3ZE1B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze1B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze1B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze1B03
1SSLA 3AL9A 4FX5A 1SQ0A 3GXBA 2VC2B 1PCXA 4C2AA 3T3MB 1MJNA 2P26A 1JLMA 5KYUA 1U0NA 4NENB 4WFQA 5KYNA 1FE8A 2O7NA 1MHPA 3PPYA 4DMUB 3VI3B 1DZIA 1RTKA 3EFOB 1IJBA 1JEQA 2X5NA 4G1EA 3ZDXB 1QCYA 4HQNA 5KYUB 5KYWB 1M2VA 3FCSA 1AOXA 3PPWA 3TVYA 4O3UB 3T3PB 5HGJA 5KYYA 3NVQA 2ADFA 4UM9D 4IGIA 2I91A 1UEXC 3EOBI 3FCSB 3OKYB 5E6UB 5KYYB 3HXOA 3F78A 3NIDB 2VDQB 1YUKA 2ICAA 2I6QA 3BN3A 3EH1A 4A0QA 3AL8A 3ZE0B 1BHQ1 4HQFA 1SHTX 4MMZA 4G1MA 1BHO1 3AL8B 4WK0B 1AUQA 1ZOOA 2NVOA 1PD1A 1OAKA 3M6FA 1L5GA 4MMZB 4G1MB 1ZOPA 3ZE2B 3N2NA 5KYXA 3OKWA 3F74A 1JEYA 1ZONA 4IHKA 1IDOA 3TXAA 4WJKB 2B2XA 4F1KA 2NUPA 3K6SA 3ZDYB 5KYXB 2XWJI 5E6SA 2VDNB 4WK4B 4M76B 2VDKB 2NUPB 1SHYB 3K6SB 3V4VB 5E6SB 1MQ9A 3E2MA 1M10A 4C2BA 1FNSA 1JEQB 2QTVA 4G1EB 3EGXA 2P28A 4Z7QB 1M2VB 2I6SA 1V7PC 4PN7A 2VDRB 3FCUB 1RRKA 1T0PA 3RAGA 1N3YA 1XDDA 3BQNB 4O3TB 4HQLA 5LN1A 3HXQA 3TW0A 1QC5A 4MMYA 3VI4B 4K3JB 1T6BY 3IJEA 4O02A 1LFAA 1PT6A 1XDGA 2WINI 1QC5B 3EOAI 5E6RA 1M1XA 4MMYB 2VDMB 1OLZA 1JV2A 1DGQA 3Q3GE 4O02B 4XW2A 1L5GB 1CQPA 2ODQA 1YVPA 1JEYB 1M1XB 1YVRA 5HDBB 3EG9A 2ODPA 4IXDA 1U0OC 4Z7NB 3OL2A 1TYEB 5E6UA 3HI6A 1MQAA 1IJKA 1PD0A 1IDN1 4F1JA 5HJ2A 3TCXB 1RD4A 3OL2B 1AO3A 4HQOA 4HQKA 5ES4B 1XUOA 1RS0A 3QA3E 3V4PB 4NEHB 1MQ8B 4JX0A 3ZQKA 3AFCA 3IBSA 3EGXB 4MMXA 1Q0PA 4BJ3A 4NENA 4WK2B 3PPVA 3NIFB 3ZDZB 4GZ8A 3EH2A 4MMXB 4FWWA 1MF7A 3NIGB 2IUEA 3EFOA 5KYWA 1CK4A 3K72A 2XWBF 3PPXA 3K71A 2UZYB 2XGGA 4JDUA 2NUTA 1M2OA 3EGDA 4CN8A 2VDPB 1NA5A 2M32A 1U8CA 3IJEB 3K72B 1N9ZA 3K71B 1SHUX 4CN9A 5E6RB 2NUTB 4Z7OB 3BQMB 1JV2B 4UM9B 3EGDB 4CNBA 5BV8A 3ZE1B 1U8CB 2VDLB 1M1UA 4C29A 2WW8A 3EG9B 1ATZA 4UM8B 2VDOB
chains in the Genus database with same CATH superfamily
5DPMA 4WI0B 5J2TA 1BU8A 2X6UA 3KZKA 1XMPA 5C4MA 1M2HA 5BRPA 2WB2A 1P5UA 5IB4A 3DZHA 1MA3A 1XZGA 3VH1A 1HDCA 5BORA 3ARRA 1KI9A 3VH8B 4IZIA 2NCMA 3OAUL 1SUCA 5DGIA 3Q8XB 2YHSA 5IM4A 5HYSA 1UXGA 4ZXBD 4P93A 2W2VA 3WIBA 3D2AA 1Y1PA 1FN4B 1KACB 4LBWA 2NNLD 1EX1A 5HM8A 2X6AA 5I1JH 2NVUA 2I6GA 3PDIB 4JFVA 2VQ1A 1WTAA 2O14A 4PIVA 5ALUA 1NBVL 1P4IL 5B3JF 1IO4C 5B38A 3EHBD 4MR8A 1JDSA 1MC5A 3KPSE 4HUXB 2WE7A 1MCHA 4KUZH 2Z43A 4L28A 2Q07A 2GTWB 1LMIA 1TA4A 1W9MA 1HNWB 4H5SA 4R6XA 2VDMH 1UJNA 1HDYA 4RAHA 1LW7A 3G6JF 5TQ0A 1IEXA 4GWGA 2VLRE 3HI1A 3H3FA 5HSFA 3MCVA 4M3NA 2BM3A 3RBVA 3TNMB 1Z6XA 1OLOA 2X19A 5KPDA 2E7LA 5T5FL 3NJKA 3ES6B 5MHSE 3WTUA 5AJHA 4BVBA 1JQJC 3GLHE 1NR7A 2DECA 3AP2A 4UT6A 1R1DA 2A9RA 3VNAA 4BFGA 2FD6L 3I85A 4Z95H 4ZT3A 1IAKA 4C7OB 2G1PA 3SDYH 4FLEA 3V8PA 2QNBA 5HHOD 1A1MB 2OA0A 2X70A 2BINA 2R7KA 3M1LA 5KAMA 3I92A 1XNGA 3TINA 4WI4A 4HWBL 3GJ7A 3QUAA 2V6MA 3K31A 4QRUB 2D00A 2Z9CA 4PJDB 5HUQA 1J86A 2WTRA 32C2A 4B9AA 1YPZB 3TN7A 1DQLH 1ZI9A 2Q3JA 1BCIA 1V6CA 5EOVA 4EENA 5JDIA 3I9LA 4C55A 4R05A 4DV6B 4HUMB 1X1RA 2PX0A 4E4TA 4N9OB 2OL4A 3DTTA 3REQB 5T3ZH 3SGEH 3A3KA 1Q0HA 2D1QA 3IJSB 4W5NA 4K05A 2VHUA 3RVLA 2BWJA 1LQSR 2H6OA 5DYWA 4MKGA 2ED6A 3CFJB 3CC1A 2UYYA 2GAFA 2O2XA 3H42L 4RQAA 2LFEA 3EDJA 3TVTA 4OAQA 1UZLA 1FNSH 3DXYA 2JG3A 5JUEH 2PIDA 4I5IA 3OPQA 1STOA 2PWFA 5HGBB 1NW9B 2VR6A 3BKWA 3N2YA 1R74A 2WIDA 4F4FA 2CGYA 3AUVA 4PJAF 1A4IA 2GZAA 1KDTA 3NIWA 4J4TA 4PPQA 3GSVA 1AT1A 1NW7A 5JAHA 4ZEVA 4ZFZB 3NDPA 1BECA 1Y0LB 2ZCZA 2E75C 3BIWA 1ZMOA 1KQNA 3WDJA 4J0IA 3ZXUB 1XYVA 4B47A 2V6FA 1D09A 5ICYA 1O7DE 3EY9A 5B4MD 2C59A 1RZ7L 3LFUA 1Q94A 2R4SL 4KU1A 4U2YA 1AH1A 1XXHE 2OKMA 4C56A 1GQ2A 4OZHA 4ENQA 5FYKU 3VGPA 3UMFA 3P11L 1AKJB 5LHDA 2ZSIA 4L6AA 3VJLA 4LDCA 4HNSA 2EW1A 1EESA 1NMAL 5IREA 4FKHA 1O95C 1CS0A 2ZAHA 4B9GA 3B5IA 4EHLA 2YVUA 4KKNA 5FL7A 3DV9A 4K5MA 4K2UL 3HGMA 3DO7B 4LHUD 1DAOA 5ALZA 3R5HA 1L3NA 4TN5A 4HT1H 4FR2A 4Y7DA 1PVHA 4KNWA 4RAVB 3MYRA 2W70A 1I7UA 3PABB 1NBMD 2G9ZA 3IAM1 3O9WD 2C34A 4LEBA 3K9CA 4FXKB 1IBYA 3DX9A 2G9VA 4XVSH 3A2MA 1CN4A 4JY6B 3TGWA 1ZIXA 1F58L 5FBVB 4K5PA 3RI5K 1BXGA 3MODH 3R6LA 4RNCA 3QEQA 1MG3C 4PZLA 3HCCA 1AS7A 4LEOA 2OCPA 3PNSA 2GD1O 3PV7A 3ZNOA 1XMWA 3SOZA 4P23C 3U3XA 4CRWB 1KCUL 2I71A 5E94B 2FSEB 4DERA 1JWMB 1F90H 4BLUA 2VH5L 5EQTA 3EPKA 1DQTA 3TLRA 1LMKA 1TZIA 5HFJA 5EE1A 4L22A 4HUUB 2D8MA 3I5XA 3K70D 2Z31B 4XE5A 2A9FA 1JXAA 2HWZH 4D9RE 1DVFA 3AB0C 2VAPA 4QARA 3HRZB 3S55A 5DRZB 1EU1A 2O72A 2NZUG 4EFKA 2WLLB 5GWXA 2GYWA 4PB0L 1N5MA 4LLYA 5IJZA 3KKKA 1UZ8A 1VPEA 4M1GH 1PD6A 1NHWA 2LIVA 3L3HB 4DIOA 2NW2A 5ANMB 5IAAA 4U3XA 4JA2A 1XZJA 1NMZA 3ZWCA 4Y3UA 1S9KC 1VPVA 4XRCB 3WLKX 2W0FB 2OESA 4FFVA 1ZISA 1NPDA 1TZHA 4RCVA 1PUIA 4U6VL 2DJUA 4ZHQF 3MCYA 4B8YA 3V5DA 1MXGA 3SYQA 2CRZA 1NP7A 1E79A 1XZLA 5BVHB 3VFSA 1MAUA 2X23A 1RS0A 2D03H 3TFQA 3VRIA 4G1BA 4MR7B 2PJRA 3TASA 1WFJA 4HZUB 5EBLA 4BMDA 4AYBA 3CFUA 1G7TA 2QXTA 3PEWA 5SYNA 3GXFA 2MRYA 5I7VA 3ZZSA 4G65A 2GXSA 3VNVA 3BWAA 4AQOA 2PUGA 2A6KB 4CUKA 5JD6A 3MJ9A 4FQXB 1GTRA 1SQ2N 4HS8H 4N0RA 4JGNA 3ESQA 4H1UA 3BLBA 4OUDB 1H1DA 5FA3A 3LLCA 3COOA 4OJMX 1CGTA 1Z5HA 1N2SA 3DLAA 3NNSA 4HGWB 2CY0A 1T7WA 1UD2A 5FUOH 1W47A 3PGMA 1J0YA 4ZFOL 4PLKC 3KSBC 1RWKA 1Z6QA 1KS9A 1BVOA 4EARA 5C0BA 4KQ2A 4YPJA 3BF7A 4NNPA 3UANA 4FDAA 3GSNA 3TN0D 1DOZA 4DXAA 1ES9A 1ZLUH 3FQWA 4YCJA 2R0WH 4LL1A 3DEZA 3GI8H 2HA6A 1QI5A 1IN8A 3AFHA 4EPVA 1TE2A 3LIZL 4E9YA 4YDKH 3V1TC 1U3HA 1W5AA 3LRLA 4HTFB 5CR8A 2MJLA 5AW6B 1MQSA 3MJFA 4GLLA 3UBTA 2TRHA 3W38A 2QP3A 4FXTA 1AUOA 5DURB 2G0TA 2XN1A 4KWHA 3AV3A 1IHUA 2HDHA 5TE7L 1D04A 1ECJA 2EP5A 2WR8A 4RFOH 2QAIA 3NHPA 1FEZA 4ED9A 3PFQA 3LNTA 1IM9D 3EE6A 1IKFH 5IJBC 4RGMC 2KMLA 2A8YA 3U4BL 2BDEA 4F7MB 1B0ZA 2F6AA 3PWNB 3SU8A 2IS1A 1I9IL 3GZJA 4LVOC 1AKEA 1XPRA 2XAAA 1TW3A 2ZRNA 1QS0A 4OLEA 4DJDC 1JP5A 3KBPA 1XL6A 5CCJA 1KS2A 2AQRA 2FQWA 2SEBA 1HKUA 1JVLA 2EX1A 2AR7A 4FABL 5F7KC 4HDNB 1N5YH 4BQCA 4BKTC 2CBZA 3BWBA 4NCXA 3RT7A 5HKKD 4PCTA 4JBIA 2GZ1A 3IHLA 1IM8A 4KR3A 4UQEA 3IF1B 4PG7A 2NX5D 5B3JA 1OZFA 1JOIA 1ESMA 1E1CB 1U3ZA 2YOCA 2QT6A 5D7IF 4LDEB 3KE8A 4QU0A 4GRLA 3TQHA 2NUPB 3G0BA 4XPTH 1ZAGA 4HJ0C 2ZYTX 3HZKA 2BMKB 1HPLA 4TZKA 4GDFA 2FRDA 3F71A 4GPVA 2IDJA 3KPQA 4J6EA 3EZYA 1O96B 1N2EA 2B0CA 3GIVB 3RWHB 1Z9SB 3ARBA 5E6RA 3MUGB 4OJNA 4UI2A 4M7ZB 1C8QA 1H93A 1LSUA 5K3AA 5IEBA 1LNUA 4F9EA 1Y6NR 4JKWA 4HK0B 1DIOB 1D8TA 1WAAF 1BFDA 3CY6A 4C7JA 4Q3AA 3MV7A 4EZLA 2ZSJA 3FHAA 4AV0A 3E48A 3FB7A 1C41A 4R2GC 4A7VA 2AH5A 1UHVA 4Q9JA 4PWJA 1XQ4A 4OD2A 4KO4S 4AFNA 1UKBA 4IP0A 1CFBA 4HZAA 4CIXA 3MRXA 2FJGA 4YT2A 2IYXA 3C5ZC 4HD9A 1AMUA 4GBMA 4ECEA 3VD4A 3ESXA 4AQAB 1RQNA 4PU2A 5K9KB 3LXMA 4I3RH 2I2XB 3IKCA 3OCZA 1H3PL 4BSVB 4OIBA 2P65A 5ILGA 3C41J 3LNFA 3WRXA 2UZPA 1I9EA 5E2VH 1EQUA 4JFDA 2V5VA 5FK9B 5L9DL 1H3VA 1SYVB 3E0XA 4P9ML 4XVUD 3VSVA 5AZEL 2RI1A 1Z5WA 3AI2A 5T6BA 1Q95A 2BNRB 5INCA 2JEZA 3ND9A 3RVJA 3CU7A 1SHKA 4AZUA 4IKJA 3U4HA 4ZI5A 3OHSX 3RUFA 4PYMA 3H6AA 4CGYA 5JROA 4L8BB 3I1FA 5CEZH 1PJRA 3L18A 3W3AH 2AV1B 3BGFB 3VYTB 1NCHA 3P0FA 1G9TA 2YOHA 3FSGD 4KXBA 2YEVB 2JJVA 4RMIA 2HXAA 5L3QA 2MT9A 1QHPA 1LO5B 3MACL 3KCNA 4AN0A 1YTUA 3BTSA 4ZW7A 2JIXD 2XQFA 4PJCB 1U2SA 3WNOA 1PYGA 1P0PA 3NIGE 4NKDA 1K7YA 2D0DA 3F7YA 1IIRA 3F84A 3OPYB 3UOWA 3ZWAA 3QUZB 4KY1H 1LDYA 4WUUD 4BX8A 1U1EA 5KU7A 1ZH8A 1U28C 4YGXB 2HLFD 3DX8B 5C4GB 2FMIA 5BNXD 3RWJA 5L9AA 2A2ZA 5FYDA 1AANA 3SIKA 4WESA 4ZPVB 3QH3A 3SDXF 1GMEA 3RVRA 5M94B 2AK4D 5DI9A 3ZDCA 5EZIH 4Y1AD 1UXOA 4NUPA 1XR8B 5EERA 3AAZA 1XH2A 1M2WA 1WY7A 1RZGB 1N6QL 3UJHA 3AVEA 5F88A 4R9VA 3UUGA 3K1ZA 2XWJB 4J03A 3WAJA 2VUTA 3BO8B 1WSAA 4GKNA 4A2MA 2ZKHH 3MV8D 2H32B 5IJVA 1IDOA 5ICXB 3TXAA 2ED9A 5KOJA 3IAHA 3NTCL 4QGFA 4X8MA 3TW6A 3O8QB 4Y2OB 2R3SA 3OLVA 2A1UA 2ADGA 1YI1A 1KTDB 2VR7A 3AB0B 5B7FA 1HT3A 4PRHD 2UZIL 1KBBA 3ZHUA 2Z0MA 4HNUA 4U2ZA 5BPPA 4AVHA 2HZHA 1VCHA 3DOIA 1E3LA 1ECCA 2JIMA 4JLRB 4HMDA 2FNAA 3GT4A 4ZKDA 2DQGL 3FU3A 1DSSG 3T95A 2D59A 2E2WA 3SQXA 1XHHA 3WJJA 2Q2VA 5KOIA 3UIZA 3MJDA 5E0KB 1SCAA 1O9BA 5E2TL 1DG9A 2QQKL 4U02A 1T8YA 3ZVVA 3UTTE 1Y80A 3FB6A 1E9QA 4HB0A 1MRDH 4EDFA 4R26L 4IRJD 1G4UR 2EFHB 3IUSA 1TD9A 5DCCA 2EFGA 1K3FA 1A6ZA 5A4FS 4PZZA 5E8DH 4CF7A 4QXGL 1NVMB 1SQ0A 1QFWH 5I1GH 3FSRA 2J5BA 3BJ91 1I8IA 2CNZA 4PAWA 3RVXD 1WBXA 4JQXC 1ODLA 3NO4A 3A04A 1TT5A 2OJZL 2NPOA 4AKPA 4EQ6B 2FJHA 4DEYA 4MNHA 1IEAB 1EGJA 2YJ5A 1AMNA 4LAFA 3DO8A 4PX3A 1OP3K 5C08D 1YNKH 3W39A 3ZVLA 3R77A 4P9HH 1YB5A 2NU7A 3N1FC 4FMDF 1UOKA 2LV8A 4X99B 4X8GA 1BEEA 1LPSA 3TX2A 5F9JA 4MWOA 5DD1H 3HR4A 3WJ1A 5F78A 5EO1A 3RAJL 2SCUA 5E6SA 5GS1C 1FVEA 4PTUA 3IIEA 3L6EA 1QYWA 3LGSA 1X7GA 1XTPA 3GLTA 4F46A 2AQPA 4DVBA 2F62A 5DGQA 4PR5B 4ITVA 4IMKA 3VXSD 3LCVB 4MB6A 3WDHA 5CU5A 1YZNA 3IQIX 1RBZA 1O95D 4A7TA 3I04M 3UMTA 5TF4A 3THMH 3FOLB 2ET6A 2ZCKH 3UL4A 1NDUA 3P9KA 3TNLA 4D2IA 5BN4A 2YW2A 1CRLA 5CB0A 1BE8A 1NLDL 4WQOA 4QOKE 4J3OC 2BEWB 1T9GS 4JEMA 1D5MB 2FVYA 4NSKB 2YXFA 1O77A 1JU3A 1QZNA 1P4RA 3KAPA 1IC6A 1U8HB 4QWMA 4LLWA 2IUEA 3KVNA 4MUXA 3GFUA 4EJSC 5F33A 1B0PA 5DDHB 2VAVA 2VO8A 2DPGA 1K8XB 4PRAB 1EFCA 4BKQA 4NO5B 1NLUA 4X5WA 5P21A 5C0EA 4Y2VA 4DIMA 2Z1NA 5KBDA 9ATCA 2C8KA 3KL5A 3IJHB 2WHRA 5C1PA 2B39A 4I55B 1AS0A 2AJXH 2OD7A 2I76A 5EC1A 3MRCA 1CLUA 5MN6A 2PZFA 1JJ7A 3C6LB 1C3XA 1Y1RA 4LDLB 5LN4A 3C08H 3KPYA 4KQHA 4PS1A 4FYSA 5D7SL 6TAAA 3FT2A 1U7WA 3WYGA 4CNIA 3EW3B 3F98A 4B71A 1NGWA 1A3CA 1EFPA 3NM6B 2V7QA 2B5IB 4OB5H 3PGFH 2AA3A 5CT4A 1AMOA 4UQ3B 2FUG1 3SQOL 4C0SA 1QATA 2F53E 1KJ9A 2YUVA 3CKKA 4F3KA 3FTYA 1FU4A 3AYXB 2ZSHA 2QPSA 1JN6B 2ID8A 2D3JA 3N2KA 1LLUA 4DGQA 5MEOA 4N8CH 4KWUA 1XAGA 1D9XA 2UAGA 1IX2A 3VWJB 2K9UA 4HS3A 2APSA 4EKEA 3BMOA 2PUAA 4BECA 1U30A 2XQKA 4N9GA 4CT5A 4Y4FB 3RVVD 2EKDA 2EIXA 1DFBH 4RZHA 3K0YA 2J0UB 5H8DA 2UYLA 3WXVH 3C6QA 4DSYA 1YV9A 2C4UA 4Y0NA 3SXJA 2OAQ1 3QYJA 4IV0A 4FLFA 1WIUA 4LMAA 3W7BA 4KZCA 4A6XA 4QTTB 1YA4A 5DZAA 4HNVA 4JP8A 4B7UA 4DOHE 4DAEA 4D3YA 1X5JA 3EVAA 4DAGL 3DFFA 2PO6A 3BH9A 4HMEA 4G5GA 1EO5A 3PDDA 1FNGB 3UV3A 3BVPA 4IXMA 3JR3A 1KOJA 4V1DD 2VBIA 5D7IA 1RFDH 3U1SH 4HX5A 3FDFA 4O02L 5LG6A 3SX2A 3E5HA 2R29L 1KO8A 4BS9A 2WIIB 4FW9A 3TF4A 4QHPA 1U6AL 4JDVB 1TR7A 1G0XA 1FTWA 5KTNA 3OOHA 3PHQB 4XC3H 1HMYA 4PJ7B 2UZ4A 3IEAA 1MNQA 1B6RA 1M0SA 1YSOA 4JDEB 5CNMA 1EHIA 3GJ0A 5JFTA 3OJ0A 4QHNB 3RB8A 1H2ZA 3OHXC 3C48A 1YIOA 2PSSA 2QLMA 1SEPA 3PZBA 3WIEA 1I4OA 2BHZA 1JMVA 3LG2A 4YC2C 5ACZA 1F8UA 2C82A 1QIMA 1WAAA 4JM2B 1V9LA 1Z73A 2Q3FA 1JLLB 2QORA 3KB8A 2WWKT 4HZLA 4NFYA 4D26A 1Z7GA 4NHEA 5BQ3A 1OGAD 1QD0A 3QU9A 2Q9BA 4F1JA 4GAAA 4MUKA 3C16C 4HKXA 4F33A 2GXAA 3B5GA 5F7NC 2YVAA 1QFJA 1UM5L 5IT0A 3O4RA 1Z4IA 3CZMA 2UUOA 2XXGA 5JXJA 4RESA 2NXZD 1KK2A 3FF7A 3K71B 1FMJA 4UJ5A 1ZXQA 2QG6A 4W6QA 5D70L 4UOZA 1ZGJA 4L2YA 1LV8A 4JHAL 3HI6H 1VEPA 5KJ1A 1RXYA 1VQ1A 4DG9A 1I1FB 3SDZA 1UUFA 4GUQA 2J44A 3B3QA 3UJCA 2X0KA 2J45A 2VXYA 4D80A 3GXUB 4ODHL 4ERXA 2OCXA 3N0AA 1Q3HA 4FQQA 3RNKB 3O8OB 4NUGH 3FTNA 4MS4A 2VNHA 4RQTA 4MWFB 3E3NA 1F38A 4Z6KA 4PANA 4YXKL 3HB9A 2EYRB 2FX7H 4NR0A 3D33A 2GBCA 2ZB4A 4F85A 1KCBA 4PREA 3D85A 3PXDA 3VR4D 4X98A 3OZDA 1QG3A 4X9YA 2X6QA 5IHXA 1EXHA 3W2DH 4AV4A 2I32A 2B8NA 2IWFA 1NMXA 3KT0A 1I51A 3QUYA 3HFJA 3K5SA 4FI3F 4A10A 3BP4B 1RIHH 3DHJA 2YUZA 1E43A 1VA5A 1DL7L 1D5BA 4NC1E 1YASA 2ZWSA 2BVQA 3IELA 4HJ0D 2YHIB 2FIKA 3MLUH 5E5RB 2AMGA 3T7IA 1VMAA 2DYPD 2PCFB 1PAZA 3BUBA 2JEOA 3V7WA 4LZJA 1FMFA 3SJVB 3NFPA 3SY0A 3UMVA 3BJEA 1AGDB 1MFBH 2W48A 4I2XA 3FU8A 3OOJA 4NARA 4NGHH 2A9MH 4KQFA 1EZ1A 1NL0L 1NPJA 4GINA 4REMA 3AFLA 4BNIA 3ULVE 1HDXA 2WE8A 5FM4A 1OA0A 3O8RA 4YDZA 5HCUA 1OT1A 4G11A 4OLAA 1W44A 4AJ0A 3CNQS 5AZ2L 3EBLA 1MU0A 5DTEA 5HBGA 2Q1EA 4I9WE 4R2GD 3SDAB 4JV5B 1CUCA 2J4WH 3IHTA 4AUKA 4IBOA 3WKQA 1G6OA 1KIFA 1AH2A 3OC6A 3FDXA 1DQPA 3VTZA 1ZE3H 4B3MB 1GPJA 4UUQA 4W4NA 5E2UH 4WKZB 1DDIA 4YR7A 3ZDYE 4LPSA 3UG7A 4BKUA 4M3JA 4U0QB 3C6ZA 5B53A 4U2BA 1PKQE 3MNZA 4I6JA 3Q8BA 3IEXA 4IKIA 4RGQA 3TLBA 1MJJB 2I34A 3UJDA 4PG5A 5CEYB 4PCVA 1T5SA 1E5XA 4C56E 2R69L 1I7QB 3NFNA 2DR3A 4LF3B 5DVLA 2DQMA 4RF4A 3MA7B 4YRNA 1R5VA 4EMZA 5F9WC 1ECZA 4A67A 4NRXA 4OI8A 2KZWA 4URTB 1BG9A 4U31A 3SQBB 4EB8A 4A6EA 3ETSA 1LK2A 3CURA 2P8LB 5A62A 3NHAA 3W4JA 1O3YA 3ZK0A 2BVEA 2JLZA 4DO4A 2FJ0A 4M7PA 5L7XL 4MWCA 3X43A 2PUQT 4PJ9C 2GAJA 3PC7A 3KVDD 4E51A 5I6PA 1PR9A 3KR9A 2MYNA 4RDXA 3L07A 3F8SA 3GWJA 4I0PB 2LCIA 3IDIB 3NCYS 4KRNA 3WTVA 3AERA 3LRGA 4PFSA 3EGDB 5DLQC 1L0BA 3BZBA 5DEFB 3GFVA 1V11A 3FHLA 3GDFA 3CMGA 3B1ZA 4E5KA 1R19A 1OP4A 4BGUA 5DNUA 3AILA 4Z7OF 2GHZA 1BBDH 4AP5A 4UDXX 5FL3A 3QEQE 4MS3B 2BFCB 4HS4A 4KROC 4QM7A 1TCUA 4GKAA 1W8DA 3AYZB 3DT6A 5HRAA 1JGUL 1ZRUA 1JV5B 5KTYA 3NUQA 2P1ZA 4J9UE 3U81A 4UDTA 2VQTA 3IIJA 2FLMA 4RYLA 3QUTA 3G04B 3I8SA 5EWIH 4O1HA 1INLA 5EFIB 3H75A 1JDZA 2C3YA 4GEGA 3RIYA 1DO6A 1MH5A 2QYTA 1EBFA 1FRNA 1VGKA 4Q12A 1PW7A 2ACEA 9LDBA 2X88A 4DNPA 1ZZEA 4EZMA 3V9AA 2MOGA 3T35A 2BISA 2WWFA 1QM5A 3ZHXA 2JQAA 5CLGA 4XXHA 3FNKA 4D6YA 3P0YH 5CG2A 3HKDB 3B7UX 5KMGB 1L5QA 3K1TA 1VPOH 1RLBA 1WB5A 2FWJA 3ZDQA 2J9FB 3I8XA 1DQKA 3KR0A 2FQQA 2F8MA 1G2IA 3OSKA 4EDXA 5ESWA 4EI5A 5EIWA 2XT0A 1NYLA 1PGPA 4NZPA 3LIIA 2G5PA 1GGMA 4FMVA 5B8CA 5I28A 2NZVG 3EW9A 2WXMA 1YJ8A 4ZCSA 4KZ0A 3G9TA 3WIOA 3VFUA 2ECQA 3QB7C 2DCUA 3ZW7A 4FG4A 5BOSB 3LN5A 1QFMA 1XWIA 4TUUA 4S1VA 1GRCA 1JSRA 1DCTA 1FF9A 4FLQA 2EBUA 3OGCB 2QY9A 4OKIA 4RIEA 3AIMA 3HCRA 1IL0A 1H2FA 4YXFA 2J4CA 1N0XH 3X1YA 3QOWA 1CJMA 1FRGH 1KEMH 2QPLA 2MSWA 1PD1A 2VTVA 4M5YL 4G8BA 2RGEA 4DSAA 4H9GA 4KKCC 1YEHL 1MW9X 3D1LA 4EGJA 2CXPA 1G43A 1CF2O 3IJ9A 3BZUA 4BO1A 3AJRA 5JYMA 4Q7EA 2Z1DA 2WHPB 4OQPA 5C0BE 2IYFA 1IY1A 3LPOA 5HDBF 4GKBA 4J1TA 5CEXA 4JN6B 4DZTA 1GPNA 2OZEA 1JZFA 1NC4D 5F89B 3WIFA 1X4XA 3EMVA 2A67A 4ACBA 2Z7UA 3DLPX 3DYPA 5HWSA 1WC7B 4JRXA 1XEWY 1G6VK 2G67A 2DICA 1RD4A 3PC2A 4HFMA 2YGQA 5IJWA 1TEXA 2XITA 2GTHA 4OF6A 3GPSA 3E3AA 3ALXA 1SF3A 1QVZA 4KPEC 4N1CA 3NAQA 4YC2B 4NV3A 3ECCA 4ENED 3SHOA 2O50A 5IEHB 3GHBH 1GYPA 2VNKA 3FBGA 4M6NL 4PJBB 1WUYA 2LE9A 2MKLC 1F7VA 2PXAA 2Q3HA 1MUJB 5CSGA 4G9BA 5IB5A 1K8DB 4WKPA 1IGYB 4JBNA 1J1UA 5CXXA 1CLZL 3OC8A 3R41A 3ABZA 4GWLA 3D3VA 1IU1A 2HU8A 2I62A 4AIIA 3RPEA 4P04A 4BFKA 1EGVB 1R4ZA 5EF0A 1MVOA 4LCYA 4I1OA 4BVJA 4V03A 4RK6A 2B5OA 5DD3H 1L0XA 4U1MB 4XWAA 4OAWB 2V96A 3I6KA 1UJ5A 4OIIH 5I82A 1JVBA 3L5JA 4RM3A 3ZHFA 1O87A 2ZIDA 3N8IA 3EXHC 3RC2A 3KLOA 1YWGO 4PG8A 2WDZA 1U2ZA 2IWEA 3L3IB 2BUBA 3WB9A 2ZANA 2J8ZA 2PR4H 4FPXA 4WCVA 2VW6A 1G7HA 1CU4H 1SIWA 4D0SA 4CZ2A 3V1YA 1K8QA 1Z4QA 4Y67A 1RZFL 1B0RA 4JFEA 3OMAB 3DOOA 2CKBH 4BV3A 4X8CA 1K6IA 1KK1A 2ZAGA 5B3JE 5KKCA 2EJWA 2QE7D 3UZEC 3EBOA 1FSGA 4OZFB 1T21A 3SLKA 1F4WL 4OK3A 1XKTA 2MCFA 1I1NA 4EVRA 4FWIB 4WW1A 3NPMA 3STBA 2IITA 2N3ZA 3EXFB 4JFZL 4PO1A 2PUTA 5K01A 3QY9A 1QORA 4PBDA 5LDDC 3RARA 1ZLSL 1S7SB 3RWDB 2YOAA 3TI9A 2G09A 1R24B 3SGLA 3VSBA 3NIFB 2WJ3A 1TLKA 2EDBA 3WS6A 1YC7A 3KHKA 2VJYA 2W2LA 3J81k 3ROLB 4FZJA 4M36A 4BQEA 4KC3B 5GM2A 3R4DA 3RHWF 2Z9BA 3OOWA 1OQAA 3C8DA 3KWWB 5GM1A 3UCQA 4FT2A 4QTXA 2GWHA 3DWEX 1CICB 4YO0B 2IXQA 3PNQA 3MV7E 4UQOA 3CG4A 4HB2A 3NV9A 5CW1A 2EDKA 2FSFA 4YIQA 2A59A 1F56A 1EEYB 1W7AA 2XRMA 2QXYA 2ZG1A 1J9EA 1WS7A 2VZEA 4EYGA 3S4SA 4IWYA 4QRAA 2QTBA 3GLEA 1YFZA 2CJWA 3HZ3A 4Y4HA 4UQ9A 3DVQX 5CJOL 2ENUA 3X1MA 4R2MA 4UXJA 3VVMA 4G7RB 2F6RA 5D7KE 1VJTA 2O1SA 2ZSAA 1A98A 2NU6B 1YN6B 1P2CB 3HV0A 2IELA 2PYIA 3UAOA 2JK5A 2RMKA 5HXAA 4XXWC 5C2BL 1QLJA 1X1AA 3DBRA 1PK8A 4UILL 5ALBH 3BGMA 4NZZA 4JFDE 1OFUX 1DFGA 3VXMA 1I9RL 2VCOA 2AB0A 4HXAH 2GEBA 4H3KB 1X5XA 2KQNA 4GH7B 2Z35A 5JCXA 1N6IA 4KBPA 3O45A 1KZQA 2GITA 2GEKA 1FW6A 1TQDA 3A67L 2J3LA 1Y37A 1OWWA 3AB8A 2UZAA 3I3SR 3H9JA 4BJ5A 3JAMA 2XZQH 1QCDA 3C5JB 1B16A 1T9BA 1IHXA 1MWAA 3UV6A 5ICMA 4A1RA 3NANA 5CZRA 4QEGA 3HBLA 1OHHD 1P33A 1MN4A 3LY8A 4FCHA 1BWMA 1OCCB 2R7NA 1TLLA 3GUCA 1L7XA 2VXTL 2IMNA 3EZ7A 2AZDA 3SLGA 1RUAH 4DUVA 5ALPA 3U1BA 3RKUA 3PJLA 3LWDA 3G6WA 3W06A 4OLWH 3GRBA 1ZA1A 5SICE 1HCFX 4UTZA 2HRRA 3LWNA 2PMWB 4WHDA 2FYVA 3JVIA 5C86A 3U4DA 2Q5IA 4PY7A 1UMBB 4DUZB 2VJMA 3SEAA 5I1DA 3OWRA 3WFHA 4DCVA 1M9NA 3FAZA 3G0HA 4FTVB 1UZAA 6NULA 2J5WA 5DHRA 1SG0A 4DBLE 1A5AB 1RYZA 3F0TA 4K3HA 3MV9B 3NYWA 4QHSA 3ZE7A 4NJAH 1VFBB 1OTSC 1W0JA 1ULUA 3I9GH 4RZCB 4CQLB 2YFYA 4FQ5A 1NDGA 3EZ9A 4BNZA 5EUMA 3ZBPA 5FFGA 4K6KA 3WRYA 3D30A 4I0WB 1QKZH 3QXGA 4NCIA 2JGFA 3K8KA 3IMKA 1QWOA 1DKUA 3IT2A 2ZIAA 3LNHA 3HNPA 4MRNA 1UZGA 1T9AA 3IAQA 3TSWA 5LWHA 5DVOA 4LRQA 2OAAA 4MWEA 2V5AA 4C0WA 3GEEA 2DY2A 3WWZA 2J5QA 1Q9OA 2IH2A 3FONA 3SQLA 5TDOB 3UEZA 2O0KA 4BVEA 1E5ZA 3RC8A 4QRIA 3MRFA 1D0SA 4XZ3A 3VRLE 8FABB 3GMSA 2K0RA 4EUPA 2G72A 4TROA 5GJCA 4Y2NA 3EFOA 5FKPB 3RWMB 4QJIA 3JZIA 3KETA 1C14A 3NAGA 4IZHA 4B6EA 3BDBA 2I7OA 2REOA 2WNGA 4NRYB 1QR4A 5K5EA 4ANFA 4Q18A 4PSPA 2IFGA 4OKVB 3PSAA 2G5CA 1VMDA 2A4KA 1V5WA 2GKSA 4CR7A 2FV8A 2Y1WA 5BV7H 3BRWA 5B4UA 5TC4A 3PGXA 5L88H 3VYRB 4TS3A 4ZK6A 3D2LA 3D9AH 1JGLH 2YPKB 1SJVA 4Z8FH 4LJRA 3HDTA 5F2NA 2O2DA 3DPIA 1ECLA 4O63O 3FRUA 5CDGA 2OMWA 5ALCL 5TR9A 4Q4CA 4QGYA 4C30A 1CXIA 5IMOA 4IF4A 4G1VA 1YMVA 3KPUA 1R0XA 1HM5A 3HKBB 3RTBA 3ZKMD 1JTPA 1I13A 2ZR9A 4ZYYA 2HKHL 1E3XA 4DJEC 3GBML 3ZK9A 2UYCA 4HKTA 4L29A 1S2NA 1NJ5A 3R3WA 3FT0A 5IW3A 2VLJA 2DQFA 2J6CA 5C9KA 4EY8A 4V1CB 3RBAA 4J3FA 3FRPG 1UZUA 1M0EA 3Q6FA 2P2CA 5ID0B 1V7NL 1BJ1J 5DK2B 4R0VA 1YZTA 1WQ1R 4M48H 2ILLA 3QPCA 5D85A 5LNK1 2EINB 2W6JD 3IPAA 5CA1F 1J0DA 3MLBA 1AS6A 2UYOA 3C3AA 5HVHC 4H0GA 2VLKE 2YLHA 1E5VA 2EQ5A 5ITBH 1LZKA 3OTWA 4MZRA 2LGJA 5EPMA 1T8SA 3QXVA 3HHRB 2BR3A 2WLHA 5E00A 4BEBA 4DGSA 4I5EA 3CFIC 3UYPA 4M9XA 1IBCA 5E9AA 5F1OB 2VLRD 1DQYA 2KE5A 3SQMA 3IVRA 3H2PA 2XGSA 3GXBA 3QG5A 1FLTX 1ZINA 1SEBB 4F58H 3HYCA 5TPWH 3UTQB 3GSRA 5T1MA 1E8YA 1NCJA 5H35B 4PJ9D 4TMFA 3IV9A 1INDH 4WGGA 5LB4A 4MV0A 4AO7A 3OH8A 1XSIA 4ZYKB 4K6GA 2AJTA 1WXHA 1ET5A 4IIGA 2W6NA 2BFMA 1B0GA 1E3WA 1NUGA 4CUCA 2PLRA 2QZZA 1AQLA 1Z82A 1T34A 3K9FC 5J6GB 3UC9A 1VKXB 4MO9A 2GJ8A 2WOBA 4ND5A 5ITSA 1TC2A 5A6VA 3LN4A 5CVEA 4R01A 3O0TA 1E77A 3IR6A 3TO4A 4YJGA 4NQSB 5I7WA 3KWMA 5ALNA 5CSZB 2W4MA 3BJIC 4ZBJA 5IKEA 4MCJA 1OLSB 4JOSA 4CIAA 3IQFA 4ETQA 3DWFA 3MRPB 1RP7A 4WNQB 5AXCA 1WKVA 3QA3A 1D2EA 4B3XA 3RHSA 3IKMB 1M2FA 3SNKA 2P28B 2K6WA 3D69B 3RJDA 4HKZA 4MVBD 1T4CB 2HN9A 4HWPA 4BN5A 1J8RA 1CQYA 1FZQA 3CR7A 1A7NH 3SGDH 1A6PA 3VFVB 1CXLA 2VXVL 3C60A 5FOXA 4OD1L 1V4NA 4HVCA 3ARUA 3AO0B 2WMNB 4Z7VB 2ZOKA 3LX6A 2Q8AH 3B36A 3O4LD 4IDHA 2VDRL 4LCUB 3ZWVA 3GCGA 3IU4H 4JPKL 2G7MC 4XP6L 3RYIB 4DKXA 1YDEA 2KHAA 3JAKA 2GA8A 1EZ4A 3KQQA 2RH4A 5FDFA 2D1FA 3EGVA 2ZJ3A 4P4LA 4PGDA 4F06A 1NUAA 2JCXA 1RWQA 3PLAE 3D05A 1QG0A 4P53A 3ZCQA 3NC4A 4DKJA 1EZVX 3QFTA 1T20B 4LN1A 3GRPA 4Q8BA 5ISZB 5DR5L 2B8OT 5D5QA 5EO0B 5ALJA 3UDWA 1CK0H 2GC7C 1UBOS 2GHWB 2XB2A 3QDJB 2IV2X 1AG9A 5B36A 4X20B 3IDFA 4H7VA 1U65A 4I9FA 2CNWA 1IBDA 3AOEC 2ZXUA 4DN6A 3RS2A 3TLJA 5CXSA 4EG4A 4YV7A 4OSUL 1OAKA 3WUWA 5FTNA 3VR3A 4H4EA 4US0R 4EZJA 1T1YA 5TE4H 3NDIA 5DQJB 4RKQA 5DA0B 4H2CA 4RVCA 4LHZA 3GVHA 5FYJE 4BE5A 1ZR4A 4YE4H 1KFAL 4UXIA 1H85A 4LOAA 4XCNA 2PLFA 4UIMB 2HI0A 4AZ8B 3MHPA 1OAQH 5JNRA 3AF3A 3BPSA 1Z39A 4XMXA 1Z18A 4KKCD 2G04A 1OIWA 1E0SA 3O03A 1MFCH 4HV8A 1KGYE 1ILWA 3L3KA 1UOPA 1NJSA 3HN3A 1MCKA 1JFSA 4ZC8A 2C03A 2H16A 1WAAE 1DPGA 3GXDA 2MIZA 2JEYA 3EHBC 4DXHA 25C8H 3H9HB 2B2XL 5IV2A 1QKJA 3NSJA 2P9FA 2APWA 4NCKA 2O30A 1HLDA 2APFA 3V52H 1HSAA 1X1QA 2O7SA 4XCFH 3LQFA 3KYCA 1U6JA 2XCOA 5FWRA 2OB1A 4I7ZC 2EW2A 2YYSA 2GZDA 3OICA 3R6GA 3AZOA 3SKMB 4ZYXA 3DB2A 1ZUNA 1KERA 5D9SB 2NTYC 5JOQA 1RJZB 2YYZA 4RABA 3AM8C 4YFLF 1FGVL 3S6JA 4IHKA 1T66D 1MAHA 3H9GA 3QDHA 1P44A 4P3DB 1OVMA 1JDPA 2JFOA 4WFFE 1MHPH 1LVEA 1UWFA 4YXWD 3NG1A 3JY6A 1V4VA 3UCRA 3NYQA 2VHTA 5IK3A 1EXWA 3CZAA 2ZWAA 1S7RA 4D9RD 4EKXA 4MMYA 4JB2A 1PL7A 2FR8A 4ZKEA 5CUSL 4Y4KB 3UPUA 2ZXEB 2X7XA 3HB0A 3RPBA 5I71B 2LU7A 2FN4A 2DCMA 2P43B 2FUEA 2Q3CA 3OFJA 5HGHA 3FWNA 4FEEA 3QMWA 4D3CL 3B1VA 3E0GA 5CGTA 3FMGL 1UA3A 4HAIA 1ADBA 2Q4BA 1PJ3A 5F7YC 4FMBB 4YCLA 1DC7A 4N90D 1HEIA 4HC1L 6PFKA 4M7OA 1KVSA 4E6PA 4WY8A 4I8XA 4A8TA 4FE3A 1L5OA 3MOAH 3EH5B 3VR2D 1MHEB 3ILQD 3RFZC 5HGDA 3SYKA 1TVEA 3GO1L 1YR6A 5LBUA 4BLWA 3L54A 4P5MB 4HUJA 3P32A 3CINA 2XEDA 1LLQA 4U1JA 3P4YA 1GGCH 2EU8A 4I2XE 1BVKB 4K86A 2D5IA 4AVIA 1JEDA 4NV0A 3OXRA 2DWEA 1RZ8B 4NDNE 1DV2A 2EEDA 3F49S 3HE6D 4J76A 3QDGB 4Y2UA 1V1MB 3WHKA 1O6FA 1S0UA 1C9JA 1GFZA 2EXYC 3Q11A 2E7CA 4C7MA 5MENB 4Y5VA 5IESH 2CVZA 3M5CA 1R5OA 1VESA 3I3DA 2B78A 1S7QB 5CKAA 4ZVMA 3EQ8A 2I5YH 3R1IA 1JFRA 1CFSA 3Q7SA 2DQCH 4BGIA 1S9DA 3THWA 1YY8B 3DE5X 4U9UA 4M4RA 5B4MC 1A3LL 2J55A 2VR8A 2O5YH 4QGTA 4XJSA 3OCVA 2W2NA 3KPOB 4BZ1L 1IPFA 2PX4A 3OJVC 3UBXB 4WA7A 4F7EB 2V2TA 4P2RB 4AKGA 4TUJB 1CUYA 4YQXL 3H99A 3DVSX 1JTFA 1TCRB 3OR6A 4M60A 1TEYA 3LS4L 4UHHA 1ACLA 1Z3RA 2PP7A 3AVQA 2H1SA 3M34A 2ZRLA 2DWCA 3PR3A 3IDUA 1BEYL 4JY5H 4R6WA 4AROA 2C3VB 3HPQA 2H5JA 4RZXA 1U5BB 5LLTA 1SMDA 4LWOA 3LCCA 4M02A 2J3QA 1EVZA 1PNVA 2N1KA 4YVFA 2FH5B 1KOLA 2Z34A 3FBQA 4NQDB 2D73A 1UK9A 5CA0B 1FFSA 5F1SA 1MZYA 4PU0A 1U2QA 4Y16D 3O9WC 5AESA 3HS8A 4ZAVA 2BH9A 1EFRA 2ZJ8A 3BMVA 1HZZC 4WWKB 3F4BA 4MZDA 4ZAYA 1EFAA 5BN3B 4P98A 1P91A 4YREA 1ZS9A 4BRVA 1QP8A 2IX9A 4NNOA 4YJ2F 2PUWA 1C81A 4HYYA 4IJKA 4Q03A 3IPYA 1YQQA 2VYVD 2VJBA 2XWTA 2X53A 4LZWA 2ZUTA 3O3BA 1P1BA 5AVTA 1G7LB 4JP1A 4R1TA 1YCSA 3BVUA 1OLUA 3MJ8A 1BWQA 1E3SA 2J8OA 1Z3IX 4FOPA 4R2HA 5E2WH 2L7UA 3ZDRA 1OV6A 5IAKA 1KVTA 2WQ6A 5A9SA 5SX4I 2BLFA 1OTSD 3BUTA 3PWPB 4Y1SA 3ZO9A 1KC5L 3M4NA 1C1XB 4QKQA 2KI6A 4LXHA 4APXB 1XGRA 4M9UA 3RGVA 3OAWA 3K70C 3EJTA 1GYUA 2IRWA 3VM7A 3ZNQA 2OVFA 4JHWL 5IMMB 1UGNA 5HKAA 3L0CA 3KLAB 2DQEL 2I4RA 4NCHA 3C8MA 5ED4A 3RRXA 1DEXA 1E9VA 4DA4A 3U49A 1J9TA 3BXNA 4R2JA 3E6AA 3Q1SL 2OSVA 2AN4A 1MJUH 5F1NA 4M54A 2CO3A 1WEKA 5IYZB 2FNBA 2NCEA 5E4JA 4I9GA 2BMAA 4OFKA 3FZYA 4D8PA 2D3WA 2VDUE 1UA6L 1JU4A 3VGGA 4PAZA 4Q7DA 2L17A 3VU9A 5I1HL 4JZOB 4KV5E 3DNPA 4LISA 1R3JB 4O2AB 1MG0A 1I8MA 2ICCA 2GK4A 5FPYA 4EN3A 2QQFA 3ML8A 1M1YB 3W5SA 2J1XA 1HILB 3AM3A 4OI0A 2M98A 4L3VA 3AI3A 3NRJA 2YUXA 4K3VA 1PY4A 4I3GA 3MQIA 1NI4A 1FP2A 1E4WL 4I1SA 721PA 1LBTA 1LE5B 3CS3A 1CYXA 1PPIA 3RO7A 1UKTA 5ADVA 3AL8B 5A5FA 2R56H 3T3PF 4WY2A 4OM7A 1Z9NA 1G7PB 3QVKA 4XX1A 1NFIB 1VHWA 4ZUSA 1Q9KA 1F0YA 2HU2A 2OGUA 1QIJA 2JSFA 3N43B 2JLWA 4HUWB 1Q0YH 3DZDA 3ONNA 3NYKA 4G9DA 5CM8B 1JX6A 2D31A 1GU1A 1O6SA 3QQ9D 1J1XH 3MQ4A 4H7EA 3I50H 1U93B 2YAPA 1CWVA 5EUKB 2D5BA 3A4YA 3EA4A 3HDHA 1ZIDA 4FTWA 1XB2A 4QT4A 3COZA 3GA7A 3ZTYA 1KKUA 2V9TA 4NQVB 2UZ1B 4G6KL 1CY1A 5AVSB 4BZPA 5MEQA 4NHUB 3HPJB 3MJSA 1GGYA 2ALJA 4J0DA 4PAOA 1AZSC 4RRPG 2CUHA 3K35A 3TN0C 3IS3A 2V9CA 1UBMS 1CI3M 1PQ4A 4IDJH 2X8JA 4QXTA 4QOIA 3K2UH 1H3GA 1XGYL 1M72A 4NX0A 4F5DA 1B6SA 5JANA 2CPCA 3L2OB 4MKZA 5E1IA 4JRXE 3IXAA 1U9IA 4MQ7A 1AA6A 4X5OA 4J0GA 2ENSA 4KZKA 4L8DB 5CG1A 4L4RA 4ZXBB 2F1BA 3MPOA 4DETA 2WP3T 1T8TA 1S4QA 3VQ2C 1XXFC 4PX5A 4Y9FA 1C9NA 3VD3A 5JRJA 6ADHA 3FRHA 2HJFA 4P46A 3EHBB 4U1IB 5IDVA 4R7LA 3ARTA 1XF5A 1RYEA 1SCJA 3EFHA 2A73A 3BSWA 4KVNH 4UM5A 5IM5A 2GJ9A 4DHLA 1GTVA 1I4FA 3CUYA 1RCFA 3O1LA 3D3VE 1KPVA 1VSUA 3C4QA 4R9UC 1UZ6E 1FH2A 1XGPA 1I8LC 1PTKA 1EHLL 4UT9H 4E3WA 1BMDA 4PV9A 2VDRB 3TMYA 4TWBA 3H2SA 1FFYA 5H2BA 2CDGB 3QVLA 3FJOA 2O5ZL 4DN4L 2HJVA 2QUZA 5BQ5A 4R3SA 5D1ZI 1WABA 5E3HA 2NYUA 3R8CA 4NM8L 5LCVH 4W9CC 4NYJQ 4DANA 4KOEC 2QRZA 2NT1A 3TCXA 3US9A 4M6AA 4RTMA 1N6NA 5AVZB 4I46A 4JFEE 1VFAB 1DBKL 1WHOA 4O4IF 2EP6A 3ZX1A 4YMGA 4S0HA 1WWBX 4N0YL 1QWNA 3IDJB 3UYLA 3H9EO 1Z06A 3L4KA 3BP6B 3VV2A 3K72B 4B3JA 3VACA 2ITCA 1BZ9A 3DO4A 2VF2A 1U8CB 1EEUA 2FTAA 4H1LB 4F3FB 4CQMD 1HSOA 2C9QA 2VDOB 2YJZA 4DV5B 4POAA 1F42A 1YYML 4BX2A 2KLSA 3PGVA 2WJ4A 4IV8A 1FJGB 3ZV3A 1BJMA 3NKFA 2AV7B 3QWIA 3PAZA 1DBQA 2EZUA 5I7RA 4AM0Q 4I5GA 2W2TA 3UTTD 5PGMA 3RVPA 3BAEL 2GG1A 5DRTA 43CAB 3SLRA 4TWAA 4ABTA 4DIXA 4ELMA 2Y5EA 5LBSH 1QF6A 2NY3C 5ADOL 1N64L 4OFDA 2GGSA 5JPMC 5HE9A 4XEUA 4KKBD 3GGSA 1FL5A 4D3SA 2WYWA 3VFPB 3HBAA 2KLRA 4HIIB 3RU8H 3CVIH 2NW6A 3KYNB 1OD6A 3S5YA 3AKCA 2FFAA 4IUCS 4NYIQ 2OXGA 3H54A 1U3GA 2JD0A 1WCQA 4V39A 3CD4A 4LZAA 1MFZA 3AROA 3SDCD 1OXBB 5F7WC 2JA2A 4UQDA 2ANCA 1NQ5A 1FFAA 3VXME 3AWIA 2X4NA 5BMOA 2IC2A 4J90A 4L1TA 3BVTA 3U30C 2C4MA 4D8VA 3H13A 1NXTA 4UBKA 4DJFC 3KZ8A 3M8OH 2P3QA 3MRGA 3O3UN 4L1KA 3IJEB 4TRPH 2JI8A 2AZ4A 4OCMC 4IEFA 1BJRE 1F8XA 1Z5LA 1CXFA 3H3PH 4N3GA 3DURB 4YRBA 3A1UA 5IMSA 3ULUF 2GCGA 1YTLA 4JUBA 4B17A 1F45A 2HY7A 2WXRA 2E6QA 5B7PA 1VKJA 1SJEB 3COVA 3W77A 1SHMA 3LAWA 3G5XA 4YAUA 4BUCA 1UJ4A 1HHHB 2QYOA 3KD3A 4LHUB 4IQ0A 2PGLA 4MD4A 1ZVVA 1A76A 4KACA 1CYGA 1XGTA 2GBLC 2IF2A 2HLFC 4NP4L 2NY1D 3NRPA 4YX2H 3HGTA 3L3JA 5IT2H 1TC1A 2XT6A 5KZCB 3P9WB 2NXWA 4J3TA 5F3BA 1IZ9A 4KE6A 1EUCA 1TJMA 3S5LB 2O5XL 4J28A 2OORA 2C2GA 1C7QA 1CUIA 3GFPA 3NT0A 4NN6C 2O57A 4LOJA 3HP4A 1L7IH 3CA8A 1DJWA 2YS7A 1NCAL 3N42B 1KIUA 3MBKA 4M5ZL 3KYDB 4KQ3H 3O8XA 3MYJA 1Y1QA 2NRDA 5GY7A 4YJFA 2WJHA 5F6HI 3DEYX 4D8TA 4C7BA 2ZOUA 3EYFB 4I4CA 1OPGL 1NQUA 2OCKA 2R8EA 3DKRA 4OTXL 4QX6A 3AEKB 1Z32X 3TIXB 1CUGA 4XP5L 4QU8A 1WMEA 3DX4A 1EFKA 4QTZA 2BIHA 2FP3A 5I9QC 3K70B 3ICCA 4EQ2A 3EQ2A 1HBJA 3GNTA 4MKRA 4AZVA 1FVCB 4OBSA 2Q0HA 4FDTA 2DJIA 3Q98A 3REGA 4R9NA 3OQIA 1C9EA 3VXPB 4WKXA 4ZVOA 2IPKB 4YJ2A 4Z7OE 2ZJAA 4AWJC 2G82A 2CZCA 4FTDA 5ITFA 3EYVA 1YEDA 2P78A 1KF0A 4OR1A 1L9RA 2OO3A 4FI7A 5J4VA 5F4BA 1XIWB 4HK3J 1XEAA 1LRLA 3CZ4A 5EMNA 3T7RA 4K4KA 2E4FA 3FZEA 4PIPA 2QV0A 4IRJC 3ZX4A 2P2YA 4FM9A 5E7JA 1Q0LA 4CYMA 1SY6H 4GP4B 5BT9A 1O4WA 4L0CA 3A10A 1M8GA 4XAQA 4DN3L 1T22A 4JAMA 3RVXC 4HHAA 4BLSA 4A9AA 1G9ML 4JFWA 1F6AA 2AFIB 5C8JA 4HPOH 3MRQA 3U4GA 1JNYA 4QXWA 2EXYD 4KOAA 5SWQB 4B46A 2QUAA 1G87A 3VKHA 2IKSA 1OA1A 2VLJE 3L5WB 1NM5C 3SOTA 1GNRA 4HJXA 3QWHA 4LQDA 3RD5A 1V7CA 3EJYC 3QZWA 3IBOA 3DMTC 1PKQA 4MI1A 1JK9B 4NUMA 5H16A 1K6QH 1HE3A 2HM7A 1T04B 1P6FA 4AW7A 2BY1A 1UDBA 2HVKA 2X4LA 4W5JA 4E2WA 2CV2A 1GZ7A 5DJ8B 2BGRA 1Y6JA 3OY2A 3K0BA 1D6SA 1NXPA 1K5NA 2ZT6A 1RACA 1AZUA 3U2SA 1F2UB 3GHHA 2FMTA 4B76A 1X7WB 1MRFH 3JV0A 3WHE1 3B52X 3H17A 1F48A 2V3CC 4X6XA 3GR6A 1EGJL 4UAJA 4R31A 4NN5B 3PWJA 3N87A 4QR7A 3WIDA 3G89A 3S3SA 3GNSA 4Y2JA 1QHHB 5BN1A 3H0KA 4AYMC 1E2EA 3FVVA 4UVHA 1B88A 4OJAA 4PWZA 2ONZA 3UBHA 5KIAA 2H3EA 4S2SB 3WGQA 5BO5A 1X7XA 4QYMA 4ETWA 1KYZA 1M7IB 3F7TA 3VRLF 3N06B 3UEOA 2JV6A 1IM9B 2I1QA 1GDHA 3M1CA 1HKFA 3CSBA 2JGDB 4RJTA 1S5IL 9MHTA 1W2WB 3OUTA 2WINB 1I1OA 2P79A 2Y99A 3BJRA 1N92A 4WECA 2QTFA 4JOBA 1A3RH 5KC8A 1R10A 5E2JA 3G2IA 3KZOA 3AHEA 5C35A 3U7FB 2BMEA 4HK4A 2Y71A 5CK5A 4ELKA 1BG6A 5I4BA 5HDBE 1JLSA 5BRZA 3ZK7A 2AUTA 2VSCA 3CMOL 3TMAA 1U7DA 2ABWA 3L1OH 5JBQA 1PZ5A 2FJUA 4CCSA 2QJTA 1U2EA 3DYOA 4ZTUB 1G9HA 3QA3E 3TBWA 3MB8A 5EWLB 3DBHB 4KHXH 3QXDB 4ZQIA 3FROA 4PVCA 4UQ2A 4JUDX 1ANKA 1UD3A 5EZJA 1I7TB 1L5MA 1KIQB 1OSYA 1EVTC 3B53X 1LYQA 5CILL 2QTTA 2ZICA 4NFHA 3UMBA 3P19A 3S6CA 2NX5B 3NP4A 1ZK4A 4LARH 5T8IA 2E4XA 1G9MC 1HYSD 1UH3A 4YIKA 3F46A 4CUJA 1KTLB 4F2WA 3JQPA 3DBXB 1A4JB 4WTQA 4NDZA 5FNVF 4AK1A 1KGCD 3NT2A 4YEFA 4JHLA 1HE4A 4L8WB 1YQDA 3K0FA 3RVVC 3PUJA 5D87A 4ODVH 2CHGA 2PRKA 2YHBA 4S35A 3K2QA 1QH1A 5DEGB 4KK6D 5J4KA 3W9DA 3DG9A 3VH4A 3CW2A 4H31A 2C7QA 3WAKA 2G5BB 3ULVD 1SBTA 4U3SB 3FTSA 3CUTA 2P8MA 4ZMYA 3ILPB 4GT7A 1V1RB 3W5IA 3TRKA 1KN4H 4D3XA 4LHQB 3RT1A 2NQ8A 4AGNA 1G5PA 1OAOC 1BP3B 1NAMH 4Z54A 4YSQA 4KWIA 1K4MA 1Q1JL 2H9GB 3VU2A 5I4KA 1OH5A 5EIEA 5DSXA 4R40A 4DBVO 5FUMA 2EDEA 3DF7A 4O4IA 2OCJA 3IEKA 3P0HA 2PLTA 1VG0B 4D2NA 3R8XA 1G21B 1CPUA 4EGQA 3F7VB 4N68A 3V6OC 3WHE0 4ZO7A 4X4ZA 3QIWA 2WAQA 2CT8A 3EPLA 2ICWI 3QYAA 3CFBA 1UBTS 1R0SA 2XICA 4FYXA 4LXGA 2IIQA 4H15A 1N9KA 4KIGA 4C56D 3GFGA 2KT6A 3IDXH 1WL8A 2JRCA 2AT1A 5KYWA 5DUBA 1FFOB 4FUTA 2MQ0A 1JKFA 2NQCA 4Q4LA 2PCJA 3FW1A 4YASA 2KBGA 3DCJA 2GA9A 1NXVA 5HCIA 2XUIA 4HWSA 4U7GA 2D0FA 4DPBX 3VFNB 3LB6D 5T41A 3SC3A 4ICWA 5FL7D 1N4AA 5BVJB 4Q7MB 1F60A 1HH6B 2Q1SA 4NECA 3RADC 1ZD5A 3BSSA 2N42A 2QZJA 3J8F7 3NDJA 2YIMA 2G3MA 1CFNA 4MYTA 3LX4A 2FMXA 4BBPA 2WM3A 2CWRA 4MVJI 4XBPB 4KK4A 4LLQB 2JC3A 2NXZC 3E27A 3DMRA 2P2ZA 1YEEH 1MH9A 4EXPX 5EEXA 3G1UA 1JXDA 4TSCL 2BP8A 4UOQA 2ZXAA 2JIXB 2QU7A 5FI0B 4HYTA 5AJVB 3GMOA 4K3GA 3GCXA 3GS7A 3X1WA 2QM7A 2N47A 2I54A 4UUMA 4BH8A 1IY0A 1CR6A 1D6EA 4EL5A 5LP6F 2IUSA 2FX9H 3DV0A 4WUUB 5AAWA 4X7BA 3UWSA 4PQYA 1MEEA 3G2KA 2DFLA 1V47A 5JPIA 4NPYA 2ID9A 2Y67A 2GS9A 5KTKA 3KNBA 3A0RB 1XZWA 2QOEA 1A4UA 1KV7A 4PHGA 2AK4B 1VM6A 2WGXA 4YT4A 1DVFD 3L05A 1QTQA 4A0SA 2N1TE 3KPMB 2ZQKA 1M5RA 1UB5A 2WT8A 5GOTA 1OAJA 3DIFB 5C4IA 4YRFA 5F1KA 2WU3A 3ZDEA 5CJ8A 2WIFA 4DTGL 2JFYA 3GZ4A 2ZZNA 4F57L 7ABPA 2QR0A 1JHXA 1A5FH 3QJZA 3JQ9C 3MV8B 2W4IA 3DX6A 1D1SA 3I09A 3ADCA 2AP2A 2FGWH 3L8YA 3ZE1E 2C7FA 3FMIA 3B9QA 3N53A 1JEJA 2GEEA 4MD0A 3TT3L 3BFVA 4BQ6A 1UDWA 4NP6A 3CVHB 2PMZA 1AD0B 2FWIA 5ADWA 1GSHA 2DI8A 3QEUB 1E79D 4CAGA 2J59A 4GMGA 4PRHB 1W4RA 2BR4A 4NBRA 4F1KA 3HCDA 1NNLA 2Q2WA 4OLZH 3VE0A 1IQUA 2VBCA 3DO5A 3CE1A 4NM4L 4Y8VA 1DXOA 4EKGA 3MROA 4K6MA 2MTPA 2PAAA 3ZCVA 4GRMB 4P9NA 1VB3A 1PZ2A 4F7CB 3TIEA 2W43A 4HB3A 3W79A 2UZ0A 5K0TA 2P4QA 1DP0A 5HK8A 3MBXH 1JXFA 2I03A 3OZSA 2NY3D 2A88A 3OQVA 2HWXA 2YIVX 4G67A 2V5RA 4IRJB 3C6MA 1WBJB 3RT9A 2FO1A 1PJ9A 1XCQB 2XXMB 1JPNA 1I30A 3P02A 2XNSA 4X95A 2F54A 5A4IS 3CIFA 5ICCA 4CVXB 3ZYCA 5C0BD 1M8PA 2V4LA 2HT4D 4U1HB 4JDUA 2BFNA 4QNNA 4B0MM 2NW3A 1K4CA 3CWGA 4C8XA 2OZ4A 2QMJA 1A7QH 1E7WA 2E37A 2BEJA 3IPCA 4ARVA 6AT1A 2PTVA 5G1NA 1C8BA 1DAKA 2MOKA 1FJ1A 3SKNA 5ESXA 1U3HD 1QYDA 5KTOA 4JB9H 2H3NA 2AJCA 2QVXX 4P5DA 3FWHA 4I8DA 1PTJA 4U1NB 4CF6A 1QHNA 2AX4A 3F3MA 1A2QA 2I24N 10MHA 1TKRA 1U1CA 3B6JA 1XVAA 4HF5L 1UIMA 4LQLA 1Z47A 2F4VB 3VXSB 3ZO0A 5JQGA 3OO1A 2W0SA 1EUDB 5AQ1A 1OALA 4PLHA 5CVCA 1R46A 5BMVB 2ZZKA 4NP9A 3GD1C 1OAYL 4MSWB 3DEFA 2AK1H 3VD1A 5K6AA 4G72B 1EH9A 3ROQA 1ISIA 4ABYA 2HK9A 1LDPL 1M2VB 4N47A 2HA7A 1G6RH 3EBPA 2B4KA 1G5IA 3WGVA 4LG1A 5IF0B 5C1IA 1YZQA 2QHLA 2UVQA 2YIDA 1O0VA 2RBGA 3D52A 2GCPA 3FWYA 3QQ3A 4GXRA 3EIWA 3D7KA 4G7SB 1CX9B 3KWXA 4PG9A 2GVNA 3REVA 3T8XA 2Y7OA 3ZQXA 3ETJA 3GPLA 5GSVA 5KOMC 3BIFA 4HJSA 1DJXA 5DJZB 1UWEL 1OT2A 2AXHA 4I5BA 4AMBA 1OW3B 1TTCA 4AMKH 4S0SD 3L9XA 4FZRA 2KDYA 5BNWA 3LQRA 3AU1A 1FFPB 1JWUB 4BZ2L 4WLUA 1GDDA 1X7TA 3RZCA 2AFVA 2YXEA 3IMEA 5F9HA 3VDAA 4P23B 4RZIA 3QULA 3DXXA 3JWOL 4Z3GA 4UNUA 3UAAA 1IBMB 1JZ8A 2XPYA 3H42B 2Y1CA 3UMNA 1NSNH 1OY3B 3AT9A 3WSWA 4NQTA 4ANKA 1H15A 3S27A 3ARBD 4HU2A 2O5NA 2R6JA 4D9EA 3E58A 4ZT1A 4XQ9A 1WIWA 1MABA 2MSCB 1YYLH 5GGTA 2HF9A 3O3MB 1YZLA 1D0IA 1EDEA 3QI7A 4HCJA 1BWRA 5JIIA 3MXVH 1JRHL 1R5WB 3KPRE 4W63A 4DGYH 2DQJL 3E5RA 4KGVA 4D9LH 2HK8A 4Z4FA 3MV7D 2BHSA 1DRKA 5A04A 3WIHA 3BTOA 3FHCB 5E6IC 1IZKA 5IW6B 1N6HA 4EQ3A 3KUDA 1FYFA 3M5WA 4Q1AA 1IAOA 1T2EA 3N3AC 3IRUA 3UJ6A 3FQYA 4JJ5A 5CBAA 2C94A 2NY7L 2QMZA 2YINC 1E9BA 4XX1E 4LLVA 4A15A 1FPTL 3TTYA 1E6OL 3CDCA 3IV6A 4WVFA 3KR1A 1CR0A 3DLHA 121PA 5FO7A 4M9QA 3FETA 3TRFA 4JFDD 1DX9A 2JKVA 1PGOA 4OQEA 5CEEA 4XCEB 1H3FA 2ZSWB 5FNVA 3PWZA 1AJ7H 3AEYA 3HE3A 3MBWA 3CFDB 5BWMA 4DWJA 3HFML 3UK7A 5IJ0B 3T7CA 1RZUA 1FFXB 3B6IA 5A4JA 1WSST 2IZ6A 4PJ8A 4HAYA 3L79A 4PRNB 1OX4A 1A3ZA 1E8WA 3EJYD 5AUMA 4LGYA 1UQTA 3WGZA 4V0KA 1CUDA 4ALAL 4A2HA 4AG4H 4OI7A 1WSBA 3TSOA 1B74A 1S9VB 4LLUB 1YNOA 5AFAA 4BFOA 3ILEA 5TVGA 2A14A 5A6MA 3S2IA 4AEHH 2VLKA 3IA7A 1GCIA 1N1MA 4ENEC 5B39G 1FU8A 1JGDA 3G3LA 1XHLA 3O5AA 2DW5A 1NLZA 3DARA 4PV7A 3KPLB 4BAGA 2R6HA 1OGAB 4UB0L 2VO1A 5AW0A 1K85A 4G4GA 2DSNA 5DMKB 3V1MA 2CIKB 3JWOC 3H1EA 3HZZA 2HX8A 3FHTA 1MNUH 3W0WA 2QGNA 4MW9A 4AL8H 2Y07L 3DSFH 3L0PA 2WJWA 4W4OC 2K7QA 3CIQA 2P0AA 5JSZB 4M29A 1CZOA 5JA9A 2Q27A 4KV5F 3QE5A 1PYOA 3PC8A 4HEA6 1CUZA 3IDQA 1YCFA 1N8ZA 1I3OA 5LUAA 1A9QA 3CZRA 2ZUFA 4RGMB 3G5UA 4TTRA 3DVNA 3QO0B 1L4MA 2PH7A 1I3NA 1CT8A 1QMUA 5E6ZA 2UU9B 4LVOB 4WKCA 5L6MB 1SJHB 1IM3A 4E5MA 3EYSH 1USKA 4O4JF 2HUEA 4E9LA 1CXHA 1MY5A 1A4RA 1RMYA 3AZQA 1LEKA 5HHQB 2EXSA 1H5QA 5EBWB 1T13A 4AKOA 1N8NA 2G1KA 1BFUA 4Q00A 1HWHB 1ZRNA 3IHKA 2P26A 3S96A 3I6QA 4S24A 1TQWA 3GLUA 4H0NA 4RH1A 3PYMA 4L7VA 4XX0A 1N33B 3W2GA 2ZJ5A 3EDFA 4P0DA 3PG5A 1K97A 2NLJB 1FG2A 3OKNB 3OE1A 3FO2A 2Y6VA 3WNVA 3HCBA 4P7FA 4KWTA 4YL4A 2MQCA 3X44A 2ATCA 1B8NA 4NO2A 5B8CC 1ZRMA 5LP6A 2ZPTX 4UTOA 3X14A 1YOVA 1R33A 2GJJA 4OY3A 3IMGA 3Q7TA 4RJ2A 1JTOA 4OZIA 1RRVA 2NY2D 3BRSA 3OUZA 3FPEA 2H1FA 3ADDA 2BNUB 1N59A 4QQNA 4LL9A 3WJMB 2F43A 3E35A 2DYPB 4S1QH 4JJHA 4ELME 1LLCA 4L5FL 1UP7A 3W11C 3GMQA 2PGOA 4ALAC 4INZA 4U00A 2ORBL 5SYAA 2B69A 5CN3A 4TYYA 4ZFOB 5AW9A 3VX1A 2P67A 4NV1A 2HHHB 1OQXA 4UMDA 1U90A 2WAOA 4PSAA 3TH2T 1S7TB 1PYDA 5DYGA 5CLIA 1A9RA 1F2TA 5FYLH 3WK6A 1TTAA 1NBYB 1ZM2A 3MTGA 4EO7A 1XEWX 2BM0A 4R2GB 1AGCA 1GSIA 5IMLB 3NU1A 4ODUB 4Q9KA 3BISA 3C7TA 2BW0A 1JMXA 3P9LA 5T1DH 3FT3A 4C1NA 5GGVL 3C5ZB 4NZ8A 4G5YA 4JFPA 2FQEA 1UZ6F 1EJOH 1USGA 4X85A 4BQIA 1NNEA 1HYEA 3Q43A 5C9JB 3MZ0A 2ZWIA 1Z56C 1S46A 3RNQB 1O1YA 2G17A 5DC2A 1DG1G 4QEKA 5D7LA 1M9SA 4WCYH 4WA8A 2EP8A 4GP7A 3W4KA 3DGGB 4G1MA 1CWUA 5CZXC 3HDVA 2DMGA 5D01A 3CH5A 2CMGA 3U39A 4WLFA 4GEIA 4XCYA 4WHTB 3Q0EA 4POOA 5DHFA 1DQML 2VZUA 2IOMA 2ODAA 2XDHA 3H3JA 1WZ2A 5FUCE 4HMPA 3FSOA 1RQLA 1SZCA 2O0JA 1I4DD 3GGCA 2AXQA 3DXAE 1CZHA 3G0OA 2FB4L 2QRVA 5K8IA 2GUOA 1A6AA 4Z5RB 3OX2A 1J7JA 4EGCB 2QYSA 2VSKB 4QIHA 2C7BA 1RRFA 3BVNB 1VLVA 3G5ZA 4CHGA 5HDQA 2H7YA 2WWVD 1E3FA 2CLFB 5GV7A 1I3CA 4ZJ9A 13PKA 4OCWL 3RX8A 2O3RA 4FFZA 1MJGM 2XHZA 3ZL4L 3KXKA 2ZS8A 3LNGA 3KLBA 3MPUA 1UJMA 4KODA 2V7QD 3P73A 3BP5B 3UUEA 4GW4A 1BAFL 3MRNA 2I7TA 3MGTB 5MEPB 3LBNA 4LJKA 1HNXB 3NWJA 3H86A 2DKFA 3WFBH 3GJFA 3G13A 3PRKE 5L4MA 2PRJA 4J2TA 5ID1A 5F8RC 2CO4A 2GHQA 4JFXB 3LBAA 5EU4A 4JO1H 5B7NA 4Z53A 5G4NA 4DM7A 1HI6B 3MRLA 1YEJH 2DLGA 2V3WA 4TQHA 5DM1A 2XCRB 1MEXH 1XRNA 4FGMA 2B9EA 1GL7A 5GRVL 4MMZC 4FFRA 3CFKB 3AEUB 1KGUA 4DNQA 1LGYA 1W76A 1DDHA 4GECA 3J81A 5L6YH 1QOZA 1BS2A 1MO6A 1MFPA 4X5XB 4FYVA 3DYMA 2EFJA 2WEKA 5LVAA 2OK7A 2X4PB 4BK4A 2R44A 5CD9A 3SPHA 1ZA3B 3IBEA 3UG5A 1MREH 3SBXA 4FI8A 2D13A 4PWGA 4A6YA 2EARA 3WD5H 2YBRB 4D9CA 3LKBA 2DWDA 1KJ3L 5ESVA 5I16B 3IDAA 1G5HA 2C4XA 4X1KA 2EC8A 1ACYH 5FYJD 2V7BA 3ZKMC 4O58H 2QD2A 3QIUA 4M56A 4E30A 3QG7H 4BV2A 4C0BA 2PRYA 3LIPA 4XYMA 4ARBA 5FV1L 1MVYA 3O1IC 2VERA 5LC1A 2D7NA 1GSAA 5A5VA 5JNYB 4TVSA 1EPFA 2P5EB 4ZUWB 1Y4AE 1DT3A 2XV6B 2DGDA 3KS9A 1XR9A 2WVHA 3WHLA 4ZYLA 3DYBA 1QLEL 1RQ5A 4DCQB 2HVBA 5I19L 1N4XH 4L1SA 3I6LD 4NQEA 3DHNA 5JIMA 3RIAF 1IFHL 2DTML 4U6HA 4IQ8A 4MEAA 3GMTA 4BN4A 4GI7A 2CDNA 2GN0A 3N1PC 5DYNA 3TZVA 2I7CA 2PE5A 1NC4B 4ZZ0A 4ALKA 1Q1NA 4C05A 5KNBA 2V2WA 3KJNA 1BM3H 1UBJS 2ZQYA 3T3PE 3AV0B 5ENVA 5GS1B 1PG7W 2GR9A 1Y3IA 2MINA 4OQFA 5FF6B 4H8VA 5IKPA 3JSAA 3IRZA 1LWRA 1HETA 4JFQB 4XPHL 4NI5A 3SSOA 3NP3A 1BX3A 2OSBA 3HXMA 2CXHA 3DKVA 2DY0A 2QVZX 5FHRA 1BYOA 4DV3B 4AGLA 3S36L 3U80A 5F1IB 1X7SA 4P5PA 1CDDA 4F8QA 3DX0A 4XWGH 4WFFD 1QLWA 1DWUA 3WWDA 3I32A 3A4TA 1BJ1H 1RZJH 3KEHA 3RLFA 4Q9NA 2IP2A 1H05A 1JPVA 1SN2A 5EBMB 4K8RH 2CXGA 3W2FA 4DQOL 3NCTA 4EJSB 1PLKA 4UM9A 5BRZE 2DULA 1VE3A 2M6SA 2QQEA 3F5WB 2K5UA 3PJEA 4E0BA 2V37A 1E1MA 3LKSB 2VHXA 1XTSA 1N67A 2XY1A 4MVBC 2AIRA 4MJJA 4OGXH 3FPGA 2BC4A 2V0AA 1CFQA 4W9KC 4FHCA 3FSWA 1LHZA 2YXNA 1TJ4A 2ZROA 4HVLA 1BS9A 3M6UA 3QUYD 1EDBA 4M0MA 3JTMA 4FJ2A 4PW4A 3BESR 3E6FA 4BMOB 1S5PA 1RH8A 5KYYB 2P0YA 3HVKA 1QABA 4M9RA 3HY3A 5CP7B 1M83A 4YGVB 1A88A 2AEPH 3O8DA 3WE6B 2E4VA 2VXQH 5IHZB 4QDKA 4BJHB 6REQA 4LX8A 3WTTA 4LOUC 2GF9A 5EA2A 1A96A 3UJ8A 1H3TA 4M76B 4S1RH 4QPCA 5B3LA 5TQ2L 2X40A 2CLVB 2XH8A 1P5FA 5L45A 5D1QA 2XN9A 3U0WL 1SXSA 3PWVB 2IS2A 4YZWA 4PBXA 3CB2A 2E5EA 4EOWL 3RYHB 4BV9A 2JLVA 4DXDA 2G77B 2XLBA 1YNTB 1QA9A 3ATAA 1A5BB 2VYNA 5TK2A 5E6ID 4O4JA 3UWKA 1OE0A 4RTOA 1UXSA 1R0BA 1WXGA 5NLLA 1KPUB 1DQDH 2JGEA 3EADA 3L13A 1J0XO 1U8KB 2OV4A 4JMPA 4X1IA 1XTRA 5ESDA 3DV6A 4W9HC 4MRRA 1XK7A 1O7DC 3P77B 3GFFA 4NAMA 2HMUA 5TDNA 2QX8A 5LLDA 2JAUA 4PJHA 4G4SO 3GPCA 4NBWA 3DOJA 5IABA 2AFHA 4KEAA 2RJMA 2Q86B 2CU9A 1QU3A 1CIDA 1N0WA 5DHEA 3IFPA 1GZUA 3NHWA 3PV6B 4RMUA 2HYMA 4RULA 2X0DA 1OJ7A 1MCJA 3RWIA 3GG9A 3L6FB 1CPYA 4XNXH 3MSCA 1CUUA 3OR7A 1QQDB 4OD3L 4L7QA 5LWYL 4B3FX 3MTIA 4DWOA 3GLFA 3VD2A 1JEYA 3NJNA 1F14A 2QL9A 3TK1A 2JVJA 2PHZA 4LJ9A 2VJLA 5HPYB 2QMUA 3OHXB 3ZIDA 2GTPA 3Q8FA 1SBYA 1DBVO 1RXWA 4QECA 1SLWA 2F9LA 5CIPB 3H83A 4ZVSA 5FD8A 5HHPB 1F9AA 3SBOA 4YQEA 4R1LA 3VRJA 2XFXB 1BF5A 4DK6A 5IHUL 2CE7A 2IPTH 2OMTA 2W8BB 4P2AA 3PREA 4KJWD 3QPQD 2C0PA 2XVKA 1CVLA 4TS1A 3A6OA 4G2NA 4YAQA 1D6NA 4UZEA 2CXTA 5F98A 1T66C 1IE4A 3EJSA 4XH2A 2ZE8A 3ZQ9A 1T5TA 1NUHA 4N8DA 3UPCA 4W7HA 1E96A 2B7CA 5EJ2A 2QVCA 3D4ZA 5TARA 4QE3A 1E69A 3OBAA 3C60C 1EJBA 1E8ZA 4MZ3A 1OYYA 3H3KA 1L7RA 2DBLH 2Q3BA 3KVOA 2WOYA 2EKQA 4PRBB 2BSTB 2E27H 5CFHA 1BZDA 4DCUA 5IWCA 3UYRH 1KE1A 5JISA 1GRWA 3WEXA 4O4LA 1HUQA 3AQIA 3ULUE 2G0NA 1UEYA 3T0DA 1KJ2H 1MC4A 3RU9A 2FLBT 3A9WA 1XL0A 1MCIA 1YJDL 5G0WA 2RMNA 5D55A 2V0GA 3K1AB 5JNSA 3K4HA 1MNAA 5DLML 4MCZB 3ZR5A 2AX3A 4YCAA 3GIDA 1AGNA 1ZBDA 4YTEA 3HTLX 4NNJA 2QEJA 2K3TA 3OPNA 2QMKA 3ILQC 1WHSA 5G3YA 4EI5D 1NYRA 1XEXB 4IOMA 4LK2A 2HX1A 2P2NA 5I5MA 3IUPA 5FM5O 3GQBB 3U4IA 4UHCA 1GZHC 1A9VA 2DPMA 3GBNH 2ZIEA 4K88A 4O02B 2H51A 4CRPA 4NZUL 1U8NB 2OX5A 3PUXA 4QVGA 5T1LB 1E5UI 2YHAA 2W6CX 1KJ8A 2C9AA 1WWCA 3HE6C 5FAKA 1QO3B 1OI4A 4CMEA 4BJ3A 2PZ8A 3AG2B 4LSQL 4BXOB 1CIUA 3H5AA 2ICES 3MGKA 2R00A 3QHQA 3W11D 3T6ZA 2G4CA 1E4KC 2BSAA 3K73O 2WANA 3KL0A 4X42A 4WWOA 4HEJA 1HX7A 1L4UA 3KZCA 4IK6A 3G5YA 3SZ3A 4D9FA 2F54E 4YRDA 4P1ZA 4F4HA 2NZIA 1DTSA 3IN2A 3KVQA 5KTSA 1S7UA 5FAAA 2X9GA 4C3UA 4RA9A 3RBXA 3ERXA 1KEPA 1Z34A 3CNNA 1BM7A 1WV0A 2PKQO 4ZX5A 3EDMA 4ZJUA 4K3DL 3EOYG 3EQ7A 1PLBA 1NWCA 1KRXA 5D5MA 5IQ7H 4BY9E 4ZFGH 1AHPA 4BEIA 1G8GA 2XQBH 3OZ9H 4A7SA 4HWEL 4DW2L 1ZUD1 4PUBH 3RYTC 3BZDA 3O82A 1SHWA 1AOHA 2Z7YA 4I36A 5LQCA 5LXGL 1R0AL 3TQRA 4EUKA 1QBGA 1G94A 1VRSA 3CZSA 3SCZA 3CUSA 3OTIA 5ALMA 4HETA 3B20A 4MW6A 1XLUA 1E1YA 2RI6A 3FBWA 1OH7A 1OZ0A 1XI2A 4Y16C 3T38A 5CZXD 5F9WB 1ZLEA 3L7EA 2PL9A 3HRIA 3KYJB 2XDQB 4IIEA 1RLTA 2EEZA 4K5QA 4U6XB 4PRIA 5AKGA 3D3VD 1W6LA 1XC7A 3HVUA 2C78A 1GZPA 1YJDC 3QEHA 1XUOA 1PV2A 2QQLH 3AUFA 1E2HA 5WRFA 1F00I 3O6KH 2Q8PA 2EL7A 3ZE1F 4PJ9B 3HO1A 3CH8A 3GPEA 3MRDB 5JDSA 4LSTL 1ZCJA 4PP1D 3SBEA 1E28B 3V4LA 4EB0A 5LOVB 3SBRA 3IX7A 5IB3B 4N5UA 2ORWA 3BYYA 3R3UA 2Q9AA 4KKVA 1IRIA 4Q7KA 3VGAC 3WWCA 1LPOA 5IFHL 1N3IA 1U91A 2KLHA 3DVRX 1LK3L 2PXYA 2CA3A 1E6WA 3LL7A 1VE7A 2PXCA 1NIEA 3GF8A 3R3SA 3R9WA 2H3KA 3GRVA 2DH5A 2J0VA 5I6LA 4KROB 1PZEA 4IU2A 2A3TA 2D7MA 2HKFH 1ZK1A 2FY8A 2ZJYA 1GARA 4EI2A 4IQHA 3HLTA 5IKCA 1SMAA 2W91A 2IFFH 1NVVQ 1Q7RA 4NU8X 1POXA 2IPUK 1WRBA 3PQ3A 5KYXB 1KZHA 2G2NA 4XBEL 2GN8A 3O3DB 3IP9A 1WZ1L 3ZUCA 1UWKA 4ONHB 1X7YB 4LKOA 4CMAA 3O4LB 4YXHL 3OAZK 1BFVH 5C92A 2I6XA 4B82A 1DTUA 2ZD0A 4A92A 1T15A 2YQ2A 2Z4TA 3UENA 3ETHA 1W96A 1FJ2A 2G3NA 1WIPA 3GUYA 4GZ6A 5FTLA 1Y1UA 4J7AA 1H94A 4HGPA 2R2HB 4PLJD 4IRZL 4Q24A 3NHUA 2PCPA 1TGVA 4Y0AA 1JXKA 3HEIB 3ZWDA 4Y4HD 4X7TB 4YHKL 4D56A 2EGHA 4M21A 3BPNC 1R66A 3L6DA 3MRJB 1V4BA 2W9EH 1XTMA 1KDJA 3QQ9C 4LNHA 4DMFA 3V0DA 3PEVA 4Q1BA 1Z6JT 4CDMA 4P3YA 2H6EA 3ZQ6A 3VXMD 4R3NA 2YAEA 3MC1A 1IEBA 1PRYA 2A77L 1R8YA 4UNVA 3D4GA 1M5UA 3Q6GH 2HUPA 5BSKA 3GN2A 3MXOA 1NMEA 4N8UA 3QRLA 1XXHB 1SCQA 5IK2D 4Z3JA 2OQJA 3NN8B 2ETXA 3FO9A 2A5GA 1PZCA 3TX6A 3SYPA 5I1LA 4MS1B 4L1BA 3H2KA 1R9MA 2LOEA 3WGIA 2ZOLA 2EWVA 3RSHA 4JR2A 1IGTB 3VR6A 3JVGC 5BN5A 5GRYA 3HG5A 5HHNA 1YQUA 5IAOA 3OMLA 2IK8A 2GK0B 1HDMB 3Q1KA 5F0MB 1Z4PX 1R6VA 2IWRA 3JV4B 4Z4IA 1BS1A 3KPSD 1W87A 4HY3A 2AJSH 5B2EA 4XW2A 4BGDA 2WF5A 5DEJA 2VPWA 1EE1A 4ER5A 4CVWA 4LDRA 2A5UA 4WCFA 4KB5A 2IYUA 4ZPTA 2IQ5A 4NBZB 4OBXA 1QHYA 2DKSA 5KOHB 1AUVA 2HEIA 5DM4A 3W0WE 4KXQA 2BJHA 1IGCL 4BELD 1A1NB 4U1LB 5MHSD 1FMLA 3U0VA 4RKYA 1W0JD 12E8H 4MO2A 1NEZG 3TXYA 5T8KC 4YWGH 4YHYC 3RGVC 3ZTJH 1YL6A 4W82A 3MLTB 4XB8A 3FNBA 2RA1A 3I61A 5E1AB 3KQTA 3CZFA 2D4AA 3A47A 3PTAA 2JI1A 2WFAA 3LXRA 1DHTA 1KV3A 4I08A 3STXA 1FNNA 3ZKNC 4HIJB 2AFRA 3CT4A 5F7OA 3V4UH 4WFJA 5TQ2B 3T9FA 1QFWI 3C15C 1DWOA 2AQ8A 3K5IA 3R9XA 5IB2A 4HD8A 4D8WA 1FXUA 1QFYA 5KYGA 1A2OA 5EUOA 3BICA 2GZMA 5M5BA 4DRZA 2DWXA 3EXHB 2FW8A 4O3FA 1TZMA 1GN9A 4YE0A 4TLTA 3BT7A 4HQQL 1K92A 2R2AA 4JLPA 4AJLA 1I3VA 3F7MA 2D6FA 3LPAA 2JCGA 1MAAA 3FDZA 4A7GA 3DOUA 1CF8L 3I9MA 5ULLA 4B4WA 2WJ5A 1HFKA 3RC1A 1JSXA 1AKRA 1NVUQ 4MV3A 3BRWD 3UB3A 5DD5H 3L3DA 5C07A 3IQEA 1SXBA 4LOUD 4K15A 1BNCA 4X80L 4OZIE 4OFZA 2IOFK 1HL3A 4OQQA 3O3EA 2R8PA 8AT1A 4FNSA 3H1BA