3ZE1B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
464
structure length
464
Chain Sequence
b'NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 106
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze1B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze1B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze1B03
2XWBF 3BQMB 3IJEA 1DZIA 4M76B 3FCSB 1RS0A 1ZONA 3OKWA 3EGXA 2P26A 3IBSA 1BHQ1 1XDDA 3PPYA 3EOAI 5E6RA 1PT6A 1L5GA 1ATZA 1DGQA 1M10A 1U8CB 4NENA 2VDNB 3HXQA 3TCXB 3NVQA 4G1MB 4WK4B 1JLMA 1LFAA 2VDRB 1ZOPA 1YVPA 1M1UA 3OL2B 3AFCA 1YVRA 1FNSA 1SSLA 1PCXA 1SQ0A 2QTVA 1M1XB 4CNBA 4IXDA 3AL8A 1MJNA 3EG9B 1PD0A 3EH1A 2I91A 1SHYB 1JV2A 1NA5A 1RD4A 3VI3B 3M6FA 3PPXA 2VDQB 5KYYA 2XGGA 3TVYA 4CN9A 4HQKA 5HGJA 4XW2A 1MQ9A 5KYUA 3ZE2B 3K6SA 4K3JB 3IJEB 3EGDB 4JX0A 3HI6A 2ADFA 3NIDB 4UM9B 1TYEB 3FCUB 1N9ZA 1RTKA 3EGXB 5E6UA 4DMUB 4HQNA 4NEHB 1YUKA 2VDOB 5E6RB 2VDPB 1L5GB 1XUOA 1IJBA 1M2OA 4NENB 3EH2A 1RRKA 1MF7A 2UZYB 4MMZA 1JEYA 4Z7QB 1U0NA 2WINI 4Z7NB 1BHO1 2ICAA 2M32A 2IUEA 1CK4A 2XWJI 2ODQA 4MMXA 4UM8B 1T0PA 1QC5A 3TXAA 2NUPA 2VDKB 3AL8B 1SHUX 1AUQA 4MMYA 2O7NA 1JV2B 4WJKB 1AOXA 3EFOA 3BQNB 1IDN1 5KYYB 3ZQKA 3VI4B 4WK2B 3PPWA 4FWWA 4JDUA 4CN8A 5KYXA 1UEXC 5KYUB 3Q3GE 3K6SB 4BJ3A 4C29A 5HDBB 5BV8A 5E6UB 4G1EA 1M2VA 1IJKA 1JEQA 3PPVA 3HXOA 2VC2B 4O3UB 1IDOA 3EOBI 5E6SA 4MMZB 4C2BA 1JEYB 5ES4B 4O02A 3K72A 2NUTA 1CQPA 1MQ8B 3RAGA 3ZDZB 1T6BY 3GXBA 4MMXB 2NVOA 1QC5B 2NUPB 5HJ2A 3EFOB 4MMYB 4HQOA 3TW0A 1MQAA 3OKYB 2VDMB 2ODPA 2I6SA 3AL9A 3F74A 4F1JA 4IGIA 4FX5A 5KYXB 1V7PC 1XDGA 3K71A 4WFQA 5KYWA 3NIGB 1QCYA 3T3PB 3EGDA 2B2XA 4G1EB 4F1KA 1MHPA 1M2VB 3V4VB 1JEQB 5KYNA 1ZOOA 2X5NA 3FCSA 3ZDXB 3QA3E 4C2AA 1U0OC 5LN1A 3ZE1B 5E6SB 1FE8A 4GZ8A 4PN7A 1U8CA 4O02B 4HQLA 3K72B 2NUTB 3ZE0B 4G1MA 1PD1A 1N3YA 4O3TB 2I6QA 2P28A 2WW8A 3BN3A 3E2MA 3OL2A 3N2NA 3NIFB 1OLZA 4IHKA 4WK0B 1M1XA 1SHTX 3T3MB 3ZDYB 3EG9A 1AO3A 4Z7OB 1OAKA 2VDLB 4HQFA 1Q0PA 3K71B 4A0QA 3F78A 5KYWB 3V4PB 4UM9D
chains in the Genus database with same CATH superfamily
1KGDA 1SU4A 1DLFH 4JPVL 4PR5A 1AXTL 2NSMA 1RM0A 4GW4B 4IIYA 3IJSA 2YUVA 3DKHA 4C2TA 2ADMA 3F8TA 4DEWA 2WY3B 3PICA 2C7RA 4F6LA 2CNLA 2FPGA 1AIPA 4GXNA 2N3ZA 4HWZA 2QDWA 1NSTA 1V16B 3GJ6A 1L9PA 2Q2NA 4XWWA 1ZK4A 3UFXB 3V4ZA 1FVHA 4HC1L 5EWLA 4R3NA 5HJ5A 4FXGB 3EZNA 4XOUA 2FEEI 4Q3DA 1GRRA 1HFWA 4LRNH 2QZ9A 2AF2A 4Z86A 3D4OA 5F3DA 4JM4H 3OC0A 4ETYA 2AFNA 5CVEA 4DCUA 2IZ5A 2AFIB 1E5ZA 4U1SA 4DEXA 1IBGL 4NJMA 1IONA 3HUJE 4N0QA 1MCZA 3BTOA 4PU0A 5JO5A 3UJIL 2VRCA 2X13A 3ONNA 2GJ6D 1XXHA 3QPDA 4MW7A 4S0SD 4YDRA 4XE0A 1L0XA 4OZIA 4PQEA 1XGTA 3QFRA 5A16A 1JV5A 4R4JA 4A15A 4WSKA 2LU5A 1J8KA 3R3VA 1FO0L 3EFFA 3S2IA 4MUJA 1O6BA 3EMVA 5GRUL 3C6XA 2RCSH 3P0VL 3U13A 4FMKA 1BOYA 5HI3D 5JJCA 1K6XA 1L9RA 4CM9D 4PJGA 4Y4HC 5JH7B 3F58L 5T3XE 1EEUA 1A6VL 5ILTH 1WV0A 2V2TB 4WHMA 4C55A 1ULAA 3F78A 1OWLA 2VHEA 3AS1A 4V1CI 1A6ZA 3OFVA 3AUVA 4U7GA 1SXJA 1U0TA 3AERA 1TQCC 1JDZA 5DZAA 1NCUA 3U48A 1U36A 2FUTA 1BBDL 1OF2B 3NFNB 1RRPA 3PQ2A 4E5VA 2WB2A 3ZKXC 1A14H 3VUAA 1Q95A 1Z8DA 4UUAA 4EHHA 1FK8A 3VKHA 4PPNA 2H18A 3BCUA 1K88A 2FOLA 1C30B 4H1LB 1W88B 5E03A 3KS0H 3E3LA 1JGVH 2L7QA 1KETA 3PC2A 2YJQA 1U8MB 3H9QA 4FZ8H 3H7IA 2C58A 1TG8A 3FQNB 3TZVA 1F42A 1X6VA 2D7OA 3V1NA 3CLFH 4OBXA 2YN5A 4U1MB 3IGUA 4IRJA 4IJTA 3RA7L 2X9ZA 1FNHA 2V6HA 3F73A 3LP6A 4TMKA 2PMEA 2C1PB 3VYSB 1U1EA 1V39A 4KHXH 5L3QA 1KGCD 3PNPA 1NLFA 4RZIA 3I6GB 1ZC4A 2I6UA 4O1IA 4R54A 4L1HA 4DNPA 4DV4B 4Q9KA 1TMYA 1FZKA 4EF3A 3H56A 1UM9B 4E2ZA 5TH2B 1II8B 4K9EL 3BSFA 4TTIA 3QBJA 4CMGA 1I1AA 2F5AH 3QORD 5D7JB 3QISA 1S2NA 5TMPA 4K3EH 4EDXB 1BD3A 3K2UL 1C7JA 3Q7RA 2Z83A 3HXQA 1BMFD 2OYPA 1EZSA 1GLGA 5BCAA 2BUCA 4EIGB 4Y8VA 3VFUA 4M1OA 3WE6A 2EDXA 1KFAH 4X8GA 2FEXA 2O8VA 1A9OA 4PZEA 5HYFA 4MW4A 4WZZA 4D7BA 1N5AA 4OD2A 1XF2B 2J3SA 3FHAA 3BSZH 4NZOA 5B2FA 5HYQA 1TMOA 2B8JA 3DLBA 6PCYA 5GGSA 1UPCA 5E9QA 1SXCA 5I6PA 2DY2A 1ZSYA 2EF1A 4WNJA 2FJSA 3NDZE 4LZWA 1RW4A 1LLCA 3U6XA 2O61B 3Q8KA 3BZ4B 2RFXA 3IS1X 1FTYA 1YQEA 1CDZA 4PS0A 3NH9A 621PA 2WZDA 4ESEA 2ITFA 5HK8A 3VR5H 4XMLH 4IJ6A 1SOMA 3QIUC 4HQOA 1SHZA 1W0VB 1D04A 5FOVA 1VCBC 5K0TA 2GIYA 2VNSA 4YIQA 3I9AA 1M5UA 4L23A 3OZCA 4I1PA 4KRPC 3V97A 3SJUA 2D1RA 2F7QA 5A02A 1T4CB 1BGVA 2PCPB 3MCVA 4K3VA 2XWTB 4WFIA 2XUKA 4P4KB 5FW6A 2BKAA 2VR6A 5JLJA 1E5UI 4ZVQA 2P3OA 1IFXA 1WIWA 1F1AA 2AD1A 3CDZB 4Q9HA 3ORYA 3DK2A 5LQDA 4Q1CA 5JNSA 1L7PA 1Z88A 2EXWD 4LMRA 5BV0A 2WZPD 1NFFA 4CM1A 4B3HA 1JFSA 5DHPA 3O3EB 4RVOA 3QVLA 4H6VA 4Y5YA 4YSRA 1KHTA 2IF0A 5H02A 3WSQH 3LNEA 4OYRA 4UHBA 4UMVA 4AQEA 3FLMA 3IETA 1L7DA 3CFDA 2ORBH 4JU8A 3HI1A 4D9RE 4GI1A 5JATA 4MW5A 3VMNA 1FYFA 3JARA 3L92A 2NACA 3CINA 3HZKA 5HIAA 3WKPA 3KPOB 2XPZA 1J56A 5K3FA 1PEDA 3LGAA 1EE9A 1N2CA 1RAFA 3TLBA 4BKRA 4RHEA 3QFDB 2CO7B 5FORA 4B09A 4RDCA 2WQ7A 5F7OA 4WKCA 1L4HA 4MA5A 3D6MA 5D8DA 1V2HE 4NC1E 2AANA 3SM3A 4H4CA 2R7AA 1J88A 4XO4A 4DKEL 1EZ1A 1ZM9A 2IUFA 2P4UA 1OP5H 5FOSA 4YLCA 5CT4A 5F7EH 3BQUD 2VN6A 1NCWH 4XTRA 2WKQA 1ZTXL 2R751 5FOXA 2VDKH 3LT1A 5AKYA 4G8EA 1A1OB 5FT9A 4EKJA 4N6NA 2M9MA 2JI1A 3O82A 5F9OH 1SD2A 1U0HC 3D39D 4DZBB 4WNYA 2DM7A 4WGKA 2OHXA 2MINB 5BW4A 4GZLA 2XCQA 3W4JA 1NV8A 3L5KA 2QXYA 3MCUA 2QD3A 1Q94A 5KSBB 4ZYZA 4QTFA 3WYCA 3TIIA 2ZVJA 4ZODA 5AZEH 3A06A 3E23A 5M2QA 3TIEA 3GDCA 3RB8A 1QFWH 5J12B 1RPAA 2D2IA 3ZI7A 2ZB7A 4PVCA 2DQGH 3CF2A 3FFOA 2HKFL 2QADD 3PA8A 2R0WH 4E7PA 2NG1A 4Q16A 1C7IA 3RS7A 1CT8A 5LD2C 1CICA 3NETA 1ZJ4A 4RKEA 5D2LE 2YD6A 5BVPH 1QIJA 2IKQA 3MV8E 2VATA 4L2IA 5A4DA 4RKWA 3FHTA 3AJ8A 1XTMA 1JJ7A 4G8IA 2W2MA 2BFMA 1NYRA 4Z0XB 3P9IA 5ADPL 5B1KA 5U4QA 5JRJA 1UR5A 1PZHA 1N5IA 1WM1A 1SFRA 2PKRA 4LB8A 3R09A 4NG4A 4JA2A 3TJHC 5I28A 4PZCA 3FUJA 1XVAA 4N68A 2QN8A 1YRYE 3APCA 3RIAK 1T3LA 5IFAH 2D9QB 3L9EA 2WICA 3DW3X 4AYFB 2GBTA 4I18B 4IOSD 4PSCA 1P84J 2OMYB 2D00A 1CHDA 1KEGH 1J97A 1N3BA 4JZJA 3T34A 3G5LA 3HMXL 4R5TA 2DLNA 4ZWNA 5JS7A 4PAGA 5LZ8A 2VHXA 1V1RB 2G5PA 5FFLA 4IWXA 4YP9A 4A0HA 4NC9A 2A5FA 2N47A 4U4IA 1FVEA 4UNIA 3A1SA 3FWZA 5KSZA 4N8VA 3E9TA 4Y6LA 4GOND 4PWZA 1NNSA 5E5UB 3WQRA 1BIHA 2PCYA 5KJCA 5ETJA 1OM3H 3WO0A 1D1QA 5EIQA 4XVUA 3RZCB 1KMGA 5BN5B 1BJ8A 1ZRMA 3VG0H 2FUNB 1JN0A 3UHFA 1XGRB 4WBNB 1IDN1 1GVIA 4TVKA 2CXUA 4MUAA 4TQ9A 3GGWA 4HJIA 3BSSA 1A6UH 5LZ7A 5E6IA 2WT9A 5IT9A 4XBEL 2VERN 1WV1A 3ZCXA 3B51X 1MRDL 1RZPA 3BFXA 2YJGA 3ZKAA 1ZGBA 3IT1A 5SV4A 4QXQA 4U39A 4ELDA 5BSUA 1TEZA 4BGDA 2NXWA 3PEYA 2I3ZA 1QX3A 3HRZC 2BR3A 4PJIA 2DFKB 1JR6A 4K0KB 1NF9A 1N6HA 1Z4IA 3A28A 5IBRA 1XZEA 1XB6A 2YPKB 2DQZA 5D2LB 1R3HB 4RMBA 1M53A 3QBDA 3MV8B 1YKFA 4ODTH 1TLKA 5F6IB 4ZQHA 4Q7QA 3ARDD 3HKZA 2BIFA 4YRZA 1YDPB 1XVLA 1VDZA 2JD2A 1FTNA 2YRWA 3NV9A 5JCZA 5E0QA 1EFPA 2O2GA 3P19A 1EB9A 3RDPA 4AWBA 2IPXA 1D9KB 2YD7A 3Q43A 3KPYA 2D13A 4JQZA 1PJWA 1M6OA 2WIAA 2I80A 3PG5A 5GIOE 4GJTB 2HN7B 5A40E 2PJDA 4CKWB 1DQLH 3A6CL 3VQLA 4AIOA 4MVJM 1ABBA 2EZ0D 1XKQA 3QIBD 3ZY7A 1E2ZA 1L9XA 1NUSA 5JHLA 3ZKMD 2WZ0A 3X12A 2OMZA 1ZG3A 12E8L 2C9DA 3MFYA 4TVPE 1JDBB 4DC1A 3EOTL 1NBQA 2WHYA 3DLAA 2QQNH 2DULA 2FG7C 3RTQC 1D2HA 1E2WA 2WSKA 4LMBA 2I1LA 5IW6B 5D6OA 3L0ZA 2GN9A 1U2GC 1IAIL 3OCVA 4C87A 3E3OA 2QLVB 2B4TO 4XB8A 5F1YA 2QRLA 1EUCA 2ZW9A 2OMUA 1X5JA 5A05A 1VI5A 3H1FA 3CLUD 2V9ZA 4CG0A 3W1VA 3DTVB 2JW5A 3ZKNC 5FUQA 3NIFF 3D43A 1U91A 4X7FC 4RGMB 3QK0A 5F88A 1E3QA 2X3FA 4YMVA 4QOJA 3TLXA 4BZXA 4G6AC 1XB8A 1D5RA 3N59A 3QVMA 4ZX4A 1BVKA 2AJBA 3CLTC 4WDIA 3ZGOA 1JXAA 1X5HA 1MREL 3F2LA 3WEXB 2AJDA 3I5XA 2HVJB 4XQEA 4Q19A 1W9XA 3Q10A 3RWCB 2WEKA 3D4PA 3QKTA 3SOBL 4JRXD 2VXQL 4RVBA 1JHKH 4ZRDA 4L0PB 3KS9A 1E63A 4LKXA 1J0AA 4E5NA 4REOA 4G8FB 2VA9A 5DNUA 5KSAD 3AW9A 2TRHA 2PPFA 4PJDA 1ZMBA 3FLEA 4TSAL 4YPFA 4XKJA 1KYTA 1J9QA 5I4KA 4HHAA 3TYGL 5E4FA 4E2YA 2GZHA 2HY7A 5JSZA 4FZ5A 2FIRT 3LBAA 4G4GA 2KL6A 3MS7A 5CEYB 1AIFB 1DAEA 3HN8A 5AI0A 4QWWC 3E9RA 1XAUA 1JGTA 3ZYCA 4MKRA 4P23B 4JASB 1ZA3A 1U8TA 1DWQA 3FPHA 5EYPA 5J6GA 4J4BA 3TO4A 2FQYA 1I4EB 4NKMA 1QQ6A 2VKWA 3VO0A 4BBWA 2J46A 4AQ8A 1SK8A 3VFMB 2PW2A 4ZT3A 4NLAA 3FFCB 1JSCA 4J3OD 4M8QA 2R79A 3CH1B 1WZ1L 3BRSA 4ODHH 5LGJA 4OLZH 4NZZA 4URZR 4K81B 3FKQA 1QG3A 3BAWA 2R6ZA 3JX9A 4X6BA 4TUYF 2C7OA 1ZVJA 3G2KA 3E58A 1EAOA 1DX4A 3ROOB 4YZFF 5KNDH 1X19A 3DMPA 3OXRB 3OIGA 4K6OA 9ABPA 2WBJB 2GTWB 1QU2A 4IHJF 1T0MB 2X4TB 5SWZD 3WUWB 5I2IB 3Q1KA 4WESB 1TLLA 4R9SA 3TV8A 3QVJA 2QR0A 5INDA 2D06A 1I14A 1N0VC 2O48X 4IZHA 5C0BD 3MYJB 4D0DB 4PJ9B 5I1EH 4EN3B 4G6JH 221PA 3K16A 2W90A 2X7HA 2AV7B 3L6CA 1JPEA 1PFYA 4F8LA 2WIBA 5DLEA 5C08D 3L5XH 4OOEA 1UD5A 4CYMA 3IDFA 4NCHA 4JFXA 1TEYA 5PNTA 4V2BA 3FW1A 3DQQA 3AIMA 4IS6A 4ES9A 2OBYA 5L9DH 5K0ZA 2BGIA 1HTTA 2PPLA 3FMOB 2H1XA 1MX1A 1S9DA 5E3JA 5ETUA 3WIFA 1JNLH 4Q1VA 1ZHNA 3T6QC 3U2SA 1YYCA 2WD0A 4EI6A 1GNSA 1GYVA 4YDZA 1IHUA 2C3MA 5I71C 4Y2HA 1L9KA 1VE6A 2OMXB 3CNBA 1T2QH 1IT9L 1AGEB 3UTOA 4MCZB 2I9TB 4NAMA 4ELMB 3O8XB 1E3MA 5BV7A 2X5KO 1SVZA 5GONB 1FBNA 1EVLA 4AOFA 1Z25A 3E3QC 3FYSA 3MLYH 2WVJA 1NVEA 5KVAA 1DV2A 4MVJE 5FL7D 4KVZA 3R7BA 2IG2H 5KREA 4Y4KB 3WJLA 1I94B 1AP2A 2HBYA 2DPYA 4CKCA 2YV3A 1C4WA 3D7SA 4C01A 4HCGA 2XFXB 4CRWB 1ZQ9A 3L07A 1J8MF 1AXSB 2WJ3A 1F2TB 1NGPL 3V8QA 5HVNA 3ZPXA 2OB1A 3UQZA 1NKVA 3RJ5A 3VNBA 3G0CA 2UY6A 1WXXA 2F8VA 1DSYA 5CDGA 1SJVA 4G36A 1YNKH 1DAIA 4IBTA 1ABEA 2YDXA 1Y3DE 5HDBF 4MJ3A 1J0JA 1HE5A 2DFVA 3HC0B 3KSMA 3M8OL 5A6IA 3TEJA 1G6RH 4EJMA 5JBIA 1DEDA 5IW1A 3PWPA 1I7UB 3HS0A 4L8DB 3EG5A 1ZNQO 3FMIA 3EJUA 2HG5A 1V25A 1RRFA 4Y5VA 4HNAB 5AW4B 3VC7A 3VKVA 4K1XA 3HRHA 1Y9ZA 3CN7A 4LFBB 2XYBA 3CZGA 2VL5A 2NW2A 1N6RA 5AVSB 2SNIE 1I3RA 2J56A 5T1MA 1JWUB 3A1VA 2HCRA 1M2EA 1AHPA 1U81A 5I0ZA 3AZPA 3EAGA 3C6QA 5TS3A 1S78D 2RH9B 1L4YA 1TZ8A 2IH8A 4Z0NA 3SQNA 4BGUA 3HE6C 5IDXA 4JI0B 4AZ8B 1VM6A 3B9KC 2WYWA 1A4BA 4PHXA 5EE3A 1PR6A 3Q5GA 3ZQXA 5AUPB 1GZVA 4KPGA 2NGRA 3CFUA 3FPCA 1OGIA 3IILA 2GEBA 4R1QA 1XD2A 4PPGA 1A8HA 4L9LC 1DCEA 2ZRHA 2IH5A 1BEYH 4I4IA 1CBVH 4KXDA 2BFVL 1PGPA 2C1EA 3G2QA 3DX2A 4MBRA 3NEPX 1U8UA 4LHUD 5FULA 3W82A 1LL1A 2K6WA 2WAHA 1QHEA 4S1NA 3DVNA 3R19A 4KZDL 4O3MA 2UZXB 1EAYA 2R51A 5JHAA 1LO4L 5KVDL 1E43A 2VKTA 4Y4FA 3MVSA 5C09E 5KTKA 1QSFA 4MCYB 2N42A 4IUBS 2AF3C 3ZDBA 1C3XA 1WAAE 5M5BA 3FPJA 4CIXA 3GBDA 1Z07A 1TYRA 1X8XA 5E4EC 3OJOA 3ABZA 4DLBA 5EOCJ 3NN8A 2YLHA 1C1XA 2WD8A 4WEBH 2HNKA 2ZRGA 3QGMA 2C78A 4XP1L 4B41A 3USES 3TIFA 3GLHE 3RS5A 4AH2A 3H9HA 3EBLA 1WO8A 1UJ4A 2XUJA 4PTYA 4QHYA 2F5BH 1XTUA 4FERA 1V7PC 5JPNB 1TT5A 2B9VA 4X6FA 2E3VA 3TYFA 3PFHA 3K1AB 4XUEA 4CGZA 2B1AH 3D06A 1SRRA 3DJYA 2DM3A 5I1IH 2FXVA 1HNZB 3DDCA 3DX8A 3HA7A 2FZLA 1EK6A 5DEFA 3MRSA 2D1TA 3NCYS 4OQ4A 2FIKA 3EVNA 3CFJB 1B76A 1YDMA 4R81A 1G9EA 4HIQA 3AF0A 1QMGA 2EJVA 4RORA 1S02A 4XR4A 1BHQ1 1WULS 1WT5C 1ZK2A 2GCNA 4ABYA 4P3NA 4FBMA 3T2QA 1G0OA 1PYOA 3QZMA 1RJDA 3VH8B 1JQKA 5HXAA 2EINB 2J43A 1MJNA 4U9HS 1FPMA 5EBLB 3K6DA 1I2ZA 3VI4A 2HIMA 4ILDA 1T22B 4BEIA 2C7UB 3DHUA 3DGGB 5GXBB 1Z36A 3N7UA 1LJUA 3MJWA 4YRJA 5LBGA 4DP1X 1LTXA 4F8NA 1WXEA 4P8RA 4G5QA 2Q0ZX 1K6QH 5TJHA 3M4ZA 1BBJB 1VZ3A 2X4IA 3G7SA 3SYAA 1YBHA 5C0OE 3I6YA 4PIBA 1AQNA 3NIGE 4QMEA 2Y0PA 2NP7A 2DYPA 5SV2A 3LI2A 4EI5D 2WO2B 4C4RA 3K8MA 2Q07A 2Q5BA 2ADJB 4G9GA 1UXIA 3F5WB 1MCBA 5ALCH 2XE6A 2YIMA 4PJHF 4L3CB 3AQXA 5IARA 4HMEA 3KX2A 2KPOA 4HPOL 1N2IA 1UA6L 3D1MC 4U3JB 1RUQL 4HWBL 2NY1C 1V1MA 1KC3A 4WY2A 1XEXA 3OJLA 5C09B 4Z9BA 2H07A 2F64A 3QGVA 1WAMA 1ODAA 4BFYA 3W04A 3WC4A 5FBHA 4ED9A 5J2UA 3DD1A 3ND9A 1SLWA 4MVBD 2FNWA 4HUQB 3GT7A 4LXTA 4Q4JA 2ZZUT 2G2RA 1WABA 4DIKA 3GLHB 3TECE 1NGWA 1XTLA 4DLNA 3P2DA 3TBFA 2E46A 1WLSA 4CJ1A 1XX9C 1GCIA 1DBPA 1Z4PX 1ZOSA 5AW7B 4LQ1A 5E1AB 2K7FA 4MJ4A 4FC6A 2DWXA 2HGSA 3BBPA 1ZMRA 3JSXA 4UARA 1JD9A 2ZG3A 4NQXB 4DMHA 2G1AA 2VLJA 4URXR 4NZJA 2KQMA 3RIEA 4LL1A 5IXSA 1XUOA 1BMQA 1TU2B 1CD0A 3MWDB 1VB3A 3C70A 4I1NB 4Q1AA 4OSUH 6FABL 5L3VA 2P91A 1YB1A 4Q4IA 1A2KC 3S36H 3RFXA 1AANA 5LYJB 1IKNA 3D7MA 3BKCL 3VD1A 1QO0D 5HDQA 2XWJA 1WCWA 5A03A 4LSSH 1UB5A 4XOAA 2C83A 1EWKA 1LRLA 3SBWA 1GKUB 3ZCSA 3FU7A 4MWBA 2DWOA 2BGRA 4DLPA 1KDIA 3IKLA 3BD4A 4FWTA 3KTAB 4GXUN 1JZDC 3WOHA 1CLZL 1WFJA 4J0QA 3NIGB 4AZ0B 1OB5A 3JASA 3BC9A 4P9HH 4XO9A 4LJ4A 4OA8A 1ZK3A 1GYCA 4J4PD 3DGFC 1K5NB 3KKLA 3HCCA 5C9ZA 1RVDA 2JE8A 3L5WA 2WZBA 2G67A 3G6KA 3I42A 5JQWA 4F1SA 3KLOA 1VPWA 1UURA 1EFXA 5G5DB 1QBML 3HE7B 3A4YA 4GXUM 1U2TA 1PE0A 3SGKA 4R8SA 1MLBB 3VXUE 3HU5A 3KCQA 1MAKA 5UKDA 1QRTA 3SDAA 3TIGA 3LY8A 5DK2A 4L2YA 1FLNA 4JQCA 1T6VN 4UMGA 4PJFE 5F71A 2WZQA 2I27N 4Y89A 3FB7A 1HYHA 1E8ZA 2DQHL 4U2EA 2Q8BL 4MZXA 4HBZA 3G5ZA 3CFEA 1LWRA 4PYNA 3RE1A 1TTUA 3DX7A 4GQQA 3OAAA 2BMWA 4QOFA 2Z1KA 1T89C 4PSUA 4UWQB 4C7OA 3OKYA 1CYDA 1SWWA 3PNQA 4QYIB 3R2JA 3FO9A 3GUYA 4A1OA 1QORA 3TN0C 3WY9A 1MB2A 1CIJA 1YQXA 1BQHB 5BRAA 3EYOB 2Z09A 3D54D 1PSKH 4BJ3A 3KPPB 1W8NA 3U46A 1NCCL 3NUGA 4LSGA 5IAAA 4O5AA 3QPXL 4LFCB 3Q2VA 1FU4A 4YGVB 2QPEB 1OXXK 3TLMA 4NFCA 3PFNA 1JHDA 1SG9A 1NRWA 2V7QA 2ZUDA 3IR5A 1A6TA 3EPJA 2CUAA 4M9RA 3V4PA 3C8KB 5I9MA 4C2AA 1Y1RA 4EJSA 2W65B 35C8L 5FJIA 5I15L 1WVMA 4JVNA 4TQEH 4X7MA 1IGYA 3HSYA 5CGYD 3ZCPA 4JPWH 4JMPA 4GBXB 2Y66A 5I6MA 4YL9A 4ND7A 3TTSA 2CK3D 4LXXA 2G07A 1A7UA 1AUXA 1CF1A 2GKSA 3IFNL 3OHMA 1U30A 4KUEA 4EEXA 1KT2B 1H0DA 1LP9A 3Q2WA 3ND7A 4QOKB 2ZE7A 3HKBA 1EA9C 2BLNA 3GO1H 3HKFA 3DAOA 1JU9A 4H3HB 4W7SA 3QIAA 2OMWA 2VDMH 3MRMA 1SHYB 4KXXA 4NQUA 1XTKA 3S34H 3TLKA 3ZLTA 4I81A 3U4BL 1FJ1A 5M7EA 2DQUH 1EMDA 3UJ9A 1FSZA 6REQA 1C3LA 1S3FA 3JQFC 3N2GB 2W0SA 3D0RA 1T5SA 1TC2A 5GIPE 5HI3C 2QGBA 2ZX5A 3C3WA 3O3BA 4V1DE 1SH7A 3VXUB 3KL2A 3KD3A 4G71B 3CSUA 3H7BA 5CCKH 5KVEL 3T15A 1HE3A 4PJFB 4MB1A 4PO8A 4CIDA 1WDKA 4TOYH 3RYHB 3HMKA 1U2PA 4QNPE 3C60A 1XZIA 5DYIA 2VSNA 4BB0A 1F18A 1DSFH 2GC4C 3PUCA 1MGOA 3CLWA 1JZ7A 1MCHA 2JIQA 2PXHA 2CL5A 4LPUA 1TPXC 4F4JA 2HI0A 2VLLA 3CN1A 1TIUA 3HNTL 3I5MA 3KWWA 2APBA 5BVHB 1RV6X 1N6OA 1EDHA 1E3DA 1P7WA 5MHSD 4CVZA 3ILPA 1AKNA 3ESQA 2XDHA 2CDGA 3V9CA 1PHPA 1F5WA 3EFDL 1M2JA 5L6YH 2NO4A 1LS6A 3LRMA 4YUWA 1JN6A 1TVCA 2J9RA 1I3GL 4Q8BA 1TVHA 1NMSA 5FYKH 3KPSA 1YEFL 2Z7YA 1QNLA 3GJ7A 5JAHA 4GKZB 1SJ9A 4FG6D 2J0UA 1NBYB 3EFEA 4IUYA 2PRIA 3HI6A 2FPOA 3SF0A 1PR2A 4Q6IC 3NZHH 2FI1A 4FSXA 4PY8J 4NZTH 5B5SA 2IXQB 5IG7A 4Y0VA 1I8LA 2Y9PB 5GGUB 5JEDA 4D8PB 3K91A 3G2OA 1NOFA 5ALLA 1WMBA 3NZUA 2CKBA 2KC0A 4CDMA 2VJKA 2IADA 5HILA 5JWHA 2OBLA 3SHFA 3EUDA 1HH4A 2XA8L 5IHWA 5ERWA 1D5MB 2F54A 1G84A 3QORC 3CU5A 1B73A 2QN1A 3AVXA 4A8JA 1I9JL 2AOTB 2AR9A 5SWSD 4BGLA 3BD8A 2H0FA 4REQA 1TZ2A 3DKRA 3ESZA 4BQBA 4X1KB 2QY9A 1YR9A 4GR9A 4DCVA 3CONA 2FN3A 4CM8A 2WMPA 1BQLH 4Q0MA 1NJ9B 1F0YA 4N0FA 4S1SL 4H26A 1P0FA 1XRMA 1KB3A 2TSBA 3CFTA 3GSWB 4CAGA 4NIMA 2A1UA 4FE7A 4A92A 2FWJA 4V1DB 1P2CA 2VAXA 3T5CA 1YS9A 2IZZA 4GAYB 2RAUA 3H18A 4BNYA 2NU9B 1T5WB 2E1RA 5IM4F 1OV6A 4WKGA 1Q7RA 3BWEA 4FNLL 1ZSHA 4WEQA 3B6SB 1KGWA 5SZJA 1R66A 1DVFB 3I62A 3LNIA 5FDYA 4LCWE 2B4CL 1OF1A 1ZEAL 1DQRA 4G1VA 2JFOA 1MT0A 1GADO 3R3HA 3FS9A 4HV8A 4N39A 4QULA 3U7RA 3ZE9A 1WUHS 3NHWA 2D8AA 1YD7A 3D3QA 3GL9A 1ZM4A 2VLKA 3WMSA 3UTDA 3EJRA 1I10A 3GEFA 5BURA 2VQEB 2F74A 3F8SA 1E66A 2BI7A 3QCVL 1B8UA 2EFDB 1GA6A 4M1CC 2YJTD 5M04A 2QW8A 3GSNL 2VH5L 2G09A 2V59A 3PQFA 3QHZL 3OOHA 4IDBA 4MA1B 2XVLA 2X4PA 1M9NA 3MUJA 5GPRA 1T9CA 3ZHCA 5LP6B 2FPPA 1P0QA 4N9OB 4IBWA 2BTQA 3ROZA 3R7WA 2XRMA 1MVFA 4X4MA 3C24A 1TJHL 5DQDH 1ZUNB 3CMOL 3OQJA 1AG0A 2I7OA 4IIJB 2XNHA 1ZH4A 1KKUA 4WTQA 2CLMB 2AKRB 4AZVA 2DLFH 1WUIS 1GEEA 2ZDGA 3TN7A 5FO9B 2NUTB 3DOCA 3H8VA 1KPRB 3LLSA 3TMYA 1KBGL 5B3KA 3TDNA 1DE4B 1Y7IA 4LOKA 3ILYA 1BXRB 3JQPA 2AEQL 4LARH 5BYKA 4Y9DA 1HHGB 1HLDA 5HD8C 4DAGL 1EFCA 3F98A 5JR3A 2GY7B 2JK5B 2ZETA 3SD2A 5CAEB 1T20A 4DBLE 1G1YA 1IC0A 2IKSA 3WD5H 1ZMYA 1IE4A 1OFTA 5EUQB 5MEOA 2G83A 4DLWA 5JECA 1CFMA 4KAXA 1TZKA 2W48A 4QOIA 2ZWNA 4NG5A 4QD3A 3CNEA 4ZQIA 3HTXA 1HHIA 1ULSA 4TQHA 3BQUC 3BD9A 2PUVA 2DEXX 4HRVA 2RD2A 3EY9A 2VBFA 3CBRA 4JP2A 4A16A 2AR0A 3VGFA 4WNQA 3ASNB 4QHUA 5DX0A 3RF7A 2Z3WA 3QNZA 3KWJA 3DOHA 5HF6A 4QG7A 3VXRA 4QHNA 1ZLVH 3DS8A 5LFAA 1ZGLP 1LO0L 5ER6A 4DLAA 5AWFC 1ZICA 4ZPVA 1PVOA 4YSOA 5I8ZA 4F21A 4K9NA 4EJFA 2D0PB 3E18A 1UOVA 1IEBA 5ICEA 2X14A 3W6NA 1OPRA 1QTPA 3FAKA 3L5IA 3ZJTA 4ATWA 4R2KA 4BNWA 3THXB 4P5DA 1W2HA 1TM5E 4YK7A 2QADC 3L1IA 3DXAA 4KSYA 3TDMA 4MZ3A 2NR6A 2WJVA 5BO5A 5DUML 2O2CA 3BQMB 4P2RA 1Z0IA 1FZOB 3OKNA 4DGVL 1M8PA 5BQFA 1A2QA 4JBNA 1KXTB 1WSWA 2DTML 5ESRA 5C7YA 1HHKA 4G8BA 2C2BA 1NBMD 1BGXH 2HA2A 4XP6L 3GX1A 1QYVA 4E5PA 5JQ6H 4XCFL 2O8FA 3VR4A 3SC6A 4RZCB 4KZEL 5FP0A 2NY5H 3M6FA 3CSYB 1FX0A 1BQ4A 4EFDA 1UADC 2QSYA 2FE0A 1DDIA 2XPGA 3S36X 2WIDA 1V6CA 2V5AA 4NPYA 3I01M 3EQ2A 4KVGA 2BY1A 1L3BA 3NAGA 3TW4A 1H69A 2JATA 5BMVA 1M83A 1DRUA 3SIKA 4O2EB 3UMMA 3K6NA 1D6VL 3OEED 3J07A 3QKRA 4QPPA 3QBVA 3KB8A 1BYNA 4YJ3F 4NRXB 3IE4A 5A6VA 1DCFA 3FQWA 5ESAB 3L7DA 2VC2B 5F3HA 1UC9A 1PN3A 5BNTA 3D59A 4B4VA 2N4IA 3H16A 5K8UA 2FFBA 3G2LA 3W7AA 5BXFA 3OQIB 5T1LB 4L5FL 1ONQB 1QC5B 1TCRA 1V5GA 4JKOA 4RQBA 2VDOL 1VBMA 1B0GA 2QV2A 3F74A 3ZBTA 1V26A 1KARA 3X1ZA 1MCKA 3B82A 4HS6A 3PXHA 4QRRA 1JAEA 3L6OO 2WY2D 2E5FA 2D1SA 1DJZA 1NOLA 2MQGA 4J5VA 2NLOA 1O03A 3DROA 5K3DA 3RWBA 3IE1A 4J94A 1MEXH 1JT9A 3UZQA 2D5CA 1HI9A 3RS3A 3L3IB 1G2IA 3EOBB 3D6FA 2BY2A 4KUCF 4ZTPH 4NV1A 3W39B 3UKOA 3L8EA 5IOKA 1XA4A 3ARQA 3KG2A 5F3BB 1QUNB 1UPXA 4B60A 4UQ3A 1T83C 1OE1A 4ZO8A 3KR1A 5GRJL 3P40A 3B1XA 3FF7A 2WUVA 4AZSA 4G6FD 3F6RA 2Q6TA 3L4VA 4N8EA 4TTAA 1XF4B 4OZHA 3VCLB 2AEWA 1JIQA 4RM3A 5HE8A 1J70A 2WWMD 3QBEA 2VQ1B 1K2DB 2IV9A 4LL9A 4YRBA 3RIHA 4L95C 1CL7H 1FDVA 3MRLA 3S28A 2OO7A 3FNEA 4ZRMA 3K32A 5DQ9A 2YA1A 2VO8A 3D0QA 3QNWA 4F4UA 3KPVA 5KSBF 1ETZB 8GPBA 3OC6A 3E05A 3FKSD 5LBSH 2BWIA 4WZBE 1MF2L 1YNSA 3KKZA 3ARDC 1NFDA 2R29A 3WFBH 3EXEB 3DRQB 4QXVA 3COZA 4WUVA 4ZOEA 3FUCA 1YFZA 1OLUB 2J20A 3KO8A 4WL0A 5I1AB 1DFIA 2OCCB 2J09A 4MQ4A 3JWDC 3MSPA 2QRMA 5C0RH 1ML3A 4J2XA 2X0IA 2LDBA 1ZHBB 2HT6A 3VYPA 3AAZA 5KDDA 4B6PA 2EZ0C 3KGTA 2D3NA 1PLJA 4C22A 3BFKA 4ZXBA 2WSIA 1ZS8A 2JAQA 1BJRE 3V8PA 2ODWA 1UJ3B 3ZKMC 1W0JD 2G0KA 1KMQA 1YAJA 5BW8A 4JN1L 2APJA 1BVNP 4Z5XA 4Y2PA 2JZCA 1C8QA 4KI5E 1JLRA 1SK9A 2QTWB 3AJDA 3WJJA 4PBDA 4Z7NE 4P5MB 3RCBA 4B9IA 3RTDA 3H1BA 2GPYA 1H1LB 5B7FA 1GN9A 2L2QA 3GRAA 4XI9A 4X1YA 2L69A 3TZEA 4JDZB 3O0DA 4D4KA 1DC6A 3CLTD 2JGDB 4MCHA 4B6OA 3V1UA 5EN2A 2K5UA 1YIDA 3CLUC 5LHDA 2JGKA 2YKGA 4JYCA 2DSNA 3TC9A 1E1RA 5AM1A 2Z8VC 1BWPA 2XODA 1ZT7B 3RASA 1H8SA 5FYLL 3PWLA 3V6BR 4A7TA 5F3RA 3GMOB 4CCYA 3DSNB 2V97A 5DK4A 2NP6A 1RQPA 1OHHD 3ETGA 4B73A 3O75A 4UZEA 4L9SA 4WBNF 4RD3A 1CY4A 2ZE6A 1UCBH 4C04A 2XZCH 3AFMA 3SSNA 3D7LA 5CBAA 5HTSA 1E62A 3OLIA 1B0AA 1Q19A 1T0BA 3T1QA 1A7RL 4WZBB 1Q0UA 2HJLA 5H5JA 2ZIGA 3OFJA 5EJEA 3AVPA 1OAOC 5FNVB 2V9TA 3L9YA 3O45B 1DO2A 5LUBA 2ZLBA 4Z8FL 2FQGA 3E1ZA 2DH2A 5EKDA 2VT3A 2DUJA 2F1BA 3WIHH 2Y1ZA 2F8IA 4FA6A 4ZCQA 5EIXA 4IYRA 3ZDAA 5KTMA 1QBLH 5J1AB 2XQIA 5FIEA 3G6JB 2AEJA 2G1UA 3JTEA 4L5YA 3L4XA 1PMYA 4DLYA 2YK1H 3QUYA 2QRVB 2IEDA 4YJ2A 1SUHA 3UTSE 5KJEA 4UBDD 2JBWA 2X4SA 2RARA 1SXIA 1QO3B 2JJMA 1KULA 1C16A 1TFHA 4Z95H 4XD7D 421PA 4BMVA 3AM8C 4JN6B 4U0JA 4OT1H 3G5XB 4OHUA 3IAS6 2VQTA 1A7AA 3WS6C 3IHTA 4BIKA 3VJLA 4KKNA 1Y7VA 1V96A 2B37A 4JGBA 1MIEH 4FLRA 3ZXSA 2H9GB 4Z7NB 2JK1A 3BJRA 4M8IA 1OYWA 3BIKA 3DBIA 4EQ2A 1L9SA 1XZ0A 2EW2A 3DC0A 4J3OC 3MJ7B 4NAJA 1KOAA 4M49A 1GL6A 4FI3C 3DO4A 2XNJA 3DX3A 4GWLA 4KKLD 1LJ8A 3VM5A 3GNLA 2VPQA 5K4AA 1NRXA 2PW1A 3BKYH 4RS3A 3VDMA 2JLYA 5DULA 4ARIA 1PS9A 1A5FL 1OANA 1SMKA 3BJ91 2P75A 4XGQA 3PWSA 4OH1A 1WZIA 3G89A 1CT9A 3FRUA 2DQJH 1KB5B 2I6GA 4JVLA 5FOWA 2RA1A 2QTHA 3WLKX 4PWJA 1AYRA 2V8MA 5GTDA 3NAAH 2H6EA 3QHTC 3FWHA 3HBFA 4JJ4A 4JVOA 1RZKC 5LMNB 3I92A 3HL0A 5H7XA 1QCZA 4JEHA 4IJKA 1CJTC 4GAGH 1U8HB 3WXVH 1AS8A 3ULUD 4P2BA 3QQ5A 4UNTA 2AJ8A 4EZMA 5B8CA 4WGFA 3QNYA 4LZLA 5DGIA 1FN4A 3MB5A 1I4FA 4J4HA 3BIXA 2HFGH 3NBAA 4KN6A 4G0OA 1XP5A 3SBEA 1YC2A 4IXMA 1KFEB 3UPUA 4I50A 4JXJA 1P3JA 3PZRA 1C9YA 3ZDFA 4BV1A 4CWAA 2KHZA 3A7EA 4WRLA 1CERA 3ZMEA 4CHGA 4O4JF 3H84A 4DMUB 4UUBA 3T94A 5GVSA 1R5BA 3ONFA 3VWKB 2JJWA 3ZX4A 2B3RA 2VJOA 2WWYA 2OTWB 2XBZA 4QTZA 3DAHA 3SGEH 1IGFL 2QTTA 4MAZA 1NTDA 4YONB 4DLSA 5C0CB 3ET9F 1ZL0A 1GEGA 1DFGA 4TTRA 4LAFA 2ES4A 3UTSB 4G43A 1CX9B 5CFNA 1CEEA 3V46A 1R33A 3D25B 4U8HA 3GJXC 4KXQA 4C83B 1YC5A 5IESL 2GM5A 3ALPA 4A9AA 5LL6P 1E9PA 4IHOA 5SYAA 3GFSA 5DMJB 3IAHA 4R9RA 3OPVA 5CW2A 4I2XA 5CJQL 3FFXA 4FB5A 2XUGA 2AJXH 1QH1B 1I7NA 4AVIA 2PQ2A 4D4JA 2JZNA 1FJ2A 2V7HB 2V1UA 1ZC3A 2XT0A 3QUML 4R96B 3FU3A 3MV01 4Q56A 4CEHB 1OLXA 5K8CA 4F93B 4X4YB 1K8YB 3IT8D 4AG3A 3T0AA 4ZI7F 1LE5A 1E0AA 2CLVA 4Q66C 4XMKH 4C4KT 3RPEA 3W9DA 1S5PA 1XRNA 2YKLL 2QVLA 1YMQA 1N6PA 5TQJA 2BIIA 1FZMB 3MA9L 5GV7A 2G88A 3ZTCC 4WPGA 4ODVH 1ACZA 3S35H 3UPTA 1LPNA 3SO3C 4I0PB 2IE0A 3AUKA 5TDNB 1RZ8B 3JD3A 4TNVK 3AI2A 2DRIA 3IU3B 3VGPA 2PP7A 1S78C 1IUPA 3UK0A 2QUZA 3O0LA 2Y0SA 5DJZA 2RK6A 3HN7A 4PJBE 4XAKD 2FYYA 5ERXA 4ONFL 4GMHA 2ZTSA 3LQAL 3RGVA 4DOMA 1IO4C 4K94C 3O6VA 4RZ2A 4OF3A 1D6EB 4MINA 2B3DA 1J5XA 3BIJA 3RO7A 1MJ7L 4KYUA 4PNHA 3ZE7A 1YJAA 1M6EX 4X0KB 2O5YL 3RFFA 3EEFA 4OIBA 1P5HA 5AVUA 2FJUA 2FJFB 1SZPA 3OJEA 5EBGA 4EZJA 5CNJA 4QRPA 4L1DA 1MFEH 1CFQB 1RFDH 3BRFA 2X1VA 5J5AA 1GTVA 1LPPA 4Z8YA 4BL5A 4G9DB 1VECA 5FHRA 4BLPA 3S2UA 2W92A 4EW3A 4QATA 4XIYA 5FYJE 4LCCC 3RUHA 1CG9B 1F4WH 2A6JA 3LUPA 1UKTA 4O51B 1X38A 4PO9A 4IU3B 4ONHB 4F5CA 1VSBA 1EXUB 4C0SA 4OGLA 5DUPL 4JZOA 1E1LA 1WFMA 4ELMF 1IC5H 2J8ZA 3HAEH 4JI4B 2NCEA 2YQ5A 4UREA 3B8YA 1VMKA 1GV1A 1DAHA 1RBMA 1QP4A 5I8EA 4ESVA 2H1RA 5HS4A 5DQJA 4FQ2H 4IKKA 3GQBB 2VTKA 3DXXA 1RIHH 4JO3H 3C4JA 3IOMA 1RFLA 4RAQA 3KPLA 1E5CA 5K05A 3BYZA 2DQFA 4TMXA 3PFKA 4MFHA 4P3KA 1PWZA 4UJ5A 2F6RA 2W60A 2KLRA 1YYMH 2GPZA 1OCWL 5LLTA 4MP8A 4WKXA 1P2TA 4V3BA 2BF7A 1PJ4A 1AUQA 4DUPA 2VSOA 4BHUA 5GHWL 2JVUA 2AUTA 3SLKA 3UTZB 4CDHA 3WTUA 4JFHD 2X7JA 4JQYA 3H5VA 3BICA 2UVQA 3H0EA 1GRCA 2RONA 1GGBL 2L7UA 2G9QA 5E08H 2HU5A 3AGPA 4NDNE 2IYPA 1MH1A 5J9PB 4LYAA 1ZPDA 4ODXB 4B45A 1C08A 4M5YL 1FAIH 4WFHE 2Z1MA 4PJBB 5K3CA 4LSQH 3VJ6A 1OK0A 4FFVD 5HE9A 5INCB 2VDWB 5F73A 2VOTA 1NVXQ 1EXMA 4MHHI 1HTBA 1DINA 5CB8A 2GXAA 1X87A 4CETA 2EV9A 1GQFA 3GVIA 4RFVA 1OQAA 5EUOE 2W6OA 2BHUA 1C0IA 4EI5C 4KITB 5EIHA 1Q83A 1Z47A 4L75A 1T0IA 1A7OL 2BHTA 4IKJA 5EZYF 3HADA 5F2NA 5J5VA 2VKXA 3AYXB 5E1BA 4AIZB 4XTCS 3BQVA 5EEGA 4D5EA 2YHGA 2FW9A 4P5TD 1A6AB 1G59A 3LCCA 2CUZA 1WMDA 3U9UB 2DWDB 3F7OA 4YDNA 5HGBA 4NJOA 1J10A 1HHJB 1UMDB 3VX1A 5C9KA 2FEOA 2ZIVB 2ZEJA 2GVDC 1W52X 3OOEA 5KAQG 2CJSA 3QWIA 2DAVA 1U3UA 2DIEA 3K94A 4KN8A 1AHWC 1LTKA 3QWAA 3BHIA 5CYOA 2XCMC 2WLZA 1ISHA 3HLYA 4OZFA 3HCDA 3GBML 5LGYA 1NJ2A 4KROB 3OCZA 4BSWB 2ERJC 5TGTA 1TUIA 3WGOA 4ZUVA 3H1AA 3USCS 4DIOA 4EZEA 7PCYA 4YASA 5HHNB 5CNIA 5HHTA 2H3NB 4N03A 3GEWB 3JWIA 3DSFH 1CZNA 3WJMB 5KSUB 1A7KA 2QTLA 2VJPA 5DYFA 2OYRA 3WAGA 2J0VA 3HP1A 5EGSA 4TKUA 4QYXA 3UGKA 1UC6A 2PU7A 1SC3A 3OR7A 3IDNA 3OCJA 3IP3A 3ZTYA 1AS7A 2YMLA 1J0KA 2ENQA 2Q6WB 3BMQA 2PS9A 3TRDA 3TUJC 1AH2A 5CU5A 3ZCQA 3SB3A 3E82A 4WXHA 2WD7A 1EGJL 2BGKA 3ORSA 4PCVA 2FX9L 2FSIA 2ZYRA 2Q41A 4F84A 4RMUA 4OZGA 3VYVA 1BOGA 1D03A 1ET7A 1S4MA 5J06A 2QSZA 2J48A 2QNIA 3KR3H 2F1KA 4GQAA 4YHIB 4KI0A 3MW8A 2J4WL 1EJ2A 5EL0A 4DY6A 4WIAA 1E98A 1ONOA 5F9DC 3PC7A 5DK0B 5EUOB 3KXFD 1JVBA 3K9HA 4M7LT 1UVQB 3WGQA 2B94A 1N0XL 2ZRMA 4XZ3A 4V0OA 1IAVA 2ARJQ 5DRYA 1OXBB 2B3TA 1W72L 4O58H 4J4PC 2ZROA 3TA3B 2X15A 1SXNA 3EDQA 4ADSG 3PWNA 4E13A 5HK9A 5WRFA 5MHTA 3QTLA 2ZCKL 1FQWA 1R88A 4NNPH 1TVMA 2V7TA 2VUIB 4NPHA 4BRVA 1EFDN 4D57A 2B99A 3DUFA 4O3UB 2JAXA 2YS6A 3RQIA 3ZTTA 3ORRA 4KREA 3JYNA 4N6OA 4LVUA 3UMNA 2C0CA 4LSVL 5IOPB 4X54A 5ALHA 5AT1A 1SMOA 3DARA 4Y6PA 3TN0D 1Q84A 5AKVA 3FK3A 3V0VA 3ZK0A 3I6BA 4JROA 5B6JA 1LBSA 3FUEA 2E9GA 2Q3DA 2ZBVA 1BROA 1RWPA 2H0PA 2DEUA 3UHAA 4KQXA 4CGYA 4OQDA 1LBTA 2RHOA 4OL9A 5C4IA 1E9RA 2Q9AA 1BYPA 1NBVH 5L3SB 4OQMA 3RWIA 4XMZA 1FP4A 1QIKA 3RQSA 1FSSA 5IF0A 2YN4A 3O7MA 1E7WA 4Z51A 2CA3A 5JSFA 4QSHA 1EVQA 1SCUA 3WIBA 5LNGA 1J1UA 5LXTB 1L6PA 2HUNA 1KNOA 4YGXB 1UBSB 1NRJB 3HM9A 3Q8LA 3ZWKA 4C4SA 1XIWB 5CRIA 1QEWA 4QY8A 4B9FA 1WFIA 2PGNA 1OIWA 1ZD8A 3KOXA 2WFLB 3NRBA 4R2HA 2ATVA 1MG5A 1Q72H 1HWGB 4U9IS 5CGYC 3SIPA 2JQZA 4X8CA 3A26A 3C6LB 1WX1A 3RWJA 4MR8A 4BJ6A 4PLHA 1XD9A 4ZOCA 3RWDB 1UACH 1IDOA 4IOLA 3KQOA 4FC7A 2A74A 2HRGA 4QXWA 4KJWD 4W9FC 3THWA 4BZ1A 1L1FA 3B8HA 3CH8A 4K2AA 1AXIB 3R5XA 4ISCA 3QMPA 1AHMA 1FZJA 1VLXA 3UYPB 3D6VA 4W63A 4QOHA 2DMKA 3MFFB 3AVQA 5MEQB 5D87A 5KKAA 1I8IB 1P4AA 1G1OA 2PUGA 4LXQA 4PLPA 4XZUB 3FRPB 3ZQWA 4UVEA 5CA1A 2IWGA 2QAGC 1QFWM 5K3OA 1SYVA 2CZCA 1AO7D 3FWPA 4HX1A 1HZZC 4RA3A 2GF0A 4QYMA 4MHSA 3ABLB 3R5JA 2B35A 4UU7A 4JOBA 2VYVA 1WZNA 2J67A 1WCIA 2VHUA 5CD3A 1OGPA 4IH1A 2REOA 5JD5A 4PJ7E 4BRWA 5D7KD 3KUDA 3VI3F 4DQOH 4PGAA 2GFBA 3PS9A 5JCOA 3PP3K 2BS9A 3G85A 4QTTB 3RARA 4IVQA 1U3VA 5KBLA 3BCSA 4M1KA 5DFAA 4B4WA 3DLTA 2YUWA 3SZOA 2JDID 5JDIA 1UOWA 4NYMR 1JTFA 1RRKA 4BEVA 1NIJA 4ZA2A 3A23A 5T5FL 1Z9LA 3P71T 2C98A 2GBIA 1OMOA 2ZCJA 4GHWA 3WV0A 3RB7A 4DZTA 1U04A 1KJVA 4P08A 4D5GA 4E5UA 1A47A 4Z9FA 2WWKT 2G8LA 1D9XA 3G0DA 4G5FA 3HZOA 4WV1C 5JOEA 4IDOA 1GYUA 4KMTL 3U83A 4D9EA 1LVEA 3GZKA 1O6SB 2SHKA 4AZWA 3HUJB 5JIBA 4UOZA 1F51E 5F23A 3UA3A 4FLEA 1ODLA 1H3UA 3L08A 1OD6A 3TL6A 4FG6C 2YXDA 4FM9A 1ZNYA 4QHMB 3K4QA 2ZP0T 5LXGL 2AW3A 4NUMA 4OM7A 5DZSA 3FHOA 1UA7A 2QKYA 3VXSA 4Y16A 4LSRH 2WYZA 2ZXBA 3LRSB 2UUAB 5LCVL 4NT6A 1WA2X 2IEGA 2XE8A 4EPXA 2VN4A 3T8YA 4RX4A 4L8FA 3X1XA 5H37H 2WAQA 1Y33E 1KTRL 3FQTA 1Z2CA 3FOEC 3CWCA 2VLRD 4Y2OA 5IBLD 2LD4A 4XNDA 2OI9C 4LSUH 2XWEA 3S35X 2OBGA 5DZVA 2I4MA 3C8UA 2R8PA 1JWAB 4D9MA 1NC2B 1LEKB 4IJ5A 2CHDA 1KU6A 2GLXA 2YHSA 1L5HB 5AQ0A 5IAGA 3EMDA 4GFTB 5CKGA 1L6RA 5EIWA 1D5BA 2ODNA 4EG3A 4KY1L 1K9VF 1PJLA 1L5RA 3W8EA 3MQ4A 2HTLD 3P9YA 3ZL2A 3GG2A 4PJ7B 2RGNC 4PY7B 1JHTB 3QDGD 1E5XA 4ZRGA 3PHLA 1A7QH 2I3GA 4UDTA 3LCYA 1N18A 4LHJB 3UC5A 2C34A 1OBCA 4M1CD 4NX2A 3Q5OA 5J13C 1GRQA 2FMFA 4JBGA 2LCQA 4IM8A 2P9FA 3MRVA 4CM7A 3HYCA 3L7KA 4WJZA 3TJZA 4UUMA 1O4VA 5K2MA 3MBXL 2C00A 1J86A 2EW1A 3PXAA 3OCYA 1WWCA 1L7TH 2EZUA 1XF3B 5AKIA 1Q44A 3EUWA 2WYHA 4K40A 3OY7A 2YPVL 5IULC 3VNYA 2BJMH 2I99A 2C4FU 2V74B 3VMPA 1FFDA 5DD0L 1PF3A 4DSOA 2MQCA 1X6LA 4DH2A 3H6HA 2Z35A 3I28A 2ACEA 1DRWA 1NLBH 1GZUA 4I87A 4W8OA 1NL0H 1RK0B 2WV9A 4A27A 2P8MB 2FGWH 3LLCA 1SLUA 1DRKA 2C4FT 4ZCIA 1J0XO 2QMUA 1S5HA 3ZS8A 5TGZA 4XN9A 2ZOWA 4TV9F 1ZD6A 2PX8A 3STBA 3FNKA 5KYGA 1U21A 2Y1WA 2F58H 2IYAA 3VBCA 1RUPL 1F2QA 4GX1A 4CMAA 2JB6A 2ZM5A 5HD8D 3QMMA 4Z7QF 5K0NA 5JASA 3ID6C 4Z99A 4E42B 2A0FA 3FSRA 4JM2A 4J2OA 2FXIA 1ECYA 5F9HA 2R8OA 5FJJA 2IBTA 4PX3A 2ESVA 1KEUA 3NH6A 2DV6A 2NV2B 4PV9B 4PGMA 1V5EA 2Y7QA 4MZ2A 4PONA 4GW1B 5THXA 4XOEA 4HDNA 1N34B 3BM5A 4GPAA 4C0XA 5IKOA 4PRID 1F58L 3O2VH 3ZV6A 2Z0UA 2H54A 1ZGCA 1GCUA 1UG9A 3X3GH 4L5CA 4XE5A 2H3HA 5C0AD 2CL6X 5EMLA 4XPIB 5GSVA 3GGDA 3L3OB 5F4ZA 1KYQA 3IEKA 2BDUA 3D3VD 4JG9A 3NVDA 1H2AS 4Z2AA 2P80A 4DILA 3THOA 3ZR6A 4ZI3A 2CNNA 3IDQA 4UTAL 3HVHA 3LVQE 5JZSA 1YJ5A 2D7QA 4EA7A 1V8FA 5FUZH 3QT2A 5T33L 1W0WA 1THMA 2ZUFA 2CIKA 5CDFE 3T3DA 3ST7A 4A0SA 1D6SA 4IG4A 1SEQL 2YXPX 2EFGA 4N82A 5E4OA 1KZ1A 3U6XS 2VJNA 2A77L 1XTZA 4ASUA 2WTNA 1LC3A 3N0TA 1NU8A 4GEIA 3PABA 4Y2JA 1XR8B 3H1EA 3LK6A 2WJAA 5LNDA 3SQOL 1T10A 4D45A 4D0CA 1Y4SA 3BDBA 2QT6A 2NTFB 2GEVA 4GRLA 4KDCA 3EO1A 5L40A 3OXSB 1FS5A 4UFPA 3FUNA 1J5EB 4WNSA 4JFFA 2CJPA 2BERA 5E6RB 2DIAA 1TO4A 2WE7A 2LFEA 2IVZA 4BFWA 1HNYA 2XMDA 2FDRA 2WLKA 3OKAA 4J6FA 5KZMB 2FBOJ 3IAAA 2PNJA 4P3DB 1TQBC 1ZJ6A 1G7QB 3T0EE 2V98A 2X4UB 2B4KA 5FUXA 4AMUA 3UBXI 3G0GA 3ZDZF 4YAGA 3O4LE 4BCDA 4Z2YA 1Y0LB 2J07A 2JD1A 5EEHA 3NABH 4MVYA 4WOJA 3EA0A 3O8CA 1KJNA 1RZIA 1KV3A 1NUDA 2QQFA 3N07A 4P93A 4UEJA 4KFZC 2CFRA 2XADA 4ATTA 2YBDA 1XMXA 4OLYL 2Y27A 3BAYA 4DN6A 4AJVA 1PQPA 1H2BA 2JJ2A 4IH4A 5ALIA 4DIUA 2WVUA 2C3GA 4KKAD 1SG6A 1GN8A 1FNEA 4CZ2A 2X3AA 5DHQA 3H9CA 5DTQA 4B2IA 3G5VA 5CSZB 1M1XA 3ZY3A 3OR6A 3COYA 4OF8A 3IOCA 1NA8A 5AI6A 3WA7A 3VRHA 3WIOA 5F9AC 2HJKB 1EIWA 4MXVE 3F9RA 3DJZA 2A35A 3ME0A 1CRZA 2CK0L 2VUOA 4EZLA 1I8TA 2X2HA 5AWNL 2DYKA 1AHIA 3F6SA 2ATPA 2P9YA 2XD4A 1CQIA 3HJBA 3LYRA 1QCDA 1LSUA 2HX1A 2OK0H 3NIDF 3LFUA 1I31A 5G53C 2Z5VA 1TQHA 3KUXA 1EFRD 4BUQA 4R01A 1OCOB 4FGMA 4L37B 4PJ8A 3S2YA 1KXVA 1QHQA 5E8NB 3WRVA 1IC7L 1YKGA 1S9XA 4LYHA 1ZUHA 4AGQA 2VUHB 5AVRA 2AI0L 1C29B 4TYPA 2PWYA 2BVTA 5IMLB 5CT6A 4CMIA 1U9IC 3ARXA 3CXUA 1QRNE 2JFFA 4APQC 3NRJA 2FMKA 4O5OA 1N7HA 1FFSA 2CK2A 3N85L 5TB5A 4NXNB 1UK6A 2XICA 2KPWA 2PL3A 2P4AB 3KJQA 1DLJA 5IM7A 2B0SH 1JJFA 3ZGVA 3Q6GL 4XPGL 5HTOA 1FUIA 2O50A 1JF1B 3VVBA 4Y67A 5JRZA 5MERA 1L6IA 1OZFA 2WWMC 1ZM2A 1LZLA 3LMJH 3A6ZA 3OZBA 3T0EB 3OUUA 3SC2B 1X5FA 1XNRB 2PH5A 2OXHA 4OSPA 2WM9B 2NY2B 1N2SA 3ZR4B 3CRMA 1V7ML 4FHCA 2QW1A 5A9SA 4JY6A 1F8YA 4KBYA 2DFDA 4EGJA 2NO6A 1S7CA 1M05A 1EK0A 3IMGA 3K0CC 1JHYA 5AVJA 4QASA 3MLVL 4PWKA 3IMUA 2E4UA 4IMPA 4BFSA 4OJEH 4P35A 4GUPB 3DFFA 1YEDB 4XN2A 3MV9A 3S6JA 4LEOA 2X2UA 4J76A 2D2VA 2FRDC 1E6KA 4EUPA 2REXB 3K6SA 5EEYA 3RK0A 2ZX7A 2W6JD 2FKAA 5IQ7L 2CWDA 3KWLA 3QQXA 4GSLA 2A5DA 3PV7A 4PJEF 2BHRA 1G66A 2GNAA 3S7TA 5CGTA 2W43A 2H1LA 3LPDA 1E6MA 2VDQH 3L1FA 4RA6A 4CU5A 1BKSB 5EP4A 3QDJD 1RMTA 4EBFA 2BNRD 3P4NA 5CHEA 4MB5A 3QPQD 1U2CA 2B6HA 2XRZA 1ZA1A 2AMLA 1N4XH 3WKCA 1MUJB 4JHBA 4GL2A 4MX8A 4QNRA 2BGJA 5KC8A 1EGHA 5SX5H 1E4WL 1BIFA 2X6AA 5DJ6B 3OCUA 3PZBA 2JFGA 4BC0A 1JQ3A 2XYCA 4X6EB 2PXXA 1QRNB 2I5PO 1TSHA 1XU9A 2CHQA 3HJNA 1TK3A 1WMSA 5LQNA 1J39A 1J5CA 3ZH2A 3G6AB 4JW3A 1KN2L 4J0JA 4YBLB 4H1UA 5CFPA 4FQXD 2OBNA 2I60L 1EX9A 1U3YA 2LTAA 4H8PA 3E9QA 3RWGB 5KJ6A 2YTZA 3EYFB 5IKCB 3I37X 1QGDA 4OIMA 2HJFB 2PRKA 4YXHL 1GKEA 1A8IA 1RABA 4P2QD 2OOSA 3W79A 1IC4H 2X28A 1HBJA 2PZAA 5F21B 4GS5A 4HWTA 2G5CA 3QUAA 2DP4E 1TITA 1KCWA 4NCC2 1HYSD 4WUUE 4L28A 3ESAA 3WWDA 5DD3H 5C0DB 1SJHB 2YOCA 4AJPA 2H8PA 1L5GB 4F97A 2P62A 2G30A 3W8NA 1R6UA 4U7DA 2RMNA 2B36A 2J6HA 3V52H 1GXSB 1XU4A 5DWDA 2IXBA 5EEWA 4FR0A 2EDWA 4K3JH 1KZYA 2I2CA 2ODAA 3LDUA 2A9PA 4Z7UA 1SBSL 1NJFA 3LECA 3ZQ4A 3UTPD 2QQLH 3U44B 1KJMB 3ZV7A 1OAUL 3D8MA 1VTKA 3QXUA 4D26A 4UBDC 4OBSA 1OBVA 1ZIAA 3MIZA 5HRAA 1FL3A 5TE4H 1O7DC 1LQUA 1BW9A 4HHEA 4BRUA 4FG2A 3WLWC 2AZDA 3MVEA 2UYQA 1P6WA 2F3TA 4OYYA 2XD9A 2FEKA 3KOMA 3NFPA 3H8NA 5IQMA 3OKCA 5JMRA 3FSAA 2F62A 5B22A 1TUPA 5K0SA 3ZYOA 2CM5A 4HFWA 4KKLC 2BKVA 1HXKA 5FL3A 3LQ1A 1O89A 5CF3A 4L8GA 5FK9A 4P0QB 3ZOAA 1JLMA 1U5CA 3PFCA 3RB5A 4ZJZA 1YO6A 2OHOA 2YWBA 4UM8A 3IFOA 4RZXA 1HL4A 1TNNA 1KBZA 1GHFH 5DHYB 4XCEA 1NANI 5FTNA 4I9WE 4INOA 3KVPA 2Y2YA 1Y5NA 1MZYA 1FH5H 4AC2A 1PX2A 1DN0B 2X9QA 3GK3A 2M1KA 4RMQA 2VQFB 5I5MA 1JP5A 1WFOA 3D87B 4AQ1B 1AZTA 3KAKA 3KJGA 4HAOA 1FFNB 2FR4A 1I80A 3LKPA 1PZAA 3DX9B 3HEBA 2ARJB 1IEXA 2XWPA 1MA0A 3ULUC 4FWWA 4PS4H 3O6LH 3QS3A 1Z0JA 5K3BA 1JKXA 4UB0L 3IAM1 4ZTUB 4CNIA 3AR9A 4WUUB 4FJ6A 1OP3K 3GLVA 4AN1A 4WY8A 4XJVA 3LEYL 3UAJA 3LEVH 3WL5A 5CHNB 4EIUA 3ZHSA 4NUJA 3T1TA 1YUMA 2DHQA 3QC5X 1Z16A 5FA3A 4AWXA 1GC1L 4WOPA 1GGNA 3V5DB 5JPMA 5IB1A 2P8PB 3T09A 2JCXA 2MCAA 5C8YF 1UB6A 2WQSA 3VXKA 4K9QA 2IGBA 4KDTC 2J4CA 3TT1H 2HREA 1VFBA 2NVWA 1PL7A 1N3YA 1BVRA 4MWFA 2OCIA 2Q76B 1YNTA 3E8MA 1CU4L 2W2NA 3EIXA 3PNBA 4AITA 5CCJA 2ZXQA 2BNUB 2NVBA 4LSPH 4DLLA 1KPUA 3BISA 1V8HA 1MXDA 3UJJH 4F0JA 3IV6A 3FA2A 1RS0A 3NTCH 1S3GA 4GMDA 2GITA 4R0LC 2BEWA 3PC3A 1RPZA 3AROA 1YIOA 2MNUA 4WGGA 2BXZA 3H4HA 1F4LA 4BQPA 4HSQA 1UT6A 3ED5A 1NQWA 3F7NA 1QQDA 3QWBA 5K6RA 5TJ9A 1NM5A 3CNNA 2A5LA 1M4KA 4OJNA 3S4SB 3T3HA 3HZHA 4E3WA 3LVFO 2PTUA 3JALB 3T65B 4B6FA 2D1QA 3QRGL 1DAOA 3WFEH 4TSCH 4FCVA 2G28A 4MAYC 5TQ0H 5IMBA 2RMKA 5EJAA 4LZJA 4IWYA 4QJ3B 4FCCA 4XVSL 3CVVA 4M56A 4OD3L 1P7QB 1BS2A 2G36A 3VYUB 1M7UA 2AK2A 2H08A 3C98A 1FXWA 1ZLYA 2YCBA 4S1RL 4B8YA 4UT9L 3MHTA 4G8GE 3PP4H 3DA8A 2IX9A 5EOCL 4OF4A 5KUMA 2AK4E 5EIEA 1E8WA 3FSEA 1UJNA 5BSGA 1U9CA 2H59A 4K1LA 5I5JA 1XH1A 3URKA 1GUAA 4BO9A 5BRNA 8ABPA 5CN2A 1EBFA 3MNWA 3U4GA 1YVEI 4GOOD 1FFRA 5AKLA 4UMSA 2CT8A 4ZFZA 3MS2A 3KQWA 3L7YA 1JWMB 2VDPH 2ZCLH 3ZHXA 3ARGB 3L41A 4FQHA 4UVHA 1A9QA 3FFWA 4CJ0A 4AI6A 9LDBA 3U3JA 3VA7A 1AA6A 4BKOA 4WD3A 1JUDA 2VXUH 4XX1E 3BB1A 1QJ4A 1UXKA 1I0ZA 5I7SA 5TK4A 3PR2B 4X00A 3NWOA 4JENA 3OKOA 3OLDA 1SNYA 4MHHG 3OQVA 1F1DA 2JLPA 4YDKH 5BVGA 3CR8A 3GNTA 2ITEA 4II2A 4KJQD 4CW1A 2FAXA 4CNBA 3EXLA 3QOYA 1S46A 1XZJA 3HMWL 3MBWB 4XZ4A 5FR3A 1LNUA 3O11B 4KN5A 2GG1A 4UAUA 3NP7A 1RAGA 4X8MA 4FFLA 2QUAA 3D1VA 1KH2A 5DDHA 3HMXA 1YIAA 1EHYA 3E27A 1ZNZA 4TYYA 1IIKA 1NT4A 1I0LA 2EGHA 4CDNA 2EL7A 2IYUA 3NASA 5AHXA 3EO0A 1NDTA 4CM4B 5KTEH 1UZUA 5C9JA 2OC9A 3GC3A 4KMRA 1Y3CE 3ZT5A 4U6SA 5I8OH 1NOJA 2OTCA 5F7AA 2DBVO 3GRWL 4MAFA 4NN6C 1N67A 3NHJA 1R0XA 2OGTA 2WYUA 2E6KA 2UDPA 5LDGA 4KXFB 4CEIB 4FNQA 5LQBL 2OULB 4RH4A 1Q90A 4ZN6A 4KDEA 3KOUA 4NNXA 3FDWA 1N92A 3E2HB 4G8GB 4A63A 3BSHA 3EIWA 2QNBA 1ZOLA 2AK4B 5F5NA 3GIZH 2AEIT 4FFYH 1MCOL 3BE6A 1I2MA 5FHAL 1V8DA 3ND6A 4LE2A 5D5QA 4H88L 3WGIA 3NDIA 4FDVA 1RYFA 2G5GX 2HIAA 4DDMA 2LDXA 1I3UA 4YHLH 4CMHB 2H26B 1Y7LA 1O8CA 1NCGA 4DVBB 4O2RA 3A1TA 4AI7A 1A5ZA 3SE3C 1XZBA 1ZVQA 4DSZA 1RIUH 4WO4B 4OUOA 1TM1E 5B38A 4NQED 1R47A 1QFHA 4MQEB 4FADA 2B8OT 4RNDB 1G9NC 2OR9L 1JG1A 1S9VB 4FFVC 2XJ4A 1SY6H 3VXNB 2V33A 2MOQA 2P3YA 3RFZC 5GS0H 1QGUB 4Q9JA 4A10A 5EAIA 3V6FB 4IQ4A 1MCIA 1ARZA 4FGWA 3LLVA 4O02L 2WRZA 1KSJA 5JNWA 2OJZL 3ZG6A 3HG1A 1MWOA 3CVCA 4GEJA 1XGQB 2ZRQA 4W9NC 4LVNA 4ENUA 4P5TC 1H5BA 2XZTA 3ELAT 3CX7A 3FSGA 3C5CA 3VGHA 3ZHYA 3R3ZA 4OXYA 5IGXH 4YPOA 4G86A 2R0ZH 4A7GA 1NQVA 1EXGA 4ZEVA 1G94A 1HORA 5HIIA 2I9LA 1V7NL 1R16A 2Q0HA 3U49A 1OFUA 2FUG1 3IKMB 4LRYA 4TTDD 3FT1A 3PU7A 2KM1A 1GY1A 2NSXA 3BD6A 2WIIA 3TX4A 4CR6A 1T9ZA 3U9SA 3SKOB 2P9GA 1TTPB 2QT9A 2PBRA 3KW7A 1KJQA 4NXKA 5ENWB 5CH3A 1IGIH 5LYYA 2XMGA 1ZVSB 2W0PA 3FJYA 3DCNA 4JQOA 3MNZA 3DMMA 4LF3B 5D2NE 1PSWA 4BMOB 5GQBA 1D7FA 4LSTL 3VFWB 3W6UA 4O29A 1WZKA 4Q9IA 5DEGA 3NFSH 4XNAA 1ZBDA 2Z9BA 2UWEF 1T1YA 4MIEA 2VGLM 1WDLA 3F3MA 3P9ZA 3OA2A 4HL6A 2XG5B 3NJNA 4MJHA 5F7DA 4NLLA 3E9UA 4Z49A 3CR3C 2ZR8A 4ZDKA 2W6CX 4G9FD 2GZDA 2VSFA 2CLZA 3DYIA 4WW2C 1EWRA 5GJTL 4AEHH 2GVZC 5FWQA 2QRNA 3UG3A 5CFRA 4BLVA 1RRCA 3NV7A 3W6OA 3QMVA 1YGYA 4DP8X 4NS0A 2CNKA 2X58A 2OMVB 2J1KA 3S3SA 2VXQA 3FTGB 5IREA 4LXHA 2AMJA 2GABA 3QDMA 2UYHA 2QRPA 1E58A 2HG0A 5EWMA 1D0SA 5GS1B 1J0ZA 1E3FA 4TRPL 4X7RA 3D52A 4OUUA 2PTTB 3ZKSD 3QYMA 2FATL 2XETA 1YRLA 1FBIH 2VAVA 4JLWA 2CKDA 3TIDB 5AM5A 4TZKA 2ADIA 4RWEA 1Y6JA 3EISA 4XP9H 4RISL 1IM3D 4XXWC 3SDXE 1KTDB 4LEEA 4N3AA 4MJIA 1QTRA 5LBUA 3A3YB 4LYGA 3DUUA 2Z5GA 1QHXA 2ZOTA 2AIRA 3SE4C 5AAWC 1HRDA 2ORYA 3TZHA 4UQPA 2CBTA 2JIPA 4NS4A 2E74C 1WISA 4MRCA 1N70A 1YN7B 2YD4A 4NPKA 2P5TB 3CAFA 4UQCA 1HDXA 5C3LD 5F1PA 4DP4X 3OKFA 2AN1A 3RL1B 1UBRS 1XCWA 4GQZA 3CT4A 4U0RB 1RWMA 2Q29A 2IWEA 5LZ5A 5HWSA 3GNMH 5KNBA 3VB9A 1JGUH 1QE3A 3UNXA 1Z6PA 4ECEA 5LMCA 4CUCA 4YPGA 2NY7L 2AXPA 4R7TA 3GLIA 5B3JC 2Z4TA 4P5SA 4N0RA 4N2AA 3GSQA 3OQ1A 1TGVA 2WHPB 1RVFL 4KPHH 3ARFD 4LASL 1QDLB 4Q7LA 4OFVA 3EQ9A 4C29A 5D2NB 5AAMC 5DM4A 4M4RB 1S4IA 1WW2A 2WNWA 2P42B 1IWBB 4OB8A 4BJ5A 4YCAA 4XI5D 4QM7A 4NN7C 4JGNA 2F55A 1FDOA 2VMEA 3UN1A 1BJKA 5DZNA 2H32A 1V7ZA 1F6FB 4J91A 1IGCL 3STZA 4LXYA 3G08A 2BVPA 2BEVB 1IM9B 1IHXA 3AXLA 4E5XA 1CE6A 4KAJA 3G0OA 4XUGB 3IUBA 4WK0B 2P6MA 4LNRA 3S88L 2QLFA 1A3RL 5IAOA 2CXSA 1YZ3A 3TD6A 1RXUA 4GU5A 1DC4A 3WLFA 2DKMA 3CUUA 1TKBA 2A5UA 5I6KA 4NZFA 1Z6JT 3U6BA 3HPJB 3I74A 1RJLA 1P1RA 3AETB 4GE0A 4R7GA 2XG4A 3LZFH 4QRSA 2IXGA 3LC2O 1NGZB 5D71H 4PPFA 2BP8B 4EL0A 1GAXA 1KJWA 4KJWC 1MRNA 2WJ7A 3RG2A 2IHNA 5BPPA 4IBQA 1WZLA 1UC5B 3OD5A 3SDXB 3PXGA 1U8LA 5IDVA 2J2ZA 1A2OA 3LRXA 3DBRB 5FWYA 4LDPA 1MFBL 2Q2OA 1CUDA 4YE4L 1M7GA 4ZQBA 5J4KA 4C08A 2O7NA 3TOVA 2C4NA 4ZMOA 4YAEA 4PRPE 1QPKA 2HXYA 1QO7A 2HCZX 1X1TA 4GFDA 2HYIC 3OKDB 5JW4R 2O6PA 4TZ6A 5FYKE 4NBWA 3CW2A 3MF4A 4I9FA 1UL1X 4U3HA 2F9MA 3PX2A 4NOBA 3BKML 1SBQA 2B34A 3HXLA 5DB4A 3U1QA 2DHDA 3L3JB 1QB8A 1LBQA 1KQOA 3G5YB 2BP0B 3NSJA 1LPOA 1UPFA 4DLVA 1GCAA 3LUBA 5KOVC 5AJZA 5A7FA 5J5EA 1QSZA 2XIIA 4O0LA 2FJ0A 3D1JA 2BCKB 3QNFA 5C81A 4Q15A 2JXMA 4PBTA 2VL7A 1S3KL 2VM9A 1UCFA 1E2DA 3HABA 4JKIA 1J1OH 3AITA 2JJVA 2J59A 4KO3S 3LWZA 1NZDA 5GQSA 1EHXA 1VCMA 4M43L 1XL4A 4F7EA 2FT8A 4EPSA 5I1DB 3U6KA 1OGAE 4EOWH 1I5RA 3V9EA 4RK5A 3ULVD 1EBAA 3RWEB 2QI9C 2ID5A 4JQIA 4ZSOE 1Z7WA 4ZGBA 1B16A 4YX9A 2X0WA 5EU4A 3OTGA 2PYEE 1R4AA 2G06A 1WQ3A 2CZNA 3VHLB 4HX2A 1A8JH 1TW3A 1YHZA 4FGUA 3VR3D 3V6OE 2PS1A 2BMAA 1CY8A 2IY9A 1ECPA 3ARBA 1UWGH 5EO0A 3TXAA 2PCFA 5IEBA 5CWSA 4W4TA 1M1SA 3EFOA 3JZYA 3OH8A 4Z3TA 4OQTL 1VHJA 2DPGA 3KTFA 4F33A 1RZGA 1RAHA 3HC4L 4Y1AA 4LE8A 2ICWJ 3U5TA 2AP2A 3LOQA 1O5PA 3YASA 5D7SH 3S99A 4QF1B 4FQ1L 5IBLC 1OARL 3OB0H 5DSCA 1RZ3A 4JP8A 1N64L 3BYTA 3GDFA 5ICYA 5KYXB 2CVOA 4E2WA 1Z9BA 3FTVA 4XP4L 5CX1B 4OM8A 3DUWA 3QQ4A 2X5NA 4PCUA 3AILA 4MVCA 3PWZA 4QEGA 4XN8A 4PRPB 4MWDA 1T7YA 3GJ4A 5JH7F 4YAUA 4P48A 4PCKA 5AUOB 1T9GR 2HTLC 3S37L 2GAJA 3BWVA 3U4MA 4ENPA 4Y1SA 1J22A 3ZRSA 1AXGA 4BWYA 4OH7A 5E7JA 1M7IA 4RTJA 4YR6B 4ANXA 3ICPA 1X7HA 2QHRH 2QN3A 4MS1B 1Z39A 1A9XB 1DQQA 1X1SA 3PJDA 2EX0A 1ZI8A 1WEJH 1TA4A 3JW8A 4XBGA 1XQVA 3NIBA 5J4HA 4JCMA 4I55A 3GLZA 3FCAA 4RVNA 1VSUA 3F85A 1PNDA 2C5DC 1UUNA 1U2SA 3RX5A 4YHOH 4AN0A 3IJEB 5E8RA 2J5KA 4QGFA 1HSBB 4ERXA 2FSUA 1OL0A 5IWLA 4L50A 5J47A 1LPMA 1ND5A 3VISA 1E40A 3HVUA 3S2GA 3AU9A 2W8BA 1MFCL 4YA6A 1UD4A 3ZHUA 4B3FX 1V10A 3VYOA 4GBGA 1FQJA 5SICE 4IX1A 4N1EA 2V54A 1NRIA 3D07A 4JUCA 5EP3A 1VLVA 4H0GA 4LPSA 3QXGA 4JRYD 4PYHA 2YVLA 1VE9A 4ZUUB 5LKNA 4JB8A 4B3XA 1YR7A 3U61B 2VHTA 3F1KA 1ZK9A 3FVVA 3IPLA 4TRJA 2WLMA 3L79A 1G5GA 1USQA 1DC7A 3PNVA 4NCAA 3UBXG 4D94A 3KQMA 5DHUA 4LYFA 4FMPA 4WLNA 3CVHA 5F64A 4FNPA 3IA7A 4K73A 4A6YL 1CPYA 4P22A 3W2DL 2ID8A 1KZHA 1NPJA 2X4RA 2YD1A 5L8LB 3DE4X 4BELD 2W5PA 3DV4B 5LKAA 2YMQA 5IZCA 3T0FA 1K8XB 3W06A 4NZDA 1TJ3A 5EV7A 4NI6A 1HE7A 3A4LA 3LYAA 2R0KH 1CLOH 4FMFA 3HG7A 3B1TA 3KPNA 1IRIA 1MQKH 2OCGA 2NTVA 5HJDA 1KO7A 1CG6A 5I1HH 1OIVA 3SSAA 2NYRA 3N5AA 1XZLA 5EO9A 4HCRH 1GSOA 2D4FA 2QD5A 2HC9A 4J1UB 4LCWB 4MUYA 1Z7JA 2GBPA 2YQZA 5L2KE 1QV7A 5B53A 4UOW1 3A47A 1UXSB 4ZIRB 3SYCA 5MP6L 4HMQA 1ADFA 5BW7C 3ESNA 2PWBA 4PHFA 2RHGB 3EXIB 1LQSR 5IHZA 1IVSA 4JFDA 2LRHA 1E9SA 4OFPA 4BZ2H 4DP7X 5FO7A 1A22B 3FT4B 2OBBA 2PEZA 3CG8A 1Q0ZA 3O9MA 4Q00A 3NP9A 4QRDA 5DFVC 5TRTA 1IEVA 1I7RA 1HH9A 5F6HJ 2EP5A 5ABPA 2H51A 1HZKA 5I0YA 5CG2A 2CL0X 3QP3A 5JPCA 1ISRA 3KPRE 3NA4A 1AQKL 1Y6NR 1INQA 4TTQA 3MRIA 1DIOB 2FY8A 3A9UA 1B2WL 4Y5XB 1HXYA 2WJGA 3CHSA 5IYZB 5EC8A 1WITA 3V0HA 5C97A 5GZOA 3LQ4A 3I6LE 5CR1A 5JG7A 4G8AC 4PH8A 4E46A 2EICA 3PXDA 3SYQA 1JXQA 5GIRB 2P7HA 1UZ8A 3QVSA 3OX1A 5IBUG 2W2LD 5CLYA 3DE6X 2NVUB 3PWPD 4C47A 4RAUA 4KO7A 3FOCA 2Y36L 2IU3A 1T04B 4I13B 2XQBH 2LKCA 2Z31B 3LSOA 1YR3A 3R7LA 2MPVA 4TL6A 1QHFA 4LQLA 3KAJA 1EUDA 2XT6A 3DRTB 3U30B 1NBIA 1O94A 3P94A 4H31A 4X8LA 1OAZL 4PLVA 1C5KA 3GEMA 1EHCA 4KTDL 5ELLA 1BVNT 2I29A 3A9VA 1I7ZA 2VZLA 4JANB 1BLNB 1B41A 1JHMA 4QBFA 3AEZA 4IUCS 1H8OA 3ND8A 4R97C 3FBKA 3BCFA 3QVTA 2E0IA 1ZR2A 2PABA 4ZZ1A 3D0VA 3L7EB 3IHLA 2H8GA 5IMOA 1ZWLA 1JRHI 1HDRA 1YAZA 4J28A 4M6MH 4PAOA 2EIBA 2Y7NA 4I3RH 4KKAC 1X5IA 4OHYA 1ETB1 3L95A 4GC9A 3REVA 4NFHA 1G8GA 1JZ5A 2WUCH 3R6WA 1S8OA 4F1WA 3FGPA 2EEDA 3K92A 3IP6A 2BFDA 3DBHA 5DZOA 1TQDA 5L2KB 4TSKA 1ESEA 4JY5H 3IQXA 2MCFA 3TO5A 3RWFB 3IOEA 3PDIA 5LJIA 4GUCA 1D7BA 5ED4A 2IZ6A 3CGWA 4XDYA 4WDRA 5FPIA 2ZIXB 1X7YB 3BD5A 3ZBQA 4YO0B 1QSFD 1ZD3A 1Q7TA 4DKXA 1BAFH 3PAUA 5I9QC 2I4OA 4OM0L 4LDNA 3RABA 4APQD 2EG5A 3U56A 4JQXA 3EWSA 3RAJA 3NPSC 4OSOA 3UAYA 4E31A 2CXHA 4QXOA 1OP4A 2Z3ZA 1WPQA 4M1QA 2X8WA 4QEDA 3KPRB 1P19A 3TPUA 2W42A 1GZDA 1NN3A 2YD0A 3UK7A 1JIBA 1SBZA 2ZOOA 5E5RB 4MTCA 5ITWA 3MYRA 2Y24A 1H0RA 4X6CA 3VPHA 5HDWA 1V41E 3MWFA 1TTAA 3EF1A 4Q4HB 3KG5A 1XNHA 2JFVA 1IATA 4E33A 2G9NA 3FXAA 3IOBA 2H1PH 1T1EA 1J5OL 2P5EA 3B12A 3N6RA 4MS4A 3HI5L 1ACJA 4EA9A 1B2RA 3MT9A 3I1IA 3B2DC 4MQXD 5AZ2L 4DHLA 4S1PA 3WLMA 1BAPA 2IOFA 1FSKC 4QKXB 4ZVSA 1NEZA 5FDWB 2E5WA 2NZWA 2XWJI 4R9VA 2FZWA 4MV7A 4B5LA 1Z5PA 4H16A 2ZKXA 4M7OA 2EJWA 5EFIB 1SULA 3MOQA 1L5QA 1MO5A 3CX8A 1NAMH 4OJKA 4G82A 2VTBA 4YSSA 4EGQA 2FWSA 1V35A 4ZAGA 3I75A 3R5HA 1E3WB 3OTWA 3SJZA 4XBPB 2V7WA 3TLYA 3C8ZA 5EJGA 1JSRA 3QV2A 5FDFA 2WPGA 3AMLA 7REQA 3BWMA 3TEMA 3W78A 4KFCA 3OD3A 4V0SA 1RULL 3PWVA 3K1ZA 4KK8C 4Y0AA 5AKZA 3F46A 1QPGA 3MQFA 2PVSA 3U7HB 5C0EB 3DZFA 4WCFC 4X9IA 2OMEA 4MNQD 1Z17A 1ECGA 1T1IA 4Q12A 4LDAA 5HHVH 1ZDMA 4GP6A 3BZWA 1SDDA 2G4CA 1AQDB 2OZ4A 2A1WL 4RD0A 1UWEH 1I9IH 4M76B 1BWQA 2BFCB 3SN6N 5ELXA