUA 2C84A 4I1VA 2QTNA 1E5AA 4UMGA 2AFNA 2B4CC 4QRPA 4OZFB 1I7RB 4P46C 1ZD8A 5M29A 2WXKA 2AV6A 1UFVA 2XV2A 4I7ZC 1AGFA 3FPLA 4U2KA 4ZV7A 3I12A 2X4NA 3G8BA 1ILUA 3P73B 4M7LL 3LXRA 5B4UA 1GZ6A 3ZD7A 3VSAA 4PJ9B 4XI5D 4AIIA 5I7AA 2YVKA 2BINA 3ZYCA 5D1XD 3ULVE 3FMIA 5I23A 1PZCA 2XCIA 1YI8A 2WIIA 3EPJA 2W6ID 4BLTA 3T8XA 4LARH 4KGZA 2B20A 1V96A 5JUEH 1BPVA 1B4RA 1HKFA 4ZZIA 4KRPD 4AX8A 4LBEA 4IQGA 1BSIA 1V43A 1GWNA 1WFMA 4H0CA 1XEUA 1I7ZA 2IV2X 5FCDA 3V0AC 3RZCD 5IVIA 2IGLA 2Z6FA 3OKLB 2JLQA 1ADYA 2REBA 2R1TB 2WK1A 5CDYA 1VCOA 2YN3A 4OXQA 1DBKH 2F00A 4CKBA 5C8ZA 5BV0A 1UP6A 4IUYA 4R8VA 3DPBB 2GDZA 2X0JA 2FPWA 5G4KB 4ATTA 1T24A 1CS4C 3CSYA 1K9TA 4W9KC 3X1EA 3FOZA 3QOFA 5DMHA 3RDTB 1DAHA 5KOMC 1ADGA 3DX7A 3U7JA 3FCYA 1UXWB 1MJJB 3A0UA 5BRZB 4K9EL 1KI9A 3TVYA 5CEFA 1C4OA 4IXTA 3N5CA 3GBLA 4TS9A 1TTUA 3KPRA 5SWSA 1U04A 5ALOA 1J0HA 1ULTA 3OLXA 1ZHKA 3BISA 4U7FA 1FGNL 3OJ0A 4PEEA 4R8WH 4XO4A 1UADC 2ZXEB 3ZDZB 4CU5A 5J89A 4ZVOA 3ROQA 5CDFA 4HUWB 4GW4A 3T3MB 4Q5IA 1IU9A 3I6KA 1A7OL 5DRZB 3O4IA 1HSOA 1V37A 2YEZB 3RTAA 3X2QB 2ZJ4A 2WU0A 3INUL 2G4GA 4GM0A 2NYYC 4Z7VF 5IARA 2ZOUA 3RFFA 3U9UA 2OM6A 1IM2A 4CCYA 2WINA 3R3WA 3U0VA 5LN4A 1OTTD 1GYAA 2P45B 4FL4C 3ZY4A 1CE1H 2R1WA 3MVEA 1AY1L 5FHAH 3BILA 5HM6A 3HCVA 5L51A 3BVUA 3M9WA 1USVA 3VG0H 3QEGL 3DEKA 3WGYA 1HCFX 2YPLD 1BEYL 5F7HA 3IOBA 2BSXA 3TZBA 2WZ5A 1TI7A 2RH8A 2WGXA 2TSBA 3II6X 3MBEB 5ALUA 4WXRA 2K7QA 5DYFA 3I5UA 4C7OB 2EYRA 4UZGA 3W11C 1GR0A 5HHVL 3TJPA 1N1EA 1MAMH 3RL1B 5AR1A 3PWKA 2ZRDA 4CA4A 4U63A 3GLEA 3GAZA 1ND0A 3NP7A 4WJZA 3N85L 5B7EA 3HW7A 3I9AA 4EPSA 1GG9A 3B3AA 1D03A 4IIJA 4HNAA 1I1YA 1V1RA 1IUKA 4GBXA 4K7JA 4CG1A 2WU8A 3RYCB 2ZXQA 1C80A 1YS7A 1RBZA 3F5SA 4IWYA 4PJ7A 1NTOA 3ETEA 4QUOA 1E2BA 5DTFB 1KAGA 1BD2A 4DH2A 4CKQA 5E8NA 5IM5A 4F5ZA 3L6EA 4ND7A 4BQEA 2WVJA 3ETCA 4H8WL 2IU0A 3JARA 4QNPE 1PNOA 3GLTA 3H6GA 1MQSA 2FV8A 1P0IA 4JNKA 1AOXA 3EO0A 1N0IA 4ELMB 1CR9L 2BMKA 2QF7A 2OX5A 5ICXA 2NQCA 3L4CA 2YWRA 1CFQA 1RIHH 4B3DA 4KHTH 1EGAA 4XVUA 1FXWA 3ANXA 4JPWL 1CBVL 1QE0A 2WP0A 5EIBC 3UEOA 3HVIA 3I6LD 1CR4A 1VLVA 3HNPA 4Z99A 1U2HA 2D1TA 1MF2H 2GEFA 2LW7A 1D5BA 2QTRA 4YEDA 3RBVA 4GXVL 1HQ4B 5LM3A 5ELIA 2BZDA 4Q03A 2B7CA 2LVEA 1MEXH 1QYIA 1SCKA 3AUJB 2XVAA 4DA8A 3QXJA 5FI5A 1R47A 3RL2B 4DMHA 4CF5A 4KVFA 2XUDA 2Q5FA 2O7NA 2P5PA 2UZXA 1QUNA 1DKOA 2HCTA 3L16A 1UA3A 1RYFA 1IJ9A 4RK6A 5EO0A 5B4MD 1D2MA 5EUQB 2FTAA 1BFKA 5AYTA 2HHCA 3L92A 1FFNB 4UQLA 4NQEB 2EG5A 4U1MB 4N41A 4PIBA 1AD0B 2J1KA 1KVQA 1HNWB 1JEQA 3NBXX 4FMCF 2QTEA 1OVGA 2UUPA 3BKXA 2R8YA 4AG4L 3TQIA 1ES0A 1KC3A 1N1GA 5F21A 4PW9A 1A5TA 3HLTA 1PZNA 1HSBA 3FT3B 1JBEA 1GPKA 1C0PA 2PBFA 4JIGA 3BLBA 3UZEA 3HNTL 5JSKA 4KK5C 5KSAD 3DXAA 1IE5A 2AEQH 2OMTB 3P9WB 1ORQB 1HRDA 3EW3B 5KYUB 2CE7A 3UY4A 2QJRA 1DEEB 5KCZA 3B5GA 4FFWD 3CPUA 2XXFA 4DR5B 1V3QE 2KZWA 1HDMA 4KREA 4QQFA 2F8IA 2H2AA 1GTG1 1XTQA 1F3LA 1A3LH 4P0DA 2DQFA 2PYFB 4LLWA 3W8FA 3WIDA 3UMTA 2RGYA 2ZRAA 3FN4A 1KO8A 1TL7C 2GSIB 3GVIA 1N67A 3ER8A 5D1HA 4AL8C 2C31A 1E8MA 2FATH 4GH5A 3OQPA 3FU7A 1ZHNA 2VZUA 3L8YA 5D1ZA 2Y7NA 5K33A 4NBXB 2G60H 3UZVB 3NAAH 2GD6A 5EE1A 4NBLA 5J57B 2ZSUA 1D7FA 3IJHA 4C3ZA 4KR6A 4LTNA 1D2AA 3EH5B 2YEVB 3LIUA 2E4XA 2O61A 1N6IA 4I66A 1NFKA 1KT2A 2JKWA 4XP4L 3T9BA 1JR2A 2BGJA 1YD7A 3MROB 5BV7C 3ZIAD 4C2UA 1XGYL 1SCIA 3NJFA 4TZTA 2Y1ZA 5B2ZA 1E5UI 3FQTB 2JW5A 5TJWK 2PTTB 4W9CC 3F46A 4TYYA 4L3EE 2EFGA 1OKEA 3GGWA 4ZDIA 2AA3A 3ZR5A 1OH5A 2ASEA 5HHXH 4M61B 4PU2A 4LXHA 2YGNA 4ZEVA 2C77A 2G7MC 1TGVA 3PWPA 5IGXH 1IXSB 3UABA 4TQHA 4OT1H 5CPBA 4UNUA 3WQQA 3K8YA 4ZVPA 5KOHA 1WGOA 1UURA 1SCUA 2R62A 1I9RH 4KI5D 4UT9A 5BOSB 2RGBA 5WRFA 2UAGA 3CURA 2O3RA 1ODLA 4KYVA 3VR4A 1I1AA 3ENZA 3QWBA 5J2TA 4N25A 2FQXA 4Y6PA 1FX0B 4UU0A 2NXYD 4P2RB 1MFUA 4MNQA 2A0WA 2GF2A 5AVKA 5B4VA 5FQNA 1WF6A 4HT1H 4PYKA 2HIHA 5IH3A 2FPOA 3HHMA 1F5NA 1KIAA 4QPJC 4GLOA 4OLJA 3GLIA 3U7QA 3TYFA 3JTEA 1ONSA 5K9OB 1O75A 2DQJH 4HX9A 1UPBA 1FRNA 4P46A 2MMXA 1SWWA 5DHVH 5IQ9B 5JH7B 1ZVSA 4FZVA 1T4BA 1WWKA 1M7GA 1ZK5A 3ZHLA 4YDHB 1E58A 1DBSA 2CJWB 4U0RC 4NO5B 2W6CX 4MW6A 1IZYA 1E1RA 2Q7YA 3WFDH 1DKQA 1HEIA 2QE7D 1SBNE 3BSSA 1SZDA 3PXXA 2ZQKA 2RAUA 2HRGA 1LDPL 4I55B 4M9OA 2LTAA 4GI2A 2BOBB 1MCHA 3MA0A 3E23A 4F85A 3B2UC 1YEEH 4A6YH 1JXDA 1UZ8B 5C0DA 4HTFB 1EFDN 4F71A 4RF3A 1M7UA 4PHFA 3J80A 2YD0A 3HI4A 1VHJA 3WTCA 5JECA 2VYCA 3G5YA 3SO5A 1FUKA 2BUCA 3SYOA 5AKLA 9CGTA 5IF9A 5BMFH 1KEWA 2BFAA 4DNFA 3DBXB 3MAGA 5M95B 4A92A 1GC1L 3PDGA 1U6IA 3PVSA 1T3ZA 3DV6A 2YRZA 1JSRA 4JBHA 2XZZA 2I6QA 2WG1A 1TAUA 4L1HA 4PI0A 4XCFL 2RMNA 5AI9A 1U58A 2FR4A 2BX5A 1JEYA 2Z95A 1IBYA 3CW2A 3M4JA 1J33A 3EDKA 2FQWA 2AJDA 3TLGA 2QSQA 3SEAA 4JROA 2PUFA 1AQDB 4ECAA 4RGBA 4JQYA 1A4KB 4P49A 4L9AA 2CPUA 3VGJA 4YHIA 2WQAA 2P80D 4WKBA 4JGBA 4G41A 5L3SA 4PRPD 2F3TA 4N5LA 5FOUA 1T0NA 3ASOB 1W75A 1Z17A 1UADA 2BEKA 4I0WB 1NCCL 2OY0A 4GI8A 1PG7L 2XIIA 5I74B 2EIDA 1ESNA 2FX2A 4MO2A 1C12B 4HCFA 1K7FB 3ZWMA 1S7WB 4OAQA 1MN4A 2BHTA 2BT4A 2OD9A 4JKPH 2IALB 4XDHA 2D5AA 1ND5A 3H9UA 4DHWA 1GL9B 1UYWH 1ZSDA 3V0WL 3ND7A 4E9VA 1S7QA 2XQYA 4JJGA 1HHIB 1N9GA 5I30L 1A8QA 4AIZB 1YR7A 2D8AA 1K4YA 2ZR7A 3HC3H 4RAOA 4BZZA 1WQ3A 2G0KA 1FB5A 2GK0A 3G17A 4OB5L 5EZYB 3AS1A 4WUUB 2RCYA 2VDVE 4X5XB 1A9PA 4H25B 5F78A 1MF7A 2WWKT 3DBLA 4HK3J 3WRWA 2OHVA 1QPKA 2H6PB 5C7XH 4FBGA 1WE2A 3WTYA 3EFFB 4KTDH 3DWFA 3ONNA 2XGJA 3I2KA 3GLAA 5KQGA 4LRUA 4B87A 2QW0X 1RVFL 3W5VA 5HSFA 3X13A 3UGKA 3BYTA 4PLTA 4WSOA 4LTMA 1TQCC 2ZT7A 3GY0A 3MJ7B 3SBEA 3U1QA 3B7GA 4PG9B 2VSKB 2X4IA 2O0LA 5C86A 5E8PA 3KWWB 3NHLA 3WQHA 2E8ZA 2X76A 1ZVKA 4HH1A 4KH1A 1LE9B 1E2LA 4ZI2A 4AP9A 1F1DA 3HXMA 1SXJC 1CB7A 2L82A 2NXWA 3D06A 3O1JC 3DV0A 3F7PC 2GN9A 1JZ4A 1A8HA 4NO2B 3VVCA 1J0KA 1MFBH 4FJ2A 4RD1A 2F58H 3G5LA 3P02A 5D72H 1AJEA 4JELA 3CK0L 1L1FA 4G2TA 1AQHA 2HRQA 3OEWA 2R8BA 2OYKA 3A6KA 1G9SA 2UXGA 4LCIL 1XGTA 3EF7A 1NBEA 3CGTA 5BN4A 2I9LB 1Z4LA 1ETJA 4NNPH 1KRWA 3E1KA 5CDHA 1HDIA 1KR2A 3ESAA 1GIGL 4PWHA 2JB6A 3NRPA 1BWWA 1QK5A 4K8RB 2A6DA 1YHPA 1C7SA 4HWGA 1D07A 1Z5ZA 4OX9B 1DQJB 1KZYC 4ROSA 4P32A 4MJ6A 2WQ7A 3QUTA 1DCKA 1VACA 4FZ5A 2F1IA 1MORA 1GKOA 4B32A 1RP9A 3EBHA 4HQ0A 2EGUA 5GGUA 5DQJB 3FQ4A 3NGLA 3QHQA 2NY5H 4J6FA 3EGDB 2OV0A 3IFLH 5DFTA 1GUBA 3ITNA 4N20A 4KJWC 3OX2A 3ESNA 3AG3B 4GLRH 5AVVB 3GM8A 2ILLA 5E9WA 1AZLA 2JASA 1LNZA 4NUPA 3N2GB 1K8ZB 4KQHA 1RYZA 4A5OA 3S1AA 2DQEL 3N2ZB 1RYBA 2JANA 2NO0A 2WWHA 3QZWB 4P35A 1X6NA 3V8EA 4MYRA 1P4RA 1JG6A 3ZEIA 2EXSA 3GSUB 3S3TA 1SZJG 4ZFFA 3DMYA 3VXTB 4P5KB 3U83A 2AKRB 3AUXA 1A69A 4KNTA 4GRWE 3B38A 3UT0A 4JW3A 1YMMD 1KGCE 3TLMA 1XDTT 3NIWA 4QARA 5JOQA 2CHEA 3M1LA 1T1WA 5E08H 2QUZA 3OU2A 3MWKA 1JWUA 4JFDB 4J9UE 1J4AA 2B15A 5H3LA 1PV2A 1JWLA 4LSUH 5J6HB 2R8SL 2P77A 2XMDA 3E9QA 3DV4B 3PFIA 2XE4A 3EWIA 2RAMA 1W0KA 4ZSOA 4OHFA 4APQC 3HIZA 1RHKA 1G4MA 2PZKA 2HIMA 5JYBA 4MRNA 3L9RA 1W5AA 1ZE3C 3FH0A 5LYJF 3DNPA 1LLQA 5GQBA 5GGQH 4LJKA 1KJYA 1Y7IA 1KI1A 3KPPB 5C0AA 1M53A 2XT0A 1MFZA 3U60B 4KI1A 3UV6A 4OYHA 5CJJA 4YTEA 4WN9B 3H04A 5KTOA 4KFCA 1CF4A 3WO4B 5AXDA 1S9KC 4EG8A 4X7TB 2ENPA 3SYQA 4KZDH 2Y67A 5F76A 1QRNE 1SJHA 3AF5A 2IOFA 5A5DA 2OA9A 5I15H 1NKSA 2NACA 5HKKA 4OLWH 1ZGLP 1WAEA 2D5LA 1BKSB 3BXNB 1HYQA 1AN9A 2J5WA 1MH5A 5BV7A 1DJZA 1USKA 1KG0B 3K20A 1ISRA 3QXSA 1N70A 1PQZA 4QXVA 1OX5A 1JYEA 2OM2A 3CHQA 2F43A 4Y1RA 1JGDA 3TBSB 3FCSA 5DGQA 3QQ9C 4L5FE 4RY8A 2J5LC 5IT5A 2EZ8A 3AY2A 5F4BA 2ZXFA 4YC7A 5EZJA 3SKJL 4DP8X 3HV2A 3I30X 3I04A 4PGDA 3K2QA 4N82A 4O2CB 1W96A 4DQAA 3CONA 2G5BB 3I5XA 1FGVL 4HDMA 2ZBGA 2QOEA 5L4MA 4HUUB 3ZHDA 1XKQA 3W37A 3GFTA 4B0OA 2V5UA 2NO9A 2WXMA 4KRLB 3K8ZA 4FQCL 1VG9B 1GGFA 3APNA 4NIYE 4BRZA 1UDXA 5E9DD 4G3XA 2L8AA 1B4DA 2GSDA 4D4GA 5DMYA 3KNBB 4NKDA 3E27A 1QMPA 3S0PA 2ZJSH 3VOSA 3QXHA 2PCPB 5FPSA 4ZP1A 2ZBEA 3O7MA 4WRLA 4HMQA 4P2QB 5BOZG 1S01A 3C3KA 2Y77A 4EIWA 5EHZA 3H99A 1WAMA 1PL8A 3BH8A 5FWXB 4UOEA 1M3SA 4GOKA 3OZDA 2NSJA 5LQRA 2YXMA 2PTHA 3CVIL 3NBNA 4LMQI 1UBHS 3D3VD 3LT0A 1T6WA 3DHEA 3MJ8B 3BTOA 4DQLA 4HH3C 4JXXA 5EGSA 3OTHA 4E5VA 3UXFA 2VLIA 3HFMH 5FA4B 3T0DA 5IESH 4V0KA 3NFPB 1LS1A 2Z1PA 3FWZA 4A6EA 1VYHA 5TIIA 2HUHA 1WS6A 1TCAA 2WQ6A 2D5CA 1FYFA 1ECYA 2H11A 1MR3F 3GPSA 3EOAA 2JE8A 4AF8A 1A76A 3RSCA 3SHOA 1B88A 2FW1A 1T4CB 1DBRA 4OGFA 1EO7A 1PNTA 4WT7A 1CRQA 4N7RA 3LDGA 4CM5A 2ODWA 5L8KB 3HU5A 5C08A 5JOFB 1FVEA 5HJ2A 3T0EB 1PDWA 4C06A 4NO3B 1P5UB 2O6FA 5JD3A 3TPCA 3GUCA 2D6FA 2AYXA 5L6YL 3ORHA 2J43A 3WLQA 1EESA 3O8XB 1GGBH 2RHHA 3AXTA 1OM3H 1JGUL 2Q6LA 4X24A 4FNSA 1P31A 4PG4A 1KNXA 4F4CA 2ITCB 5BW4A 3G6WA 3AESB 4Y4KB 1AQIA 5FUXA 2OB1A 4LOEA 1DIOB 4MV5A 2ZSHA 1WBBA 1JUFA 2NV2B 2AQHA 3WMRA 5T33H 2CLVB 1AF7A 4R7DA 1US8A 4BFEA 2VKXA 4NZYA 4KC3B 1K98A 1SQ5A 2QIOA 1RU9L 5IT9A 4GLLA 2JIPA 4AQZA 4JR9H 5KS9B 4C4PA 3BMWA 3I3EA 2B1GA 2XBLA 4O1IA 3KU1A 2GJAA 2IXEA 4Q1FA 1D7AA 4ERSH 3STXA 5H94B 4XIGS 3CDYA 5DK3A 1RWQA 1ORIA 3DO8A 2X6QA 1UVQB 1LEKA 4U9IS 1NOJA 3DIFA 2J2ZA 1AZVA 4ZQKB 3LQRA 2F6AA 3B36A 3ZTEA 3V4VB 3BUTA 2X6AA 4R26H 1HMYA 1G1KA 1VBNA 2GD2A 1CUAA 1PLCA 3WYRA 4FLFA 1HCVA 2GYWA 5LBIA 2TRHA 2QR0A 3J27A 3T6KA 3BUBA 3BP4A 1W0VB 3W79A 1NDMA 5H2BA 3W5IA 4PLZA 2IEDA 3W5UA 4PNZA 2RGGA 1X4XA 3UJJL 3OHMA 5F23A 1HF3A 3KPLB 5JJ5A 1KCSH 3GSOB 1FUUA 4R4BB 2WO3B 2ROXA 3L8MA 2MQCA 4RISL 5BN5A 1SY7A 4KMTH 3DJZA 3C60D 1EP3B 2VRNA 3E5HA 1T4WA 4AYTA 4GP4B 3A1WA 4TKWA 4KPHL 5JAOA 5ER6A 3VVVA 2BGIA 1LXCA 4PJGB 1H2FA 2GVNA 3CC1A 5AMXA 1T0JB 3KM0A 4XAQA 5KOVC 2OVFA 1FO0A 1N2HA 3D8BA 3QB7C 1J1IA 1E7RA 1DI0A 3CCBA 4TQGA 3FMPB 3ECSA 4B3GA 1SXJA 3V8PA 2FN8A 3F84A 4W5HA 4GL4A 3L77A 4NGHL 3U9SA 3MRJB 3WIUA 4BFXA 4U1KB 4H5SB 2ZJYA 2JKVA 5FTKA 5JYMA 1UASA 1DQZA 2ZYIA 1MOPA 1V7CA 4NB7A 3NTLA 1Y1PA 3VSQA 2WV7A 8FABB 35C8L 1N5LA 3HZMA 3KVYA 3GFPA 3VFVB 5CJOH 3HP1A 5K1NA 4I0CC 4OZFG 3UAOA 1BD2E 5ER9A 1KIQB 3SBXA 1R0ZA 3IXTB 4OAWB 1POWA 3GJSA 1R24B 2ZP1A 3EZFA 5A3RA 3ELYA 1C7QA 3BWDD 1JHPA 3VFMA 2HJHA 4R4NC 3CV5A 4GPAA 1FIGH 4WK0B 4IK6A 1WXFA 1KZYA 1RZRA 2P67A 4TTDD 3HBLA 4LNUA 2Q6WB 4EQ2A 4GSQA 1NI4A 2OZLB 3BH7A 5A0FA 5JJLA 3M1IA 5C09B 3EJSA 2I34A 3FCBA 4UAOC 5JXEC 1VRWA 3O4JA 4KPUA 3RHZA 4F9EA 5EN2B 4LARL 2LTQC 2E5EA 3TLKA 1YEJH 5JUEL 3HUEA 1MFCH 4M0FA 1BWRA 1F4XH 1RLIA 1G7PA 1M2KA 1WXEA 4MJIA 2V98A 5GGSB 2ZIXA 3V4SA 1Q7RA 1RLJA 1AZZC 3AVQA 4ZFZA 1ECZA 4R05A 5LAXA 2GBIA 4RJLA 5TQ2B 1DBKL 4K2HA 3OIDA 4OZIB 3KZKA 1GITA 4JC5A 3A4AA 1FQ9C 4JJHA 4ETQA 2JLLA 4FN5A 3VKGA 3KAKA 2K9UA 3EO1A 3N1MC 4F7TA 5DHVB 2I65A 2OORC 1SIWA 1RI3A 2OPCA 3NHJA 4YHPA 1BZOA 4KWIA 3V2HA 5DLMH 4HKZB 5HTKA 1OGAA 2LPMA 1FZMA 1HAWA 4E6PA 3CX5J 3DXAE 3MV7D 1PVOA 1G5GA 3UGUA 1GVHA 1PDOA 3LL7A 3JQ7A 3STHA 4CR8A 2LCIA 1KTIA 4APQA 1J90A 3Q9NA 2OMEA 2CSPA 5KSUA 4NCDA 4TVSa 1DVFD 3OQ3B 1OB1B 3R74A 3IB4A 2RJOA 1V3TA 1X92A 4R8WL 4NP9A 3NC0C 5EU7E 5AJTA 1YBAA 4PS7A 1K6JA 2VN6A 4G6JH 2WHQA 5GADl 4R96A 2PX6A 4RBNA 3VR2D 1CUJA 3T2OA 4BNUA 4G8IB 4XHJD 5CEZH 2FJHB 1BVHA 3I32A 3SHQA 1K89A 2OMVB 3DR5A 5E95B 5KKAA 3RY5A 4BUJA 4X6EA 3QWQB 1CE1L 4F84A 3CSBA 2CLLB 1JV5B 5FHAL 2GKOA 3UZQA 2XUHA 3AVPA 2A59A 2Q7NA 2MQGA 3VG0L 2I29A 1QHHA 5JCOC 4F92B 2EFJA 2JGDB 1DADA 2I6GA 4ZXBD 1ADBA 4G9FB 1QV7A 3AKYA 1PKQA 3V7FA 3HMQA 1B3RA 5I17A 2DJ4A 4A2QA 2OCPA 1N5AB 1HLPA 4F4JA 3OLGA 3HB9A 1MAML 1GGVA 4CKEB 1JT2A 3W3AH 3KB2A 1A6WH 4B48A 2IH3B 2IU6A 1X6LA 2OL3H 1CBUA 5EU5A 1KOGA 2V3DA 4WSJA 4H26A 1MQ8A 5E6ID 5EHXA 1U8CB 5TR9A 1AE6L 4OGLA 3RC8A 4QJ4B 3K5PA 2B4QA 1LW7A 3K6FA 4ADGA 3QEHA 1BXGB 2HO5A 1NCJA 4KJZA 1BU8A 4BPRA 3PJSA 1E7UA 4OXNA 1Q12A 1NFDB 3NDZE 2P4AB 1BROA 3UK7A 2MSNA 2FWPA 3TL6A 3IEVA 5DEFB 4ARUA 3LHPH 3Q06A 3RFTA 2XOKD 4XVJH 2HGSA 1HL4A 5ANRB 1RQ5A 1FZJA 4O4YH 3FT2B 3LG2A 3B6ZA 3Q6GH 2IP1A 1RIHL 1FMTA 3WYDA 4KHTL 2BSRB 3OKDA 3RH0A 3SYMA 2ZIZA 4FIZA 4MROA 2GJJA 2X9YA 1D8AA 1ZY9A 1LHZA 3WGVB 1MF2L 5FRDA 3DBRA 5AM1A 3EPKA 1QYRA 5CDUA 3ZX5A 4X6DA 1T21A 4YHKH 1WFIA 5G2NA 3L1FA 4IRJC 2B36A 1OAKA 3MBIA 1FVDB 2ACKA 1T80A 2DSTA 1MEXL 1V7MH 2JIXB 3ACCA 4C6HA 3LX8A 2C4NA 1AGBB 2PCLA 1CLCA 4BO2A 2HX1A 1FSZA 4JLDA 3H85A 2GITB 3UK6A 3VO0A 3I6YA 2Z98A 2B1IA 3GDOA 3G9AB 2JFFA 4D0CA 3IMUA 4IP0A 5HVHB 1OE0A 1CD9B 4H0NA 5EBWA 3ZR6A 2XW6A 2CLCX 2AV1B 2QPAA 4EBQH 4NQSA 2EVJA 3B89A 3PD7A 2YUWA 3QJ5A 2FR1A 3A4VA 3N2KA 4L4SA 5DN6A 1LTHR 1T0IA 4TLDA 3CVWA 4X5LA 4KKLD 5I26A 3H9SA 2QN2A 2IODA 1T22A 3UJ6A 4UQAA 3STLB 1VCBC 4ODHH 3UJTH 1WPGA 3NHZA 3CFMA 4Y5VB 2AEQL 5A7BA 4BYHA 1ZLXA 2P6NA 5ULLA 3U3KA 2EVHA 1ASOA 3QO0A 2GSGB 2YKLH 1J9SA 2C42A 3TZVD 3EF3A 3D07A 2CM5A 4MIKA 1GADO 1KYVA 1K5NA 3B82A 4UQIM 1A3LL 3KT3A 4JMPA 3TI7A 2FEPA 2F54B 3RUGA 3BDXA 1UANA 3E1SA 1P2CB 1H3NA 2FATL 1NEZG 5KTRA 1I13A 5LU8A 1S2EA 1F6BA 3KLLA 2I33A 3JWNE 5CRIA 2NU8A 5EULV 3NTRA 4ZU1X 2G60L 3BWZA 4KIFA 3JRXA 4IDFA 2X28A 4IDNA 4JJEA 1IBCA 1PV1A 4QRTA 5CZVH 3EHBB 1DEOA 4ROTA 2R4UA 1DFHA 2WNSA 1Q1ZA 4H2AA 4Q4HB 3FSGD 2JLXA 4TSFA 5HGXA 4PP1C 3CZGA 2I26N 4S1WA 3F8WA 4AT6A 5CYOA 2G4LA 2QN7A 5MN5A 1WMBA 1MH9A 4DA4A 5HHXL 2VT3A 4P98A 1M7DB 2L7EA 4CIYA 3ICEA 5AW5B 5IGXL 3P9IA 4J4PC 5IM7A 2E1RA 4IS6A 4P4RA 2R79A 5ISMA 5EPOA 3JQFC 4OT1L 5JMTA 4EOGA 2MDTA 1H4QA 3IJYB 4KXMA 1YMUA 4G7VL 1I9RL 2FSDA 4UQ2A 1Q50A 3D59A 3HBQA 3DKHA 2QZZA 3CFJA 5KREA 3WFJA 1SFDA 1QJCA 5F77A 3IMEA 2PSFA 2YD7A 2MSLA 3QUCA 3I75A 4ND8B 1QBAA 1EB9A 3LEXB 5F71A 2J3DA 5LIPA 3NEPX 4GP7A 2X89A 1Z7EA 1ZM2A 4RAQA 1RURH 1AZWA 1YRBA 4HWTA 3THXB 4HT1L 4DCGA 3FH7A 2ED8A 2CK3D 5AVXA 5L8JB 1LTKA 1E4KC 3UQYS 1ZDMA 2BDUA 3PR3A 1XAUA 4GOXA 2WK2A 3CV3A 5DTIA 4UT7H 1Y1SA 4IDCA 4OP3A 4LVNC 1WXIA 2P8MA 4QULA 4KX3A 3NJJA 4HW6A 5I1EH 5KAQG 2E55A 1I53A 2IOFK 2DQJL 4YJGB 3HTXA 2IAND 4P54A 1WIPA 2IV7A 1QIJA 4U7WA 2H2SC 1NM5C 4OM0H 4YLGA 4ECNA 2UWEF 1BF5A 4DUXA 1KY6A 1ZITA 2DPLA 5JXEA 2DTEA 2GT1A 3WFDL 2DKMA 3VRIB 4YFYA 1NVTA 1GTRA 4JU9A 3MCKA 3VFTA 3QV1A 4LMPA 521PA 3IDIB 4OI7A 1EA5A 2WHEA 3QY0A 1YEEL 4A6YL 3ZEAA 3CQPA 4NCBA 5LQNA 1NDUA 3GT7A 3BTUA 4I5FA 4S0ZA 3RKRA 3F7RA 1TKRA 3LCMA 3QRGH 2QAGB 5CHNA 4XFKA 1K4CA 4C1NA 1SYSA 2XTNA 4YLBA 4Q3OA 1LK5A 5BMFL 5U4XA 3VJ6A 4GUAA 3PX3A 2WHPA 4D96A 1U0EA 3JW8A 3GHEH 3NCWA 1JG3A 4PRAB 4D0LB 3KTAA 4RWHA 4FNLH 5HGBB 6REQB 4ID3A 1CF8H 2FJ0A 2X7LB 1BFOA 2QJOA 2OORA 3K9NA 3JWOC 1JIBA 4O29A 4HNHA 3BHBA 5BSVA 3PWTA 1HYSD 3O9WB 2I2BA 2JD1A 1UH4A 3NNDA 5K4AA 4WU7B 2ISDA 4G23A 3I09A 2V5AA 1AO7E 2ODTX 4QKQA 1JLLA 4N6NA 1CEYA 4W9JC 2D2VA 5FCSH 3QU2A 2DLFH 4O2BF 5FYQA 4DQ0A 1PJAA 4NPAA 3KXFD 1NRWA 1PZFA 1J5PA 1NOIA 4EFMA 1A1NB 1G2IA 4GKBA 5ILOA 4EMZA 1JHVA 3OKCA 4L4RA 1D9KC 3OTOB 5BZDB 4ZSOE 4M6WB 5F2OA 2GKIA 1KBZA 3DLIA 1WFJA 3OPZH 3WHPA 1TTQB 2EDOA 2DPHA 4UCQA 1TO2E 4OY9A 1WW8A 4K86A 3QLEA 2XF2A 3CN9A 1SXSA 4JKPL 4NZUH 1VL8A 1MCWW 1T1ZA 1UYWL 1EINA 5DWPA 4ZAZA 2XN9A 5C0AE 4H8QA 2VATA 3EDYA 5ENWB 3ME5A 3HC3L 2CVFA 3FSZA 2WLNA 5J3JA 5PCYA 3GRKA 1Q77A 3ESOA 5JCOA 4N5DA 2PN5A 4MJLA 2KW5A 1NPUA 3ETBF 1L5MA 5C7XL 3HE6C 4MRBA 3ZI4A 3EEOA 4R40A 1X5FA 4PHCA 3D39B 5DHFA 3BXPA 2ILVA 1ZHFA 2WQWA 4KTDL 4OZFH 2JZOA 4Q58C 3QBEA 3OJLA 1FP5A 1BWMA 5DK0A 4BGUA 3QXWA 4OZ4A 1CR6A 4KSCA 2YWEA 2X0KA 1TJ5A 4U1HA 5CLFA 1Q0UA 1NRIA 4BL5A 4Y2HA 5HG0A 1MG0A 4EUKA 1XFAA 3SZOA 3T4EA 2H1CA 2ASVA 1EVEA 1WXXA 5JSHA 4L28A 4MV9A 2E3VA 5LNK6 1N8TA 1NGWA 5JAMA 1MOSA 4ZAWA 3LKBA 3DVGB 3RT7A 2OB2A 1YR8A 5J1AA 2PJZA 5E6SA 2IOHA 4W99A 5D72L 1DJIA 1IN5A 4ZOLF 5BV2P 1OOAA 5HGDB 3H4TA 1SG9A 3KD4A 3U3DA 3X3HA 3S96B 5L7WA 2BC9A 1KTBA 2QYSA 4FU0A 5FXCH 1LP9E 1E5VA 5IMBA 1DO2A 2Z91B 2D31A 3TG8A 4IJMA 2FSEB 3NBFA 4NNPL 4R81A 2CD9A 3PWNB 3GJYA 3R9KA 3RVBA 5FIEA 2ZWAA 2JNZA 5IF0B 3BH6A 2XX0A 2ZYTX 3G6JB 3OZBA 1XO1A 2EDRA 4TNWK 1W1IA 2GI7A 1U42A 1L4EA 4IRJA 2D4AA 2I4TA 1AMYA 4RVOA 2PE5A 4D57A 2MR5A 1Z28A 4NPJA 3BP7A 3QNXA 5I1AB 2OSLB 2PWHA 2W37A 1ZGJA 3MIZA 4RA9B 3IDJB 2NY5L 2EL9A 4MDHA 3IFLL 3MMXA 4J2HA 3TECE 3OKEB 2ZS9A 4H1HA 5BUAA 2YXDA 4DESA 2EKBA 3AETA 3QZWG 4NZ8A 1QYGH 1UK7A 4Z0XA 1K4DA 2GYYA 2NYUA 2DBJA 4NAHA 4Y2UA 2LU3A 4XP6H 1JI1A 2H7CA 1ZGGA 1EK3A 3I83A 4OLYH 1SBCA 1JXKA 3PKIA 3M34A 4ABTA 4TZ6A 3QU5A 2R2GA 3OMXA 3HVNA 4TGLA 5T3XH 2BC4B 4MXWH 1KQOA 2ZKYA 3ZXAC 4WLNA 3KWUA 2PGIA 2GESA 3IAAA 1NX9A 1JDBC 4KSBA 3TN0B 5E08L 2Z2YA 3OE7D 4ZQHA 1WGVA 2KQMA 2P5SA 3C6LB 3GKWH 3IIMA 2B82A 2ZIVB 2CZNA 1Y7TA 3ECCA 4LCUB 4YFLI 3I1FA 4GAEA 2JFCA 4TWZA 4RX4D 1P3Y1 4LSUL 1I51A 3VFNB 2JKXA 4FGMA 4X00A 4JDEA 4N86A 4IGFA 5K93A 2C58A 3IUNA 3Q6NA 2ADFH 3RUPA 3ORRA 2WUBH 4F3KA 2XWCA 3CQQA 3FU9A 4FTVD 2FXIA 5CGQB 3SXUB 5L3QB 3C5ZC 5BS0A 4OMCA 1H4VB 5J6GB 4CLOB 1XDWA 3D05A 1BJMA 3GBMH 1V4BA 5BVGB 2GHZA 3Q8FA 4Y4HD 5FTMA 4H1LB 5GGQL 3ZE0B 3ZJVA 4IIGA 1GZ5A 2OBYA 3VZBA 3PD0A 5AJZA 3D6MA 1NVWQ 3UHPA 5KVSA 4WHTA 2A9CA 5AD0B 3AFIA 2DHEA 1H0RA 4LLMB 4JSRA 1DCTA 3BX1A 1ZUIA 2J1XA 1TD1A 3L9WA 5E8DH 5HYVA 4KRFA 3GDGA 3F65A 2OTUA 4KZDL 4L6CA 2BSQA 1JLMA 1TK9A 1ZIYA 3TXYA 3C97A 4YFDB 1GAEO 2WQSA 2EIZB 3CX5K 2XVBA 1VL0A 5I15L 4OLWL 4FOLA 4P9MH 3OJVC 1CS6A 2PRYA 4AZ0A 1EJOH 3H2SA 4HAVA 4I3HA 4JPQA 1GIAA 4KXDA 5D7NA 3JTSB 2IT1A 3OBIA 1D6NA 2ZS7A 4MRMA 4Q9HA 2BGWA 1JCVA 4HOYA 4G0NA 3L5KA 2JA1A 3IAHA 5DSCB 3FRUA 4NYMR 3JQAD 3N5AA 3E3QC 5DC4B 3QORD 4M9RA 3JQFA 3GJ8A 4K8OA 5CNJA 5C9JB 3AI2A 3SP1A 2GJ6E 3OAYK 5K4GA 1OXKB 1N8KA 4PR5A 4F7PB 1EX0A 1SXIA 1HE8A 1THCA 3LBNA 2YLKA 4G5GA 3LLCA 3DE7X 3JVDA 2NZ8A 4JRWA 1TTFA 1NMXA 4Y8DC 3GSNA 3P27A 4PJ6A 1S7SA 3WKYA 4GW5A 1EGJH 4QXPA 3J07A 5G3YA 3NUZA 1SXJE 1T2DA 4Q0XH 1T3FA 4PPYA 5A5GA 4BGEA 5LQKA 5IFAH 4R0LB 4FWWA 1E4KA 4WAUA 1RZIB 2LP4Y 4ZAGA 5K03A 1AFVH 3R7LA 1GG2A 4YR6B 1SCAA 4LVNA 2F1HA 3IP7A 5JO5A 3OQMA 5JOPD 1FVXA 4WLEA 1FL5B 3ABZA 1NONA 4DEXA 4RZHA 4WNYA 1AUVA 4XLLA 1T3LA 3FHJA 3FPAA 3HFML 3HY6A 2DECA 1IKOP 4D9LH 3AP3A 621PA 4ZS6D 1NM5A 5BRJA 5DJ8A 1GNVA 5FM5O 5IREA 2WKGA 3KKEA 2CHWA 2MPAH 3RREA 3SJUA 2MCG1 4JRXE 3FPYA 1U31A 2H0AA 3NJ8A 5LC1A 3VYTB 1U7UA 2X6VA 2GT9A 2DS4A 3BWYA 4XUCA 1LPMA 3DOJA 1DWQA 1O87A 5EMYA 2AYZA 1QZZA 3S36X 1L4MA 2Z31D 3L46A 3FPGA 3EXLA 4GH7B 2EVWX 4YDKL 4X4YA 4C88A 1M1UA 2B2XH 3TCXA 8GPBA 4I4LA 2Z0UA 5EWMA 1HI9A 4P7KA 5DI8B 4RMIA 1NNLA 1UOOA 5JWRA 5AFAA 1EFKA 1GGBL 3Q9PA 3LJKA 1K2DA 2ETVA 1TLFA 4U7GA 2HU5A 3AWFA 1OM3L 1TVHB 4LT7A 4LHUG 2KQUA 5IAJA 4WJKB 3AGPA 3QIBD 5DS8B 4Q9IA 4MJIE 2GJ8A 1XFPA 4X8XA 1TK3A 4AQDA 1W9MA 4UHBA 4MD5A 2XPZA 4QJ3A 5KC9A 5AT1A 3C8HA 3G9TA 3BMOA 3WN5C 3JWIA 4ZMVA 3RRBA 1QFUL 2I7DA 4F60A 2C88A 1D7CA 5JZBA 3L0CA 2HK6A 4G0WA 5MN4A 4LK3A 1XZBA 4J0DA 1XXHE 3JZ7A 5T33L 1BOYA 2YQ2A 2EF1A 4XVHA 1P4BH 5TX7A 3ASYA 5F8QC 2BS8A 2HG5B 4UDUA 3L8DA 2D59A 4KQCA 2YBRB 1EFPB 1TEVA 1UT9A 4PFSA 5EJGA 3LVTA 1ODCA 3WGNA 1TPYA 3OX1A 4O4LA 4AQEB 4EB6B 2J0SA 5FAKA 1WMEA 1U33A 3EYVB 1D9KA 1ORHA 1J07A 2HB6A 2IH2A 4ZCPA 4R26L 2CLZB 5FOBA 1J0AA 5FTLA 2HLAB 4U1GC 3X11B 1Q7TA 2ADJA 2HCZX 1C3XA 3K71B 2Q2VA 1O9BA 3OB8A 3VR5H 4I3FA 3M6AA 1PMYA 4KAFA 3DX9B 2N3JA 1JIVA 2QROA 4NDAA 4RAUA 4HPXB 2Y3NA 4MMXB 3FE2A 4U1NA 1ECLA 2ODEA 5AVUB 4HXGA 4EDFA 2NSYA 3LL4A 4EI5C 4MKMA 2BNQB 1AXSB 5GRJL 4FG4A 4I3SH 3G2PA 4KZKA 1YCDA 2OCAA 3HE6A 5HDOA 2AXFA 3BRWD 1C1XB 3T7IA 1KCSL 1D0IA 1Q9OA 2AK4B 4OFZA 3W5NA 5J11B 1LLDA 4M1CC 3B9KC 4KMTL 2AX3A 1E0KA 2Y06H 3D5TA 2BEVB 5GY7A 3LC2O 2XXAB 3IT3A 3V4ZA 3EYAA 3OIWA 2EWMA 3MRPA 1G7SA 2ID4A 4WY2A 4KDCA 1VZIA 4ZZ2A 2ZE8A 1BJTA 3NATA 4GKVA 1OTUC 1JA9A 2E6UX 1X4ZA 1PKQE 4PVBA 3CUSA 4AMUA 2QPEB 2XACC 2QQKH 2I78A 1LSSA 3Q1KA 1OT4A 4MJ4A 4LV6A 4HEA6 1MI5B 2N0KA 1EXUB 2A83B 3N50A 3CYFA 4KO1S 5CIPA 3BWSA 2DWDA 1ZL0A 1L4FA 1T7VA 3KLHD 1K5WA 1GR1A 3FPKA 5IB3A 1YQVH 4GLFA 5JS8A 2PUHA 3F00A 5D3MA 2RHMA 3IQEA 5ALCL 5TB5A 3RGGA 1U8AA 4L75A 2F8MA 4Z0NA 1GGKA 4Q3EA 3BCDA 3QJHA 4ML3A 2BNRE 4UUQA 3H9GA 4IO0A 3DOCA 4Q02A 3KPNA 1GSHA 4KGLA 3WY9A 3FGNA 1FIGL 4RENA 1MIMH 1RTKA 4HYYA 2OXEA 2VLBA 1O77A 4IFBA 3IALA 5HF8A 4CIXA 2V3EA 2NXZC 4A7GA 4FN0A 4LLUA 3UBHA 1DL5A 3SKNB 4BLQA 2O7VA 3J8F7 1X7YB 1T4DA 1Y8RB 5FWYA 4ZVLA 1HDOA 5HCUA 1S78D 1UAGA 3V46A 3RSHA 1X5GA 3IBSA 3FPXA 4Z7QB 4X6DE 5CU5A 1T9KA 2CUZA 2WNGA 2D7CA 4ARAA 1GNLA 1YEJL 1XVVA 3QUMA 4QRQA 5DHRA 1MFCL 3D31A 1F4XL 5FPHA 4QXWA 4QAMB 2MRYA 4XWGH 1WV0A 4AP5A 4G6MH 1W52X 3L4JA