3ZE1B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 106
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze1B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze1B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze1B03
1XDGA 3ZDXB 2VDPB 4HQLA 3OL2B 4HQOA 4CN9A 4WFQA 1IDN1 3VI4B 3NVQA 5KYUA 4O02A 4CNBA 4F1KA 5KYYA 1QC5A 2O7NA 1XDDA 3K72B 3EGXB 3PPWA 4JX0A 1MJNA 1U8CB 3EFOA 4G1EB 4MMYB 3AFCA 3K71B 2I6QA 3PPXA 4CN8A 5KYNA 3BN3A 3N2NA 3FCSA 4G1MB 2VDRB 1PCXA 1Q0PA 4WK0B 1SHUX 1JEYA 4K3JB 3E2MA 3F74A 4WK2B 2P28A 1FNSA 3EH1A 4FX5A 4HQKA 5E6SA 1ZOPA 3QA3E 1MQ9A 2NUTB 2VDOB 2VDLB 1IJKA 1M10A 1JV2A 1QCYA 2X5NA 2IUEA 3EG9B 4UM9B 1JLMA 4BJ3A 2VDMB 2NVOA 2ICAA 3TVYA 3AL9A 1MQ8B 4JDUA 2XWBF 5KYWA 3NIGB 1IJBA 4WJKB 1MF7A 3OL2A 1XUOA 2XGGA 5LN1A 4WK4B 1OLZA 3V4VB 3AL8B 1YVRA 4Z7OB 3Q3GE 4DMUB 3M6FA 2QTVA 5HDBB 2WW8A 5BV8A 4Z7NB 4MMZB 3ZDYB 1MQAA 1RRKA 4HQNA 3TW0A 1U8CA 1JEQA 5KYXA 2B2XA 2VC2B 3VI3B 1N9ZA 3FCUB 4IHKA 3K6SA 1PT6A 4IGIA 1RS0A 1DZIA 3RAGA 1LFAA 1ZONA 4C29A 5E6RB 2ADFA 4A0QA 3HXQA 4NENB 3IBSA 1N3YA 2NUPA 5HJ2A 1ZOOA 2VDKB 4HQFA 3TCXB 5KYUB 3PPVA 3V4PB 4O02B 3GXBA 5KYYB 1BHQ1 1M1XA 1M2VA 2ODPA 1L5GB 1SQ0A 3IJEA 5E6UB 1BHO1 1ATZA 1PD0A 2UZYB 3EFOB 1RTKA 3NIFB 4F1JA 4GZ8A 3F78A 1AO3A 3EOBI 3EOAI 1CK4A 3HXOA 3PPYA 3FCSB 4UM9D 3ZE1B 2I6SA 4MMXB 2VDQB 1JEYB 4NEHB 1AUQA 3EH2A 3ZE2B 4UM8B 1YUKA 1CQPA 4C2AA 3K72A 3EGXA 1U0NA 5E6SB 3OKWA 4O3TB 4G1EA 4MMYA 1PD1A 1AOXA 1T6BY 3K71A 3T3MB 3EGDB 1JV2B 4G1MA 2ODQA 1U0OC 1SHYB 4PN7A 3ZQKA 4FWWA 4NENA 5KYWB 2P26A 2NUTA 1UEXC 2I91A 2XWJI 3NIDB 4M76B 1QC5B 1IDOA 2VDNB 1FE8A 3EG9A 3T3PB 1L5GA 1MHPA 3TXAA 5E6UA 1RD4A 3OKYB 4O3UB 1DGQA 1JEQB 5KYXB 3HI6A 1YVPA 5HGJA 3ZDZB 3K6SB 1M2OA 4C2BA 1TYEB 4MMXA 2M32A 5ES4B 3AL8A 3ZE0B 2NUPB 3BQMB 4MMZA 1M1UA 1OAKA 4XW2A 4IXDA 1V7PC 3EGDA 1M1XB 1M2VB 1NA5A 3IJEB 5E6RA 4Z7QB 1SSLA 1SHTX 1T0PA 2WINI 3BQNB
chains in the Genus database with same CATH superfamily
1IAIH 4CRPA 3MLTA 4ZK2A 1NF2A 1R34A 3AUWB 2ZJ4A 5MGBA 2PUTA 4GMTL 1WPXA 4G43A 3AM8A 3CQQA 4POYA 3H1BA 2QVBA 1FFTB 4YR7A 4ZUTB 2V9PA 2GPBA 4FN0A 1JK8A 1G9NH 1F3OA 5ADUS 2H29A 5JOEA 4G5OA 3AREC 2CG9X 5JT1A 4ZYZA 3B8EA 4LI0A 3RIFK 4PCSA 3K09C 3EFFB 3UF0A 4JKKA 3CO0S 5MHTA 5KVFL 3VZPA 4ALIA 4QG3A 3T0BA 3RVRA 2JJTA 1IGML 1WCQA 4D9QD 5H80A 1J8MF 2Q4TA 2YMLA 3AJAA 3PGMA 5J2UB 5E5MA 4X1OA 4P99A 5D55A 4GOXA 2XWPA 3Q0HA 1QOPB 1ZP6A 4RLSA 2EDHA 4QOKD 1DLFH 4W9IC 2X1MA 1OKEA 3IP1A 2EYRA 2WP3T 4I3SL 3GUZA 2CLSA 3T3HA 5AOBA 5LBTA 5IVZB 2XYCA 2FJHB 4EDHA 5FW8A 3OZXA 2F9BT 1RWOA 3G5UA 5ALPA 4E1VA 2UZXB 3ZVRA 4KROD 2PJUA 2C3UA 4KWEA 4JHVA 1I7QB 5I1KL 1G5AA 3P0GB 3A1UA 4XO4A 5IJVA 2DWTA 4PE5B 3RWEA 1RI2A 5DO2C 5DVLA 4P3CL 5JLAA 4TNFA 1GXEA 4E03A 4B6JA 4HADA 4P4GA 1NAMB 4A7VA 4I1YA 1G6Q1 4GQPH 1ZD3A 4C2TA 4I89A 5DE3A 3LDBC 2NGRA 2PD3A 2JFVA 2W65B 3GLHE 2VL5B 2V0NA 2NY0C 1B6GA 3GJXC 4GKVA 4N2MA 2A1UB 4BO1A 1E3DA 2XXMB 2Y6SD 3B7GA 3FFTA 4UBJA 2A0LD 3MRVA 4CU2A 2XA2A 1ERNA 1EDZA 3W5NA 4M49A 3M17A 4M1SA 1VPTA 3GXPA 3SG0A 3IA7A 1LRJA 3MB8A 2V5MA 1S9VA 1QWUA 3E05A 4BM7A 5F2EA 5EWIH 1VMKA 4HLUC 5DJZA 4QBIA 1AO0A 3MWFA 4X98A 3IFLH 1WSBA 2PKWA 4FHKA 2GC4C 1DLJA 3B1ZA 1NQWA 2QEQA 3L45A 3V7UA 4K6GA 3EYWA 3EWAA 4J1QA 3OH8A 2BS8A 4CFSA 4BQIA 5C08D 1RXEA 3RRMA 3ECAA 4DGIL 2PKCA 1NIBA 2O0LA 1Y42X 1Y6ZA 3GLIE 4G84A 5AW3B 4NO3B 4OJFL 2V59A 4XMZA 2QYTA 5F89A 3Q2VA 1UOPA 5F7HA 1XMIA 4LHWA 3IU3A 3LX8A 1L7VC 5I9LA 3JSAA 2KI6A 1JD9A 3GRGA 3ORRA 4NQEA 3KKLA 2ZOKA 1KOAA 3RUGA 2EXTA 2DQUL 2PWAA 3Q9LA 4OCRL 3TA3D 2KMWA 2ZSWA 3H1ZA 4W6QA 2NACA 4OLWH 3AG5A 3L4ZA 4YSOA 2XDQB 4XCEA 1BZYA 4OLZH 2P91A 4DN4H 2RD0A 3MRHB 3KPYA 1Z7WA 4QO1B 3BMVA 5AXDA 2SKDA 4AOFA 4QWMA 2GBVA 2CSXA 2XBTA 1OF2A 3LD9A 2QGZA 3N87A 2Z0UA 3DE2X 3DLQR 4AJ1A 2P2ZA 3GBSA 2WDZA 3ZGIA 4NL4H 2H5EA 4RMVA 2VA9A 3RWDB 3LUJA 3D1LA 4ZUSA 1S9WB 1WBBA 2FKNA 1T1GA 5EWMB 1OGTB 2J88L 1DQJA 4TQEH 2QXYA 2FYYA 4NSKA 2WF5A 4ARZB 3I4LA 1MB4A 1AS2A 2XB2A 4JQZA 5HD8C 5E6UB 2FX7H 3IGAB 1ZUD1 3DGGB 3MFGB 1I1QB 2PBRA 2VDQB 2ZG6A 2R9VA 2O50A 1UFQA 2PYEA 5D8JL 3VKFA 4YX2H 1BD4A 3T5CA 1S8AA 2EOAA 3RX9A 1NA8A 1QAQA 4OKDA 2RIRA 2PANA 4KY1H 2JWHA 3MLTB 4EVRA 3RS4A 4IR7A 1UZ6E 5ALWA 4F33B 1MH5A 4BNWA 1I4EB 2A83B 3TTVA 1MX9A 1OM3L 4G43B 4R0VA 1N5JA 5IBTH 4PNEA 3RFTA 2IANE 3ZNOA 1TMOA 4Z5XA 4LCCC 3HFSA 3QIUD 4QOJA 1L5SA 2FX8H 5CDUA 3MJDA 1JK8B 3VWKB 5DJYA 3M6AA 5JHAA 2FUG6 4IRSA 1ZE3C 3VRJB 5ALLA 3K8OE 1OD9A 3S5JA 1YASA 1CQJB 3M5PA 3LY8A 1RTTA 1ZRHA 4DZTA 2FOIA 4XE0A 5DCCA 1BGVA 5TPWA 2QG9A 3GIWA 4JUSA 3NFPA 5IBRA 2F2TA 4U1JA 1Z9PA 3STBA 5BZDA 3RSQA 2WSSA 2HH9A 4NGHH 5JVDF 3UMTA 2PL5A 5C0ND 4X9FA 1RHHB 5CP3A 3B2XA 1KH3A 4PYNA 2C57A 4EYQA 5IESL 4FD3A 2H47C 1G8AA 1TYDE 5CX4A 4CDGC 1DRWA 2WAMA 3FH8A 2V0CA 1R5NA 4HTFA 2QN8A 2GNPA 1K85A 4OAPA 3NAMA 2CE6A 2EVIA 2VWQA 1IJFA 3VGGA 4P22A 4AQYB 2X3UA 4MV3A 1P1RA 1GRWA 2XYHA 3HZVA 1AOXA 4QHMA 3T7AA 5AAWA 1MV5A 3A6JA 1FE8L 2P35A 4JFWA 1UFRA 2ZIXA 2A1WL 1UJNA 1XT6A 4KZDH 3RVTC 1I7UB 1F3RB 1Z6JT 3GDOA 2INGX 3TBTB 2RAVA 4YHIB 3H16A 2C34A 4MW5A 4D94A 4ZTUB 1ONQB 3L7AA 5I9IA 2EXSA 4E14A 2GJZB 1JDZA 4KOCA 1E3ZA 1S2EA 5BT8A 2HX9A 1MVFA 1K5HA 3CRMA 1FYTA 4Q3NA 1H2FA 3ZTYA 2K4WA 1V5IA 2F6RA 3RRXA 4X98B 4DW8A 2YEVB 3RYMA 4M93C 3JQ7A 4C4XA 2AXJA 4L5FH 5FUZL 3BDBA 3V8MA 1Q0RA 3KM1A 4C7BA 3ROOB 3RBAA 2C97A 4GS5A 4DV2B 3RS8A 2AJUL 1Y9JA 3O74A 3QZNA 2YS6A 4QJBA 1VHLA 1S2DA 3CVIL 4TTAA 3TJZA 2WO3B 4LE8A 3GRUA 3MD0A 4G0XA 2HKFL 3KCNA 4L4VD 5F89B 3LCMA 1YOVA 5TGZA 3U26A 1EZ4A 4CSSA 2VZTA 3UMVA 2G36A 2L7JA 3IU3B 3A7DA 1NC1A 2CFIA 3LY9A 1TDQA 1XRPA 4PYMA 2GZ2A 1TM7E 4OA8A 4ZTPL 2ERXA 4NQEB 3VQMA 4BLUA 4IXMA 2JFBA 2XLCA 1E32A 3RUGB 5MEPA 3ULVL 3QR2A 1FAIH 1W2KT 2NZ2A 3HB3C 1MAUA 4N18A 5ETUA 3C3CA 4P2RD 2BDTA 3ZW3A 5DGHA 1ZD8A 5FBHA 3OF6D 4IM7A 2B4CH 5HDBF 5T4FA 3PU7A 5IB4A 1P7WA 3LQZB 1WCWA 4KH2A 4QPJC 5CIQA 1I94B 1YA4A 3FO1B 1KJWA 1NAIA 4R31A 3D2BA 5C9KA 1YRWA 1YMHA 3QXAA 4JKPL 1M34E 4AKQA 1B88A 3D08A 1J09A 3NBYC 1XPOA 1E1NA 5FL3A 3AYXB 1HE8B 3AR3A 4TVPD 3S5ZA 5CUQA 2XVKA 4UIKL 5HIIA 4V03A 1FVHA 3C5JA 2YD1A 3MZGB 2C7RA 1EPUA 2WXHA 2FYYB 4EPRA 1SUCA 2BL4A 4XNYL 5IEJA 1XHHA 4U1RA 4DJMA 4QCIA 3CIAA 2C2MA 4M00A 3G6DH 5CJXC 3REFA 1WZMA 2LVEA 2L2QA 1PNOA 1SQGA 2OVFA 1D2MA 3RURA 1KMGA 4HISA 1ZS8B 4NKIL 2GI7A 4QXVA 3X44A 1BZ7A 1PY4A 3CFUA 3MRCA 4ALJA 2WDPA 1ZPDA 2NVWA 2AE1A 3W82A 4ABWA 4S1WA 4DETA 4ODHL 5JW4Q 3U79A 5DYGA 1E79A 2R56L 1MGPA 1E50A 2R2EB 4X6DE 1LMIA 3ZUCA 3FF7A 4LBVA 2W4QA 4ER6A 3X3GL 1FYFA 5SWSA 4LJYA 2R87A 1DVZA 1AXIB 1EFRA 1OX4A 1DEAA 1S8FA 2OO7A 3HVKA 5LIRA 5CP8A 3I50L 1XZBA 4RTSA 2ZOWA 3WYBA 4N7JA 2B3IA 3QORB 2HWZL 2SBTA 4NZZA 1PBTA 1EGJL 4E0RA 2A9CA 3RRFA 1A1SA 1B6TA 3PL6C 1PJQA 2B1IA 5TPWB 4HC1H 3MA9L 3NFPB 4NZOA 2VRNA 3LQFA 1PZNA 3MX0A 5BZDB 1E7VA 4IPTA 1HKUA 4OP1A 1UMDB 4DSTA 2JFGA 4R0LC 1XVLA 5CZVH 5HMMA 2QBWA 2G8NA 5JQHC 4KIJA 5JXAH 1NW8A 2AXHA 1RWMA 2WJWA 4H20L 1X6VA 4I3HA 3TGWA 1S9KC 4EFMA 4HTFB 1O94A 4TVBA 5A2JH 5A4AA 2KL6A 1R37A 1H4VB 1DC8A 1R5VB 4PGBB 5L4IA 4KMSA 4MH0R 2BUAA 3RU9A 4YDQA 3Q1KA 3MRJA 2OCXA 2VN8A 3FSVA 1XMSA 1HA3A 4Z1MD 1F5SA 1GTMA 3QEUA 4B3SB 2HG5B 4PU0A 3F97A 2KZ1B 4XCVA 3AVOA 3LGAA 3QJHB 3I3SR 1ZO8A 3OKNB 4FS8A 3AQZA 4AK9A 4RIEA 5CEYB 3T7EA 2ZIXB 2H18A 3U16A 1WZEA 2J9FA 3N1FC 3UP6A 3HZ3A 1K88A 4QWWD 4HAUA 5KVVA 4QTTB 3VNAA 4K8RL 3RWBA 3KYMA 2ZWAA 3V0EA 1QTRA 4I87A 4O1IA 5HPYB 3QUTA 1SF5A 3S1LA 2VZUA 2P40A 1XZMA 5D5MF 3N3EA 4G9DB 3JQ7B 2JGKA 2FECI 1S3GA 1LBEA 3QF4B 3M6LA 2H41A 5GSRB 1ZK3A 3PFUA 2ZS9A 2PH7A 1QH8A 3BGOS 4J4PD 5HA5A 1YT5A 1Z6AA 1XN1A 3MBED 1HV8A 4MB3A 4O02A 4GBXB 1JYXA 2VUIB 3BKJL 3WMRA 1NDHA 2ZT6A 3OT1A 1PQPA 1CGSH 4G1MB 2JG3A 3K4ZA 3S36L 1UUFA 1TKWA 5C09D 1CXHA 4K8RD 4KRPC 2B59B 4B9YA 3PC8C 3HR7A 5E2TH 5EOQH 5JD3A 2QL9A 4URZR 3OQOA 3S97C 5D1ZD 2W0KA 3E4DA 1FX0A 2AXWA 4XVTH 2QUAA 5BN3B 2FJGA 4GI9A 3ARBB 2PUHA 2VLJE 1L6PA 1JERA 3OKDA 5ETUB 5JV5A 4NRYB 1N2CB 3MRIB 1E2ZA 1J5PA 4I7EA 3W2IA 3V2GA 4HAVA 3F78A 3FM9A 1NDUA 2IHUA 4JEHA 1Q12A 5EF3A 3ZN6A 5LXGH 2BMFA 5DK2A 1XCQB 3KB8A 3QXAB 1QCZA 3T3MB 2QX4A 4DGQA 3IB3A 5CD1A 2PXCA 3MLUL 3JQ8A 2QKIC 4BC0A 5ERXA 1B16A 3IJYB 4S1TA 2V5TA 5TDPA 1A8ZA 3C5JB 3IJPA 3HRHA 1RC1A 2RHEA 1LPSA 2NZ9D 3LS2A 1KS2A 5T3XL 3LS5L 1CFMA 3MSXA 4C20A 5AYQA 4UNRA 1NAKL 1W8NA 1ZGLP 3O81A 1CF4A 4GXVL 3C3PA 2EBFX 5E8EB 2YJNA 3N8IA 5DMXA 2WM2A 1YMVA 3FGPA 2E7HA 2ZQKA 1TRKA 1W581 4JIGA 4OBBA 5AFSA 3DMNA 4HIPA 2HA5A 2A73A 3BWYA 1BZ7B 4HT1L 4NPYA 1JP7A 2F1RA 2JGJA 1R0XA 2P52A 3LO5A 1L4NA 3HZZA 1XZPA 2WJ6A 1DANU 1A4IA 1PNDA 4I81A 4PVDA 5CX1B 1NYQA 4GAGL 2HIAA 1P5ZB 4PJAB 4Y8AA 3QP9A 4HJTA 3BX1A 1NJFA 4W5RA 3ARDC 4TS9A 4JFOB 2JJ1D 3S0PA 5ALOA 5L3SA 2UYCA 2P67A 5SWSB 3OFSA 4TOYH 4P33A 1W88B 1F56A 2VC2H 2A5LA 3JWJA 3BJIC 1RI1A 3RJTA 5LVEA 4DC1A 3KPRE 1J48A 4IJ3C 1C3OB 4L5BA 5FPTA 2NXJA 2WUCL 2ZCZA 4JDVA 2AJCA 3EOTL 5T3XD 5A9SA 4HNTA 4WDIA 1N5DA 4IOLA 2R23A 4JQIA 5F9AC 3WDLA 4DCNA 4E11A 4BNYA 5DQDH 2OHGA 1NGYA 5C0JB 1BBDH 4MYHA 1Y9EA 1JPNA 3M1BA 3UJNA 2BMDA 4N0UA 5DMIL 4FHBD 3VSDA 1AMUA 1PDKA 2Q4BA 1J87A 4YRNA 3TSWA 5J1TB 4KTDL 4CUCA 4YMTA 4L51A 4OGYL 3W11D 1RZIB 3T5AA 1RJ9A 2LAGB 2OESA 2BZGA 2VCOA 4XIJA 2J44A 2IXEA 4UMEA 2Q7YA 5LLSA 3ZWVA 1ENYA 3FRPA 3TYFB 3DHYA 4GGMX 5E2VL 2EP8A 4R16A 3QEUB 4BK5C 3Q9UA 5HPMB 4Y1EA 1TFRA 5FHQA 1PCXA 4DUPA 2V55B 3NESA 5IK3B 1WULS 5BOSB 4CM3A 4FMFA 4LZKA 3UBHA 2NY3B 1OHHA 4W70A 2VRKA 2ICAA 3P0VL 4LZLA 4CQMA 2P90A 5EA2A 1HXKA 3I02A 3KYMB 4JJ5A 3U62A 2OXHA 3B56A 1BCSB 4JP2A 4EHNA 2WWVD 2BMVA 1AQKH 4Z3IA 4N0QA 1WFMA 4MNGE 4PJ6A 3FWKA 1VRCA 4JROA 3IR6A 5CEJA 3PNQA 5CPFA 2WIGA 4BKTC 1ZT7A 5AUNB 3UTTA 4KZ0A 3CINA 3REGA 3VV3A 3MJ8B 1GOHA 2LCQA 3ZN2A 5KC8A 4QGTA 1XAJA 4M7ZC 1B7GO 3ECCA 4F1SA 3U56A 3DPDA 1KCLA 4O9HH 4JO1H 3BDVA 4Y2JA 1QH8B 3VYPA 4RS3A 5FL7D 3DK0A 1W0JA 4QHYA 3T7TA 1WHSA 1U8TA 2XCRB 3JWNC 2ZUQB 1AOZA 3R0ZA 3OT1B 1S7XB 4J2OA 5E4EB 2NTFB 4OF7A 2QPTA 3C1OA 1ZGCA 3FWZA 5K69A 2W0LA 3FTXA 1ZW6A 1PJ2A 3B9RA 4M02A 3O31A 1Z34A 3RC2A 1UDRA 1YV9A 1U2DC 4GUPB 4G56A 3ETLA 3OWHA 4JT4A 5DGXA 5BUQA 2GYSA 4OLAA 3CHYA 3FLAA 2QGNA 3GSVB 2D9CA 1KDIA 3OKDB 3MV9D 3SNKA 5IROA 1SKMA 3FUHA 3RHTA 4LE1A 4YPGA 2YHAA 1SBBA 3EUFA 3TUJC 1NSTA 3FFCB 2FI1A 1NHGA 3U61B 3UJ9A 4YJFA 1PX4A 1GPOH 1EK5A 2DW5A 2CBGA 5DK2B 2OWDA 3FT3A 1W4ZA 4FFWA 5E95A 1TVBA 4XPHL 4ATWA 4PJEA 5I7AA 4LQFH 5ESQA 2F5BL 3FDWA 3JQ8B 5HD8D 1MO3A 4YV1A 4KLZA 1V10A 4XOCA 4BO0A 3KHUA 3B51X 4WIQA 2H08A 4Y9DA 3QU9A 4HUTA 2I3DA 2Z65C 1AUVA 2D3TA 1ONNA 2HZBA 1E6JL 4YDIH 1ZKMA 1TZJA 2AFHB 4YLGA 4P9HC 2QZ9A 3H13A 5KBKA 2QV4A 1WS8A 2P7TA 5FI5A 2EKQA 3FD8A 3UXYA 4HK3N 5AXCA 1G9ML 4OATA 3GRRA 3QV1A 3E9CA 2HD4A 4XSGA 4UXHA 1LJLA 5JORA 4YSRA 3MLSH 2AFVA 3DM9B 1RHKA 1MIMH 3WENA 1H2YA 4IBUA 3I5AA 1TQ8A 3UXEA 2VTVA 3IXTB 2LCIA 3Q41A 2RHWA 2CHXA 3GSRA 3B9BA 3WBKA 4JBIA 1RE1A 2WICA 2CK0L 3PPWA 3RVQA 3D3VE 2OXEA 4BK4A 4W4NA 2B8OT 2H1SA 1UXKA 4WJ5A 5BMVA 2X2HA 1BVUA 2CGYA 1FSPA 5F73A 4TVKA 3IAGC 1SPDA 3R0MA 4NLLA 4OV6B 2NXZC 3MTBA 1FSKC 2D7DA 3FKJA 3HE3A 3DAGA 4XVJL 4PJCE 5KCZA 4LXXA 2MJLA 1A9ZA 1NGYB 4KNTA 1J24A 2I4IA 4U1SA 2QTMA 2A74C 3PQFA 4EQZA 2C5FA 1DVQA 5GGUA 2FWMX 2RG7A 3BUDA 1USKA 4N0UB 3TOPA 3U6BA 2B2NA 3VV2A 1X6LA 1G8GA 4BO3A 1NKTA 3TEFA 5F2KA 1A04A 3P9PA 3TLXA 1KCSL 2FSSA 3DX2A 1HGXA 4YJ2B 1SZDA 4P5TC 1TA9A 3NYRA 5LBSA 1AS7A 5C0CE 4KR7A 4CBZA 2YK1H 1S46A 4K73A 4X91A 5GVSA 1EE1A 1BREA 3Q9PA 5DVOA 2QZZA 3H1EA 4RYLA 3V4VL 3ID6C 2MQGA 1MF2L 3D07A 3DDFA 4C06A 3AXHA 4ZDWA 4YCAA 2MMCA 3BWVA 5K0ZA 3ILHA 3HNOA 5DK4A 1XRMA 4BWUA 3ZWDA 1Z3RA 3G1UA 3HDYA 3BIOA 3U4EA 3VW3H 2W2KA 3H9CA 3PHQB 2BT4A 3CD4A 3ONWA 3IJSA 4X6CA 3QPDA 2C31A 3UJ6A 3VDMA 3WLLA 1H1TA 4GSLA 3I02B 1JHDA 2H0JA 2EO7A 4JJ5B 2OXHB 2VJ0A 1J12A 2YO3A 2BN4A 3BGFC 5F7KC 5DWQA 4AWXA 2R7EA 2IX9A 4DUYB 5GSVA 4YBHA 2QGFA 1M6UA 3ROLB 1HCYA 4C7KA 4KYUA 5ACZA 4FC6A 3AINA 3S96A 4URUR 3Q8LA 2Q29A 5TV2A 4GECA 1I9RH 3OEHD 2AQ2A 4ZG1A 1XPJA 1FBNA 3T6WA 1XL1A 4LHVA 1IVLA 4R81A 1L7QA 4K3DH 1QIJA 4R6WA 5KQLA 1N5AB 4DSZA 4NKDA 3NK4A 4F56A 3BCRA 4PB0H 4XNXL 3PR1A 5DCLA 5FFLA 5HDQL 4UM9D 3RT7A 3N2IA 5E1OA 3DI2B 2LCFA 4MR8A 4MW4A 5F9JA 1NVGA 5CFMA 2PUAA 3HB3D 4QO8A 2ZOTA 1ZAGA 4PVBA 3OZTA 1JNHA 2EQDA 4Y6OA 4Z95L 1P91A 3PQ5A 1T5OA 2PKQP 4CMIA 1XTSA 4KREA 1EQUA 3NW9A 4I48A 1IMHC 3O45A 2XE8A 1Q9LB 3W8RA 5ISZE 1SM3H 3BAYA 1TGYA 3WZLA 1QE0A 3PUXA 1M4KA 2ITDA 5E9DA 5AJXA 1WD8A 2P2LA 4Y6SA 2VW7A 4CWAA 4D6PA 2LTQC 4PIBA 1YU6A 3EDMA 3LZOA 4HPJB 5GS3A 4GIPD 5KVSA 2VP6A 4QNRA 4UQ2A 3CHOA 3CG4A 4R01A 3FT3B 2OQ2A 2AQHA 2HRQA 3QJVB 1DBKL 5AALA 1P45A 1BF2A 3SE8H 5UKDA 1LNZA 5BWLA 3HBJA 3ETTA 2R4QA 4JW3A 1I9GA 1KZYC 2IDTA 3GUHA 1WLSA 2E27L 3QIVA 1W25A 3L81A 1UZLA 3RDJA 1JPTL 3ASOB 1MJGA 2XV3A 2DTSA 5AO9A 5JHDB 3UO8B 1ISHA 5H81A 5DEJA 1GD1O 1ULUA 4PZ9A 5IXSA 1AC6A 2CXGA 2RKBA 4R2WA 1IY1A 4E70A 4B3EA 4PY2A 3V2AR 2PMCA 1CE1L 1LX7A 4JVLA 3BQ9A 2FWRA 3WHKA 2K7FA 4P4KC 4GVLA 2P7TB 2E9IA 4DLTA 1LTXA 4OQPA 4A39A 3QSYA 3QCUH 5EN2B 4ONHA 3IQDB 4OGGA 3WJMA 3OX3A 3A0OA 4XTRA 3W3AA 2IPUG 1V4NA 4YY3B 1T8RA 2IPXA 3ZGOA 5KANG 4W1QA 3CFJB 5HK8A 4XMLL 4IU2B 2AVFA 5ALZA 3PEWA 2GTQA 5IG2A 1GTL1 4MDRA 4DCQA 5TVGA 3RYTC 5CVCA 3QJXA 2VDNH 5CBKA 1MELA 4IJMA 2BVEA 3GW8A 4JT2A 1M2OA 4WJ5B 1CR2A 4YK7A 5BMVB 5D84A 4Z3OA 4RNCA 2DC1A 1Z4OA 5BXQC 2EIJB 1VFMA 1T20A 1T4BA 3ROQA 4YIKA 2WNWA 2E89A 1S96A 4OQTA 1CGVA 3UFIA 1T1IA 3BE6A 5CN1A 1K0FA 4A1OA 4Q16A 4YC2B 4DUVA 5MHSE 3WB9A 2XPCA 3PICA 3QFSA 4QDJA 4BAZA 4IWNA 3JWNH 4QNMA 4X9BA 3BK2A 3LB6C 4G25A 1MJJA 3EDQA 1NDMA 2J0UA 1QCYA 4N1EA 1F38A 2OGUA 2XGMA 4NZNA 4QELA 3QRFM 4DKEL 3D9AL 3TG2A 4JG5A 4JGIA 2DJ4A 2QLBA 2CNYA 1JB1A 2ADOA 1EM8A 2OMUA 1K1EA 3PDOA 4CC4A 1KR2A 3IMRA 4X95A 1KPUB 2G83A 3ZDXE 3NV7A 4AJIA 1XU4A 2M8XA 1V5JA 1YC8A 2P9FA 3IDGA 1BNCA 3F2LA 3V1TC 4BPRA 2ODAA 3V6OC 4P8RA 4CMAA 1CBJA 2OORA 1NBMA 5BRPA 1D7CA 3RB5A 3L7LA 1S6NA 3FB8A 3IJSB 4FNQA 4IRZL 3UG5A 3CK0H 1XT5A 4PZZA 2IBTA 1OU0A 4QFBA 3N6XA 3QY9A 4ZAKB 1LPNA 4KQ1A 3RVPA 2AL7A 3S3PA 4OJTA 2LPMA 4CODB 4ODTL 3JQBC 3DA0A 1IK4A 2P69A 2SECE 2A6KB 2WINI 2XBDA 3FQNB 5I8EB 4AEHL 2F7RA 1CRQA 4RX1A 4DIFA 2OQJA 3M7FB 1CICC 3IPYA 4MMYB 1NM4A 1BWPA 3DL4A 3MUOA 5JMTA 1A82A 2RGSA 4AXXA 2P5ED 3G49A 3UH1A 3VXMA 5DHTA 1G63A 1BX2A 4YNBA 4N2IA 4PJIB 4TV9B 3O3UN 3WTYA 2H0FA 2X6UA 2OJZL 3RR2A 1L3BA 2DGDA 5FTJA 5IHBA 3MOBL 4G8BA 2R8RA 4JFFE 1Y1QA 5JISA 3OZDA 2JCCE 3LS4L 2AHRA 4PG8A 1HINH 5DTRA 3RVBA 4E5YA 1TT5A 1N34B 2WZ6A 2DN7A 3UKJA 2RA1A 3U0WH 5F9JB 4F2ME 5IHHA 1QKIA 3L6CA 1EAPA 1BIFA 1OWPA 1CIDA 3RAGA 4O63O 5C0FA 4IXWA 2FUG1 5BN5A 2VNCA 1KCKA 4MDJB 5LR6A 1DJPA 5GISH 3DHWC 3PGDA 1OIWA 4CMIB 3RODA 5INDA 4E9SA 1U3HA 1M1SA 3KUUA 4KKBC 1NCCH 4G5AA 2QU7A 3DMMB 1L1FA 3TI9A 5E9DB 1C14A 2P42B 4WWKA 5DUMH 5G4LA 2HDHA 1GW6A 5IB3B 1PWHA 3RVDA 5ESXA 2JAHA 1KYWA 1KEMH 3AUXA 1Y5NA 3JQOB 4ELMF 1EDHA 2IH3A 3GSUA 3L6UA 1Q0XH 2P5UA 3QAQA 3DX1A 1C8PA 5IFHH 2TSBA 3CW9A 3ELYA 4HIXL 3IP9A 3NIWA 4RMGA 1I5EA 2OV8A 4GRLB 3MRPA 3MV8A 4I2NA 3RK0A 2HSGA 2NSXA 2Q3LA 3AABA 4BNJA 5JCPA 2JJ2A 1JR4A 5C6TL 4W9CC 1GR0A 4NEGA 1YUBA 3IAS6 1Z0IA 2JAQA 3CG8A 1LF0A 3L7JA 1MWAA 4H5SA 4AUEA 3EFOA 3NC4A 4N9QA 1KO4A 2CLRA 3LZQA 2OMKA 4KAFA 3R7WB 5EIIA 2OV1A 3N8GA 3R4VA 2XN0A 1PQUA 4JDTH 1VJCA 3QSGA 3I01A 2W2LA 2IOOA 5EC8A 2QR2A 3C5ZC 1YZTA 2ZROA 3KPNB 5LZ4A 3MPCA 1Q38A 2Z83A 4NBZB 1QFPA 4AJPA 2O7VA 3CZEA 1C7EA 4EABA 2JIBA 2HIHA 5KAQG 1CIPA 4YMHA 3W0WE 1Q92A 1L2TA 1ECGA 2Z08A 1J88A 1JNLH 4AKTA 3HDHA 2EJUA 5EKSA 4Z99A 4ME6A 4X20B 2HWWA 1EI9A 1P9NA 4UATA 5BV7B 3HMXH 3O82A 4BFTA 3OKWA 6REQB 3H6GA 1I7LA 2X87A 3ZI4A 2N75A 1Z2OX 3PFCA 5EB9A 2BNQA 3EIOA 2Y7QA 2RKWA 1MFMA 2GN0A 1ZS2A 3EJUA 4X7TA 4MJID 4HAGA 2VUKA 1I9JH 3TVMD 5AW9A 1Z17A 1GZHC 5GS0C 3HBNA 2LE0A 4KHTL 2R9HC 1BAFH 3LH2H 3LZFL 2IDKA 3DJYA 5AJVB 3OVMA 4W6YB 4WCVA 2DUMA 3CZJA 5GJWC 2IRWA 4GKZA 1RLJA 1I1AA 2J0UB 5CCKH 4AX8A 1RAGA 4N12A 1M5UA 5DN9A 3U46B 4MD4B 2FSEA 3NACL 4BKSC 1R10A 1Z6YA 1V05A 1Z3IX 3BT7A 1W8EA 4CPDA 2XWSA 4PVMA 2OMUB 4G71B 2N42A 3MQFA 1SJ9A 3PDOB 3R3ZA 2HFTA 3O2DH 2E7ZA 1XXHA 3MR9A 1AGFA 2Q3MA 3Q8AA 5LC1A 3BS4A 1MCOH 5CH8A 2YWHA 3T0WA 5EMHA 3BHNA 4D0RA 4DT2A 4KR6A 4MCHA 1MHPH 5F12A 3X1GA 1FPMA 2UXDB 4ZOLF 3FMVA 1T1YA 1ORDA 3FTGB 1Z4KA 1YE3A 1I10A 3B2VL 1W80A 2ORED 5SWZE 3FB8B 3RGBA 4HI0E 4NYMQ 1EJ6A 3VGJA 4X3CA 3KSBC 2FXIA 3FUIA 3P96A 3OPZH 4NZUH 4XCFH 4D96A 1B4JH 3INNA 3FYIB 1ZCJA 2EW8A 2IDMA 4B4KA 1E3EA 4YO8A 1QQ7A 4Y5VB 3UZUA 3NKFA 3G68A 2Y8EA 2QY6A 1O4WA 5MEOA 6FABL 1CLOL 5FW6A 2DF8A 1V27A 3FW1A 1D8TA 3FUWA 1DJMA 2P49B 4H8UA 5ITBL 1I1NA 2HN7A 1BX2B 4HK0A 3SEPA 1OFUA 5DNEA 1IM3A 1Q16A 3SHWA 2CJSA 3CWGA 1J86A 1LI5A 4AMGA 5L40A 4KDVA 4C0BA 4B0OA 1YA6A 3HG0A 2P6OA 2FPOA 7CGTA 1NVTA 4TRPH 3O9WB 1TT5B 1BWWA 3U0TB 5CF3A 1ESOA 4HPOH 4MXWL 2I33A 1DQDL 4GW4A 4XMPH 1MT3A 4ZZ1A 2NO5A 1UZ8B 1S7GA 2R1YB 2CH8A 4TNWK 3ZWYA 1TYRA 1PZ2A 2JKRM 4PM4A 2X5NA 4IOFC 2GN1A 2CPUA 1DVSA 2YXBA 1FGNH 3P9XA 2K70A 4O08A 5HUJA 2Z1KA 5KMGB 4WWKB 4D3CH 3WP0A 4UTAH 1V54B 2Z30A 3C8ZA 3KQWA 1UWEH 2OL3L 4OXQA 3F1LA 4NU0A 1YEGH 4Z1PA 2IH3B 2PO6B 4TL8A 2ICWI 1XJCA 4QYMA 5H4HA 4DWJA 4Q9RL 2APFA 4BB0A 3WDHA 5IY5B 3P26A 4MAUL 4OZ4A 3MRPB 4Y2VA 4MPPA 5EOCH 1MR3F 4ALNA 4FBLA 4DA7A 5AKYA 4TPRH 3BFPA 1DR9A 2EDOA 4MRAA 4H5SB 4WHYG 4NCAA 3S68A 1ZV2A 4DVBA 1T0IA 1A97A 2D73A 3EXIA 1JGIA 4FUQA 2ODBA 2NO0A 1TKCA 3ML1A 1F11A 3QWOA 2IHJA 3IURA 2PO7A 4AN4A 3TLGA 1P0MA 3NP9A 1I2DA 2CBMA 3MWEB 2F08A 5J7CC 4JUCA 2WJGA 3USCS 1EUCA 5AKEA 3BYYA 4P98A 2ZOUA 4GGOA 3GHPA 3FN0H 1P7QB 1DJXA 1JEYA 5TPZA 4RZHA 1NCAL 5B57C 3KZ8A 2COKA 4LKRA 4CLXA 4L0CA 3I45A 2BOCA 5IW6A 3ZU5A 4L85A 3UTQA 4ENQA 3FULA 1SJEA 2E5WA 2Z2XA 5JJKA 1SMOA 2RSLA 2ZX5A 3TYXA 1MCKA 1VE9A 1RULL 4HYTB 1VC2A 4WZBE 2GHWB 4LXUA 2G7MC 4P05A 4L3EA 1JHYA 1R8YA 1DBJH 1KELH 5GJSH 2VJLA 2FOXA 5K1NA 4GLJA 4XP1L 1BGWA 3C48A 4H3HB 3ZHXA 1LO5B 1NLDH 4RGMC 1OV8A 2OBBA 1QQDA 4X7TB 4R9UC 4DK6A 3LLVA 3PNLA 3RDPA 3GDWA 4P7KA 1YRKA 1CFVL 5H37H 5FHAL 3JYLA 1YIOA 1X4ZA 1LBTA 4OB8A 3T1NA 5AK5A 1I1AB 2XIJA 2FSEB 1VHWA 1N5LA 1KXQA 2F3TA 1WVIA 2DRIA 3UJCA 4QTUB 1UA3A 4YRGA 2PWFA 3ARFA 1O9VA 1GS7A 1R18A 3GXUB 5E08L 4FFLA 4FCVA 1U1GA 1F51E 3AKYA 4MAYB 2QJDA 3S4YA 2VUOA 1F48A 4CDHA 1KY2A 2IQ5A 4JHAH 4QT0A 2PQ2A 4QJIA 1JCVA 3RZCC 3KYAA 4XIYA 1XFAA 5BWNA 2HCRA 3KJXA 3K31A 3QKWA 4K9JA 5FCDA 4OCYH 5HE9A 2UAGA 4L1BA 4PJFB 3C12A 4FQLL 4MRBA 3CF4A 3ZGZA 2YS7A 4LECA 2B9VA 4D3FA 4DPRA 3UBXG 3QDGE 2REBA 4TGLA 4WV1A 2IH1A 5I75B 2HM7A 3A6BL 8FABA 1DOHA 4NERA 4C6HA 2JKVA 2VF2A 1RC0A 1O6VA 2IEGA 5CZRA 1G5GA 1OW3B 2ON6A 4XN1A 5BO5A 2XHNA 1M8KA 3CVHA 3PVCA 2QPDB 1PGQA 3U1SL 1MRZA 4A2WA 1YS7A 5DNDA 4J12A 5J1SB 2NM0A 4UNNA 3PTZA 2HN7B 4HK0B 2JIOA 3NCWA 3OESA 1UEYA 1JR3D 5D2NA 3T0EC 4G6ZA 3WHXA 3LFTA 2WOYA 3P0HA 1RXYA 3INUH 4K71C 4HFUL 1F1DA 1AQYA 1VBMA 4CL7A 2L8AA 1YB7A 1PFCA 4X1YB 5LGKA 2C4MA 1A8SA 4IICA 3EPRA 1WHPA 2CCVA 2I5PO 3G5LA 2A1TR 4L78A 4UQCA 2AR7A 4GBJA 5LAXA 3NTCH 3JQEA 3QH4A 3ZE1E 5BZWB 2VUHB 4GAJH 5JIHA 1XSKA 1ROWA 3UV7A 5E8NB 2C3MA 1MO2A 4Z0BL 2ZRCA 3MOAH 4M8IA 2CDGA 2A0KA 3CX3A 2VAXA 4HATA 3GA7A 5JO0A 3KZOA 2II6A 1EO8H 2FCRA 5DBHX 4C0QC 5GZ3A 1I6LA 4JELA 1OAOA 4ZEXA 3LCYA 1GQSA 1AX9A 2XC8A 2IVZA 5TF0A 4OZ4B 4L8VA 3HZHA 3IDFA 5BVGB 5HI3D 1C8LA 4FEYA 4Y2UA 4IIDA 2QZQA 1NVKA 1XCWA 5TNXA 2CXUA 9MHTA 2HO4A 3TPFA 4F8NA 3WBBA 4I5FA 2XN9A 2QSZA 1ZI6A 1T3HA 1B14A 3N85L 3CN9A 5I1DB 3VZCA 4MXVE 5CJOL 4M48H 1ZQ9A 2BVPA 1ZHLA 1YZFA 6CGTA 2UXCB 4M5SA 4PCUA 5F9WB 1F11B 1L3CA 4OLJA 1XGTA 5GQBA 3QWOB 5L7XH 3RW9A 3PQYD 3TLGB 4F6RA 4QOKE 5FLYA 4R9SA 1ZISA 2WLSA 2W8CA 4HMOA 3R5KA 4Q15A 2VHCA 5DHRA 1XGPA 4PRKA 3SD2A 2W2MA 3LVEA 4X83A 3I28A 3HNSH 1DJQA 4S0SD 4H88L 2P1ZA 1QU3A 2WXLA 1IQPA 2Z8ZA 5LNGA 1M7GA 1H3EA 5FT9A 2BOCB 4E5NA 1EK0A 5C7XH 1N4XL 4NJOA 3HKDB 3BDXA 3BRQA 3U48A 3N0WA 2GT9A 3DEHA 3WY2A 1Z37A 1MRDL 3NR2A 4EW2A 4AYEC 1WG8A 2V8OA 4A6YL 2KQUA 3BWMA 3RF7A 1A4KA 1J05A 3KB1A 1WE2A 1UYWH 1KULA 5I7RA 3KLHC 3CFNA 4E2WA 1QQDB 1MAMH 2PT6A 4NQDB 4F8TA 1BHGA 3K5SA 4WO0A 1IIBA 1JDTA 2FRDC 3ZDZF 3SKXA 2YKLL 1TEZA 4A2HA 3C70A 3GNLA 5GGSY 1GLNA 4H2AA 4F7CB 3NX4A 5ESAA 3ATBA 2FEWB 1FIGH 2CJWA 3OWOA 3ARFB 4WI5A 3RVJA 3T41A 4JB3A 1XAUA 4PAZA 3UUEA 2NTYC 2CKBH 3WX0A 3QFJB 3KCWA 2FEAA 1AE6L 1G9NC 2YGNA 4NBNA 5C08E 3PXCX 1P7KA 2GVDC 2WC1A 1V95A 1BQUA 2LRHA 2W0MA 3GH3A 3MUHL 1J2TA 1LY1A 1WSWA 1D04A 5JPMA 3Q3HA 1UMCB 2ODEA 3LPMA 4Y2RA 1EVZA 2ZJSH 4NYLB 4ERSL 2Q5HA 3KOOA 4BZQA 3GQBA 4GSXA 2OMNA 3B9AA 3WNPA 5FBQB 4PR5A 1O2DA 4ZFOL 1FUEA 1ZD2P 3E3MA 2IS4A 3VPXA 2H9YA 3GLIA 2FPPA 2XWXA 1V8ZA 3KL3A 1BLIA 4P57B 4J49A 3FMGA 2GIYA 3RFZC 4DMMA 4PBRA 4NQCA 2YQ5A 4IH9A 4DW2H 1TJPB 1RK1B 3D0VA 2R25B 3VR5A 5IJAA 1KB5L 1M71A 1Q0PA 4CG0A 1G7IA 2WT8A 1MUJA 1SELA 5BT9A 1WQ1R 2AE2A 2Y1ZA 4EF3A 4XAWL 4JUAA 4E7OA 3DAYA 4XC3H 3Q2IA 4N1HB 1TETL 3ZCQA 3P2YA 1CNEA 4DB2A 1AO7B 4AKSA 1OR8A 3V8PA 2R0LL 5DI9A 3F5QA 1BEEA 5E7FA 5BRZD 3HE6B 3IUNA 2GSDA 1MAKA 4PLKC 5DCYA 2EBHX 3LUHA 1SEBA 4PYGA 4I77H 3B6JA 3NCJL 2C2BA 2NYAA 4F8OA 1E7YA 1U9CA 4JP3A 3OJMB 1GGJA 3NHLA 5AM0A 1T4KA 5F23A 4NHUA 2YJ3A 4PLZA 2WFMA 2DWUA 3TLCA 2IIVA 4AJKA 2OMZA 1U0LA 3BUQA 1AXTH 5CXSA 5A5DA 4I19A 1Z29A 5LAXB 5TDOA 1YCGA 3IDIA 3F85A 2XZQL 1IDOA 4V2BA 4ZNCD 1CDDA 3R0NA 4ZT6A 4DB4A 3U81A 2CXOA 3QJOA 1NF9A 2I3AA 5LPNA 2CDGB 4HXAL 1OSZA 1WZIA 3F8SA 2RJOA 2HA2A 3P4MB 1TITA 1GL6A 1Q0SA 5F3FA 1IBYA 4AQ1A 3ZIAA 3G2NA 4W5TA 2BFDB 4NBRA 1G20E 1UM6L 1NQOA 4EDFA 3IE4A 3P52A 4UT6L 1A7UA 2AGJH 3THML 2IEDA 1MRSA 1JMXA 3T12A 3CPJB 3IFPB 2JJYA 2VOJA 4FSDA 1O96A 2MEJB 3K1AB 3RTQD 1DL7H 2DY2A 5FJJA 2GHQA 1Q72H 3C5ZD 2BZCA 5GZOC 3CXFA 1LSOA 3KGRA 2QUIA 5E99H 1Z4NA 1G19A 4PINA 5NLLA 2GY5A 3A3YA 3C9NB 3CM0A 3ESUF 3U09A 5ELXA 4FTVA 1S78D 3NYQA 4RANA 1NDGB 5AM5A 1XGTB 2QTLA 2R1XB 2RE8A 1YNKL 4WWPA 1WY7A 3K9BA 4TWJA 4F6RB 3DKKA 5AI4A 4BO7A 1J0IA 1RSZA 3ISVA 3V2IA 3X1NA 2JLYA 3G8DA 5DHPA 3IIKA 3GWJA 4RJKA 2NY2B 5JNLA 5HYEA 4R26L 2FG6C 4HRXA 2QMJA 2VHVA 3R9KA 1F18A 2CLFB 5KSBA 2H51A 1BSIA 2V45A 3JZDA 3L3KA 5DQJA 1AQNA 4GOOD 2ZXQA 2Y06L 4KITB 2YRBA 2EIZA 5C0RL 1N0LB 5GS0D 4HYYA 2XNJA 1A4KB 3VHRA 1J05B 3S88H 3B9KC 3E0QA 1NQXA 2Z9DA 3U7RA 3NNSA 3DE3X 4EUEA 3IPLA 1ZV5A 3UOAB 4P5KA 2C9BA 1OAKA 3OB0K 3I72A 3NMUF 3U4GA 2E6UX 1BFOB 2C9OA 3O6ML 4YDKH 2HY7A 1BG1A 3O75A 3VZBA 2Z09A 5ISMA 3IAFA 3P9LB 4BSWB 2FZ4A 1JU3A 3MEQA 2XQIA 3FYUC 3L7YA 5C1PA 1GAQA 1OAQL 3CVWA 2CJWB 4F3YA 4Z7IA 3EEBA 1KN2L 3N0TA 3H9SB 3T5TA 2H3NA 3DLPX 2AKRB 3SZUA 2OXTA 4TUJA 4N54A 2VCEA 5CH5A 1IUPA 5I15H 1Q3HA 4JXKA 3ZQWA 1BLNA 3GGJA 2PWGA 4UNSA 4L4VE 3V6FA 1BAPA 1FUYB 3D8HA 2R4SH 2W42A 3KPJA 2WXIA 3WGGA 3UMFA 2Q3FA 4M8SA 3EOBI 4H3KB 4MA3B 2GIXA 3PX3A 3ZE9A 3GQBB 1BYOA 4ML3A 1GPDG 2MPVA 5TS2A 3H8SA 3ZYOA 4R51A 3SOPA 1XF5A 3FRPG 4QPDA 2OGZA 4S10A 3VMPA 1SM4A 2FPPB 3MRLB 1VKOA 2V2XA 3TLYA 4D4MA 2O1WA 4BA8A 2UZ3A 1E9CA 1D2RA 4FYTA 5ICSA 4ILKA 4NQCB 2NO1A 5YASA 1RYMA 1HVXA 4EA7A 5HW0A 5IM4F 4P2RE 3MT9A 2BY0A 5HGGS 4QGAA 3KKPA 1MUJB 4A27A 1PLGH 2WQ7A 1IFRA 2QQFA 2CJPA 3FB1A 4YRPA 4DMKA 3M9XA 3IHKA 1KYOK 2ANCA 1MC5A 1BQLH 3IUMA 1M7IB 2VXQH 3VPCA 3OG4B 4DZ8B 1PWEA 4KKAC 1TM3E 2J5LB 3M46A 1KO5A 3W8NA 1C9JA 2VMEA 4TVPE 1DRVA 2E4TA 2IV3A 2NY1C 4QQRA 1QUEA 2VXSH 5EZOL 2PVSA 1R6VA 4M9QA 4Z3EA 1TCCA 3P9SA 3DOHA 5DD1H 2Z1MA 3ZQJA 1T4KB 2OA0A 3OZEA 3VR2D 3LEXB 4O58L 2ZUUA 1SQSA 3VKVA 3KWLA 3AL8B 1M34A 2QQ5A 3VGAC 1NP3A 4LE2A 1ODIA 5JHLL 1QLEB 4F80A 3DX4A 4OSUL 3GSNA 4AJVA 5TDOB 3IDIB 1WXFA 1G0YR 3S5LB 1R0SA 2H7XA 2OZ4H 3LKSB 4BU0A 3FZQA 1FYEA 1CNFA 5BW7C 3AS3A 2QMYA 4RTLA 2A6JA 3E9EA 3DUUA 2BMKA 1IRIA 3GN1A 4WGVB 1CJYA 2CRZA 4RBNA 4PHCA 1JQDA 3PA6A 3DH0A 3GFOA 3NAAH 5FB8B 2A9DA 4WLVA 3VI3A 4H77A 1KENL 4B4VA 4FDTA 3D4GA 4FE9A 3D8NA 3T1TA 4PGAA 3VR4A 4I1OA 1EA9C 3VQ1C 1A3LL 4UHJA 4AC2A 1BZQK 4RGNC 2Q6WA 1QYVA 3RRBA 2WMDA 1W36D 4D2NA 1SFRA 4HOXA 4B6QA 4Y4FA 2G0TA 5B7NA 4LK3A 4J28A 2SICE 3I2IA 1VJDA 3NFYA 1GGIL 3A3YB 2MNUA 2GKOA 3CUYA 2G5BB 1OUMA 3E3QC 2WYUA 4DCPA 2GZSA 2CKDA 2HV9A 2UZYA 4MGEA 5HF8A 1P44A 1RHQA 1OXUA 3ZZLA 3TJPA 5BYAA 2B4CC 2VWPA 5EWLA 2ZE0A 5TJWK 2YRLA 1N7MH 1MEJA 3OZSA 3VFOA 3ASWA 3QVXA 4A26A 4S2EA 1UKSA 1Z0ZA 3A14A 3IKCB 5GGSB 3VB8A 2D4AA 2ADMA 4LASH 5F7JA 3MRBB 4E1BA 5IBPA 1HBJA 4FQPA 1HSBA 1KSGA 3PXUA 3LHIA 1VSVA 4OXXA 3U7IA 4DF9A 4ODVL 3QA9A 5FLEX 1DQLH 1BQ4A 1EUQA 2HBZA 3NMEA 1PWYE 3P32A 1ACXA 1UCBL 4X7DC 3AUYA 1OCCB 2Q5CA 2VZ0A 3F58L 4OYHA 3PYCA 1NEZB 1ZXBA 3NZUA 1U99A 1F4WL 1R64A 3QUMH 2NY7L 2ARWA 1GVHA 1JEAA 1GR7A 2WOOA 4FX2A 4OH1A 2A0UA 4UE6A 5GRJL 1TCVA 4WUUB 2KMLA 4BL5A 4KGVA 3SJCA 4B76A 5D96C 1N9PA 3E84A 1QFWL 4NU8X 2W98A 2D2EA 1ZIOA 4Z0TA 1TLKA 2W4IA 4AG6A 2Y2WA 2DY0A 3R5HA 4IY1A 3SKMB 4BVLA 1J6UA 3ANXA 3MGOA 3NZ8A 1YJXA 5ETJA 15C8L 3BWAA 3QULB 2P48B 1SKQA 1P4BL 4X6EA 3NASA 2VDRH 1B9ZA 4K5LA 4RQBA 1BLNB 4U4IA 3OPVA 1FFAA 5JRJA 1JGVH 2CNBA 3V6FB 4MW9A 1CR9L 1SEQH 5C09E 2RGNC 4URVR 2IZ5A 4YV2A 2R2BA 4H1UA 4KC0A 4BO6A 4H2CA 2Y1LA 1AZLA 1N6OA 3GRZA 3WLSA 3WIAA 3LZRA 3MQ4A 4QULA 3J80A 3U9SA 1XF5B 4KDFA 1PX0A 4FEGA 4FJ0A 1P6AB 2V2XB 3QNYA 2YMTA 3IAS1 2VSOA 3AAZA 2BCEA 2QTRA 1VGEL 3ZTJG 2ZNXA 5GIRA 2FWIA 3T4AC 2R59A 2CHZA 2DQFA 4YCNA 2FX5A 5TQ0B 4WY7L 3OZ9L 4R1QA 1VYUA 3N8KA 1UZAA 3PDGA 3CSGA 3E22A 3ZNQA 1OXTA 2BGGA 1ID1A 4MO9A 2BNUB 1KIPA 4ZX3A 5AW0B 3WMPA 3RNQA 2A9MH 3QAZC 3QDJB 3HE7B 5JOPD 1DDTA 3JWOH 1MNAA 3NZHL 1CF9A 4LRQA 4JGJA 3BXXA 4G0WA 4NS1A 5U9CA 2WYVA 2Y7LA 3HPQA 1ZITA 3BCFA 2I9LA 3H4TA 5BPHA 3WRWA 1V5WA 3QVLA 3ZWWA 4B71A 4DA8A 4YLBA 4B2IA 1E77A 1KGCD 1UA6L 4PSKA 3D59A 4PJXE 2G1JA 5L3ZA 2FKAA 3BFXA 3KZVA 3ABMB 1P3JA 4NNXB 3FA2A 5CJJA 5K9JH 1CQIB 1T03H 4MGZR 1H15A 2EDBA 3MA7A 1OGIA 2W2OA 3SYKA 3OTOB 1JZ8A 4KXLA 3BRCA 3V0VA 4WL0A 1EJ0A 2PCJA 2FPLA 5AP9A 3DUUB 1XPUA 5DJDA 2BMKB 2B82A 3OJFA 2KH2B 1A9RA 4XP9H 4NEQA 4OM1L 3ABKB 1OI7A 5K6TA 3VI3B 5EPUA 1NQTA 2BZDA 2AWOA 4IAOA 1QSEA 3A9TA 2ZXBA 4H8VA 5SICE 1U6KA 3EF1A 4JG1H 2EDQA 4QRFA 1FNHA 1A14L 1QIGA 1WA0X 2RGGA 2N1TE 1JZDC 4P34A 2XTJC 4E13A 2Q6WB 2BJWA 1DSYA 4PJHE 1BVRA 2EFYA 3CH5A 2XUIA 3WE1A 2ZR7A 4GPAA 3QWQB 2J55A 4UM7A 4JC5A 1WEHA 5T3XE 4PN3A 1J39A 4ZMQA 3QX8A 2GAZA 2SNIE 4JKOA 1FSGA 1B90A 2EAEA 1UASA 3I6SA 1RXIA 2PLAA 3PL1A 5DZPA 5IKOA 4FYMA 1T9ZA 3QEQD 4KAXA 3GRAA 1E2EA 3DKPA 3MJ9L 4E07A 4G7SB 4XN5A 1Q22A 4FHZA 2B25A 1SPBS 3E48A 1UQUA 4IEFA 1GAFL 3RL2A 5EWLB 5E5MB 3ZCPA 2ZVJA 4AYGA 1FFWA 4CIVA 3VFOB 3MNFA 3BVVA 3P2DA 3DL7A 1JFQH 2Y3NA 1J9RA 2EYRB 4F86A 3A9RA 1XV5A 2X0EA 1J1UA 5F3HA 4CMMA 3LXXA 3G2QA 3AW9A 2KPOA 1GL3A 3D6HA 3VYVA 5IJWA 3UPDA 1ZJZA 5LQBL 3M6MD 4OM8A 5IJVB 2OG1A 3RWEB 1EFVA 4KZCA 1SYVA 3UBXA 4NWIA 3I58A 1ESEA 1H23A 4GFXA 3UG3A 2QW0X 3CN7A 3U7FB 4IHKA 3K8ZA 2KPNA 3A9CA 3HXMA 4M56A 4P54A 7MDHA 1E2PA 4N8CH 4LZJA 3FWNA 3CSFA 2JK1A 3RS0A 2FWOA 3HI5H 2EQBA 1OY3B 2ZITA 1Y7LA 3DOCA 3WFBH 1KDOA 2EGHA 4RVDA 1M6VA 1L5HA 3IUBA 4RMIA 4U1NA 2MCFA 3ARGA 2DXIA 4GNKA 2E75C 4UDXX 3M17B 2JIRA 1BDYA 3ZL1A 2J1YA 4MB4A 1S9VB 2Q5BA 3NZ8B 3FPKA 5DJZB 2FBJH 1WAAA 4R2HA 2OK8A 3X12A 1SK8A 3BWAB 2G1KA 1MRFH 3URKA 4WF7A 4PRBA 1CS4C 3TAUA 4LPCA 1JNNL 1BPLB 3KUDA 3N1GC 5FUOH 1J9CT 4RX4D 2FLBT 1O75A 2W0SA 3EPPA 3NRCA 1KCRL 2X19A 3OQRA 5B53A 4ED9A 3SR3A 1OAXH 1BG9A 1COZA 4RETA 4FB4A 1RRVA 2Q5QA 4DR6B 3RBXA 1KH2A 2NQ2C 2QGEA 3H3KA 1XCGB 4TVPL 2QYSA 2IV9A 3CLTC 2R97A 3AAZB 2VDLB 3A28A 2I3GA 3VGBA 3PRYA 5AW6A 5GIRB 1JVSA 1AYRA 3MV9E 2OAQ1 4RVHA 5CG2A 4RGYA 1VL1A 5IB5A 4UEOA 4KQGA 3P4OA 4WZZA 4PGZA 2JCVA 2ZOKB 1LB1B 4WBSA 3E22B 5FPQA 3SM3A 2BKLA 3PP4L 2ZSWB 3GHEL 5JW4N 4AU1A 3ZZQA 2Q2LA 4QDGA 1KIPB 4XCEB 2TMGA 2AMGA 1U4FA 2EFGA 1XIWD 3RNQB 3V4LA 1THMA 4A5SA 1SXSA 4MV4A 1M72A 2BO0A 1QIMA 1RFLA 2FGZA 3NBUA 1OF2B 4ZQGA 1PBYA 1SBHA 1U90A 3T3DA 3HTLX 2I9LB 5LMCA 3QSKB 5C0IA 3HP7A 5C5CA 3R3VA 2YIDA 1E5UI 3IKLA 2H7CA 4ZUSB 4N8VG 4LEXH 1ORTA 3FHCB 1T7ZA 2EL7A 1ET8A 5J1AA 1DQJB 2DB3A 3WN5A 4NSKB 4F5YA 3E70C 3ZJYA 3P2JA 1FS6A 1OLLA 3RFRA 3SYNA 1LPAB 3GMDA 3H2IA 3DARA 4N3BA 4TSCH 2WWHA 1CYDA 3CEHA 4U1IA 3EYVA 5F44A 3EXAA 2P4EA 2WU1A 2IWFA 3NHYA 1E5DA 1JZJA 2PYEB 4RFOH 421PA 4H0NA 4LSRL 1RWNA 1DHKA 1U91A 2Z2JA 3WEXA 4XHJC 2ZPTX 1QSEB 2A3RA 2QVFB 1JLRA 4QSHA 2RACA 1SVZA 1MH5B 4NI6A 2C78A 1A9TA 3LRTA 2NYKA 5F3RA 9GPBA 4EDXA 3H3XA 3TRDA 3TLJA 2FUTA 3PWPD 3HRZA 4QHKI 1QRUA 1QG2A 1XCLA 3Q3GE 3QQPA 3K8YA 4P83A 4L4YA 2GAZB 3PXJA 3WRYC 2NDGA 1IO4C 1M2HA 1W5AA 5DJYB 1IAVA 1DIRA 2FATL 3G7NA 2BWJA 4IRSB 3O7MA 1YXMA 3DZBA 1OLSA 2YD9A 4EN2A 2KW5A 4OHZA 4OLFA 3ZV6A 1FTQA 3STUA 4HUUA 1EFUA 3PDIA 4IEFB 3RL2B 4IXNA 4U1JB 4HLQB 5LWYH 3OAAD 3GSOA 4Q97A 3OCYA 2A57A 2C7VA 2X9QA 4OK6A 2OBMA 3WKQA 2F54D 5J6GA 3SLKA 1NPUA 4HMEA 4F97A 1CTMA 4EZBA 1A22B 1JEOA 3OAUH 4Y2QA 2EWMA 5EIIG 2R60A 3R0XA 4YJ3A 4XRRA 2UV8A 1J5DA 4D4IA 4WCFA 1N6RA 1RI3A 1X5LA 1ZJ6A 2TMDA 3SDDC 5FADA 1EFVB 3DJ9A 4HJEA 3FVRA 3PJGA 2Y9PB 4JRYA 5L88H 2IALA 5AYVA 3HZVB 1H93A 2F1IA 4QHMB 1DFGA 1G0NA 5DTIA 1NBHA 3M4ZA 5TF1L 4O33A 1AZUA 4DRYA 2NSLA 2JATA 3BAEH 3SKNA 2C7BA 1M1YE 4POUB 4BV3A 4MP8A 2FZLA 4BZXA 1UAGA 4HAFA 1U65A 4BO9A 2FWOB 1CLUA 1RKUA 3FPLA 2G60H 1M6VB 3QKSA 1L5HB 4EI5D 1M0EA 4U1NB 1NR1A 1XZGA 2Z0MA 5I9MA 1P6UA 1PT6A 1U2GC 1G6RL 1MJFA 4DEVA 1EK3A 2YPLA 1VKRA 5K8LA 4FONA 1D9KA 2IYTA 5EUKA 5DW3A 3K4AA 1FYTB 3NDBB 5L2KD 1L7TH 1DQML 4WH0A 1OFVA 4YRCA 3GGSA 1QH1A 2OW7A 5CDYA 4NEHB 4FMKA 2QVKA 2GK6A 3ESRA 1AHWA 4H6VA 4KO3S 1KI2A 4YUYA 5FTLA 1AG0A 3GWGA 4M86A 1TAQA 2AG5A 2FFBA 1N5OX 3PA8A 3C1UA 4ZHQA 5CLXA 4ZFGL 5KU1A 1YOVB 2F7OA 3CPEA 4BWFB 1AY1H 4CADA 2Q1TA 1G6OA 4XFKA 4BMNA 2XZCL 1CZLA 4G80A 5AW6B 2LKDA 1DQPA 5EU5A 3OX4A 2XE6A 3LYAA 2YR3A 4LVOA 4KKAD 3P4OB 4CGYA 2PR9A 1KBGL 1L8AA 4FKBA 4PRHD 4QSMA 5MEPB 1W9MA 3RIXA 5C6PB 4RGQA 5I8KH 4U6VH 3E9QA 2YFKA 1SUWA 1QLFA 1V26A 3HK2A 3L9BA 3VSTA 2D5CA 4ZQKA 5IB4B 2R96A 2E3JA 5ALBL 4IHJA 4FBGA 3A06A 2XY2A 2YMXL 4A04A 5BS0A 1RJZA 3LUBA 2P6NA 1YMHB 2CRMA 1IM9D 2IPLA 4O4LF 1W0KD 4CC1A 2GPZA 1IN4A 5L7YA 3Q6FA 3HB7A 3Q2OA 1RIUH 1BHQ1 3EQ8A 4KJQC 4YUEH 3H3JA 2PXYA 1UOKA 3ABZA 1URPA 4I18C 2B7BA 4MNTA 4RD4A 3F7LA 1R6BX 1OV4A 1QUFA 4QCIB 3UJBA 1NMCB 2JJWA 1B2WH 4C7JA 3DJZA 4U1IB 1SNYA 2X09A 3C4VA 2AJXH 3GFFA 2FCBA 4RGND 4GOLD 4E2OA 1V37A 5K6AC 3AONB 3LQQA 3OR6A 1U91B 4FP8H 3MRCB 1XSEA 3OLEA 5BSVA 4M6AA 4HHAA 4YBQC 1M05A 4NZ9A 2PX4A 2BP0A 4W93A 1YWGO 1BOFA 3ARED 5LBIA 1QOKA 3GEEA 3EZ8A 1VCNA 2QVTA 4LAQH 3HRZB 5KQRA 4P2BA 2VF5X 3E7JA 3V48A 2CK2A 1CKEA 2BM1A 5DC2A 3CU7A 1OX4B 2ROXA 3HLTA 4K23L 2HSIA 4Y4HC 4R1TA 3MT7A 4YHZL 5HMLA 3NVAA 1RMFL 5A0VA 3P77A 1RXWA 4XDYA 1EG2A 1U58A 4LL1A 1Z5NA 1Q91A 4E0RB 2CJTA 4JMLA 2VZ1A 3TQQA 5FCSH 2YAHA 4HIQA 4WI2A 4HUUB 4GYJA 1Z4LA 1XNGA 5I9BA 2HJRA 4Z78A 4BZPA 4KFTA 1W1IA 3MX0B 1RRKA 3RLFA 2W6NA 3WJJA 2PMBA 2V3WA 3OTWA 4E15A 1QV7A 3NCCB 4QRUA 2YD6A 4AP5A 1ID2A 1CV2A 5J6GB 4MTMA 1XCTA 4GQBA 1TJ5A 5H82A 1LP9A 1T1ZA 5T1JA 2CMRH 3M88A 1Z4JA 4YJ3B 4UU1A 4PIPA 3QG1A 5DO2D 4NP6A 1YNTF 1CLZH 3DGFC 4LSGA 5LJIA 4K2AA 2CV1A 5C31A 3EULA 5AOMA 1NBOA 5CJPA 3KVNA 4NFSA 3L8EA 3MRJB 5AIAA 3GXIA 2YWYA 3HY6A 2NY0D 3NIDB 4JRYB 1JDCA 2IALB 5AJHA 2ZWKA 4UNUA 1D5XA 2ROYA 3V80A 1V47A 4MRNA 3SKNB 4HBGA 4PEEA 3A31A 2I60L 2HRPH 2XJ9A 1I4LD 1CJKC 3K4DA 1QKZH 2J9FB 1KGWA 4E4RA 4P9NA 1MCJA 2JI6A 1EX1A 4D9HA 1H1DA 4H6WA 1BGXH 3BESR 1EE2A 5DLDA 3B6IA 5D72H 1QFUH 4ALLA 1BU8A 2HU7A 2GEDA 1CFNA 1YIAA 4LEOA 1WGOA 1AZSC 1E9DA 1CD9B 5JW5A 1D9KB 1M53A 3AR6A 1R00A 3BLBA 2P5EE 1GTSA 4KE6A 5I19H 3K2KA 2FQFA 5KQMA 1IEXA 1ULAA 3BKCH 2AEPH 4AYMC 2R4RH 4BYMA 2JB9A 1RL1A 1N2ZA 3KXFD 5FBRB 2E4ZA 3Q7RA 4RD1A 3ESNA 3EYUL 3E9MA 1SVMA 3RVVC 1U8IA 4O02B 2NQDA 5SYMA 1F9EA 5HJDA 4DM7A 3PXHA 3GJSA 2BSBA 5F4ZA 4JCCA 4Z76A 2DTEA 4JFFA 2VLLA 1TKWB 2HFGL 1AKMA 4XARA 4WUVA 3DTVA 2W43A 1MH1A 4CADB 1LPMA 3TM5A 1YEJH 2GJ6D 1BO6A 5EU5B 3JQAD 4M7KL 1MFBL 3C39A 3L4BA 2Y68A 1ZNQO 4C57C 2YMPA 3EWIA 4F2MA 5IMMA 4OG2A 2OILA 121PA 3BKML 1CD8A 4DR1B 1OE3A 1FX0B 1E8NA 1JQJC 2FJGB 1XZQA 3GGOA 1Y3CE 3RDTA 1ZU4A 4R5HA 4E31A 2B1RA 3B3JA 3CF4G 4YFDB 4UPEA 2WJHA 2YZKA 3TDKA 1QLFB 4N2FA 1SQMA 2AG0A 1H8LA 4TTVA 1NL0H 1T89A 3SDAC 3SX0A 1PVHA 5CGZA 3TCNA 1KXVC 1TU2A 3TH5A 3ZDBA 3C24A 5BS0B 3SFZA 2JSFA 4YHYB 1I7PA 5B3JA 2C0PA 1HYEA 4B73A 3Q6FB 1KL7A 5EA0H 1AAJA 4ZCRA 3ZKXC 1JJFA 1A88A 1FPQA 3H9BA 5TDPB 1H19A 2MOGA 2PXYB 2H4WA 1HNGA 4LRWA 5I73B 3LW8A 3OAWA 1W91A 5FWNA 4YGYA 4P38A 3WXWL 2GTWA 1O87A 1ZLVH 5CILL 1JEQA 3EXG2 4UCFA 4B6RA 5L9AA 1XSJA 3FN9A 1KZQA 3WFZA 3PI7A 4X99A 3CU5A 2IYPA 5FOWA 4YAUA 4DQAA 1IKNA 2XG5A 1OROA 1YCFA 4W9NA 3NONA 3OR6B 2A73B 5TE6L 4FE4A 1VRVA 3MN8A 4W81A 1DS6A 4NPYB 4KVNH 4ZAFA 3O4GA 4HHAB 4TXLA 1M6OA 1GNSA 2WWXA 1V3KA 3QXDA 5FWAA 2NDFA 1E7RA 5C8YA 2OXFA 3QWHA 2P26A 4LTNA 4N65A 4FYXA 5L3SB 5AVTA 3W0WA 2X2FA 4R83A 1DGQA 1U9IA 1WOMA 1FAKT 1FHGA 4LWOA 3WLQA 3KJHA 3P77B 4MJIE 1UEJA 4KRMB 3PAYA 4U4AA 4MUXA 4JDVB 5KNBH 2Y93A 3KZKA 5A9SB 2PZAA 4WDIB 1KFAL 2R23B 3VC1A 4EIUA 1MAAA 4XBGA 4Z78B 3JVVA 4LS3A 5TRTA 2JELH 2XICA 2CF6A 3ZYZA 3HC0A 3PE3A 1AVAA 5T1DH 3K2UH 4ICWA 1YGPA 2WBJA 2Z3ZA 3M1BB 2ZTHA 5SY6A 1YL7A 1LP9B 4DN6A 1LI7A 1FFNA 2FQYA 4Q89A 1PDKB 2NOYA 3FT4A 3HHPA 4X5XA 2HH0L 2Q10A 1G8YA 2QKYA 5BSKA 1B8NA 5DJCA 4WY8A 2LU4A 4U02A 3GVHA 1RJ9B 2V7NA 1C5CH 2D8KA 2Q7YB 1BU5A 3NJGA 1Z2DA 4YSPA 3GGDA 3FRPB 3RVTD 2P9BA 5FBWB 1K4MA 4AUNA 1F6FB 1D5XB 3MYJA 4NESA 2GBCA 3R41A 2J5BA 1V6CA 2R4TA 1RYHA 2B8JA 2VZ8A 3KLMX 4GBGA 4POAA 4BQOA 3GZNA 3QQ9C 1DL5A 4HGOA 2FNAA 3KYCA 3KQPA 1UPCA 5AHWA 1NW4A 2W2QA 5AW5A 1YZGA 1MZYA 1YJDL 4U7FA 1FLNA 4CQMB 4OLEA 3V5NA 4C3ZA 2HNAA 1QG3A 2ZBEA 4LY6A 2F64A 4LHSA 1CFNB 4KGJA 4DTCA 2VVTA 2YXWA 4PJGF 3AZUA 2WJPA 2AK4E 3FQTA 3PXDA 3I9NA 3WTTA 4KPFC 2EDCA 1ZT7B 3UTTB 2HF9A 1TR7A 4KQ9A 5SX4H 3I9IA 2X8AA 2VQ1A 3UTCA 4HVAA 1KT2A 2BSED 1J1XH 1PQ4A 1PEWA 3MMSA 1WHSB 4XE5A 3CZSA 1EHCA 1APBA 1PLJA 4NBLA 5DD3L 2ZEJA 4LP5A 1ARZA 5DB4A 3WNZA 1W0WA 4FFZL 4XCNA 2VLLB 1YRLA 3D7MA 4F4JA 1ZIBA 3KL2A 4BKQA 1BX1A 1FDTA 2Y22A 5DUPL 2G25A 4V0ME 3P4YA 1SOVA 3U7YL 4EHJA 1LVUA 3SXUA 1LE5A 1T9GR 3L8GA 5IMMB 2FAUA 1F2XK 1TPXC 1YSOA 4AS1A 3RDTB 1Q95A 2WLZA 2C9AA 1HFEL 4M37A 1OLOA 4YPGB 1XH3A 2A5YB 2NG1A 4CF6A 3N9GH 4AI6A 1JHMA 1NW5A 3GDHA 4OZIA 5A6LA 3RAJL 2ZETA 2DCUA 2SHKA 4F5DA 4B3IA 2DTDA 1UWVA 4YJFB 5JXEC 4FABL 1TU2B 3D2TA 3A4DA 1IM2A 3WOVA 3NCFB 4EO4A 3DBVO 5E95B 3UTDA 1TVBB 1CUOA 4PJEB 1U9YA 1FUUA 5ESQB 4L8SA 3BQMB 2EX4A 2FV8A 2N46A 4AV0A 2H4FA 3G6JA 3BGDA 1EK1A 3UYLA 1ZJYA 5TQ2A 4EMSA 1J22A 3QIBA 1S9HA 1HFUA 3QWNA 3H0CA 3LHDA 1CUXA 4WK0B 3AIOA 3NH7L 4IO0A 1IZZA 1OTUC 2GCPA 4LIQL 3U5TA 4BRWA 5JBQA 2XG5B 1J8VA 1XLWA 4G5QA 5FKAA 3GVPA 3DXYA 2CXNA 5JORB 3V00A 3C7DB 4AIOA 5CZKA 3EK2A 1M6OB 1N4AA 3U0VA 1RNLA 3WISA 2QENA 3BVDB 1TFPA 3QXDB 5C8YB 3O6FC 4UBMA 1ZVSA 4NP4L 2QA5A 5T1LD 3MGAA 3QM1A 1WTCA 3GSRB 5AVTB 1CRLA 1ZOXA 3PL6D 3N6YA 3HFML 5DYFA 5FPPA 2OSYA 1ORVA 3EVCA 1F4XL 3ZKWA 4D9CA 1ZANL 2WB4A 1CEXA 1G41A 2WHRA 1SXPA 1KP9A 4BNDA 4XVOA 3UYPA 4H9GA 4CJ1A 4WZBA 5DF1A 3B2UC 3QU2A 3D8SA 1ZWLA 4BN5A 3GEMA 1SBSH 1DJYA 3PS6A 4A6PA 2DQ4A 2X1OA 3AYZB 3HC0B 4XPTL 3SOZA 2DU8A 4U1SB 2HK7A 3ROZA 2PP7A 3F4KA 4GP6A 2WBJB 5GGUB 5D6CA 2UUOA 5EN4A 1M9WA 4YTEA 3MCYA 4YDZA 3T71A 4YP7A 4IXDA 4M36A 4QG7A 4UIMA 4QE3A 1ZLSH 4PZYA 1Q0YL 5IZ4A 4X5XB 2GN6A 3G2OA 4AT1A 4AVKA 2JLLA 2F8IA 4GIBA 1ZYUA 1XD8A 4IQ4A 4P0TA 2YBGA 2BRQA 3H8VA 4YBLB 3QZLA 2GBIA 4NRXA 5CURA 5EMLA 4HL6A 5IDXA 2R0ZL 4DAOA 1ULTA 4AY2A 3MYJB 1CJSA 4KQFA 5F3BA 2GD1O 2AW3A 1LO2H 5FH9A 3JQPA 5GGQL 3E58A 2QVMA 3O8CA 2HJLA 4EYSA 3ZDYB 3BQUC 3OMZA 3U4EB 4LNVA 3BP4A 2W2KB 5AW5B 1QGYA 5K5EA 4X6CB 5F77A 3FYSA 4ZMOA 1RHMA 5B55A 2ED6A 1DADA 1TG8A 2B20A 1AE1A 4CNIA 3TV8A 4XP5H 4FUTA 3UX9B 3EBIA 3T4YA 1AO3A 3WY3A 2GETA 2HPZA 2YCBA 1UWGL 2F3QA 2NY6C 1RW4A 3RG2A 2R7EB 5GSVB 1KYXA 1RAAA 5HYVA 3FQTB 2K2QB 3WFHA 2HSDA 2J1LA 4HWPA 3I09A 1Y1LA 5ACZB 2WQRA 3NRJA 3S96B 1JR3E 2XA8H 3BWSA 4PVLA 4HKBA 4TNGA 4NF2A 5ABAA 4BP1A 1N70A 2IS6A 3P9IA 2QMQA 4EJSC 5FFFA 1YYML 4N8VA 1ZN8A 3QUHA 4KRPD 2WXKA 3UIZA 2VSFA 4NKDB 1PW7A 4UV4H 1NRWA 4YBRA 1LEKA 4HEJA 4Q4LA 4ZMNA 2PR7A 4AKEA 1UKAA 1IZ9A 2BRUA 1FP5A 4KYIB 4G0ZA 3QE3A 1K7CA 2LIPA 4MR8B 2VN3A 4Z8FL 3QWFA 3CLHA 3JQ9C 1IIRA 5DVNA 5C8DA 2ACWA 4QXUL 1LE5B 5KOIA 3JV5A 5T5FL 4ZMAT 1JNHB 3WWDA 3U9TA 1CG6A 3ALWA 2FG7C 3LYLA 4XPIA 4PX9A 7TAAA 1T2CA 4GI1A 1Q4NX 1F9AA 5BQDA 1E2BA 3TGLA 4R9NA 3CKMA 4I48B 3O45B 2PJDA 5K0CA 4TYPA 1WXXA 2ITDB 4Q9QH 3FO0H 2PU5A 1EJ8A 1TJHL 2OXRA 4HB2A 3IIEA 5HDRA 3K5IA 3VDNB 4DE5A 2IPTL 1W8OA 5F1KC 2Q5IA 4UQ2B 5C1IA 4MCNA 2CVHA 1QVWA 1Z12A 3V55A 3O4VA 4C4KO 1CLVA 5JLZA 1G17A 1Z5HA 5IDYA 1NKSA 3WO4B 1S7CA 3D0LA 1Y0BA 3V6LA 3CGTA 1YDHA 5HGXA 1Z0UA 4B8WA 3UMSA 3G6JB 4JPVH 1L4UA 5JMOC 3PQYE 4YK4C 5A03A 4OF4A 5K3EA 2G06A 1RXUA 2VXVH 1TM4E 2DJIA 4YBQD 4J39A 3NXKA 4MDHA 4WFGD 5EU7C 3KSRA 3MD9A 4JFED 4JEMA 4RHTA 2DPLA 1JXDA 3FQ1A 1CBUA 2V2TA 5B39G 1E4XH 1DTSA 3WTWA 3O92A 2VLKD 3ARDD 1IY2A 4ONHB 4BIKA 3BD8A 3BIKA 3WJMB 2WP8J 3B8HA 3VNQA 3WB1A 2GJ9A 2YIVX 3STZA 1EUZA 1L0PA 1DWQA 2RH8A 3SK0A 3DOOA 2WAHA 4P32A 1QGED 4FZJA 3FHQA 2YIHA 4Y0GA 2OYKA 1E59A 2G7ZA 1ZVSB 1FO0H 1Q11A 3O6KH 1XDBA 3SM9A 4DCQB 3BJRA 5CA1F 2WBWB 1P1HA 3JV6A 2HREA 3LHAA 1T3GA 3NYIA 3GBLA 5IRCD 3DM5A 3ZKWB 4OZFG 5IM7A 4UNTA 2WLTA 3QWAA 4Z8XA 4IK6A 1M2OB 4GSKA 4BNDB 4MA7H 3NQIA 3UYPB 3IKMB 1TJ3A 2G07A 2CSUA 3MVSA 5EEGA 3QEGL 3P11H 1T20B 1VFNA 1PDVA 4DLZA 1D8AA 5T8KC 3KAJA 2YRFA 1ETHA 1CZRA 3HG5A 4EVNA 3TBWA 3ICWA 5J12C 1TYAE 4GIAA 2W37A 3GNML 1ND6A 5D6CB 4NZTH 2YGVA 2GPJA 1MJJB 1EDDA 3V6OE 1NDMB 1V0JA 1LDYA 5JI2E 5CDFE 4M62H 4XB6B 4RHUA 3CFCH 4Z9YA 3CVDA 1HDYA 2B3TA 1L4HA 1Y6JA 3IR5A 1EM8B 3QYNA 3L5JA 1N36B 3PHSA 2GUGA 5DHSA 4NRXB 1TEVA 2A8YA 3M89A 3QFGA 4NM8L 3JRNA 2B5VA 1EXMA 3X1YA 3UJ3X 1NIDA 4NRZA 4JQXC 5DGCA 4ELKA 2JH2A 5F3BB 2FPSA 3IDGB 3DNFA 2CLIB 5G0VA 1JGUH 3MJHA 2HJLB 2PRIA 5JBIA 1CS0A 4NUGL 4N90D 3IA2A 2B2XH 3EJRA 4JO2L 4YQXH 2IW3A 4LJ7A 5EU6D 1ZH6A 3ZXSA 4CNIB 1E58A 5K0NA 5TGBA 2HPAA 2GN9A 4ZCQA 3LNEA 2J0QA 3DOJA 4AULA 2ZUVA 3OO1A 3K0BA 4WK4B 3Q9NA 2DKSA 3SE3A 5K3BA 4J0QA 4EIGB 3D4CA 3C3EA 1CZHA 1AKEA 3D87B 1WIOA 4NZRL 4L5AA 3GJ7A 2XVXA 3GIZL 4NC0B 2BW0A 4HKBB 2EL9A 4Y9FA 2HC9A 4P5EA 2O72A 1AZCA 3INYA 4WNCA 4ZRMA 2ODPA 2FR1A 3AW5A 1ZXKA 3RI5F 1KBVA 2OQJB 5BRZE 2DFDA 1BVNT 4OB5H 4QM7A 1EIZA 2F7SA 2GXSA 3VXMB 5JQWA 4NBYB 3ULKA 3TNFA 5A4IS 3GUVA 5CMLA 4OFVA 2CU9A 1PL6A 2QQKL 4ICXA 3LKPA 5CINH 4LV8B 3V1MA 4D41A 1N75A 1YQQA 3PUZA 3DZHA 4AECA 2QMOA 1Y3FE 4EARA 4X4XA 2ZYTX 2W59A 4P9HL 2ZRJA 2JJSA 2ZR8A 3CYFA 1EAPB 5CB0A 2PRSA 5C0FB 5BN5B 1KY5A 4LSQL 1GA6A 4OCMC 4XPIB 3SDAD 3PGDB 1PV2A 1FVOA 3LRKA 1D1SA 4MIEA 4RW0A 1Y6MR 4BMCA 3GMOA 5K0FA 1A7QL 1GADO 5INDB 1R8QA 2YZ1A 1U3HB 1SIOA 3K9LA 1XZEA 1S7TA 3A6EA 4PAOA 5EEZA 4XXCC 2MWCA 1RC8A 3MTIA 4G1BA 4MJXA 2NYVA 3GZTB 5KJRL 3KS0J 4HRVA 4LCEA 1M6NA 1MCWM 4GYYA 5IUKC 4R1UA 3ETJA 3GSUB 2RH0A 3FZEA 4GW1A 4Z7UA 4NJAH 3ENZA 3WL3A 4ZSOA 1S3KL 1UH2A 1E6UA 3MV8B 4C7XA 3FAXA 2P80D 1R66A 1NP7A 3BPOC 4R5XA 1N5RA 1UKCA 5DSTA 5L6YH 4LT7A 4XMKL 4Q82A 1RPUA 1DQYA 1MWAB 4IV8A 1I3RA 3EFOB 2Q8BL 1MCFA 2CLRB 5LA6F 5EIIB 4EJ0A 1WAPA 2V2TB 3DGDA 2ICCA 1SCAA 2FB4H 1L4GA 3WGNA 4HJGA 1TTAA 4J1TA 3GC6A 2P3YA 3ZE8A 1NBVH 3MUY1 4WSGA 5HHOA 1V3JA 2NZIA 4PJ8A 2GB4A 4EKXA 1QVZA 2DB8A 1EIWA 4Q12A 4JFDD 1EUUA 5DHEA 2JFZA 4J9VA 3FU9A 5REQA 2Q3XA 2ZJAA 3RZWA 4B4UA 1RQNA 4IS3A 2CUHA 4RPIA 3TQOA 2NXZD 3TEWA 3V4PL 4AJOA 1CUFA 3KYBA 5I7WA 5IM7B 1ZVJA 3NATA 5IHUL 3OC6A 5C3IA 3GOHA 4NPCA 5KTTA 1UB6A 4CDMA 3LUCA 4MARA 2X3AA 1JSCA 3D43A 1LU9A 1G7JA 1YZZA 5IUNC 2A9PA 1UG9A 1RPZA 2BNQB 2Y7QB 5T5QA 4NBXB 3LUKA 3T9CA 1CUVA 1FGVL 5JSHA 5LWQA 5AW9B 3DSFH 4P5TD 5JHHB 4GS7B 4B60A 1AV7A 4CHTA 1E69A 4KK8C 1ADCA 1VLJA 3ZGYA 2QRGA 2GRUA 4GKZB 4RZXA 3CBRA 3KEOA 3SJBA 4KVGA 4FOPA 4S2UA 3LVRE 4LYGA 4MV0A 1SHWA 1ZHNA 2F8SA 4IIQA 1MFCH 3Q87B 2PZKA 4RGOH 1DDHA 3PQCA 5A5VA 1NPYA 4FGMA 4MASA 1CBVL 1XXHB 4D3DA 3P9QA 4AY3A 3MR9B 1AGFB 4EZKA 3NHAA 3OTQA 5F4BA 2BDNH 4HV8A 1HIMH 3QX9A 4ELKB 1IILE 4Q9KA 2DDQH 4EIWA 4B82A 4QUOA 4NONA 3T2NH 4EJ1C 1CFSA 4NBSA 3GNQA 5DUJA 1Q0UA 1VB9A 3QLVC 1U7PA 3AR7A 4FLSA 5ALVA 1T1YB 1FE8A 1OCWH 3VXKA 3LPAA 3SPXA 3LKDA 2ZTVA 1YVPA 1TIBA 3KPSD 4B6ZA 2FW6A 2CDBA 3FWYA 1M6EX 3SE4C 2H3XC 2ET6A 3B7SA 2P9GA 3CISA 5M94B 2JVJA 1N2SA 3DC0A 4CT0A 2XQKA 2BV3A 1P4IH 4MOWA 3WLRA 2A0XA 3DBRA 3QHAA 3DWFA 4F11A 4JVMA 4E46A 1KXZA 5GVRA 2PXXA 2KT6A 4MYUA 1ECJA 4Q7JB 4PLTA 4G0MA 5JYCA 4JKMA 2BVOA 5CIPH 4ENUA 1A5SB 4WNSA 4XWAA 5C07A 5MEOB 3EMBA 1UJ4A 2W1NA 3BPLC 3AGPA 2A5DA 4R3WA 2J73A 3Q8MA 4ZQBA 2H1LM 1EINA 4ZYWA 1VE6A 3UGUA