3ZE1B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 106
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze1B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze1B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze1B03
3OKWA 1T6BY 1YVPA 5BV8A 1FNSA 4Z7NB 3EH2A 5KYWB 2I91A 1M2OA 3V4VB 1QC5A 4K3JB 3BQNB 3TVYA 1V7PC 2XWJI 3PPYA 4WK0B 3TXAA 2VDPB 1BHQ1 1IDN1 1L5GB 4JX0A 4HQNA 1MHPA 1RD4A 2XWBF 1M1UA 4WK2B 1PT6A 5HDBB 2ODQA 5KYUB 1IJKA 2WW8A 1OLZA 4CN9A 4F1JA 1TYEB 4DMUB 1AOXA 1IJBA 3ZDXB 1ZOOA 4MMYB 1QC5B 3PPXA 1RTKA 4CNBA 4IXDA 3PPWA 1YUKA 4HQOA 3AFCA 1L5GA 3FCSA 1U0NA 3NIGB 3NIDB 4MMZA 2VDLB 5HGJA 2IUEA 1UEXC 2XGGA 5E6RA 3HI6A 5KYUA 1XDDA 1JLMA 1XUOA 2QTVA 2NVOA 3VI3B 1Q0PA 4MMYA 1NA5A 1SQ0A 2M32A 3BQMB 3F78A 1BHO1 3ZQKA 3HXOA 1SSLA 5E6SB 3FCSB 3K71B 4MMZB 4XW2A 2VDQB 1DGQA 1ATZA 1SHYB 3GXBA 1MQ9A 1MQ8B 3IJEA 5E6RB 2UZYB 3N2NA 4WJKB 5E6UA 1YVRA 3EGXA 2NUPA 4UM9B 4O3TB 4HQKA 1N9ZA 1AO3A 2VDNB 4UM9D 4G1EA 2I6SA 5KYNA 5E6SA 1M2VB 2P28A 2P26A 3T3PB 4HQLA 3K71A 3EH1A 2VDKB 3IBSA 2WINI 5KYYA 1U0OC 3EG9B 1LFAA 4FX5A 2VDMB 5ES4B 3IJEB 4BJ3A 5E6UB 4G1MB 2ADFA 3EFOA 3E2MA 3EGXB 2NUPB 1M1XB 3M6FA 3K6SB 1PD1A 4NENA 4CN8A 1IDOA 1JEQA 4G1EB 4GZ8A 4Z7OB 3FCUB 1M2VA 1OAKA 1SHUX 1ZOPA 1RRKA 1T0PA 4PN7A 1N3YA 2VDOB 3AL8B 1PD0A 4WK4B 3ZE1B 3EG9A 4F1KA 5KYYB 1XDGA 3RAGA 2NUTB 1MQAA 4G1MA 1JV2A 3EFOB 4IGIA 3PPVA 1M1XA 1PCXA 3K6SA 3ZDYB 4NENB 1ZONA 3HXQA 3OKYB 1JEQB 3VI4B 3OL2B 5HJ2A 1AUQA 1CK4A 3AL8A 4JDUA 1MJNA 2VDRB 1DZIA 4IHKA 2VC2B 2NUTA 3K72B 1JV2B 3TW0A 4Z7QB 1U8CB 4UM8B 3T3MB 4FWWA 1SHTX 2X5NA 4HQFA 3BN3A 2O7NA 5KYXB 4A0QA 4MMXA 3EGDA 4C29A 3EOAI 3Q3GE 4NEHB 1JEYA 4O02B 3OL2A 1QCYA 3K72A 3V4PB 1U8CA 1M10A 2B2XA 2ICAA 4O3UB 4M76B 5KYWA 3NIFB 1FE8A 1RS0A 2I6QA 3F74A 5LN1A 4C2BA 3EOBI 5KYXA 3NVQA 4MMXB 3EGDB 3QA3E 3ZE0B 3AL9A 4O02A 4WFQA 1JEYB 3TCXB 3ZE2B 3ZDZB 1CQPA 1MF7A 2ODPA 4C2AA
chains in the Genus database with same CATH superfamily
4URZR 3OE1A 5DWUH 4X8JB 5J5EA 3S68A 1YZQA 3WP1B 4NAQA 1MW3A 4DTCA 3HV0A 2GBAA 4MNHB 4B84A 3GSXB 2ZWNA 1E4YA 2X3UA 4FTVD 3FLEA 2Y9MB 4Q1VA 1OF0A 3CLUC 4M5ZH 3QPKA 5TQ0A 3QRGL 1CFTA 1ZT7A 4ECNA 1YNSA 2EABA 5KTRA 1CI3M 2IRWA 4OD1H 3V1LA 1YZLA 1D2GA 2X5OA 3FHTA 1F2DA 5AVKA 1JYNA 4DPCX 2DH3A 2VTDA 4KV9A 5A16B 5DCCA 2QT0A 1VIMA 5IBUB 3PFWO 5T5FL 3ZGIA 3K5RA 1RUML 5BS0B 1DSYA 2ZX5A 1SUEA 4RBNA 4DUXA 4LOAA 1E3IA 4XNDA 1CS0B 1ASQA 2OV4A 5KJ1A 5GGUB 1KGUA 3D1MC 3BZWA 3CC5B 1MFNA 3QO1B 4JLJA 1OTSD 5I0WA 3ZBMA 2NSMA 3Q2CA 1Y4DE 4YGAB 1K68A 2W9DH 2CUKA 3W9UA 4JFUA 1E1NA 5DFVD 3HVIA 2XCOA 4P46D 4TTTS 2FSFA 2WQ6A 1ST3A 3NAZA 3WFJA 4KFRA 1E2UA 5TARA 2KS0A 3KGRA 3M9LA 1TA4A 1GPNA 1WFIA 1JDDA 2H5EA 4Z1MA 3IULA 2BJML 1S7RA 1MELA 2AC0A 2N3ZA 5JH7B 3ZSSA 4QZVA 1XO8A 2CKBH 3UK0A 3ILQC 5I17A 5T1KA 1PV1A 4E11A 2BSQA 2HMID 5F7EL 1L4IA 2CHZA 4KUHA 3BJZA 5EHXA 1MRDH 2I8AA 2WXQA 5LZ2A 4HZIA 3P4OA 5BZWA 4QUKA 3ONFA 4IICA 4MMZA 4Z6AT 3FLMA 5C08B 2IXQB 1GKKA 3W5HA 4UXIA 3D0OA 4U3CA 3GROA 2A4KA 2IV3A 3T3PE 2V7VA 4P23C 3L1VA 1X8KA 4L57A 1N2OA 4F8JA 2BOCA 1ZLEA 4FYWA 4W9RA 3JWEA 4UUAA 5AI8A 1F48A 1XNQB 3HACA 4I89A 1FBIL 2YXEA 2OCLA 1FXWF 4MW5A 5E6UB 4M62L 3O6FA 1ID5I 1ULAA 4YBLB 4N0YL 1J39A 2A9OA 4B09A 5C09E 2WT8A 3I09A 3D2UB 4XVHA 3QORC 4XLTA 4QVGA 1BFKA 2CC2A 1KJ2L 2AB0A 3UAXA 4EKEA 1W85A 1VG9B 1QAOA 1E4KC 4AYXA 3AETB 4P4KC 4YWHA 3ZDXE 1W0JD 4DR6B 4O8ZA 1PWEA 1AK9A 4B2IA 3HRZA 2VJYA 1JV5B 2A3RA 4P4RB 1JDZA 3MT7A 3FTZA 2Q46A 3DLHA 2FATL 5C0RH 1C9EA 2E6PA 3LVTA 1CRLA 4L2IB 3TZEA 3L8ZA 3KDPA 1AS3A 1CDDA 3LDBB 4U3SB 1Y8QA 4W81A 3PWSA 4RD2A 1C30A 1KR5A 4JFSA 4JX0A 43C9B 1W73A 3JU3A 2PUBA 3WHKA 2XSZA 3KWVA 4KX8A 4IDOA 2NT4A 4H4CA 2VPZA 3NFPA 2V54A 2R56H 1NP3A 4RMQA 5CZXD 5TEVA 5ABZA 2UVQA 3STBA 3BE1H 3AHGA 3A1TA 3EEIA 3ZJ4A 5K0JA 3GSWB 2NPFA 4BEBA 5CXSA 2MTBA 3S98A 1HHKA 5F7XA 1U95B 3I0MA 3MAJA 3SGKA 4I0PC 1CFZA 2JJ8A 3SD5A 1ECGA 1JIXA 1JQ5A 2YNMC 2SEBA 3MJ7B 2EKPA 5DSZA 3FO2A 2NXZB 3AS0A 2YNMD 3N6VA 1TO2E 1H5BA 3D64A 1Q7RA 4TLBA 3ET9F 1WKBA 5IWAB 2QPSA 1PSWA 3IUBA 4IXWA 3E1GA 3PJFA 5ESWA 3GB7B 1K8YB 4ZOQI 4XPIB 1D1SA 2XWJB 3I50L 2V37A 1FIUA 3RNQB 3LSTA 4UQPA 2QDKA 4QWWD 1KJNA 3PGA1 1TI7A 1NCDL 1CDBA 2WMOB 4JGGA 4J0JA 1G60A 1G7MB 3F4BA 2RSLA 2PGIA 1CP3A 4K28A 4FWWA 4EIBA 1KT2A 2BHLA 4E9XA 1C8KA 3PI7A 2BGMA 4O5LL 3VXSE 2HMUA 1WIWA 4BNNA 3HOGA 5FR3A 3TEUA 3Q9UA 4P23D 4ZI3A 1K8IB 3HYLA 5KVMC 2OQJA 4NG5A 1QQAA 3QKTA 3HYSA 1J88A 4J43A 4OLXL 1JZ5A 1MIEL 4RTQA 1G4UR 5C0JB 4YMTA 3RC9A 4Z4HA 1X5FA 5EG6C 5CEEA 5C0GB 3DX7A 3D0VB 4JQXA 2PLNA 2QTVB 3BMNA 4L4ZA 1ZD3A 5HHXL 1TTTA 2BC4A 3IHKA 2VERA 4FWTA 3C5ZA 4KWIA 2XGOA 1CT8A 4GPTA 1WZ2A 4QL3A 1DE4B 2W07A 5DW0A 3PP4L 5TQ0B 4GEIA 5IBTH 4EEZA 4LEEA 3ZZMA 2P4SA 4FHBD 2FNWA 3VD9A 2NUPA 4K3DL 4KXWA 2XFXB 4A6XA 4JRYB 4OREX 5E1GA 4P5RA 8FABB 3SDXB 4HSCX 3U3JA 4KQGA 2J5LC 1CLVA 2PV0A 3GY0A 3O7WA 4G8EB 5FCUH 3P4MA 2ESVD 2PYIA 1VPVA 1JHLH 3EO1A 3O41B 1ANUA 5TB5A 4QXVA 2Q6IA 2C58A 1JMXA 3C2AH 5E6IC 2FA9A 2WXHA 4BFSA 3NBAA 3SO3B 2NO9A 1BD2E 1A3RL 4HOMA 2L7EA 1BW8A 4N8PA 3WK7A 5ILTL 4UAJA 1AIPA 2PT7A 5T57A 2QG4A 4S0SD 2OV0A 3KIPA 3U2SA 3WLOA 1KACB 4WHCA 2NO7A 4DMFA 3UZQB 1FS6A 2BJHA 8OHMA 4RFSA 1I1HA 2Q9AA 3JAWB 2R8YA 4NQEB 2PWFA 2Q0SA 4K73A 4S2UA 3V8OA 2WVVB 1JB1A 1YAZA 3IJHA 3SVTA 1YRQA 1HAUA 1O6ZA 2EZTA 4ACBA 4AGMA 4NQVB 5E7FA 1TKCA 1RIVH 4R6XA 1YT5A 4RA3A 2BR3A 2IIBA 3OE4A 2OMVA 3NNNA 2ZUTA 1C8BA 2J7PA 4GJTB 3H5TA 2FOLA 2WG0A 3DX1A 3GIZH 4EUPH 1QZTA 1GGNA 1EDBA 3RHZA 3ORJA 5C8ZA 2DF8A 3HHRB 3QF7A 2HOQA 4MKTA 4O5AA 1XTRA 2WSPA 2JAOA 3EIFA 4EF3A 3FUEA 2B14A 2BP0B 5GGRY 3M4ZA 3N8NA 4G4JA 7ADHA 2BRUC 5DT9A 1FU8A 1ZK5A 4EFMA 5HGAB 2D3TA 2NU6A 5MN4A 3BH6A 4FLOA 3QJ5A 2NLJA 4OV6F 3UX9B 2WJ3A 3UFXA 1RRPA 4WZAE 3UK1A 1GR0A 3HDVA 1KZGB 1AKQA 4F5EA 1Z18A 2GSGA 3G2QA 4C47A 4H88H 1Y6FA 3TMYA 1NBMA 1SIBE 4GX5A 3SZKC 4LCWB 3WKNA 3MINA 3MMNA 3LO8A 3SI7A 3MRPB 3QZLA 4LU5L 1EX6A 2CUZA 1TAGA 4XM1A 2ZRCA 3BKYL 5E0OA 2PGAA 3TFKC 1E28A 4A92A 2X9QA 1WF3A 3HPQA 4EBBA 2BSEA 3OZUA 2J46A 5JASA 1B4LA 1JZ3A 4FR5A 4LEOB 5LBSA 3RUHA 3Q2OA 1JAIA 5KUKA 3THYA 3LHKA 3K5PA 4XDYA 3BIBX 3HIZA 3UMNA 1DOZA 1Z34A 4LQ4A 2CHEA 2C3PA 3GDGA 2BP8A 5JALA 1A9QA 1CE6B 5A1JA 4R2JA 1NCAL 1CYDA 1IZ9A 3KYOB 3U3XA 3JZDA 4KXLA 3GSOA 1HDGO 1X7ZB 1YDMA 2H1LM 3W2HA 4OZIB 4ZVKA 4RCYA 4II7A 5D5HA 2Y77A 3GXFA 3DS8A 3BVUA 2JQMA 2P44B 2PLRA 4YI3A 4MTCA 1DKLA 1E9DA 2RHBA 1CVIA 1THGA 3GRAA 2HA6A 4RGQA 4UFNA 3NEXA 4AYBA 5AW0B 4O4JB 3ZXYA 4YSRA 5L7XH 1TQDA 2C2MA 5CJBA 3L7AA 2FSVA 2V4UA 4P7BA 1T0NB 5HJ5A 4AX8A 5KQSA 4NULA 5FHAL 1S7TB 3BP5B 3G82C 4P06A 4JPKH 4IMPA 2CSPA 1XXLA 2QADB 1EK0A 2AF4C 4PJ7F 1O9BA 5JZ7C 3AKCA 1ZLSH 3TF5A 3K2UL 3O7MA 5AJWA 2G4LA 4FC6A 4GXNA 2JVKA 1S9WB 4UT6L 4R1NA 2SBTA 3VNSA 5JSUA 4FQQB 1NGWB 2A6PA 3MERA 5FO9A 2B5WA 3AROA 3ZMRA 1ZHKA 1GZUA 2ZIVB 1O87A 4L15A 1O7JA 2GYVA 4I1SA 3BAEL 2MYNA 3PWJA 4U6SA 4JO3L 3CRVA 4ODHH 5CR8A 4WW2B 1RI1A 4JODA 4JFFB 2WZ5A 1SC1A 2GBLC 1Q0UA 3QUXD 3IQHX 2XXBA 2ZRIA 5EEWA 3CO5A 1MHPH 3ED5A 3HN8A 3NACL 4ZW7A 5TE7H 5F35A 3BW9B 1PJQA 2DOKA 4BP9A 1P1HA 1VBMA 4RD1A 1HQKA 3PVCA 2GF0A 4XP1H 1G7HB 4XYGA 1ZVJA 4LK4A 2O7QA 3H42L 3WGUA 2KLTA 3D1JA 4IOMA 2GLTA 4B0MB 2HA7A 4HJJL 1OA1A 1S7UA 2GK0B 4RH4A 3VB8A 5JDJA 4R96A 3HI5H 3WS7A 5HKLA 3OEEA 4MIEA 2YKLH 2XVLA 3I5MA 5AW9A 3BE8A 1ARZA 3ZHSA 1PZ5A 2AF3C 4U6QA 1RXUA 5BVJB 3KR3H 2OZ4H 1QOQB 4JPKL 4GMSL 3MTAA 4AYID 1YKFA 4I18A 1TEGA 5LQCA 1JILA 3Q11A 4K7PL 5LCVA 4HGZA 3V9EA 4EI2A 1IM8A 4BEWA 5CIPA 2MSEB 1DQVA 4UXHA 1D5IL 5L3RA 1QCYA 2DR0A 2HX7A 4ZTPL 3PC2A 3V0IA 1FS4A 4ISBA 1LDGA 3NA4A 4R3UC 5AVZB 2B15A 1ZLUK 3NH7L 4PJFE 3MSCA 4BCDA 1E1QD 5GQSA 5JC1A 3O0RH 3EXG1 421PA 1SXHA 4B7ZA 4QRRD 5HSFA 1ZGJA 3OSUA 5LQAA 3RWCA 1BQHG 2F19L 5CD3B 5CJQH 5AKJA 5IVOA 2BHRA 4ZGWA 3INRA 1NUQA 4TOIA 4TLUA 2X9WA 4OLWH 4JB8A 2HR1A 3DX9A 5FHBL 4OI1A 4UNNA 4YT5A 3RRBA 2WC7A 5IJXA 4F8NA 4WIQA 3EMDA 2OMKA 5IAAA 3SAJA 2NUBA 1U3TA 2BSED 3I6KA 2C31A 1FNAA 3UYRH 5HX7A 4HQLA 3HB3C 3D25B 5KYYA 5T3YA 1A5FH 3KW7A 3P27A 3GDWA 3B6KA 1P4SA 4PPYA 3VHXB 3STZA 4KI5F 4N12A 4BAGA 1JDBC 3VGHA 4NP6A 2BFBA 5KJFA 3WWZA 1YG9A 2NLJB 1MIHA 2D2XA 3RHFA 1G1CA 2XMGA 4BATA 2VHEA 5B1BB 3DCIA 3L0YA 5IARA 1EA9C 3L04A 3LD9A 1NPNA 1D5IH 4J4TA 3H16A 4E6EA 2XN0A 3WO1A 4UNIA 3ETTA 4AQZA 4PI2A 3VXRE 4JYCA 1D03A 3L49A 4YXKL 1DC3A 1C3OA 5DZPA 2QT9A 5K8JB 2GJZA 5FTMA 5IC6A 4UPVA 4P5KB 2RA1A 3QUHA 2PKQO 1J0IA 5F7HA 3RDTD 1JYFA 3R3XA 4JZKA 1H0SA 3HN3A 1OAXL 1YEEH 5IKCA 3FTUA 4YSUA 3R09A 5DJYA 3ZK8A 5LU9A 3ZUCA 3RTQD 2O3TA 2OK8A 1FJGB 1NBME 1YVUA 1U1DA 4Z7OF 5J11B 2L04A 1JG3A 3HNVL 2CDGA 2R79A 1LU9A 2YCBA 2CDEA 3K8LA 3X11A 3KJ6H 1NGSA 4HOXA 5TNXA 2PO6D 2IAMB 2VQUA 4P5PA 5BQ7B 3E1F1 2QGZA 3GZNA 4L28A 3VD2A 4MCYA 4ZALA 3RO7A 4H1UA 1X6NA 2ZWOA 3TBVB 4A82A 1XB3A 1TX4B 5KWJA 1NYLA 3BWZA 4F7CA 2CG9X 3P94A 4UTAH 1UL1X 4XBPA 3BN9D 2W93A 4EATA 5F9MA 4PLGA 4R4NC 5H80A 5EOCH 3C3MA 3JQPA 5CXXA 1JJAA 2BTQA 3RUDA 4QQRA 2A4EA 4B9KC 4YASA 5JXEA 2PZJA 3KE9A 2D5BA 2HRHA 4JKMA 1NBQA 2NSDA 3NDRA 2VDOL 2ZVQX 1PQWA 1YZHA 1WLHA 1M6VB 1SHLA 3K2EA 1LEKB 3S34H 3ZU3A 1GQYA 2BINA 4J9UE 3GW8A 3ZU2A 1TADA 4FN0A 4YDZA 3FZEA 4MI3A 2W6JA 4QGGA 5D7BA 4A15A 2ZOSA 1TW2A 3OHSX 1KAMA 1C9KA 2G1AA 3NDZE 3RTCA 2RARA 1OM9A 1AC6A 2ZAGA 3ZBQA 2Q7YB 2XY2A 4F1WA 3ZMNA 1QYDA 4NMMA 4JFFA 3MXVH 3EXAA 1SMDA 2YWZA 1LO2L 5AW4B 2VK1A 1AKJD 3MLVL 3ML1A 3VI4E 4GG6E 1HILA 5I73B 1LUAA 4K9NA 1YEGH 3B78A 4UTOA 3AAZB 4ILKA 3UZVA 1FC0A 1ZRNA 1P1IA 2FG5A 2VHVA 3KCPA 4MS8D 3VU3A 4PWKA 3QPQC 2ZRMA 2Q6WB 5M7EA 3FKSA 3MNFA 2A73A 3VOAA 2NTYC 3K0CC 3I84A 2EW8A 4DN3L 5HHTA 2XRMA 4NZRH 3OSVA 4X1OA 4R1PA 3RVOA 1AJ7H 2PEZA 3H2SA 4KTDL 5ELIA 2WANA 5BQDA 1Z2OX 4XPIA 1Z5LA 1XRMA 3QZOA 4IKPA 4NO5B 5IR1B 1E2MA 4DP2X 4ZMAT 1MNNA 5KOYA 1RHHB 4EI5A 1A7KA 3EOTL 4X1IA 3QUQA 3TV8A 2NXZD 1JRHH 3NIFB 1WEKA 4QREA 3WIDA 5IZ4A 2ZT8A 5C18A 2HLAA 2VLKB 1LK0A 1RI5A 1RZIA 3U81A 4IAOA 5AAMC 1NANH 1N2HA 1CURA 2K8QA 2XZZA 3IDGA 3F9IA 5FKAA 5LLTA 3QARA 3NRPA 2I7CA 1DL7L 3DBLA 5HFAA 2PHZA 5I45A 1JTOA 3WMPA 4EG5A 4BRJA 2BFFB 1OOAA 4IDJH 1FG9C 5GZND 4HDNB 1WZMA 2XQBL 1PLBA 5FUOH 3EVEA 1FBNA 1PJRA 3MOBH 3HMXA 2BERA 3FAWA 2ICCA 3AM3A 4GVXA 3RKSA 3X17A 2W90A 3DZDA 1X92A 3O45B 1MHTA 2E59A 2PSEA 3PWLA 1UUSA 3BG5A 4BJHB 2HC9A 1X86B 4OJAA 3FLBA 5GM1A 3B8YA 1P3JA 1J7VR 5DC9B 1E5CA 4XC1L 1KELL 3D8RA 2YZ7A 1OKEA 2QKIC 3RRMA 5HUHA 4AF8A 4UZSA 1HHHB 1KJ8A 2OXHB 1EX9A 4JJZA 2REOA 1PUJA 3F7NA 1JXFA 1HH4A 2YRXA 4IJMA 1EVTC 1FSKC 2EH8L 1X0XA 2OXRA 3IH5A 1ESMA 1U5BA 1KDVA 2YAFA 4J0GA 4EHHA 2PCJA 3V6ZA 3VSDA 2MSNA 3SDSA 3QXHA 4PV7A 2XWTB 1RM0A 3RIMA 2PABA 3VX1A 3OUUA 4G4SP 5HZGA 4BNFA 4TZ6A 4TL8A 3RURA 1EDYA 4X5XA 3JUYA 4ASUA 2C8JA 4HNAA 1LCIA 5K39B 3E9YA 4DBLC 1GS7A 4PLJC 3QRBA 1NGPH 2ICWB 2XQ0A 2C94A 2RQ8A 4ZQGA 1G8GA 1KCSL 1TJ4A 2VKQA 3F6RA 1Z2AA 3TCNA 4Z18A 3FPSA 2VTBA 1NWHA 2MTPA 2G6TA 3RYFB 5HRUA 2H7WA 4LVOC 1MNQA 3V8BA 3RWJA 2QFRA 1OLZA 1JSRA 2VYNA 5EZOL 3MJ9H 2I4OA 3P30H 4Z1OA 3ESOA 4A1OA 3VU0A 2VMEA 1WE2A 4Z7VF 1R8QA 2E9IA 4PJBB 3AY2A 3VXMD 3IQZA 3QUYA 1P6XA 5GGSA 1WBXB 1CU1A 2FTAA 2AN9A 2HTLD 1QH8B 4LJ7A 1XDZA 4OJDH 2E9JA 4JM2A 5J1SC 3CNNA 2XMSA 3L8QA 2VDVE 4N2AA 2ASVA 4JK3A 2OFXA 1XX6A 2BCKB 3L8GA 1XGQA 2O61A 5BZDA 3V0JA 4KZDH 3ARPA 2X5KO 3IKVA 1MHHB 4RH3A 4ZOLB 2ZJBA 4BMNA 5GZOA 1UUFA 4R5XA 5FO8A 2FPMA 1MFEL 3SICE 1WW8A 4P57A 3N74A 4MW7A 4N3CA 4DP6X 4PREB 3PXAA 2JCXA 4MB4A 2RHGB 3BD8A 2J5BA 4HQ6A 4ARZB 1XVUA 3SK0A 2GSGB 3SC4A 1Q16A 3MLUH 3DURB 5FKJA 3AY3A 3G89A 3VNBA 3B2VH 3MAAC 4EPTA 3MX0B 3R4CA 5BV7B 5DHYB 5KYWA 1RJYB 1YBAA 1TEZA 5D4HA 3T94A 3NVQA 1JF6A 2HPHA 3Q7JA 4D9RD 5MHTA 3T9EA 1E27B 1I1AD 4EE2A 4IIHA 2DWQA 4G6AC 3EUEA 4NMHA 4PS3A 2CDFA 4OCRL 3AF4A 1MCRA 3JWNC 4POYA 1M1UA 4WGWB 4DGVH 1EPUA 2E4VA 4M1YA 4NBNA 5FI3A 3DTDA 2BNRD 1T1GA 3AFIA 3ZWBA 1BQLL 1OGTB 3U31A 1B8UA 2ICEA 5TK4A 1DE4A 2W07B 5AVYB 2CXPA 3IX7A 5ELLA 1MQSA 1PG2A 5I6OA 3WQBA 3OQ6A 2IYYA 3MAWA 1A4UA 3B1TA 2QLFA 1TCCA 4DUGD 3WV4A 2NP6A 3CGGA 3AZQA 4EW1A 5EFIB 1E5BA 2JGLA 5CPFA 2P5YA 1OSEA 3SODB 4GQBA 8GPBA 4V1DD 4ENTA 3EG9B 4I8XA 2EG5A 3GCGA 2Q3DA 2FN3A 1NAKL 3I6SA 3IJ8A 2E7MA 5FDWB 1KC3A 4RQQB 2NV0A 2ZT5A 2HU8A 5I8CB 3WC4A 3WFDH 3FQYA 5J4YA 3IEPA 3JZAA 3II2A 5GQBA 2JWGA 3ZS9A 5A7FA 1KQGA 5I6XB 3S8WA 4RVCA 3CPLA 4ZSOB 3PQ5A 4D4LA 1NIAA 4RLSA 1VKNA 2DFKB 4K71C 5T4FA 1L6PA 3MMEB 5D2LB 5DC2A 1NNI1 1U0FA 4DP8X 3SF8A 1JLHA 3LBFA 5L3VA 2KDGA 4ZTEA 4FMPA 3AT8A 2ZSKA 3KT3A 1O6BA 3OT1A 4MROA 3CLEH 4RWEA 5DM2A 4P46B 3HXPA 3BDVA 4FNRA 3CFQA 1PNVA 4YRKA 4N5HX 5FOJA 4JCCA 2OQRA 3HZOA 4ONOA 4QDKA 1IZYA 3NHUA 5GRVL 3DQQA 5FFGA 2YIVX 5IU6A 4GUCA 3D2CA 3GLKA 5PNTA 2FWSA 3BSYA 5GV8A 2IODA 3WEAA 4PVBA 2CMFA 4G80A 2QZZA 2W6PA 2WKQA 2ZRBA 4IOFC 1RQNA 2XMZA 2X10A 4M6ML 4DS3A 2V45A 5EEYA 4HDNA 3NGBC 3S2UA 3T9WA 3E80A 4Z3HA 3K4AA 3SYKA 3CF4G 2J55A 3FUXA 5JNVA 3E05A 1JAYA 1U4SA 4FFWC 1RPTA 2CIKA 1T0MA 1EE1A 3RM3A 4O4HB 5FOBA 2OBMA 2XPZA 3CH1B 1DO6A 4YAJA 1BBDH 1PFWA 2HXGA 3QLVA 1EANA 1ONBA 4C9BA 1NFDA 1AZBA 2C3VA 5G5DA 1BV8A 3B3BA 2CL5A 4KE6A 2VXQH 1AUXA 3CSSA 3R18A 2V7XA 3QJZA 4MNQE 3A4VA 3NOIA 4WEBL 1LPOA 2V2TA 2FPLA 3FVQA 1Z2DA 2Z93B 3FU8A 2A5DA 3RYMA 1OEZW 3CR7A 1GZ4A 4JANB 5K3EA 2ZRDA 3ASNB 2QVKA 3Q9QA 1A7JA 1FUYB 3D6HA 3UGXA 3TB6A 2ZWLT 4HKBA 4TMYA 4ALMA 5U1PA 5GS0D 4FD3A 3U0WH 1IAIH 4BMCA 1SFHA 2ZUQC 4Q39A 2DAPA 1WVGA 1AB5A 1E9EA 4OOEA 2IW3A 3IB4A 4QRSB 3FG9A 3O82A 3MLTB 1MPAH 5DK4A 4Y9SA 1LO2H 3WFZA 4KACA 4QFDA 4B6EA 3R8QA 4D3YA 3WKDA 1ZS2A 3WJMB 1X7HA 3KB1A 4YRIA 4DKFL 2JS7A 1N8SA 4BH8B 1E96A 1UF9A 1YJDL 4E09A 2Q10A 1U94A 1FNSH 3IVMA 1CFJA 2X2UA 5EN4A 3VU8A 5FO2A 1I7TB 2ITCB 2DWXA 4KU4A 3SP1A 4IBWA 2YD0A 3N1GC 1RWQA 4QRBA 3IAM1 2KUTA 1QO0A 1QOKA 2CNOA 2R1XB 5E2UH 4YHOL 3MN1A 2DW5A 2NY3C 5L4LA 4Z9BA 1QLWA 4LNRA 4Y5XC 2AVNA 3FKQA 3RWDA 1WAPA 2FK9A 3S5JA 4R7DA 1FNLA 1L7MA 3PZRA 2K9FB 2YHAA 3OPQA 5IFHH 1BGWA 2ZI5A 3NRBA 1YMQA 1ZN7A 4G7VH 4C7OA 4AM0B 1ENZA 3MJEA 5FA8A 1CUUA 4EITA 3QJXA 3EPJA 1A96A 4O4LB 4DA8A 3MCKB 3SQOA 3EVZA 4JLUA 4BBZA 1P2CA 2PO7A 3GNQA 5DKFA 5LGHH 1GRQA 1OZUA 3FNKA 3BS4A 3ZK9A 2XIIA 4IVQA 5EZLA 2WFMA 2O54A 2CCJA 4MNGB 3KQSA 1AI1H 1X1BA 1WFNA 5M04A 3A6BH 3CDFA 1A6ZA 2PQMA 1S01A 5E0KB 43CAB 1YEIH 2OYSA 1SUPA 4RHEA 4YV1A 3I1JA 1I7UA 5FUZH 4UYPA 5BO0D 4ER0A 1WVZA 3RWIB 1FZMA 5KNBH 5IQ9B 3WLBA 1TQSA 4DRZA 4KMMA 2IXEA 1WPCA 1FZKA 4G3YH 4NI6A 3PL6B 5JW4N 2DFDA 2AMJA 5LKRA 2JFWA 4JQOA 4R7NB 3QWIA 3BP7B 1MH5A 2RJMA 2VJLA 3RZCB 5IV2B 4MHOA 5DXAA 3ARUA 2CDEB 1Y18A 5SY6A 3RVRA 1AGFA 4L4JA 1IUPA 2FWJA 3M6UA 3WLNA 2V0CA 4F7EA 2XZAH 5CM2Z 2QQ0A 4ORGB 2P5WE 5CCKH 2F5AH 3UZUA 4JN2A 3W2DH 1XD9A 2RKOA 5DEOA 2AVGA 4BXSV 1UWKA 4H4NA 2WKOA 5MEOA 4BUJA 2CL6X 1FMFA 3AB0C 521PA 3U40A 4FFWD 5E7JA 4I3HA 1XEWY 2GY7B 4MZDA 3QNMA 4UD2A 1IUZA 3BP4B 1BIFA 4EY8A 2E46A 1GILA 2WYZA 2PRIA 5LOVB 4XB8A 3P9ZA 2C26A 2A0WA 4WGKA 4MV8A 4M62H 3IVXA 4LV8B 1HI6A 1UBTS 4LL1A 4EBFA 4M00A 3F3YA 1OY3B 2F1IA 3JAKB 1R0RE 4K7PY 4QXTA 3EPRA 1UJ3B 3EJJX 2CXSA 5FGSA 2YEZA 4JFHD 3HY6A 4IMLB 3DTVB 5CEZD 3WYFA 3JQ7A 1JVLA 4LNHA 5MGNA 2RGAA 1X5AA 3MCTA 2GEBA 3A7DA 2VHQA 4OCMC 3LZOA 1UWYA 1E79A 5DULA 1XCQA 5EE5B 3MTBA 1YACA 3P0IA 1NF8A 3G5UA 1RRGA 1ZW6A 2X4PB 3I30X 3S0PA 3PK0A 1NQUA 4XB3A 5DQDH 2FR8A 5E8NB 1YR8A 1A5TA 4G67A 4N5UA 1IOZA 2CJ3A 4K5NA 1JGLH 2I22A 5ALZA 4N9OB 5DXFA 5KANG 3SE9L 5IEHA 1QPPA 2O3UA 4TXNA 3SZMA 1KIPB 5HJ3B 3DD1A 3VFTA 4ICIA 3SQBB 1R7RA 1I31A 3Q2IA 3ZVMA 5MERB 3R7SA 2B1QA 4XYEA 2AGJL 4WZBE 2XQKA 1RUPH 5EEZA 1KIAA 1FU4A 5FL7A 5LR6A 4ACPA 4TUOA 3QJUB 3P9CA 4Y1SA 1XXFC 1NW7A 2ADOA 2ASEA 2ECQA 1D5ZB 3ZL2A 3VXRB 2Q1XA 2IXFA 2OSLA 4HV8A 1AQ8A 2ENUA 2HU2A 4ZVUA 1T21B 3H3BC 2WOOA 2WJYA 3KQLA 3M8KA 4AYFB 4YBZA 2JBHA 2ZCZA 3GJ3A 1HQ4B 1T4CA 4XGRA 1ZM9A 2IHZA 4B9GA 1X8XA 2FQEA 1JBJA 1GL4B 3GCWA 3DT6A 1T29A 3E2HC 3RG8A 3ESRA 4Y4HA 1OE0A 1B93A 5DLQC 4EJMA 5CXPA 4AEEA 1W1UA 1L5KA 2VJ0A 2HLDA 4BZWA 3UWMA 3O45A 3EVGA 4ZANA 3P40A 1M1XB 5E5LA 5JAOA 2ITCA 3SE6A 3AG4B 4F33B 3MRQB 3A4NA 4ZXBD 2EXYC 4X6BB 3MBXH 3QWQB 1D6EA 3SEPA 1Y98A 2FZWA 3AM4A 4X6CE 4XO5A 3X12A 2H6UA 1EFVB 4UARA 3GNSA 3F8SA 4TLSA 3W79A 3L17A 3KWLA 2H1OA 1CL7H 2CDAA 3HU5A 1Y3HA 5GONA 2AKYA 3S3TA 3V0WH 2F53E 3QPWA 4YX9A 4ONGL 3DYOA 3SBWA 3HNSH 3I3SR 1DEDA 3GLFB 1Y8QB 3MRKA 4BNZA 4P3WA 4KQ3L 1BVRA 1SHKA 4PC2A 4RWYH 1GUDA 4X6XA 4CBPA 2APBA 3TKYA 1POXA 3QJQB 2GZAA 3GZTB 1AO7B 2XAAA 4G4SO 4CHGA 1VJ5A 3TD2A 4YSQA 2KMWA 4YJZL 5GRUH 2ICWA 3HZZA 1ZVSB 1KJ2A 4OAOA 1U2DA 5DRYA 1T3GA 2C2YA 1IC0A 5D7EA 1DOAA 2XNKA 4WHDA 1J0KA 2NN3C 5BUQA 1S9VA 4XD2A 1LQSR 2C83A 4QRDA 4LIQE 3LUBA 4NZ8A 4L74A 3NNDA 3GAAA 4XPFL 4B47A 3FMGL 1QACA 1EAJA 4AM0Q 4OCXL 1N59A 4B3CA 1B2RA 3CVBA 5DCUA 1QR1B 5INTA 1H2BA 5LZ4A 3QSGA 3RNQA 2YJTD 1YZNA 1VXRA 4B9FA 4LSVH 3DL0A 4RGVA 1ZJWA 5EF1A 3L54A 3BKMH 3WXVL 1NXOA 5DR5L 3BL8A 1USVA 3P2OA 5LDGA 3RVVC 3QIWB 2QR3A 1IFHL 4X1YA 5BNXD 5FO8B 3DO7A 3P52A 1EERB 4PUBL 4NKDB 1ZI9A 2ED8A 3OLDA 3OU7A 2CJWB 3N0AA 5EQTA 2XRYA 3MXWL 1DO2A 7PAZA 3HKEA 1LK5A 4GXQA 4LPVA 4MGEA 2KQMA 4UNSA 1NFRA 1PL3A 1AGCB 4NRXB 5FKAB 2D03H 3CPUA 4L2YA 1LVUA 4Z95L 2D13A 1FSKB 1DFXA 4F11A 5DIZA 4KPHL 3L7JA 1P2VA 3WWEA 4K26A 4UTXA 4DOHB 4WAUA 4KG7A 4FCVA 4PJAB 1TK3A 5JA8B 3DEYX 1I4TD 1QE5A 5AM3A 3F6YA 2WTUA 2ZP9A 5ACLA 4P5DA 3L4CA 1G43A 4HIQA 2BZCA 2QF7A 3OVMA 3BZBA 4MB2A 2P9JA 2A9MH 1Y7TA 5DGXA 1OGSA 4DRXA 3JSAA 4MXWH 5JTTA 3D0LA 3TZCA 1VMIA 1WPGA 7YASA 4RDQG 2C5BA 1ZGHA 3EHBB 3VXOA 3RSCA 1ADFA 4OZGF 1QSFE 3K73O 4JR9H 4MCNA 2IYXA 4EHLA 1A3QA 5KQRA 3GRVA 3GKWH 3AG3B 3P2DA 1L5NA 4HWUA 1SUCA 1NWPA 3BDIA 1AGRA 2WD7B 2VF4X 1GTNA 3LV3A 4HTFA 3OPZH 3SGDH 1W5AA 5GGUA 1PYOA 2JASA 2JFZA 3PWKA 2ID4A 4U7MA 5IC5A 3GQVA 2R25B 1I8IB 2J3JA 4NNOA 5IMOA 4E14A 4PQXA 3GUFA 5K39A 3LIIA 4KODA 2WF6A 2COVD 4I0KA 4K8RL 4QKXB 3T5PA 1Z4QA 3NTLA 4KQ1A 1HNNA 3T9CA 2GSIA 1JLRA 3AL3A 3UIEA 4F3KA 5G4LA 5IHZB 3V42A 3VC3A 4MQFB 3ZK0A 3SO3C 3OKMA 4D5GA 1LC0A 3HL4A 4OF3A 1UPAA 3ORHA 2HIHA 3KQWA 3QUTA 3PNKA 3R7FA 1GNTA 4K7PX 4XYMA 3NHBA 2AOUB 4QVKA 1UD2A 1XA4A 3OT1B 1KAOA 1H0DB 2I69A 4X8JA 5EHNA 5IM5A 3QOYA 3NPMA 4HF7A 2UZIR 3FTGA 3UBHA 2X76A 3CVHL 2AN4A 4CKBB 2EXWC 4K86A 1JTEA 1B3JA 4PRID 2XZDA 4R3WA 2Z1MA 1MX1A 2B9BA 2H9IA 3C39A 3LNCA 2ZQYA 3OR7A 2LABA 4P3DB 5I73C 4WFED 3ANNA 1FRGH 1CE1H 3GRBA 1YR3A 1NFQA 4WKZB 2JCCB 3PNYA 4A8JA 3W5MA 4FU0A 4HSAC 4GSYA 1E77A 3QKWA 4YDVB 4D41A 4BJ3A 1KI7A 2KJQA 3U7GA 1HK7A 4GKNB 1T03L 3IDNA 2D3NA 4FYTA 1DBPA 4RISH 4L5YA 4OKIA 3I9NA 2E5FA 3D1LA 1OB1B 2BSSB 3EFOB 5FUXA 3QO0A 4W6ZA 5D3MB 1ML3A 1ZK0A 4GYBA 3H7BB 4AQ1C 3QI2A 1WD8A 1EBUA 1Z6YA 4MHSA 1H3VA 5FYKD 3IUPA 2BVTA 4GMGA 4XI5C 5B7NA 5JSHA 3B9RA 1X5IA 1YEJH 4APQB 4KPUA 5FHRA 3FUIA 1KXVC 3BO8B 5K9ZA 3AF3A 4EN2A 4IU3B 3SZ3A 1A6AA 3KSZO 3OQNA 3HKBA 3M81A 1NV8A 3SYOA 1VFPA 1QMUA 2ZCKH 2P9HA 4X80L 2OMTB 5JNTA 2JWHA 1T20A 2HRQA 5EBLB 3R06A 2W8ZA 1P3Y1 4AJLA 3QEHA 4O2AB 4C1NA 2NXZC 5IGXH 4YMUA 3L7FA 2ADGB 5HI3C 1GTSA 2NO1A 3R0IA 3PAUA 3AABA 5C07A 1RHJA 2W59A 1TYCA 3LO5A 3QU5A 2A83B 4YGXB 2JNZA 4DLPA 1QBBA 2PUAA 3ZQKA 4M53A 2FKAA 1TT7A 3ADKA 4NPAA 2RI6A 4UE3S 4TS9A 1EFXB 1DGQA 1OASA 1UHVA 3VH3A 5C0EA 3TM4A 5IHBA 2JGRA 4XWGH 1UJ4A 1XGRA 4HNSA 1Y1DA 3FMFA 1DN0B 3GRFA 3O6VA 3CVHH 5CYOA 4WFGE 3VKVA 5FOUA 2UYHA 4BZ1A 1CZHA 4JD5A 4OG2A 3AB8A 3OJLA 1IAKB 1QCDA 3KZXA 4A8JC 4YP0A 2JIPA 3CN0A 2PWEA 3OE7D 2G1UA 2NVUB 3AQIA 4PYNA 1CC1S 1KNXA 4MUXA 4A2HA 1FGVL 4HAOA 3L3DA 1RCFA 2R1XA 1UANA 3OHMB 5A4MS 2Q1SA 2GFIA 3ME5A 3ONDA 2EBWA 4MGXA 3KYCA 5J5AA 2NAFA 3C16C 3NGXA 3RVPA 3DO8A 3DBHB 2JEYA 5AW5B 2JC3A 2VT3A 3UGQA 1T13A 1SC9A 4QGSA 4NRYB 4MQMA 5C08D 3PGFH 1I36A 2I55A 3FN4A 1BPVA 1VJ0A 1MW8X 2DG2A 3OOEA 3ADBA 1SEBA 2XPCA 3VSBA 4LLUB 2F9BT 1DP0A 2DBLL 4QYIA 1KQPA 3TXXA 4IRZA 4H1VA 3NAAL 1R0XA 2ONZA 3WLMA 4JENA 1R27A 3OE7A 4RIEA 1T83A 3D0AA 1G2IA 5FK9A 4ZICA 4B82A 5A04A 2PH5A 5FCUL 2XDQB 3IDXH 1BPLB 1IJNA 2WBWB 5CB0A 1BZOA 2F3UA 2FPGA 2AEPL 2GAZB 2V97A 5ETUB 1J5IA 4W4NA 4DP7X 4FOMA 1EXWA 2CDBA 2W0PA 3CDCA 1JZSA 1QH1B 2KQNA 3DV6A 3NWJA 4JO2H 3WIHH 1M6WA 3DONA 4JX9A 4N0FA 1BSVA 2IOFA 2W65A 4JU8A 2NUPB 3L3KB 1N18A 3LRSA 2ORWA 2P28B 3SNHA 3MV8D 5EH1A 4AXBA 4LKCB 1ZVYA 2K7FA 5HHXH 4QPZA 5IBRA 3QU4A 4E9YA 3ZV7A 3C5VA 1F5NA 5GGRA 4G41A 1W36C 2Q2EB 4F7EB 3K4PA 3QT2A 4EM6A 1AU9A 1ZLWK 5JW4M 3ZXAC 3TN0C 3HE6A 3OPVA 2YCLA 1Z6PA 4WGFA 3JTBA 2DT5A 1CFNB 1YZZA 1WWWX 4LNVA 1E1KA 4KZEL 2P3YA 2AV6A 4I1PA 4LJAA 3ALWA 4J1QA 3QVMA 3THMH 1Y1PA 4MI9A 1D5BB 1KXQA 3RI5K 4P2QE 5IREA 3CZSA 2WSDA 4X45A 4D74A 1ERNA 4KO6A 3FE2A 3NANA 4JLAA 3S2GA 1CICA 3RC8A 1GPKA 3MA0A 1VJSA 2EFYA 2PIAA 3PWNA 5TDNA 3C6XA 2J9ZB 4H6XA 2SICE 4BH8A 2IWHA 4DUZB 5I7WA 5J89A 1IVLA 2PXHA 3BH8A 5EC1A 2ESVA 4C5BA 2JXMA 2CLOB 5EJAA 2FO4A 1DVTA 2XQIA 4I4WB 2ZWVA 1PU0A 2EAEA 1FYTB 1JZDC 3QIWC 2GQHA 4EO5A 2QNRA 4P4TA 3TONA 4JBYA 2B4CC 1OI4A 4IMKA 2VO8A 2OSVA 1XSKA 4JC0A 3WY9A 3G8YA 5LBUA 5EB9A 4AF7A 4ZMPA 2Z7YA 4BE4A 3TPFA 1Z9OA 1WWKA 2QRVB 4IOSA 2RBGA 2IDTA 1A2QA 1P0PA 1Z0JA 8FABA 4LLAA 2H0EA 2E74C 3A11A 3PPVA 3TEJA 3KM0A 1ZGBA 3EPHA 1C1EL 4Z4QA 5MENA 1NXVA 3O41A 2QSYA 5IABA 2ENQA 3GPEA 5E8NA 4QBIA 1WUHS 5F21B 1FRNA 3DVLA 1BFTA 1RIIA 1SKMA 2HYDA 5TE4H 1HRKA 1IUKA 1F86A 4HWKA 4Q7LA 3UADA 5C9JA 1OFUA 2LCFA 5I8OL 4ZD6A 4JZNA 4QYTA 3UIYA 5TSDA 4OB5H 2B5IC 1T43A 3HJFA 3EUAA 5A02A 4NBYB 2CMGA 2XWPA 2L19A 5K03A 6REQB 3VMPA 4TM9A 2YW9A 2PCXA 1Y5RA 3MIZA 5DX1A 1EQ2A 4GI1A 2ERJB 1JGVL 3ZTJG 4WO4D 3ETGA 1VYVA 2C2WA 2XNAB 2O8NA 2VR3A 5E2UL 4JHWH 2YUWA 3HCPA 1DJGA 2VNAA 4WWPA 3MREA 5EGSA 4TTIA 1NJ9B 1FI8C 1TETH 2ZVPX 5EKDA 3PHQA 3X1DA 2H8PA 3PUUA 1L7XA 1WSBA 4DSNA 3AUFA 1T4BA 5IDQA 3U6RA 4A2MA 4IOFD 3PP4H 1A5BB 4LA4A 1UXSA 2OJZH 1N36B 2VOJA 3LX4A 1T0HB 2BZSA 2QRKA 4S1RL 3SYMA 5BN4B 3QK0A 1TQCC 4HWZA 1JSCA 3KPPA 2WQ8A 4M7LL 1JZ6A 5BOSB 1X13A 1Q0XL 4WVFA 5JZBA 1QRAA 4YSOA 1IGFH 4QXWA 3KOOA 1C3LA 3FBQA 4TRRA 4KXXA 1AQDB 3BSZH 3FFCD 2ALAA 4O29A 4JFTA 4UTPA 5GY7A 2RAPA 3I01M 2ZTLA 1DSFL 1PEAA 2DWSA 4K6HA 1YK1A 1K0FA 3VWKC 1LBEA 2AT1A 4BBWA 5D3ZA 5I28A 1N92A 1UBMS 3WAKA 2JLBA 1Z7WA 2R84A 1XU7A 1IZ0A 3LTEA 1UWFA 1K3TA 2DWUA 3K72A 5AUQA 5L2KE 4WEBH 3MVEA 2Z91B 1MW9X 5D2CA 2FWBA 2K6GA 5JNLA 4DV1B 3VRLF 4M1EA 2I66A 2X7LB 4Q02A 3T09A 3TTUA 1QMPA 1UC8A 1I24A 3VCLB 2CVFA 4U7TB 1KEVA 1IAII 1TF7A 4XNYH 1LSOA 4HBGA 3QE0A 3O1IC 4MJ6B 1QX4A 2EDBA 3TBKA 3ECQA 4DPKA 1V5WA 2GJAA 1HT2E 4EW3A 5JOEA 3TJMA 3A37A 1Y6GA 1B26A 1JLMA 3KLMX 2XCRB 4BVEA 5BN1A 1YFKA 4XYBA 3VX4A 4QVIA 4PJFB 5A2KH 1H19A 5DJZB 3M70A 1N7IA 2Y2WA 1ESOA 5T5FH 3VXPB 2P7TA 1AA6A 3I2KA 1MH1A 1I1NA 5I0YA 2CK0L 1T24A 2CPUA 3DMYA 2WINI 3X3FH 3GP8A 4PTYA 3AHFA 3GJSA 2PWHA 2F43B 2Z09A 1Q44A 4AX4A 2GM3A 5ADWA 4MSWB 1GSAA 2VRBA 3CUKA 2YSSB 1AG0A 1PLAA 3U46B 5CW2A 2AQQA 3D2AA 4OAWA 3ZC3A 3MCG1 4MS4A 1E7WA 3KQPA 3KS0J 4CQLA 1JYEA 3F6LA 3AVTA 5DX0A 5AB0A 2VXOA 4KVCH 2WR8A 1TZAA 4J07A 3L6EA 3VR5H 2FJHA 2JK0A 2JKSA 3VRJA 1DSWA 1YQVH 4ND1A 2YAMA 2WP0A 2WPDA 1UD8A 3UV3A 4E3WA 3PE4A 3VACA 3P7MA 5ESVB 4B3IA 1PJAA 2IOIA 4NCC2 1LX7A 3DETD 4HRXA 5E2IA 3QQ4A 3JWOL 3L9WA 3WNNA 1YDWA 3GU3A 2VSMB 1IWPB 4P5TB 1W93A 3OJFA 4HLUC 3MRDA 1MAVA 4OGYL 1X2EA 2FH8A 3UDWA 2IWGA 4N87A 1NC4D 1MC4A 1Z36A 3MRFA 1U8IB 3RGBA 2ZAIA 1EBBA 4IS3A 5B1AB 3ZPXA 1N78A 3OIFA 1WFTA 2H9AA 3V9CA 4YCLA 4FDAA 1WB5A 4RETB 1VZHA 4KUCF 2P9ZA 4YQEA 2I76A 1XZHA 4ISVA 2PKRA 4CFZA 1KU6A 5JATA 2MHAA 4WI8A 2EVWX 1AC5A 3A3NA 4C2UA 5D9SB 4YR9A 5D1XA 1P2FA 1SVMA 4N2LA 3F6BX 4F33A 1WSDA 1L3IA 2KLHA 4JN1L 3Q44A 2BFDB 5F1KC 3B2MA 4ZCMA 3QENA 2GK0A 1LSSA 4IDEA 1THCA 3HW7A 1Q1BA 2W0FA 4G9FB 3UABA 4MLIA 3MWFA 4OQLA 4H60A 5BRQA 5JAUA 4DC9A 1QHHB 4QOFA 3LKVA 2EQDA 4JWKA 1D3CA 4BTLA 2XUWA 3EGDA 4AJNA 5C3IA 3W4JA 5K0NA 2PE5A 4HFWB 2YXNA 1DDHA 4WDRA 2K2QB 4I18B 4UKDA 3DKPA 3IQDB 5TPZA 5JWHA 3UCEA 2JEZA 3CINA 4RVNA 4MW6A 4GEJA 3VR4D 3FB8B 1TO4A 5A05A 1P33A 2VAPA 4Z9AA 5AW1A 1RWPA 1O97C 3DLBA 1U8QB 4L29A 1O96A 3OA2A 3KVYA 1RQ2A 3R77A 1XZIA 1TCRB 3OMIB 2VDPB 3CPJB 1OBCA 4IM7A 1RIUL 1A1MB 1MO2A 5A03A 3Q06A 2J7LA 2O8EB 5EPMB 3OPMA 3QWRA 1QR6A 3QBTB 4NSKB 2ERYA 2FPIA 3FU3A 2Z1KA 4N2BA 2GYYA 2FMFA 5KTNA 3L45A 1QH8A 3E6FB 2A9CA 4Q9JA 5DYOA 4LLVB 3EJYD 4OH7A 3H6KA 2CNBA 2Q2LA 3QSKB 4UHBA 1RJCA 1JR3A 4CKBA 3LOWA 3FF4A 3A04A 4XNZB 1EB8A 4B48A 1YECH 2PPLA 4Y5XB 3EEYA 1KGCE 2C7GA 4FAAB 3UTTE 3F4KA 3GHEL 4ZMTA 1PY9A 2C9OA 3I6KB 3FQRB 4C7BA 1TTUA 1J0JA 1N32B 3Q8WA 3NFNA 1B6GA 1D5CA 3ASUA 1LP9A 4QIHA 2W2QA 3KFXA 1KVQA 5CZXC 5E1OA 1PJWA 1XZBA 2XIJA 5CHNB 4ZQTA 2UY6B 2AYXA 5I5MA 3T0EB 1OB1A 2BSSA 5IB2A 1W48A 3EXFA 4JGBA 2YJ3A 3QY0A 5KJ6A 1TUPA 3N2IA 3T3HA 1LRKA 1L5HA 4AZTA 1XDUA 2BDTA 5KZCD 3PHOA 1G4AE 1CX9B 5DZSA 4KW7A 1DT3A 1PR0A 1MAKA 2AX3A 4DWWA 2V7NB 2V5YA 1CICD 3Q5OA 3D50A 2OD7A 3VYRB 1VLHA 3V7MA 2VEDA 3WO4C 5HQ3A 3ICVA 1EO5A 4GGOA 2EC8A 4JPWH 1XVAA 3KHUA 3MMZA 2B9VA 3QIBC 3AS1A 1HZHH 4EDWH 4TM8A 5HOQA 4LPKA 1AQMA 1BA9A 1R3HB 4AQ7A 3DMTC 4IIQC 2Y1YA 2HFEB 4PSPA 4R4BB 5K0EA 4PQFA 5CX1A 1T6WA 2ED9A 3WRXC 3PV6B 5M29A 2X2OA 4D0LB 4IXTA 1XAHA 1BKDR 2ZXWB 4RF3A 3KMDA 3DPDA 2I6TA 2Q07A 2PX4A 1RJFA 2OZKA 4PTUB 1F13A 1KB9J 1SJEA 4K3JL 2DIAA 4EP1A 2R97A 2JAPA 1QDLB 2EIZA 1V54B 5TQJA 3GUHA 1M6HA 2QZSA 1QFUL 4OZHE 1Q9OA 3IDIB 1W34A 3JV6A 4FE3A 1PYGA 4DY4A 5AW7B 3R0JA 2AF2A 4CDMA 4F8EA 2NMVA 3O6LL 2HKAA 1WCYA 3Q8AA 3ZWPA 5ECGA 2WXPA 3HH8A 2OBFA 4H3KB 5EU3B 3AU8A 4TL9A 3QMWA 3GNML 2RGNC 4DQXA 4LDRA 5D6CB 4OZGB 3E7XA 2VDPL 4PAGA 5DMHA 2IEZA 2VLRE 1Q1GA 3D4CA 3OEHD 4GOLD 4JJGA 5DTEA 3IBEA 3BN3B 3O6KL 1WHSB 2I25N 4DCPA 1JK9A 3OWHA 2VGLM 5B36A 4K3JB 2G72A 4P46C 1AUPA 4MXVE 2FH6A 1F0KA 1P1RA 2DPKA 4ZAKA 1AXTH 4WFHD 2E2WA 1E4XH 3C15C 1E8DA 4N5EC 2RJ3A 2YGVA 2JARA 2J4CA 3B52X 2HKHH 1ETB1 5DZAA 4K71B 5ICXA 1BX1A 2CGRH 4NZJA 5CH8A 3WVNA 3MLSL 5MHSE 2R1VB 2XH8A 2Y9RT 1NCUA 3EIEA 4H0NA 3WIUA 1NF9A 3VR4A 3G85A 3A31A 2CQVA 1ZQ1A 3CFDA 4BJ5A 3WO3B 1MSPA 2YY5A 5H5JA 2I67A 2OMNA 2BNQE 4FNSA 5CLJA 4WV1C 4NENA 3EO0A 1B16A 1FH5L 2QVBA 5C0NC 4K9EL 4O4LF 4D0RA 3HGMA 4B95C 4A4DA 4WI4A 4ETYA 5IT9A 1VADB 1B14A 3IE2A 4F8YA 1EGJH 2XKNA 1D7FA 4ALKA 1UA3A 2V7HB 1THZA 4G1BA 4N6OA 5DGIA 3GIWA 1YY8B 3FI9A 2QR0A 3FW6A 10MHA 4EA6A 2BX5A 1CUCA 4XGKA 4AKGA 4WW2F 2HPAA 2WMPA 4PHZA 1A04A 1JI0A 5A3VA 3UAYA 2DUNA 4HKBB 4YPOA 2PWZA 2HZ7A 4ZREA 1ZWLA 5LD2B 3KKMA 3ST7A 3BTUA 1UFGA 4RD4A 4PFEA 3ZVLA 1BE6A 4HFWA 1I3MA 2EZ9A 4M8LA 1F8TL 4QRSA 4P3XA 4EL5A 1UM8A 1EH9A 1W0KD 5JVDF 4DJFC 3VPSA 5BS0E 2OSYA 1C0LA 4G0OA 1WZNA 4TL7A 2FBRA 3BPCA 3WJMA 4EVIA 2Q8QA 4H0GA 4UBMA 3L6DA 2B8TA 5C8JB 3W78A 5FNVA 4F2WA 1UBEA 4OQFA 1U0SY 4IRSA 1MKYA 1I8MB 4BB0A 2YARA 4MLDA 4BYMA 3CHPA 1E6MA 4OGAD 4KLNA 3VGAB 4Y0AA 1C9DB 1F8TH 3WHIA 2I7VA 5KBDA 1KIFA 2A1WH 2ZUEA 5HYSG 4N6RB 5HJGA 1NTOA 1BVKA 3ODPA 5JYMA 5B38A 3W90A 1ZJ6A 3IA7A 3U61B 3TLMA 2PR9A 2TRYA 1KH3A 5GZ1A 4GG1A 4BFWA 1I8LC 1DANT 4FKMA 1OAKA 5CBEB 1YNTF 1PX3A 3KYIB 3ETJA 1SCKA 3VYNA 2OV2A 3J2PA 2Q28A 5ILOA 2RHJA 1BRTA 3K94A 3T1TA 1E7VA 3HWSA 1U21A 5EHIA 5G53C 1ZESA 3Q7IA 4OTXL 2P7HA 3PNMA 2X1WL 5CK4A 3G8BA 3UGEA 3ICEA 1Y6KR 2PR7A 1CR9H 4L3EB 4GAYB 2JIQA 1PLKA 1P5HA 5C08E 1MVUB 5B1DA 1RK1B 1NCIA 1IZ8A 5J12C 4XX0B 3FQWB 3F83A 1SXGA 2P49B 4G84A 1ADGA 2RGGA 4PXAA 3LFHA 5K2OA 2IO5A 4YLQT 2ZSHA 5JIIA 2YUZA 4NF2A 4QYIB 3VPFA 1VZIA 3JWNH 1N6RA 3IP7A 3HG7A 1FNBA 2EKQA 2YPKB 4TQPA 3LKZA 1I7ZA 5C7XH 1ZUNA 4OK3A 3D8SA 2NTEA 2YPLD 4M02A 1TKRA 1IX2A 2QNIA 3T3IA 5CUQA 3EIOA 5IMKA 2YVQA 2FPOA 5COBA 1XLTC 4CTOA 3Q7EA 5KJEA 4TLEA 2IUUA 2ZZMA 1A3LL 2NZXA 1RWKA 4LG1A 1ZSHA 2DERA 4HNVA 2B1OA 4PZZA 4G01B 1CDZA 2GJPA 2ZJSL 4LXGA 3JT2A 4UQ2B 4TS4A 4QEZA 2F1OA 2HJHA 3BP7A 4YV0A 3P4NB 1XMVA 5DLMH 1KXTB 1RCTE 3KS9A 4UXJA 4DHEA 3RX5A 4DMGA 5CGYC 4DUGA 4JLVA 2OXGB 5ALCL 2BCEA 3IPCA 2MSLA 1QGAA 2XZCL 3TSAA 5BT9A 3ZWOA 4YRGA 5JJBA 2N1MA 3QLVC 4HWZB 1AZWA 3EXHC 4HJRA 3QHAA 2IYLD 2QKIB 3W11C 4EOWH 3NHWA 3PGDB 1JHUA 1WW3A 4E5MA 3RVWC 2HZBA 4YHPB 1CR2A 4F72A 5ILGA 3L4XA 1UC5B 3NRCA 3RBSA 2HNKA 3B5HA 1UB5B 3LIZH 1HWHB 1VB5A 3N0TA 5EU6B 2VQ1A 3HI1B 1KXZA 2HG5B 1A64A 1CHDA 1YV9A 4LSGA 4J6EA 3VI3E 4J6FA 2VS1A 4UUNA 2F8SA 3HBAA 2JHPA 2O48X 4PF1A 2YZ8A 2GAJA 3OH8A 4OFXA 3TLRA 1Q9KB 3K0BA 3BJ91 4LF3A 4HRAA 2I3BA 1M2OA 2VL4A 4EIUA 3TVYA 2B1GA 5D1QB 5JHLL 5CJXC 1ACYL 3AI3A 1KBQA 2Q3BA 1G42A 3M6XA 2FOXA 3F12B 4DV5B 4LNUA 1Z4KA 2IQ5A 5DK6A 2XCIA 3FPCA 4ZAKB 4W9HC 5B7MA 4KZPA 1NPDA 3O3DB 1V5IA 1F6AB 1XEXA 1CKEA 2GD2A 2O6LA 4DT1A 1RR6A 4EJ2A 5PGMA 5TPWA 1TJMA 3WKCA 3GLHE 2QRVA 1OTHA 3EZ2A 3WK4A 4JKWA 1QQ7A 4MKRA 1ZN8A 2FP4B 2UUDH 1FYTE 3ZHYA 1R88A 4WWKA 2I2BA 3NWBA 1HQDA 2W9LA 3SFZA 1LNZA 1SOAA 3EB9A 1S5IH 1MHPL 3QRLA 5E4EC 1USWA 3D8TA 1CD1A 1KCKA 2BNQD 3IU4H 2DMRA 3C43A 1DJXA 3TW8B 2PFGA 3CNEA 3HBGA 4Q03A 1U7OA 4W8OA 2Q1WA 4XCEB 1XMXA 3IURA 2FX9H 4PRIA 3I23A 3AHIA 2VUYA 1G3QA 5K5YA 2PL1A 4X7TB 2QZ5A 2WKPA 4R0NA 5ENZA 4N18A 3RRQA 3ZQXA 1GRNA 4WY7L 1NBHA 5SWSA 4D8YA 2LRHA 1S7RB 3OGOE 4EUKA 2ZUCA 5ALPA 2ORBH 3GSQB 1BX2B 1VP3A 4FINA 5FWYA 3PRKE 2QQNH 3OOSA 2GAAA 1GZHA 2NY5L 6CGTA 4JEMA 4DJTA 2E9BA 1XXDC 3PLRA 3LY7A 1N9GA 2XB2A 3D8BA 3MRIB 4FHGA 4E70A 1S5IL 3CX5K 2E4TA 4XWGL 1Q1PA 5DEIA 1MLDA 3TA4D 4V03A 1F97A 1EEQA 1ZA6B 3NCCB 3RC1A 4MMYA 3G2OA 4HSQA 5C86A 1DDTA 3ZCRA 3U7JA 3UAOA 1EAYA 1Z26A 3MACL 4GW5A 1A69A 1XR8B 4EO9A 1G21E 1DMSA 4XNUL 4O0MA 4PJ7E 1F1BA 5HI3D 4FMCB 2F6RA 5DHVB 2QTRA 4GB9A 3V5NA 1P5UA 3DEZA 3QHQA 4OFWA 4N41A 1ZNZA 4LWOA 1BJMA 5E1MA 4X80H 1AO7D 5JHAA 5F7UA 1YZUA 4J0CA 3FFDB 5IY5B 1UXWA 4FBMA 3WNKA 4JJIA 4IY1A 3VDCA 2UDPA 1XV8A 3OKCA 1F11A 3E38A 5CMAB 3PWPE 4KN6A 4OJMX 3TCKA 4MYCA 3SCMB 3PS9A 2Q5BA 1OCRB 2HSDA 2IU4A 5UKDA 5C46F 3WGGA 3LY6A 3IJSB 2E7CA 4AL8L 2E7LC 4U9UA 5AENA 5EDSA 5ILQA 1MLBB 2AH5A 3A8TA 3WNMA 4TXHA 5DGTA 3NETA 2JIXB 1T10A 2HUNA 1BZQK 2ZE0A 4JANA 5ITZB 4TYNA 3MB5A 1KMCA 1G84A 2AUNA 3KBEA 1AGBA 4Y9BA 2H9GA 2YD4A 1N26A 4JG0H 1XVTA 4XYLA 4Z7IA 3DXXA 1MDBA 4H3HB 2UVFA 3IXTA 3FULA 2Q4TA 4D9NA 1ZT4A 3GXMA 4PW0A 3WDSA 3GLQA 2XPGB 4QYOA 5DZ9A 5A6VA 2WUVA 1U3WA 4PLJD 1BM3L 3P71T 5ED4A 4YLGA 4LCVA 4JR2A 4H1LB 1I7UB 1Y7IA 4MASA 1LO5B 1EE9A 3DAHA 1KNOA 1JI1A 4YIQA 1CIVA 3QFCA 2CY0A 4R84A 4OLWL 5C7ZA 2CRIA 4O02L 4H5SB 2IFFH 4KIGA 5EJ7A 1GGEA 2WQSA 3RHWF 1V3UA 2P5PA 1J1PL 1NICA 3AB3A 1OLXB 4WJLA 5FUQA 1ZDQA 3OFNA 4X1YB 1QO3B 2AI0L 1NM5C 1SC4A 2EQAA 1TU2B 4ZAGA 5CVTA 5F6IC 1UK7A 4AE0A 4MW2A 2I9LB 1NOFA 1ISHA 3MNZB 2ZRGA 3HBLA 2WXFA 4GS7C 2WV9A 1T22A 2Z31B 1TJXA 5F7WC 4ZDJA 4D8TA 1XIWB 5TFSL 1L0QA 5EOCJ 4OGKA 4MW4A 3MWGA 4H59A 4Q4CA 1TAUA 1J25A 1K8DA 3QR1A 1PLGH 4ELKA 5FTKA 4EW6A 2W6ID 2OESA 1Y48E 3OQIB 2EFCB 1JKJA 3NSDA 3B4NA 5H68A 4RKEA 3GPBA 4DEYA 5K99A 4MRAA 3VVVA 3DNFA 5IHXA 2IDFA 1CGYA 4UHEA 2IPTL 3K53A 1UOVA 2NTJA 4IFIA 5EU4A 2PKEA 1TXGA 4AQEB 1NGXB 3S2YA 1CXZA 5E9QA 4ARSA 5ADVA 1YB2A 2WJGA 1SH7A 2PR4H 3KLKA 1NTRA 3VR3D 3GUVA 1ZM3A 4X6FA 2YS4A 4I5GA 1NLBH 3MVSA 3N42B 1JHPA 1A9XA 2B8OT 3M7OA 2WD7A 1N7MH 1YNOA 5KSWB 2YEZB 3IIIA 3ZVKA 2W6ZA 3E58A 5DLPA 3VU1A 1ISGA 4B41A 4PJIE 4JFED 4CCYA 4C43A 2KI5A 2ZROA 5ERGB 4BKTC 4LXXA 3IR5A 3G08A 1XP5A 1FXWA 1QV9A 1RWMA 2XCUA 1VSBA 1G1KA 1OLOA 1ZGGA 1N4AA 1BVNT 1ZU4A 4ZA2A 2OKCA 4I88A 1J6UA 3KT8A 1ZT1A 2RIPA 5J5CA 4MQFA 2OPHA 1WDKA 1K7YA 3R9WA 4LGVA 2N1BA 1WS7A 2OCCB 5EHGA 5GGVH 3CXDH 2O2DA 4F4FA 4NJAH 1MA3A 5EA0H 1WWBX 4JLMA 5TJHA 1I0LA 5DR5H 3UTPD 3GEMA 5JAZA 1ZD8A 2EBUA 4CFSA 4U2CA 2Q8PA 5F3WB 4CVWA 3CLTC 2G28A 3GQFA 4HCRH 2FLBT 3KGTA 4LXYA 2X86A 2HX8A 2JB5L 4LGRB 5IEKB 1TSHA 3EZ6A 2DJ4A 4YHLL 3D7PA 4IX9A 3NP9A 3UICA 2DWCA 4M5ZL 5C0BD 4XMZA 1EQUA 25C8H 3HI6A 1XDDA 5F12A 4IQ8A 3UJIL 1JPFA 2C00A 1EIWA 2WG1A 4J3WA 4PGGA 4RO0A 1X1SA 4MLPA 4MDRA 4PV8A 2YXMA 2YXDA 4WOCA 2QM3A 3UJPA 1LFAA 4KC3B 2YHBA 1TLTA 4IOLA 3OFSA 1FLAA 2B3IA 3RAJH 4JLRB 1UKCA 3EGXB 1GA6A 1COZA 3TOCA 1VAHA 3H5RA 1I13A 2F54D 3CFDB 2R56L 1P75A 3ZE1B 1NKOA 4BD4A 5EZIH 1PEWA 3ERCA 4RGOH 3EA0A 4QX6A 5AG8A 1J1OH 1V3KA 3UAJA 5JAIA 2B3DA 1KPRB 5JA9A 4AMWA 2TSBA 1EHYA 2QHXA 3CU5A 2I29A 3ICOA 1EJ8A 1KZ1A 4F3CA 2CM5A 4W93A 4ARCA 2ICAA 4OFDA 4GXUM 1ILWA 4J3OG 5GJVC 3I72A 3S1LA 3SDCD 3UMTA 4DPBX 4EY6A 2IT1A 4H88L 1J1UA 2QW0X 2GUOB 3KOMA 3V4RA 2VJMA 1B0UA 3GMSA 4B6PA 3WE6B 3TEMA 4K8RH 1AY0A 4LY6A 3T8YA 1YQQA 5CHEA 3F7VB 4GUAA 4UU0A 4MLCA 1JK8B 3QBJA 4HMQA 1DQLL 2OGWA 2ZGVA 5JQ6L 1OH5A 3BPCB 1ZNXA 2HK6A 3UTQB 2WU8A 3O2QB 4LC0A 1KO1A 1H2XA 5CCJA 2WQVA 5J1TC 1FFSA 2BP5M 4L5AA 1M67A 5A3IC 2GLXA 2F1RA 3PPIA 4YJDA 5B7EA 3OBAA 2DYSB 2B99A 3RILA 3A27A 2IGFL 2VDNB 1GRCA 3WN5B 4P4GA 1K2VN 1OQXA 5GSRB 1HZLA 1J1ZA 5E1DA 3UHAA 3RB7A 4GQAA 2XZOA 4DZZA 2Z92A 1KHHA 3UO1H 3QIUB 4MD0A 3A3KA 4D3FA 2VM4A 1MIOA 2GYWA 3NABH 3PDUA 3E8UH 1URIA 3LUPA 4BNYA 4RGYA 1FYWA 3C60B 2NX5A 1L7PA 3HFFA 2ZIXB 2UKDA 1NC2D 1PKQE 3H56A 3UPRA 5B3AA 3CEJA 1EPFA 2OG2A 1IBGL 1R5WB 1MO5A 1DUVG 2BBTA 1JH9A 3KXIA 1IGJB 3PGCB 2W6CX 1GVIA 4ZMXA 4LFBB 1SMKA 3RS5A 2YN0A 4Y5VC 3TH2T 3VM6A 3RWBA 2XTJA 3NAQA 3CNLA 1LYQA 2RALA 2XRAL 3UKOA 1E8XA 1MJ8L 5FCSH 3LQZA 4KV5F 4B79A 4OBBA 3PJSA 2W0SA 3ECUA 3NJJA 3V52L 3NOVA 1AXSA 5JBQA 3MYRA 4RESA 5EERA 4IGAA 4ZDHB 1H6BA 4APXB 5AH0A 3L81A 5DHFA 1I1FB 4GAJL 5C4IA 2QUAA 3OJWA 2APFA 2IPKB 3IMEA 5CG2A 5EJ2A 4WFGD 4I2XB 1NVWQ 1SEQH 1HHKB 5E6IB 4KR2A 1KI6A 4F7PB 2OOSA 4Q19A 2YOAA 2YQ2A 2WPNA 4ZCIA 3VXTA 2D0HA 2EILB 4N39A 2XEXA 5FTWA 2DBRA 2Q9UA 4Z7OB 1VJTA 3FMGH 3HLAB 1KE1A 2ZXFA 3CVHA 4M8RA 4O2RA 2XODA 2YYAA 2GEFA 3HUJE 5IBCA 2ZWMA 4UANA 1WY7A 4QGAA 2OKGA 3IT3A 4KSCA 1T1YA 4ZPVB 3O8BA 5DWQA 4J3VA 1OC2A 1VPOL 5FI0B 3HBFA 3MV9A 4S1DD 1SF5A 1T1EA 2W83A 4J7CA 4PZPA 4J8PA 2JJMA 1QBLL 4PC6A 4MKXA 1XDBA 5HGDB 3RTBA 3ABZA 4QTUB 1SOQA 2JFUA 5EU7E 3IS0X 3E7JA 4BQEA 4WKOA 3JWPA 1U2YA 4P32A 1YMMA 5D7KE 2O57A 3HC2A 4ODBD 5FOVA 2X53A 5JW5A 5H35B 3U9WA 3FYDA 3BJLA 1ZHLB 1L5QA 4IFTA 3SSNA 3MLAA 4XP5H 1BQ4A 1WOYA 1NCCL 2NO0A 3OEHA 5IUJC 1JX6A 3RY5A 4UUQA 2B1AH 3ARYA 5T1LA 2JFNA 1TTFA 4HJ1A 2VF5X 2AFIE 3T8XA 4WUUB 1IN5A 4N6RA 4MV7A 4H2CA 3CFYA 1N5AB 3D25A 3VDNB 1ATZA 4FBLA 2Y68A 4OJQA 3C5ZB 2IZ1A 2FSDA 2BFAA 3VKHA 4PYOA 1Y42X 1X15A 1L7TL 2Z30A 5KVVA 4DZBB 3SX2A 2AG8A 2OJEB 1RJLA 2I6GA 3KELA 2HSGA 3C45A 1YEWA 3E3AA 3CHRA 2PM8A 4ABUA 1J20A 3H2IA 5CTAA 1COWA 1OQAA 1G63A 1HL5A 2DFPA 1NV9A 1BWPA 2Y1OA 1ZL2A 4QUDA 4KMTH 4KTTE 4XP6H 4GXVL 4LFCB 2V59A 3OQ3B 3RR2A 1QYWA 5DHAA 1JDCA 4FWIB 4BKRA 4YJ2A 4BWUA 4EAAA 3RFTA 1RERA 5CEFA 4NZ9A 3WLSA 1QYCA 1GEGA 4Z3KA 4ZQFA 1XQ4A 4PG7A 2ZUUA 5EO0B 2VMCA 5D2NC 4RMHA 5FCDA 5FUBA 1OJ7A 3B70A 3L3GA 4J7UA 1RURH 4KZDL 1BWSA 4P9NA 5FO0A 4NJMB 3TT3H 4DOMA 3K8KA 4EG3A 1W52X 1CK0H 1T5DX 4CT0A 2PSSA 2CLEB 3HZKB 3REWB 1J00A 5EIIB 2J87A 4MULA 2CK0H 3AM5A 4Y4FB 1NLBL 3EISA 1IUNA 5BN4A 1GKYA 4GIAA 1AMNA 3PHJA 3MWLA 4NO0D 4DDHA 5CH3A 4L3VA 2HBRA 3I2JA 3B7TA 1WM1A 2D2EA 2W70A 1CCWA 2QRPA 4XJVA 2VLMD 3RIHA 2ZF9A 2FLWA 1GJRA 1UCFA 4HY3A 2LUOA 4U3JB 4H8WH 2CVZA 4L16A 1EAPB 1LW6E 1ZANL 1P4BH 2ZYVX 5CNIA 4GKLA 2ISCA 2BKEA 2GABA 1PR5A 4HLDA 1RUKL 4NE9A 4O1MA 2PUQT 3ULSB 4PPTA 4KQ0A 2G3ZA 3I05A 5DHVH 3CX4A 3VQTA 4IK6A 4ZOEA 3AWEA 4KMSA 4P3KA 2E9WA 3ZKMD 5HHNB 1IM3B 1KJMB 3W1ZA 3R76A 2AMLA 4D9LL 4PLTA 3MV7E 2R1WA 5H9WA 2ALWA 4NMXB 1RVDA 4HH3C 4PJHB 5DJ2A 5DMIH 3HHSA 3WYGA 1O95A 4I5IA 4ZFQA 3D39E 3HAEB 3DEKA 3F12A 5F9JA 1KBPA 4Q4AA 4RVOA 4HMOA 5D1XC 1LWHA 1DC8A 4X6UA 2IVFA 5C52B 3SXJA 3VTMA 1EFPB 1G5TA 3RLSA 5AW4A 2CHFA 1Y34E 4XP4L 4BV1A 1HWYA 2WKLA 2HDNB 5D00A 4F5YA 3K0FB 4FQ5A 2P8LA 3C4VA 4IRSC 2ZETA 4GY4A 2OJZL 2KLSA 2XW6A 1CEYA 5DBGA 5JJKA 2JD2A 4MUBA 3KBBA 2ORED 5TGBB 3BTVA 3DPBB 1NRXA 5KOIA 1L6RA 4UT6A 2XDQA 1FC1A 1EJ6A 1WCBB 2VR9A 1Y9AA 4X7SL 2CLCX 4YRNA 3ZWVA 5GS1A 1D5RA 4TQUS 3ISWA 3RRYA 1CDOA 3IB3A 5LLDA 5F0JB 1ZMBA 4F2HA 4JG9A 2G5CA 1OUMA 5JYCA 5F72S 3L5IA 3NHMA 1Y6RA 5IBUG 4IOIA 1VLMA 4IQHA 2R8PA 3U17A 5LXVA 2V2TB 2BFGA 4ZEXA 3JQFC 1PQPA 1LE9B 2X9YA 2W0KA 4TUKH 2V2WA 4V1CB 5IK2D 3HE6C 1RFGE 3K9QO 1Q1ZA 1JRHL 4PAWA 1G16A 1MAJA 3DGGB 4OYLA 2WXKA 2VRCD 3GSQA 5KBLA 3IO5A 4G5SA 4DP0X 2HAEA 1B0GB 1JPTL 4K2UL 1SKAA 2BY1A 2RJNA 2EJBA 3PNWA 2AUMA 2ZICA 5KS2A 4NDMB 1OAOC 4GKVA 4R5HA 4XWOA 2LGJA 3D2TA 4BO5A 3GMTA 1SBSH 2XY4A 1JGEA 2BKVA 1WXIA 3FB6A 1M7DA 4LKRA 5E4IA 4K9MA 2JCVA 1W5FA 3ETCA 3SJVD 4DQ0A 1LDPL 4MWBA 5BPHA 1VACA 3JAMA 4UMFA 2E0PA 1BYIA 1G3MA 1LY1A 5EBGA 4FHFA 4F6RA 4W7IA 2H2SC 3DBRB 3REQA 3FSRA 3WKYA 2RFXB 5L8LB 1M1NB 1TF2A 2A7XA 3LL7A 4LJ8A 5BWNA 4XNUH 4ZFZA 3WENA 1WUTA 1M1YE 4G5GA 1V43A 1STOA 1IBFA 3BM5A 3ARBB 1YA5A 1I1CA 2B5OA 4U00A 3N53A 3L1OH 2BFFA 3DJSA 3TQQA 3ATDA 3GJQA 5FWDA 5KBKA 2W8BB 3EJCA 1SYSB 1RYMA 3MC0A 2IX9A 4ZI8A 3V5KA 2IGLA 5IT5A 1SXJE 3LHFA 2H26A 3MUGA 4LHXA 2VDKB 2OCJA 1CD9B 4I0CC 4EN3B 3KBOA 4CE6A 3VXQA 3V34A 2ZJYA 1ZJYA 4DL9A 4GQ9H 4N8UA 4DQLA 4GIOA 1NVFA 4KQFA 5GS1C 3AVPA 2WSIA 4OLYL 4NT6A 1P84J 2QMHA 4PYRA 4HDIA 4HS4A 1JHMA 4CUJA 5B1EA 2ISQA 5FYJE 1OSPH 4J3JA 3O3AB 4GQZA 2LGNA 3DX4A 4FXGB 1LPNA 4WUKH 4DVBB 2Q3ZA 4YLBA 2ZKMX 1LBHA 1WABA 2IPMA 3IK2A 3RVXD 1OP5H 2H1RA 3VFNB 2PSFA 3FONB 2V58A 4HS3A 5C9JB 1PYDA 2OCDA 3ZHVA 3PNLA 4O4IA 5DS1A 5IN5A 1KQ3A 2QVMA 3TZKA 4JY7A 3C24A 2C8NA 4RMGA 4IO1A 2BZ7A 2HMWA 5D1QC 4X7PA 2VRAA 4EH1A 1QW8A 1HDOA 3LX5A 5HFNA 1CICB 3UMJA 3IU3A 4RKRA 4Y1TA 4ZZ3A 5C0BE 4WWOA 4K05A 4ITVA 1B0IA 4KLAA 4LC1A 1OLUB 4TGLA 1U6AH 1T0UA 1E0DA 1G7PB 5K7SA 3IKCA 4DWVA 4REMA 5IJKC 3VJ6A 1JPFB 2O61B 3GRWL 1BROA 5I7VA 3FYUB 4BQFA 4ONFL 3WL9B 5AW6A 1HDYA 2YAHA 1AZNA 4U7KA 3MBEB 4YGYA 3O8XB 5I1IH 1UBCA 3A6OA 2BDNH 5CM9C 4P8QA 1ZOLA 2C2ZA 2D0PB 1AKJA 2HX1A 2PRZA 3KSRA 2HWXA 5B39A 3JYOA 2TMYA 1DQLH 1D5WA 1EGHA 2CMRH 1L4GA 5KSUA 4G6FD 4S0HA 1J11A 4LZWA 5JS2A 4BNKA 5A2BA 1MWAA 5JMPA 2XTAA 35C8H 1XVSA 5E5MA 2FKNA 4FYJA 4LGPB 1JKJB 3CLEL 5KO2A 3MTRA 1F2VA 5JMWA 1V27A 1AZCA 2ZJAA 4M1GH 1DQQB 3M89A 1NVGA 4DGUA 3BTOA 4N8SA 1ZLDA 1Y9JA 3T2NL 3ROGA 2JZNA 1UXGA 4NZDA 4YHYC 1TQ4A 4LGSB 1PEZA 1C12B 1CERA 4BQOA 4X6EB 2FQYA 3WNBA 4DR1B 5FA4B 2CDFB 2L69A 2HT4C 2JAUA 4AXWA 2BNRA 2EEPA 2AG1A 4P0QB 5J0BA 1SHZA 3WGTA 2OWDA 4A68A 3PCXA 3WY4A 3DI3B 3EZJB 2OMYA 3VR2A 3ZXXA 1XIVA 3PUHA 2XGMA 4YCBA 4AZ0B 3V4SA 4HD8A 2IY7A 4W5WA 4MAYA 4URTB 2G36A 4KP7A 2X4PA 1BN7A 3L4ZA 4JC5A 4MJ3A 5EP2A 4FABL 5E6ZA 2ZWSA 3IBYA 1SY6A 2AKAB 2WM3A 2CYAA 3W5SA 2FWMX 3IDUA 4JMNA 3OLQA 4JKPL 3GGDA 1V7ZA 4KKAC 2PDAA 2GN0A 2QV2A 4F7DA 3S4SG 1G0NA 5J3HC 3NDJA 3P45A 4CG1A 3H8WA 2PXXA 3KEFA 1PK7A 1PKXA 2ZUBA 4PBSA 2JJUA 2B21A 5JXED 4FEIA 3CPLB 1IKNA 3LY8A 4PSAA 3T1NA 1AJ7L 2UVPB 1BAFL 3BRWA 1IE5A 1SQSA 5KCMA 3ILVA 1MB0A 3RU3A 4URWR 4LOEA 1BWWA 1QKZL 2BEVA 4JPVH 4RISL 1QB7A 5J43A 1SXJC 1BJKA 1IC5L 4P46A 1R50A 3IEIA 4WLCA 2GOYA 5TH2A 4FG2A 2ZS7A 1IAOA 2XG4A 2HF7A 1F18A 5DV9A 2G0LA 3N3EA 3AYXB 3OHXA 4HYEA 1O6TA 1NP6A 5IJ0B 2HV8A 3GLSA 1E4OA 1I6MA 4UU7A 3ARBC 3ECVA 3LQKA 1TM5E 1YRBA 1RSZA 1CLZH 4I77L 3AUUA 1HJBC 4ZDKA 4B9ZA 1OPGL 3VV2A 4JO1H 4QWMA 1CQKA 3DRQB 3QDJE 3T54A 3ZU6A 1R3KA 4JB9L 1N7ML 4D9JA 1B0RB 3MV8A 4N2CA 1LW7A 1U93A 5FYKL 2Y9PB 4A7TA 3EQ6A 5LBIA 1CF9A 2V7HA 1X70A 4AQ8C 4R7GA 1IARB 3IGFA 2YXWA 2CD9A 2JJQA 3M1BB 3ZOAA 2JKYA 2PXYD 4IZIA 3DOEA 3S36L 5FWXA 3IIEA 4BHUI 2C7RA 4H31A 3WZLA 5FLXA 2P9YA 3RY6A 1JV2B 3ROEA 1X42A 4G7YH 5AWFC 3ZCQA 4LGMA 3H1PA 4HXEB 3MRSA 3DSNA 1BCRB 3RFZA 1YR9A 2YD8A 4HQQL 4EO7A 2WTRB 4LRNL 4LJRA 4HK0B 4AG5A 4J1TC 3DI2B 2E0IA 4PJ9A 1UBGA 1FNNA 1HORA 2MQ0A 1M74A 4ND4A 1EX0A 3VFNA 2L7JA 3GUCA 5FIEA 2WSKA 3GSWA 1ZCFA 3R6DA 2RB5A 3QPXH 1EVYA 3CZUB 3FN0L 1SUAA 1AUOA 4W5RA 2CK3A 4GLBA 3RIAK 4M1SA 4TYUA 3P11H 4TWIA 1UBHS 4TXJA 1GPOH 2P68A 1Y0BA 3IP9A 1TEYA 2PRJA 3W4IA 3BUPA 1L7IH 2LU5A 2XOXA 4FG0A 3SPHA 2GTWA 4KXQA 1VRCA 3VO0A 2C5LA 2OILA 2QD2A 1H6EA 3DB1A 5B6PA 1UJMA 4A36A 4WKPA 3MCLL 4KFCA 4Y88A 4QLOA 3WRXA 2WYUA 5EZJA 3F90A 3ROXA 1I82A 5LQUA 3O3OB 2YGPA 4BWFB 3CQPA 5D1XB 4GI6A 4I66A 5DLYA 3K6DA 5I76B 3RDTC 1W4ZA 1FL6B 2WWNA 4CM4A 1DC7A 1XH3B 4PANA 3B2QA 4KPHH 4CI9A 3P1VA 1J9GA 2PO6C 1Z5UA 3U4CA 3UWKA 4ETNA 3VBEA 3X3GL 3FQRA 3RPEA 1Z0FA 4D2NA 1O0SA 4ADGA 1B8OA 2MQ3A 3K5HA 2WYVA 1L2TA 4NDAA 4D99A 3DJYA 4E03A 4FT4A 3MUHL 4ILDA 2PRYA 1J09A 4YDJA 2FWPA 2X70B 2VNCA 3FTFA 5CBKA 1TGYA 1NUTA 4XR8C 5ALUA 5H02A 4TOYL 3F01A 4UMVA 4DIOA 1IEVA 2DFLA 5I1GH 4CMEC 4W6WB 1KZYC 1NKTA 2XUAA 3GGWB 2CO7A 3PDOB 3HPJA 3D4ZA 2G4GA 2OCBA 2GVZC 2BRQA 4MO9A 2Y06H 2ENSA 5HHOD 4KMOA 2FW6A 1BMWA 1GXEA 4ZMNA 2ZCJA 1NCBL 1M7IB 3SM3A 4LF6B 3MPCA 3TECE 2BNUB 1Y1SA 1AD0A 2ZX7A 1FUKA 3VSEA 3TJHD 2FP3A 5DD5L 2A0UA 3Q6GH 5T5NG 4ANXA 1KXTA 3A1UA 1ZIAA 2X4OB 1DADA 5KNCH 2Y07L 1XZQA 1M53A 1U9IA 3MB8A 4N26A 3CVOA 2A1TS 3OMXA 1Y3IA 2C9BA 3G79A 3AF0A 4BIKA 3SOTA 3OI7A 2PMCA 3N5AA 1YONA 5EY5B 3HC3L 1ET7A