3ZE1B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 106
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze1B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze1B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze1B03
1M1XB 1AUQA 5KYUB 3V4PB 2P28A 2VC2B 4MMZB 1XUOA 5E6RA 5ES4B 1TYEB 5E6SA 3HXQA 3Q3GE 4IHKA 4CNBA 1MHPA 3TXAA 2ICAA 3N2NA 3T3PB 2O7NA 3VI3B 1AOXA 1N9ZA 1PT6A 4IXDA 4DMUB 1SHYB 1L5GA 4MMZA 5E6RB 1U8CA 5E6SB 1IJBA 3NIFB 4G1EB 1RTKA 3EOAI 4IGIA 2P26A 3ZQKA 1M1XA 1Q0PA 3BN3A 3NIDB 1BHO1 1JEQB 1U0OC 4Z7QB 1V7PC 2I6SA 2NUTB 4Z7OB 1DZIA 3AFCA 1JEYA 2ADFA 1MQ8B 4JDUA 1U8CB 2NUPB 4K3JB 4G1EA 4HQNA 3OKYB 3EGDB 5HJ2A 5E6UA 3IJEB 5BV8A 5KYNA 4FX5A 3RAGA 1M2VB 3FCUB 3ZDZB 4Z7NB 3ZE1B 1AO3A 3HI6A 3PPYA 3F78A 2NUTA 3EGDA 3K72B 4WK0B 2VDKB 1IDN1 4NEHB 1MQ9A 1QC5B 2NUPA 1JV2A 4UM9B 3BQMB 1XDDA 3PPVA 5HGJA 4BJ3A 5KYUA 3K6SB 4HQFA 3EH1A 3PPXA 1M2VA 3OL2B 1N3YA 2XGGA 4NENA 1T0PA 2M32A 3EGXA 3M6FA 4WFQA 5KYXA 1SHTX 3ZE0B 3E2MA 3IBSA 1U0NA 4MMYB 1IJKA 1SHUX 3ZDYB 1DGQA 4O02A 1PD1A 1M10A 2WW8A 3EGXB 2ODQA 4HQOA 3BQNB 4C29A 1RS0A 1FNSA 2NVOA 2UZYB 4M76B 3TVYA 3PPWA 5HDBB 3V4VB 1CQPA 1JEQA 3AL9A 2VDLB 1ATZA 1ZONA 1XDGA 2I6QA 1M1UA 4A0QA 4CN8A 3EFOA 1M2OA 2VDQB 1JEYB 4O3UB 1LFAA 2VDNB 3EH2A 4MMXB 1NA5A 1ZOPA 3EG9B 4HQKA 5E6UB 1YUKA 3F74A 2QTVA 2WINI 1QCYA 3TCXB 1T6BY 3VI4B 1L5GB 1MF7A 4PN7A 3EG9A 2B2XA 2ODPA 4C2BA 4WK2B 4JX0A 1ZOOA 4F1KA 5KYYB 1BHQ1 2XWJI 1IDOA 1PCXA 4HQLA 1FE8A 1JLMA 3T3MB 3OL2A 5KYXB 1OAKA 4NENB 1RD4A 4MMYA 1OLZA 1PD0A 1MQAA 4GZ8A 3QA3E 5KYWA 2XWBF 2VDPB 2VDMB 4FWWA 4C2AA 3K71B 5KYYA 4WJKB 4WK4B 3IJEA 4O02B 3GXBA 2VDOB 2I91A 1SSLA 2VDRB 3FCSA 4G1MB 3AL8A 3ZDXB 1SQ0A 4UM8B 1UEXC 2X5NA 3EOBI 1CK4A 5LN1A 3TW0A 2IUEA 4F1JA 1YVPA 4CN9A 1MJNA 3ZE2B 3NIGB 1QC5A 1RRKA 1YVRA 4XW2A 3OKWA 3K71A 3HXOA 3K72A 3K6SA 3NVQA 4O3TB 3EFOB 4UM9D 5KYWB 3FCSB 4G1MA 3AL8B 4MMXA 1JV2B
chains in the Genus database with same CATH superfamily
2YIHA 5C0CB 4HGOA 2ZUBA 3IVMA 5AK0A 2A73A 1D8AA 2Z7WA 2RKOA 3LHKA 3ZXXA 3F6BX 1HSBA 4WKNA 4HT3B 2XADA 4Z7WB 1G2IA 3K6IA 1USVA 4NARA 3EBGA 3MRPB 4K7JA 3CZRA 1DXHA 2IF0A 1SNRA 4BX9A 1NHGA 4DT1B 4BGDA 1PG7X 5EKDA 3DE5X 1KLUB 4I0PD 1EVIA 5I30H 3DMMD 4GXVH 3M6LA 1XH3B 4JLOA 1E0JA 4KO6A 4A2MA 2OGUA 4QYSA 1KJJA 2VR1A 4CNIB 1KBPA 1MRCH 2HBYA 1UXKA 5KQGA 4IKOA 1RPZA 1ODJA 2XOKD 3G5YB 2QAJA 2F9MA 2HWZL 2XBLA 5AKTA 4N3GA 1Q84A 4FI3F 1T9GS 2MPVA 4L4VE 4RZUA 3QVGA 5ANRB 1FL3A 2FZGA 521PA 3S35L 4QQKA 3PJEA 2P40A 2EXTA 2WGNB 1T1JA 1HHKB 5FV7A 3FGOA 3IKVA 3TPUA 3ZVVA 1A65A 3ZLBA 3D05A 3IURA 1PCXA 4XVSL 3DEKA 1VM6A 4Q9QL 1HFJA 2SECE 4AX4A 2D2XA 3FH5A 3VPDA 1XMPA 2CUTA 1M3IA 3AYZB 3RHSA 3RTGA 1N2OA 2NUBA 1KH3A 4RA6A 2IUEA 1T8RA 4QU0A 4NQCA 4L5IA 2ATKA 5EOVA 4XCYB 1H2BA 4X1KA 3LRKA 5CIYA 4EPXA 4CETA 3QG7L 3INGA 4X92A 1EWQA 1F12A 3TTSA 4G9DB 1MDBA 3MT7A 3X12B 3H9HA 5A2FA 2WAAA 3G5AA 5HHTA 1LV8A 2DHCA 1ZT7A 1HETA 1NTDA 4H1LB 4AJ0A 3F4KA 1Q17A 2QX7A 4DGYL 4Z0BL 4PM1A 4GQQA 2PYEB 3DSFH 4FMVA 2LU7A 1T2QL 2KZWA 1OWRM 1KXJA 4IBOA 5CJQL 2ZITA 5F7ZA 1AOZA 4GWGA 1EK0A 2CNLA 5HGHB 4QTHA 1PDKB 2IWFA 5FHAL 1DDIA 1TJXA 2GWRA 1R6XA 3ULUL 2FPLA 5SWSD 3GL9A 5ESRA 2PKCA 1DZ0A 1SHMA 3X17A 4BPRA 3B7YA 2PR4L 2LGJA 1VGEH 4IYRA 3BWDD 4F12A 3MRPA 5HDQH 1SQGA 1HQ4A 2LCQA 3C3XA 1YJXA 4JH0A 2EE9A 4PRAB 3RTQA 2AERT 4EGCB 1KY2A 2K2QB 4Z1OA 1JEJA 2NDFA 3H55A 1ZUIA 5JDCC 1VZHA 2G2RA 4N6GA 2WXNA 4B0PA 5K3SA 3WGGA 4XXCC 3E7DA 5K3FB 1DVUA 1WCQA 5DJ0B 4W5QA 1PGPA 2RACA 4GG6E 5F21A 2OMZA 5TFSH 2V7EA 4BNDA 5E23A 4M9QA 2I4TA 4PLWA 4K9SA 4HLQB 4NZOA 4ISBA 3TA3A 1RU9H 5JHMA 4LK3A 3QDME 5B3JA 4G6ZA 4LGVA 1RUKL 4KDTC 2XUAA 4POYA 2IPUK 2W0FB 3CH1B 4DLXA 5GRVL 4A67A 2PQ0A 3DV9A 4P5TA 1JYVA 4RZIA 1X9UA 3FB7B 3NJIA 5J5EA 5BRQA 1LP9A 2ZXBA 3U81A 2AGVA 3PNYA 2V4LA 4NKOA 3QG7H 1XZAA 4MJID 1OP9A 3CGGA 2D2EA 5CAEA 1E3WA 2N56A 2F1KA 3MRTA 2V96A 4DGUA 4HMDA 3RSQA 1BCIA 4XUEA 3HHPA 1UKTA 2ALJA 3R44A 4ZVTA 4F9GA 1KYZA 3LYUA 4BGUA 2JELH 3CFJA 3TOVA 1N0HA 4RPLA 5CR8A 3TUZC 4YZFF 4S11A 3NFNB 3FHQA 4XMUA 2XDHA 1EH9A 1KBBA 4ZK2A 2AXQA 3INNA 1TDQA 3M1LA 3FWZA 3PNMA 4XQ0A 4TOIA 4UTOA 2YW2A 1YTUA 2QT6A 3TQQA 4CF3A 2K4AA 4XODA 4PG2C 1F14A 4RBPK 3FX2A 5AVTA 1Z8DA 2DDQL 3HXKA 4HCGA 1T7VA 3PPWA 4HFNA 3P73A 4JRYA 2WSBA 3CX5K 4MCIA 4M6ML 4AYGA 3VA6A 1JJVA 2D0DA 1XKTA 1WXIA 4N6NA 2CDBA 1FDWA 1D1PA 5HJGA 3IDAA 2HRDA 1W0WB 4B4DA 4ZD6A 1ZK3A 1XGTA 2WFAA 3WWCA 2M26A 1UOWA 1E2FA 5EIVA 2I6GA 1EUYA 4JGMA 3MEQA 2BX5A 4OLEA 4S04A 3WFCL 2QTMA 1CIDA 2EJUA 4JCOA 4OHVA 3UMRA 1E8MA 5FTWA 3NJMA 4BRSA 4B3TB 1EVEA 2YPKA 1HAWA 1KIQB 2ICWI 1OH8A 4EEEA 5JMRA 4B43A 3QNYB 5F21B 5F96L 2VP5A 3PF8A 3KR3L 4QUDA 2WUBH 1XV8A 1R0WA 5I18H 1CUCA 3BX7C 1B4JL 3MGGA 1ROWA 4ITVA 3H2YA 4MVBD 3LHPL 2YJTD 2VLLA 4F2MB 1KC1A 4OFZA 1JG2A 5DJZA 3C4JA 2P9GA 2ASVA 1W2HA 3H2IA 3NACH 3H5TA 1DO2A 4AKQA 3MJ8B 4QE3A 3O95A 1JZ8A 3K1KC 3HC0A 1F17A 2BFBA 2XTJB 2PX0A 2MTPA 1Z4LA 2N46A 1OA0A 5ITSA 3GLIE 3OZ9L 2Y2TA 2D0IA 4IMKC 1ZVHA 1V8FA 5JW5B 4UZUA 4L9SA 1CO1A 3RT9A 2A6KA 1BHQ1 2YL2A 1KYXA 3GUZA 2XRAH 4V0OA 1SBHA 2DLHA 4L4TB 3EO0A 2XXGA 3FSVA 2PE5A 2ZRFA 4Z2AA 3SMQA 2X1HA 4P06A 3WRXA 3HMXL 3WGVA 3UBTA 4O02H 1NLFA 4BCDA 4WZAB 2BVQB 4N48A 4PJ8A 3NABL 1A4JA 3LKVA 4D3DA 3CLTD 1NXTA 2WXFA 1V7ZA 1A02N 5BXQC 1USIA 4TUYB 1KI8A 1ACYL 3AF1A 4X1YA 4YMTA 1YRHA 1ZM4A 4NMWA 5LBTA 5IDQA 4JO1L 2VH5R 4B9ZA 5LMNB 3JATB 2C92A 1BVLA 2NUPA 4BA0A 1Z5OA 3KR3H 1PEWA 4ROTA 2WVVA 4HUQA 3OKLA 4X1IA 1UOLA 3FYCA 1OV6A 1CRZA 5I47A 3UG4A 2X1WL 4IF4A 2ZXWB 2VJDA 1ES0A 4IMRA 4HFMA 1G9HA 4G41A 2OMBA 5AVZA 2XGSA 3R2JA 1E18A 5JNLA 2C7GA 2FP4A 3PT9A 1OUMA 3WK9A 3IJRA 3DLCA 3HR7A 1C1DA 3QI9C 3D3QA 3W5HA 4HZLB 5F7AA 3RAJA 1YAIA 1PD6A 3GMRB 4XGKA 3BH8A 4KK9C 2IZ0A 2BTQA 4H8QA 4ARBA 2WJ6A 2EYTB 4CTNA 2G06A 1OGSA 5DUPH 2XWBF 2FO8A 5EZYF 3ECUA 4QUOA 2ZKHH 2F19H 2VISB 2Q21A 4XD2A 2Q3CA 4C03A 3AVEA 3PQ7A 1JFTA 3BB1A 1IBGL 1UPXA 2FSGA 2ZR9A 3S0JA 4FZ3A 3AFOA 2CNZA 4FQ1L 1GPOL 4ZPTB 4V1CA 1ODLA 4U3JB 1VCNA 1KTDA 2QQQA 3LF1A 4PJFF 3MT0A 3ATEA 4TVUA 2ZE5A 2PO6A 1SXJD 2VO5A 3C5SB 5FTKA 2PABA 3FFDA 1J8QA 1CMOA 3DVLA 1IHYA 5SY6A 3ZK9A 5BUGA 3F5WB 2H2WA 2P45B 1H19A 4WZAA 2EYRB 3IMBA 4KZCA 3ODPA 1E65A 3IWVA 1Z75A 1JN6A 4LEOA 3DA0A 3DO7B 3FCYA 3QIAA 3WTYA 3GT7A 3HNOA 3BWUC 1BCSB 4LSPL 2ICWB 2P69A 3GHYA 4GOOD 3PICA 2ZJBA 4R7XA 3BEWA 4YRLA 4TVSa 1PEKE 4QPZA 5A2KH 3OZLA 5IJ0B 2WIJA 1M8PA 1GC1C 2BW4A 2YPLD 3RWDA 3K4AA 3HS0C 2ODPA 4MW1A 3P9IA 1P9WA 3JV5A 4ILEA 2X2HA 1UMDB 3EXG2 3V34A 3KBFA 3QU7A 4WECA 1PU2A 2FOLA 2E21A 4JFPB 1MOPA 1PNRA 4JO2H 2J6EA 4LRSB 5JRZA 5EJ5A 2UY6B 4YJHA 2J0UA 2N1TE 3IWUA 4MOWA 3DLBA 3DTTA 1C0LA 2QN3A 1OZFA 3RGVA 4OTZA 2ZWVA 3GF4A 5HHXL 3D85A 2EIXA 2JCGA 4D9KA 1UPBA 5AKZA 2DF3A 2A0KA 4B48A 2JFHA 1QYWA 3C5CA 4FYPA 5B53A 2ZPKH 3NBNA 4TVPH 1YCDA 1OXTA 1UD8A 4KI5E 1X3SA 5JASA 4G0ZA 5C09B 3OEWA 2XB8A 3N0WA 3AP2A 4EN3B 4YAQA 3RPIB 2VM9A 4UJ5A 2C1XA 1UPAA 3MCYA 4GLOA 1FIEA 1NCBH 2GAZA 1ZJ6A 2Y76A 5HYJB 3CMCO 4UB0L 4L3AA 4C56A 1FMFA 1A0QH 2HA4A 2H32H 4FA8A 1NVAA 2B4TO 4XI9A 2DGDA 5CZXC 2R48A 5CG2A 1AH2A 2GBAA 4X7BA 3MMEB 2OV2A 1GYPA 1K7SN 3RC7A 2OFWA 1I9IH 3BUIA 2XNDA 4XE5B 3MV01 4JO4L 1SQMA 3KYCA 3VCLA 3FNRA 4I1RA 3M1IA 2W1NA 4YX2L 4DBLE 5BS0A 2GZ1A 2XFXB 4AZ3A 3EOTL 1MH1A 3LQZB 4OJFL 4U0QB 5I19L 1W5AA 1CXZA 4D7AA 2CJTA 1O89A 3ZVNA 5F2NA 5IFAH 3MV9E 1B2LA 3BMNB 5B12A 5IWAB 1R3KB 3EEQA 3BFWA 3KPTA 4I9NA 4R96A 4TWBA 4WPGA 2X5JO 4R2IA 3K6OA 4Q6IA 1N5YL 3AR9A 4MRMB 4UMEA 4LE1A 1Y3FE 1DEHA 1IVLA 4DAGH 3D8UA 4MXVE 1AQKH 1E3DA 2VBGA 4Q74A 2YTZA 1ULSA 3DX1A 4X6YA 1QLEB 4B6RA 2GJRA 3VXNA 3DJYA 1TTBA 5B37A 3KVPA 1P4LA 3RU7A 4NNXB 3PXDA 3QIWA 3AJEA 3FFCB 2VSOA 2FPUA 1IZJA 2I07B 5EZJB 4TQ8A 4F37K 3OM1A 4OV6F 2G67A 1PIWA 1FYTD 3BJ91 4BJ6A 1BMWA 4MNQD 1M7BA 1F3JB 3KBHE 1IVSA 2YMQA 5TVGA 4CCWA 1YZGA 3O4GA 4AQ8A 1X9QA 4TLBA 2XF2A 5CH3A 2KZKA 2P8MA 4KQGA 3YASA 1VLVA 1EEZA 4LGMA 1UP4A 3TYGL 3OM0A 3OPZL 2BOVA 2HT4C 1HDCA 4OTXL 2J7KA 4GE0A 1K2DB 1TKAA 4L29A 4RACA 1AO7E 4BO7A 4X00A 4HEPG 2CLRA 1G9EA 1QP1A 3ARDC 2A9CA 2MPAH 3B9QA 4N90E 4DHWA 3N8DA 4Y2OB 3LXBA 1CUOA 1P84J 4QXUL 3P94A 3FCTA 2WJGA 2WR8A 4HG2A 2IANA 3H9SE 3F7RA 1HH4A 5FYKD 2A73B 1JU3A 4G8FA 3DRTA 2ZJYA 4DO6A 1D1TA 4I9FA 9MHTA 4AC4A 3HKDB 3HHEA 3MMEA 3ALPA 4IKEA 2ZBVA 3UMCA 3BXNA 1C7QA 3BQUD 4LOLA 2BHTA 3D8NA 2XUPA 1PJWA 4NYMR 1RV6X 1U8LB 2VDRH 1N7MH 4CDGC 5EN3A 3A4IA 3QVAA 5TRTA 2X2YA 1Y1QA 1RRMA 5EHZA 2XJ4A 2QQKL 1FP2A 3V1YA 2BNUA 4JY6A 2X6UA 3AXLA 1T8YA 1U8PA 1SHSA 2QGCA 4JB9L 1DC5A 1R3KA 4MUMA 4RMWA 1XKXA 3ZD7A 4LS3A 5JD3A 5ALTA 1F1JA 1PR3A 2PKRA 3ZVLA 3RYFB 3QIUA 2R1WB 3G9QA 4WI4A 2CD0A 3AZPA 1CBVH 4H2CA 1GUAA 1GZVA 1Z0MA 1QKZL 1FEZA 1ORHA 2R87A 4ZP1A 1TCCA 4JRLA 3ILDA 5F7LB 3TPUB 2IS2A 2ODAA 1OP4A 5T3ZD 2RJ3A 4D8PB 3ZX5A 3P1JA 5CFLA 4BINA 3FT0A 3VZSA 4Y6LA 3D6AA 1SOWA 2HIMA 2L19A 1KFAH 4GPTA 3ZV6A 1T1WA 4R0LC 2YGNA 5TMDA 2EZ9A 1IIBA 1GOTA 5KUMA 5I9NA 1TPYA 1T66D 4H1UA 3DRQA 4I4WA 4KNWA 1HH6A 1T4GA 2A83A 4M7KL 4ZCSA 3KETA 1VSQA 2IYPA 1VA9A 1WGOA 4NGHL 1T7YA 4LBWA 5FULA 4XUGB 1YUHB 3H18A 4TQEH 1RXIA 5C97A 1E4EA 3K0AB 3HSSA 1NL0L 1UWXK 5A1AA 3U9TA 3WAJA 4HISA 2QPLA 2Z04A 3A58B 4DQDA 1X7YB 5T4HA 3MJSA 3DGFC 1ZCAA 2ZJ2A 4CVZA 3FTDA 3BEVA 5JS2A 4F2ME 1WSDA 1CB4A 3L81A 1Y8AA 4FOTA 1FJ1B 1VBNA 1KBKA 4U7DA 1VKOA 2MKWA 2HAEA 2BFAA 5HYSG 3DKRA 3W5NA 2Z58A 5C18A 3FSOA 5DURB 4LFCB 1LCIA 2JJSA 4CADA 1UEJA 5IMOA 4OUUA 1XCJA 5IG2A 4G65A 1MLCB 5AHRA 4HJSA 4FYQA 4F6LA 4BK5A 1MXFA 3ZKMD 3D0AA 3B2XA 4JN2A 1G9NC 4HBZA 1DKQA 3QEJA 1YAHA 3VD3A 5JYLA 2RGCA 1NASA 4RK5A 4TX1A 4ARZB 2FEEI 4GM0A 4P3DA 4MXWL 3QQNA 5DUPL 4P3CH 3PPSA 5CKGA 1J56A 5EU4B 2ERJC 1R74A 1T1EA 3V4VB 3QM1A 3KKNA 1SVZA 4GUQA 1P5UB 3B9DA 1FYEA 5JHAA 5CEYA 4Q15A 2FF5A 3CRW1 1OTHA 1LV7A 5BYBA 1FYHB 2A0LC 1D1QA 5ABZA 1M1YA 1W25A 5IJAA 4DHEA 3KOZA 2VATA 3U3KA 1KAMA 3MMSA 4HYQA 3ELQA 2RHHA 4WXMA 2QK4A 5FO1A 3ZMEA 3DCJA 2O1XA 4GRLA 2OCGA 1XMVA 3MCVA 1Z6QA 3LBNA 3G6KA 4L3WA 3DSNA 4ABUA 1LA2A 4ZCMA 3OKKB 1JAHA 1I8KA 3ZWMA 4BFBD 3M7OA 5KJ4A 4U6VL 3ROZA 1L4IA 1X94A 2DR0A 4D99A 2HA6A 4HAUA 1XQ6A 1H23A 4MDIB 3LTNC 3IAQA 4Q3CA 2PZ8A 3FD8A 4PGGA 1V8OA 4YZFE 3B9VA 2CQVA 2JB5H 4REQA 1V6CA 4LJ4A 3Q9PA 3QMVA 4M7OA 1YNTB 2AX4A 3GHBH 2YPLA 2WJJA 5D2CA 2UUAB 4FQ8A 3P9ZA 1RVFL 3RVTC 4KQ9A 4TKUA 3MLPA 1IUKA 1SPXA 3RC3A 4RLQA 5HQ3A 2V5TA 3GBNH 2IAND 3QYFA 4TXVB 3T4EA 1NSNH 4JAVC 4BMVA 3R0XA 1B00A 1T5OA 1II9A 4P4KD 2YOAA 4DV6B 2WBJA 3RJ5A 2J55A 4OIMA 3JVDA 4X9YA 4UUOA 3SP1A 3DDCA 4WJ5A 1ZLYA 4KHXH 3A4EA 5JZ7C 3E5MA 3B7SA 2EO9A 1ZLEA 3DURB 4OLZH 1NN3A 3V6OA 2ERXA 5IHXA 2PO6D 4KDTA 1SXJA 1U9JA 2Q8AL 3F7MA 4BEBA 5BQ7A 3OZ9H 3BSSA 4NQEA 4C2UA 3NM5A 2A0LD 4G0OA 4QOHA 1F4YH 4RJIA 2REQA 3TCXA 5SYNA 1FLDA 4GR9A 3BXFA 4FN5A 1DE0A 1OLZA 4LV8B 2VWEC 1WISA 2H5JA 5HR5A 3AOEA 1T15A 3BILA 3IDOA 1SUWA 4OBEA 5A6LA 3MRGA 4OBRA 4AITA 3BQUC 5E4OA 1AZTA 2ZKYA 5CB6A 1YPZA 4LC1A 4G7RB 4ZYUA 1IQDB 5DJ6B 2WD9A 1NCOA 3VFGL 1YA8A 3KBBA 4OKDA 1V6SA 1I9CA 3EGEA 5BUQA 1X87A 4H1LG 1KI6A 4P5DA 1A9EB 3MACL 1IZ7A 1QRNE 4PN6A 4XO4A 4QTZA 3RVOA 3Q3IA 5ICYA 3BP7B 3QQPA 3EBIA 2WQSA 2PWBA 4L1KA 2FB4L 2HYMA 3E6FA 2OOSA 1NXQA 1JB1A 1E5CA 2VSCA 1PUJA 1Q38A 5AOZA 2O8CB 1HLGA 4WO4B 3V2GA 2AF4C 3NHWA 3NAMA 5I0XA 4L4XA 4XGIA 2O8FA 4PQXA 5T5FA 3HC2A 4I66A 5F9OL 4MS3B 1ZCBA 1MEOA 4LXTA 4QYOB 4JL8A 3PG5A 3QUCA 4LRXA 2WSPA 3UTSB 3CKMA 4IUYA 5JALA 3T6ZA 3NA9H 1I1FA 1LK3H 3UXEA 1GMIA 5KVFL 3UG5A 1DS6A 1KJ2B 5JIPA 1RLUA 4ONGH 2YJ6A 1IBKB 3K1YA 2E9WA 2VABB 3E1ZA 3LPPA 1OTSD 5AW9A 4KYUA 4Y6SA 4U5QA 1UWCA 4ACBA 5TMEA 1NV8A 3VPHA 5EINA 2P9ZA 4GEJA 4HIJB 3P9LA 1T9ZA 4H7PA 5DC9B 2VUKA 4OJMX 5E5MA 2FWOA 3MCZA 3ZV3A 3TS8A 4RNRB 1XGYH 3V0JA 3K8KA 1JHZA 4B84A 1UJMA 1G8JA 1ZS9A 4JOBA 3SE0A 3FRUA 3F05A 2Z0UA 4EYEA 4DMGA 1Q9OA 4PYIA 2I2DA 1V25A 3CFCH 1JERA 2XVXA 3CHYA 1YJBA 3NI2A 4AVYA 5L3SB 3BICA 2FB4H 1JL3A 1R4NB 3TYFB 1VYVA 2XQJA 3COPA 5I9QC 4H9GA 2AB0A 4OQPA 4ZZ3A 1TIUA 2HT3C 1QPPA 3RQ3A 2IW1A 1KXHA 4N9OB 2WM9B 3AGPA 3GGSA 4HUQB 4J03A 4UTXA 1O9WA 4JFYB 3EBOA 2JFOA 1CKEA 4EAAA 3QVXA 3I85A 1AKYA 4HBQA 1U0HC 1FBTA 1JEDA 3GFFA 2FZEA 5JS6A 5A9SB 2F5AH 1U8MA 5CNJA 4HWBL 3A4TA 1JTEA 3QMPA 3B3BA 1JR4A 7ADHA 4TM9A 4JPSA 3OAAD 4BVEA 3T5AA 4NQDB 4PW4A 3A3KA 2PT6A 4NWUL 1CZLA 2Q7NA 1KDYA 1IL1A 1GL3A 2OYPA 5JY6A 1ISHA 5HD8D 4JDTH 4D9JA 1NIAA 2FZ3B 4ZS6D 4NRYB 4RAUB 3HZZA 4G5GA 2KLTA 4U0KA 1V2GA 2B8EA 1EZSA 5DHYB 2WU1A 5BRNA 2C2XA 2ROXA 1JYSA 2DQKA 5MFZA 2APBA 2HLDA 2E5FA 2O3SA 1PT9A 2PUCA 3MJ6A 1Y98A 5EQDA 5EHXA 4Q9IA 3EVNA 2XMRA 3IGKA 4UT9A 4RV4A 1ACJA 5CWSB 1B1CA 2QM8A 1NCTA 1UZGA 4E41A 1EWKA 2QDXA 2J3HA 2VM3A 2IBTA 4ZVSA 4U1IB 3LWZA 1QWUA 3CO0S 5KTPA 3EDJA 3O03A 2YWDA 4CJ0A 2XV2A 4ND1A 3MODL 3T7KA 4FB5A 3KTAB 3BP4A 3Q3EA 2Z1DA 3ETLA 3MLZL 3K0KA 4TN9A 2N7SA 3T6KA 1X80B 1Q95A 2QD3A 4QXGL 5EOCJ 1JR3D 2Z6AA 3T7TA 1WU7A 5C3TA 4OKSA 3L3OB 2ODQA 1HC1A 5E5UB 4BH7B 2C07A 4NUQA 5K0LA 4XVSH 4AJ1A 3KLKA 3SY0B 1BAWA 3W5MA 1V54B 3V5NA 4BBAA 1T1XA 3KOXA 4UKDA 4EWLA 2VJAA 3CE9A 1GV0A 4IQ8A 5EJAA 4DLZA 3R6WA 1R3HB 2O50A 3EC2A 2CBXA 3NA4A 4M0DA 1VEPA 3BAXA 1Y7IA 4L0CA 1SJXA 1QH0A 2EZ8A 1XMWA 2WZ6A 1E9FA 4HNAB 1ODFA 1OGAB 5L9DH 1OKKA 3G5ZA 1R6DA 3CNKA 4IDCA 5KBNC 1SBYA 3CUYA 3GTNA 3RKUA 4EJ2A 5EP2A 4OI0A 3G1UA 3NNSA 4N76A 2VP0A 4C3OB 3VYNA 1J8FA 2P2LA 4JFFA 4MB5A 4QOIA 1RQ7A 3OLCX 2CL6X 3AC0A 5IBRA 3JQ9A 3KJQA 2NO1A 3OPQA 1MD9A 1SULA 1NQXA 5HZGA 5EBLA 5FOXA 3UMBA 2KLSA 3IELA 4U7JA 1OGTB 5FYKL 1R37A 1A9PA 3GJ7A 5DK6A 1DO6A 1XCXA 3BWXA 3VXSA 5E4AA 4P54A 3K32A 1AGEB 3NVMB 4WL0A 5F12A 3GUVA 3MLXL 1L5SA 4GZMA 2OE2A 1IGFH 3WJMB 2YRLA 5A2BA 4N28A 1F13A 1ZEJA 1GPJA 4G0PA 1K2DA 1UWGL 4M1OA 3JR3A 4GNKB 1GYRA 4NAVA 8CGTA 4Y8VA 4K9EC 4R8RA 4UE2A 2PXYB 4KMOA 3BS4A 1G7LB 1YB6A 2AP2A 4MICA 5ELIA 4LSWA 5DRZB 4F1KA 5C6WH 4UBMA 5BRZD 2EZUA 4AUKA 2PX2A 1H85A 5G0SA 1AANA 1A9BB 2DSNA 4EI5A 4OIFA 4XLLA 4NAQA 4QASA 5D7HA 4HYEA 2DERA 2KKQA 4JX9A 2QKSA 3FDFA 1W15A 4KODA 5ENWB 2HFGL 4L9LA 4WBSA 4RFLA 3E8XA 1C3JA 2QYTA 4DLWA 3LDAA 4JRWA 4QT5B 5U4XA 4XBGA 2DQSA 4JPIB 2HUPA 2CVZA 5HDQA 3TOCA 5T3ZL 4PHZA 2P8LB 2XYQA 4Z9FA 3ZYZA 5EP1A 2ZD0A 2X8BA 4ODTL 2YJGA 5SZJA 4BWFB 4NN6B 3VDNB 4J6IA 2CMHA 4UBJA 4G9FD 4HU8A 4JFFE 2BW0A 1QZZA 1LO4L 3EISA 1GEGA 3R7RA 2W9DL 4I8IA 4XP5H 2OL3H 1YMME 1U0RA 1ZN7A 1Y6JA 3S70A 3VNQA 1ZO8A 4PP2B 3S2UA 4W4OC 3KWTA 3C70A 1GPAA 3DBXA 43C9B 1M2VA 1ZL2A 1KXVA 1LQ2A 3QZPA 5AW1B 2FSHA 1XR8B 2P4UA 3BFJA 4QDOA 7AT1A 4IGAA 3K5RA 5EIOA 1EFQA 3NK3A 7FABL 4KMQA 2JKVA 4AMXA 4DYDA 3LNCA 1Y63A 4F2PA 3W1VA 1LWOA 2VDOL 3DNKA 1GDHA 3W77A 4KYTA 5IF3A 5A4FS 2IGLA 4D7PA 3SHVA 4AT6A 2AJLI 1FSGA 1H6DA 1ICTA 2KMLA 2G25A 1GU0A 5LXGH 1HDXA 4X97A 4HMQA 2NYKA 4ME6A 2APJA 3RE0A 2W2OA 4YC2B 1RI2A 3ULVE 3GM8A 3HKCB 1BJ1H 1QDLB 4EXKA 4GPZA 3HG3A 2WFLA 2WQRA 4FCAA 3EVDA 2XXAB 4QRUA 3BIJA 3C4QA 1S2IA 2HZ7A 4CFZA 4U1GB 3X1NA 3H83A 3U7YL 1TO2E 3C8MA 4PJXF 1G8PA 2VJYA 4PXYA 4ZO7A 1PSDA 5I2IB 1E42A 3FN0L 4YUEH 4UHCA 4HJRA 1CXIA 5IK3B 1NURA 1U94A 4EHNA 4IRSD 8ATCA 1DJPA 1MOQA 4L9LC 3V0IA 3KOOA 1K2VN 2BWJA 1FYTE 4JN1L 1FXUA 3RBVA 4HO1X 5IJWA 1VHJA 4FHBD 1XPRA 4CF5A 1EZUA 4MVWA 5BSUA 1D7DA 1IBLB 4JBXA 4A0FA 3ZJAA 2ENQA 1HFUA 1DAOA 3IVCA 1IKNC 1YCFA 3IAUA 3QG1A 4M21A 2QE6A 3OOHA 1U8FO 1A82A 1TM1E 5C8JA 1DCTA 3EYQD 1TF7A 1KPHA 2OQJB 3LKRB 3IU4H 4JPIA 5DH9A 3RVDA 3DW1X 1UKQA 4GBXC 2WE8A 4CRPA 2XY1A 1U1IA 4YCSA 3OAUL 1HILA 3QU9A 2UX7A 2Q1UA 3GHPA 4QATA 1RZFL 5DZOA 1NV9A 2F90A 1B8VA 4KDFA 3MV9D 1CEXA 3RAJL 2WOOA 4KN6A 2RGNC 5BPHA 3ZDXF 4X45A 3U44B 2EDTA 3D18B 2WI8A 1AU9A 3MTGA 5E1QA 1A6TB 3RURA 4M3KB 4P2RB 1DP4A 5JUEH 3K9NA 1K4DA 4Y9DA 1IEHA 2J56A 2O7VA 4RA3A 2Z0BA 3RPKA 4Z8FL 4GQAA 4M6WA 5J4VA 2APXA 1COZA 1V41E 3DV6B 4GQ9H 4QRAA 4YIKA 5E4EC 1RK7A 5AOVA 2HPVA 2VT7A 1IQWL 1SQ0A 5FGCE 3V3KA 2A9KA 2N3JA 1QGED 1V5GA 3RVQA 4ED9A 1F8UA 1QE3A 4PFKA 3JWNE 5DHVH 1S3KL 5CA1B 1N59B 3UBHA 1KTJA 1J7VR 3C98A 2ZYTX 3S1SA 4ZQFA 2ZRIA 3PHIA 2FLRT 1SCNE 2E6PA 2HSEA 1AIFB 4KOBA 3W7BA 1VRVA 1ZBQA 1ECFA 2H6OA 4BQBA 1OCWL 3IMSA 1JKJA 5DDHA 1O94D 4G0WA 4ELMF 4AG4H 1B6RA 2VQ1A 4DN3H 2J9ZB 2C00A 1VG8A 1WA0X 3GRRA 2AE2A 1AG0A 1KQOA 2ATVA 5AR1A 3LDFA 1X86B 4HF7A 5TPWL 2E9IA 4S2SB 1UUSA 4DMCA 5E9DD 3K2EA 2X28A 3JTMA 2EO7A 4XVUC 1KTLA 1M4KA 4O8ZA 3ESMA 4YFLF 2A74C 1NVXQ 5AW0B 5AKEA 4UT9L 1UFUA 5ARDA 3JWDC 5LP1A 4KDEA 2B94A 3SHQA 1NW6A 3Q2KA 4LF4B 1HL5A 3FONA 5B1KA 1AD9A 3B34A 2EATA 2O2EA 5I66B 5FUBA 1B14A 3NV7A 5H3CA 1CLZL 5E2WH 3GLFB 5ADOH 5KDOA 4KQ2A 3L4YA 4XN4A 4H6WA 1YFLA 4M7LT 4ZMRA 3KYMA 3QIWB 3C6SB 3D43A 1U11A 5H0IA 4L37B 4NZMA 4B6ZA 4K8OA 2QV4A 4KHTL 4W5JA 4XWKA 3PQYE 4CGTA 5K9KA 1VLLA 4AQ8C 4F45A 1AI1H 2K5UA 1IQDA 5DJ6A 1KDPA 4YGVA 1ZVNA 1HV8A 2MOKA 5KSBA 1AOXA 3MSXA 5FOWA 5EQFA 4PGEA 1IHPA 1HWGB 4NONA 1BHO1 4B3BA 4X8XA 2O61B 2R29H 4EELA 2QTVB 4NE9A 1SHJA 4O25A 1C4XA 4MQMA 4ZYZA 1BECA 4MYDA 4JT8A 4WUUD 5IESH 4HULB 3SXUA 3G5XB 5BV2P 3M5DA 3QITA 5JQWA 3FYUC 4EG5A 2RIKA 1E1DA 1JXJA 4YR6A 5D3MA 5KVSA 4XBMA 1OW3B 2FZCA 2PEZA 1YNLL 4BK8A 3K6KA 1K5GA 3RWGA 4TYUA 1OX6A 4NWIA 2PK3A 4P3PA 2IX3A 4EN3C 2PYFB 1I3CA 1QCZA 1RXWA 4ZT1A 3B60A 5EF1A 4NUMA 5DNYB 3FUNA 2G60L 5A2LH 4WW2C 3PNPA 3DLAA 3RRZA 4QHLB 3OAZK 3AJ8A 3HZKB 2NLJA 1ICEA 3SO3C 5CA0A 1HT2E 4H2DA 1RAGA 3T8MA 5FUWA 2VAJA 3UP1A 3NG1A 2ZCHH 4PXAA 1AZWA 5ALWA 2XWCA 1RJYA 3C3WA 3N07A 3RVBA 3PI7A 2VDLH 3JBG7 1AKEA 4TV3A 2FFAA 2QRKA 1OSZA 4FABL 2JEZA 3CZLA 3NH6A 1GQSA 3FQTB 1UCFA 2ZJOA 1SBBA 2DP4E 4V1DE 1DRWA 2ADIB 5AUMB 4N5ED 2VR4A 3GRCA 2FSVC 2XOEA 4GIOA 1WAAF 1JZGA 1NCDH 1KP3A 3BPCA 2AV7A 4KE9A 8AT1A 1T0HB 1CXLA 4K23H 5CJ5A 4HGZA 5F51A 3BDXA 5ICEA 4CUCA 5L7XL 2RR3A 3MRJB 3QUGA 2AI0L 2KI6A 1WU8A 2OXGB 1ZLUH 3QJFA 3SXPA 3TBCA 3PHJA 1ILEA 2HKFH 1KVSA 4ZJYA 1XSIA 3DDSA 5FAXA 1SU6A 3THRA 2OP4H 3T34A 3QUXB 3DWIA 1WBYB 4HHAB 1E5XA 1HM5A 6REQB 5EO0A 5BJTB 2EEXA 3QCUH 3DV2A 3X1YA 1T5WA 1V8BA 4QQFA 3LKSB 1CFJA 3E2IA 4BQ9A 1GGCL 1EVTC 3ZDEA 2BGGA 3BFQG 3UAJD 1QVAA 1V11A 1HE1C 3G5XA 4BLRA 5D5PA 2BFOA 5THKA 4AQOA 4I50F 3AF6A 3FW1A 3D0KA 3GMDA 1O5TA 2O6EA 1I0LA 2E4XA 5AHKA 1GGTA 1RD4A 2RIRA 3D7NA 3L2MA 1GG5A 4Q89A 4MA7H 3WE7A 1BZEA 1SZDA 3B3FA 1EFCA 2G40A 3Q1SH 5KKNB 4ND6A 4CM8B 1WZUA 4LPWA 1U2EA 3KQHA 2JZOA 3KZNA 2OAGA 5IFHH 2WE7A 3ZDZF 2NZWA 2O48X 2BM9A 3URKA 2W94A 1GM5A 1Y4DE 5AXBA 4R54A 4BZ2H 1EAOA 4JM4H 4BEVA 2AJVH 2ZXGA 3FSWA 3LOQA 2NY6D 2N4IA 1QD0A 1D2NA 4RIGA 3PXAA 5F6HI 2PQ6A 5F3FA 1W0YT 3T3OA 3K1AA 2Y7OA 2IGBA 1OFUA 5CZRA 5DT2A 1CZUA 3VGAC 1THZA 1KDOA 5IU6A 3A4MA 3K09A 4M8UA 4GLRH 4NBNA 2Q8QA 2ZICA 1RLMA 5I1EH 4POZD 3QW2A 4LK2A 5IW3A 3NWJA 5DR5H 3ABRB 2NU8B 2ZTBA 4R71A 2O23A 3WO4B 3A1VA 1QGOA 1NP7A 4AAYA 3FF7A 2NLOA 1OF2B 1WUJS 1LI4A 5KOHB 3OKKA 2D0OB 3B48A 2TAAA 3CLRC 1UBGA 2Y1ZA 5F1IA 1PLGH 5DQJB 1EJOH 5FYJL 2WJVA 5FWQA 3EH4B 5DN9A 4GO1A 4LIPD 3IR7A 1CR0A 4YHML 1GNLA 5KREA 1DRKA 4OFPA 5DJAB 3INUH 1JKIA 5B22A 2VLIA 3HV0A 2GCOB 3SOTA 5KEZA 2F0CA 5L6YL 2EHJA 3KFVA 4R9SA 1PQUA 4RH0A 2HQRA 3QHAA 5BS0D 4NRXA 4JLSA 3KE8A 2BSQA 1OOEA 3CLFH 4OPMA 1U30A 3HB0A 3JYNA 4DA0A 2ZWSA 1D6SA 4AKGA 3NIGE 1JGTA 5I1JL 2JFBA 2RGDA 4NU6A 2QM3A 1NUNB 5D3KA 3KHSA 3AEXA 1QQBA 4XP1L 2YDXA 4WUTA 2OW7A 5C7LO 3MPCA 2XQBH 4UYPA 3RV4A 4HS4A 1NR5A 1UH2A 3KTAA 2VLJB 3LGSA 1TDJA 4PHGA 3BSZA 3VRLF 1LDPH 4RHXA 4PVMA 4FQJL 3AM4A 2PQ2A 4YCDA 2ZE7A 3KPYA 3RB7A 4YDJB 3MRBB 4YJ2B 4MULA 1G42A 3JTEA 1M53A 3CBQA 4EGJA 1Z9SA 4JLRB 1GSHA 3U1TA 1GQRA 2WMPA 3FFDB 2YXBA 4BJHB 5ITBL 4B2IA 3Q5EA 5HYIA 1W72B 2H2IA 4GOND 1OW0C 4DADA 1LO3L 4H0LC 4Y16D 2EDRA 5T5NG 5D2NC 1KBQA 3BORA 3I6KB 2B1HH 1LVHA 2OMWB 1EDBA 4C6SA 1RJDA 4IILA 4YUWA 4RIHA 3MGTB 1SEVA 4JBGA 3TLGA 1RUKH 4ALAH 5FW8A 4PY8J 2OBYA 3VI4B 3FN9A 5F2FA 1YIAA 4ETWA 3X1KA 4WRRA 2O5ZL 2COKA 3O1HB 2AOXA 3AR8A 3WYDA 2Q3BA 4IMKA 3N2KB 3RWDB 2PZJA 2WTPA 2ONZA 2GXSA 2Z3VA 3GMRA 4EA9A 5LBSL 2X53A 3IR6A 3ZDXB 3GJRA 1FNFA 3U56A 1CD0A 1IN5A 4Z7NE 3FQ4A 3SGJA 4UNIA 4XCFL 3D02A 4FFLA 2HZHA 3X11B 3T99A 1H6TA 3RA7H 4YRQA 1Z45A 3E9ZA 4K9OA 2Z2ZA 1ED3B 3AONB 2JFQA 4OZHB 2GJAA 3B2UC 3L3IA 2ERCA 2NNLD 1OE2A 1WBBA 4OCXL 5DWPA 3TZVC 5HYQB 4MB2A 4L75A 1XVAA 3QEUB 4W9RA 3AZOA 2EP7A 4Z7OE 4KQHA 5F7BA 3ZX1A 2CGYA 4CTMA 1JHMA 4D6XA 3UXHA 3F7VA 1TEVA 4F5ZA 3SZMA 3IL2A 2DKMA 5AB2A 2YIJA 5ESQB 3U7EB 5I8WA 3D7KA 5KVDH 1OD9A 3FB6B 3AUWB 3QVVA 4FGZA 4OGYH 3S96B 2WF7A 3SJCA 5FUQA 5D8JH 3MMZA 2I9LA 2XAUA 1NZDA 3UJ7A 2HKFL 3MLZH 2QI9C 4Q5IA 5JBNA 2JCXA 1YC7A 4P2RE 5B3JE 1CEQA 4YAQB 2GM9A 5A5FA 1TECE 5GGRY 1XWVA 1JMYA 3L04A 4OX9Y 2UYGA 1YMMB 5SWSE 1AQLA 3I2HA 2FP3A 2HCBA 4BH8B 4JT4A 2FHSA 3ZJ5A 3K0YA 1QFYA 1Q7TA 1NQOA 2G6BA 2AQIA 4Y98A 3BJMA 3PEFA 1UWLA 2J5WA 2INGX 1EA7A 4GSYA 1RLOA 2CXSA 1GVHA 2ZYSA 3DV0A 1ISIA 2A35A 3OZIA 2XW6A 1FQ9C 3BRWA 4P46C 1TD9A 1IKFL 1R5BA 1BVYF 4DM3A 5EVJA 2OV0A 1L5WA 1N4XH 4FFRA 4YO0B 4JD5A 1ID2A 2J59A 1FCJA 2YFHA 4A2DA 3Q9UA 4Q4CA 4Q56A 3GXFA 2YIDA 1CJTC 4H17A 3IFSA 1G7HB 4JHAL 4ZOCA 2XZCL 5DVPA 4M48L 5LBSH 3GROA 4B3CA 4KKAD 4K28A 5B6PA 3DBXB 5LPNA 4IGBA 3W2IA 5U1PA 3FYHA 4GSXA 2C3VA 1BS2A 2F7SA 4IDDA 4LY3A 3QCVL 4PMFA 2E75C 3PDGA 3PWPA 4F8YA 4BFIA 3NMEA 1KYTA 4XGNA 4AH2A 3EPKA 4PNHA 3FNBA 1U0NA 5H5JA 3DT9A 1KNOB 4UMDA 1BXKA 4IHJB 1FQKA 3A9VA 4Y7OC 3D18A 1BDYA 1R16A 3KV3O 2I22A 1AJ7L 2JHAA 4PYMA 3EAKA 3O45A 4XB8A 2V7QA 1UBMS 3FOBA 2CT8A 4H1TA 5FYJU 3WNDA 1PHRA 3U7WL 1HQKA 3MB8A 4NUGH 4M60A 4JY4A 1A8SA 1C8VB 2YV4A 4Q4AA 3NXSA 3IGAA 1L9XA 2GVZC 2A7BA 1DBJL 4XO8A 4HNVA 3ZG6A 4HZGA 2V7HB 5DJXB 2BCJQ 2D7QA 3DVAB 4J3SA 5F7OA 3KWWA 4ETYA 2WXLA 2CW5A 5KS9E 3A26A 4PGJA 1JQLB 3KZ8A 4GYYA 3FDZA 3A47A 4P2OA 5CBPA 3L9YA 4RJKA 1S5PA 2EJBA 3G2MA 4NLAA 3HKDA 3N2NA 4JI5B 1OWLA 1T0MA 1W2GA 4XSVA 4FKKA 3IP7A 4C6RA 3KPSB 1XF5B 3BTVA 5P8WA 1QLJA 3BKJH 1E98A 3WJ2A 2JHGA 2QP9X 4LWQA 3ABKB 1GCAA 4ECEA 4C04A 1B2WH 1OI3A 4Y0NA 1QGDA 1MFPA 3WL7A 2RHDA 3WFDL 5L53A 4JUTA 1R3HA 3EFEA 3NAZA 1L3BA 3ENEA 4M0UA 4W4NA 2QRQA 3OX1A 5JANA 4I5IA 3L0CA 5EEUA 4KK8C 4RZ3A 3F7YB 1OM9A 2F53D 3DO3A 1EUZA 1EX6A 3ZHZA 4YDLB 2P9QA 4TYQA 1H3GA 4UVIA 1QVOA 4AG4L 3HBNA 3QUZD 4EPVA 5M04A 2J5XA 5JLZB 1SKAA 2J8ZA 5EIXA 4ITRC 3F65A 4PJXE 2F1AA 2QQ5A 5EMKA 2IE8A 2ACWA 2ZI9A 5DR5L 3BVNB 3KHOA 1NJ5A 1CGSH 5C0BA 3HJCA 2XCSB 1N4DA 5BR1A 3ADKA 2FTKE 3QEGL 1YR8A 5IHZA 3W04A 1J1PL 2W6QA 1NBOA 3EF1A 1BE6A 1MGPA 4NFSA 3EUEA 4QOSA 4R84A 2VIRA 1L6RA 2XQIA 2XKUA 5AFSA 4NZYA 2PP7A 3T7JA 1JX6A 1AG9A 5JWHA 3V1TC 3QYMA 3DUHA 3EIHA 2W2TA 4JP1A 3A8TA 2HQBA 4LEXH 4FMKA 4KJWC 3QLEA 3V6ZA 4RRPA 1BOGB 4JUAA 2R7EB 3EXFA 3F9RA 1MJFA 3MNDA 4G36A 3FBTA 3PHLA 1FFXB 1Z6JT 3L9XA 1RKRA 3IDXH 4E5NA 2XNKA 2Z92B 5HI5C 5LM3A 2HA7A 4B6QA 4AIOA 3E5NA 4W1SA 1NKVA 2R3SA 4UCXA 4HS6A 2FTAA 2A9VA 1UG9A 1NIEA 1M6UA 4LYFA 1KB5H 3ND9A 2QPAA 3ZHFA 2Q3ZA 5CCXA 2P5EA 4D0BB 2O52A 3UFXA 1NKGA 1FDUA 2ZCUA 3QULB 1W0VA 4CKZA 1BAFH 1UQTA 3EVEA 5FUZL 4JDPA 4DEYA 3JXEA 5CEZL 5F1OB 3QLVA 1I1QB 4G4IA 4JL5A 3CZFB 3AHFA 3L54A 4E0RB 2WAQA 2WD8A 2VUUA 5CURA 5CLFA 3SJUA 2D0PB 1Z26A 2KJQA 4LDAA 3O8LA 2XCUA 4JM4L 3UPRA 3ARGD 3I9V1 2VXVL 3AWFA 2AR9A 5IROC 2YAQA 3U19A 3KO8A 1ZIYA 3RAGA 2WQXA 1WW3A 1L9NA 2C59A 4ER0A 2G8NA 4KAAA 1AS8A 4KIUA 3F67A 4YBQC 4DBZA 5JS1A 3NIDE 5IVXA 5K0NA 4GE3A 3RFUA 5C07B 2O2ZA 2VJXA 4GLRI 1MV8A 4UTBL 4OO3A 3H7BB 1OOAA 2CZNA 4KZEL 1ADWA 3PYCA 3GP3A 3FT4B 2XWRA 4GFDA 3BD4A 1FV1A 3EJQA 1GO2A 1J5OH 4UTRA 3QDGA 5JYDA 2ZS7A 4F5YA 5T41A 1DEXA 2HFTA 1H15B 4LLVB 2VSMB 4MA3B 2R751 3TCLA 1QQAA 5F2KA 3AREA 3DHJA 4HN4B 1V5JA 2OXGA 4N0PA 3ZY3A 4WIQA 2F2HA 1BYUA 1CUFA 2AEIT 2VXOA 4REQB 1R6TA 1KRHA 5I9BA 2D3LA 3DC0A 4B0MB 3IRZA 4B75A 4EDXB 3H1BA 2GUWA 1H2WA 5I8OH 1SXQA 4I6JA 2WSLA 3W9UA 1MJ7H 4BJ3A 3ZBTA 1J8HD 1YC8A 2ZRCA 2W48A 3VVWA 5DYTA 2GUOB 4YAJA 1M0TA 4U3SA 1KB5L 3VFVA 1CTQA 3TB6A 3MQ4A 2WZ0A 4QXTA 3FOAA 3H9HB 4EY6A 4AJ9A 4J8QA 4LLMB 8MHTA 1MI5B 2VDPH 3KJ4B 2OCBA 4PTTB 2G1UA 2CJYA 1FZJA 3MOSA 3DX3A 3RVLA 4PS4L 4ARVA 1DXYA 2PW1A 1YNLH 5AL0A 4B95C 1DN2A 4GDMA 3DW3X 1JVKA 4IM8A 5E56A 2DVMA 3C1UA 4YRFA 2C7OA 3WGZA 1MFEL 3TUJC 4J0DA 4GSDL 4CU6A 4NBTA 2PWHA 1IM9B 4GKZB 4F7TB 4K3GA 3OSVA 4JEHA 5CIPA 3IJSA 1A9RA 4AMGA 4ZUWA 4GFTB 3AEQB 1DIRA 4OHUA 1AX9A 3EJSA 3ED5A 5FM4A 1F97A 4RLSA 3DDFA 1NQWA 1OWOA 2C57A 2HRPL 1KT2A 4NI5A 4IOJA 3ANSA 2E85A 2EJCA 2AV7B 3IXLA 3FSGA 3ZCSA 1JWLA 4D8UA 2E82A 3O74A 4DKAA 2B1RA 5IKMA 3WS6C 3TSZA 3VWKC 2ZGVA 1Q0RA 2BO0A 4ZTZB 4PX9A 2PFGA 4X6FA 4OCWL 3VOAA 4XPBL 1SYVB 3GMLB 1OJLA 4U2CA 2YEVB 5JCJA 4C06A 2EDJA 2E89A 5GSVB 2H07A 2I4MA 4NQXB 3F78A 2W6OA 2XC8A 1VA5A 3TXYA 2Q8BL 3PPEA 2F61A 2XWXA 4B32A 1XGUB 3H9SA 4ZQKA 4DZTA 1AGXA 1GCIA 2DIJA 2XCMC 5BO1L 3O1LA 3A3YB 5GGQH 2CFIA 1U99A 4PNPA 5CN1A 5JD4A 3CLKA 1K4MA 2XLCA 4Q3BA 4BMNA 3LCYA 1N64H 4M62H 7GPBA 4URZR 1NCJA 1SYSB 2GCNA 3HVRA 3DNPA 1ZONA 4B7IA 3TTXA 2G5BA 2DQZA 1T20B 4OY3A 1S2LA 1N5AA 3MFGB 4DN3L 5CNHA 3FVWA 2QUHA 3FOMA 2F1OA 3EYAA 3BBLA 1Q1BA 2WD7A 4M0FA 2DEUA 1P18A 1S2NA 5IVXE 2GXUA 5JCOA 4O2EA 4DUGA 3QX7A 3RUGE 3DOOA 4HOZA 4O4JA 4BFTA 3GGPA 1I7ZB 5TARA 1Z3IX 3UFBA 4PRKA 3KFXA 1P75A 3S55A 4QRRE 3NHYA 1CTMA 1KIUB 5I8KL 4W5OA 5C71A 1ETB1 2BHZA 2JATA 1XEWX 2BISA 5EIEA 4P59H 2SKDA 2FK8A 3LUCA 3LS4H 1EEHA 2DM7A 1XXHA 1O7JA 3IDUA 4M6NH 2QPEB 3AWIA 2ZJ3A 4NEGA 5HS6A 3RO7A 4E03A 4E5SA 5DMYA 1AD0A 1P1JA 5HG0A 2HF2A 3MBWB 4OJNA 2NO4A 3KLNA 4GQ9L 2IDTA 3CZNA 1P73A 2Q0HA 1LO0L 3M9WA 4RYLA 1RZ8A 3SC2A 3OHXC 3TYGH 5C0DA 4ODSL 1RM4A 1XWWA 2OENG 2VVTA 5LQNA 2QAGC 5K09A 1GKLA 1F6FB 3F7TA 3BAKA 4EY7A 1NVTA 4B7ZA 3O93A 1WVMA 3V7YA 4RM2A 3HHRB 3C9NA 5TE9A 5AKKA 1BS1A 2E27L 4TSCH 3NCMA 3FUKA 4TS4A 1RZGB 3MQFA 5EIBC 5FGSA 3L6DA 2E4WA 4FWBA 2B3DA 1G5TA 3IDZA 4KY2A 1GTZA 2XQKA 2AFVA 1MPXA 3X1BA 3WN5B 5D1ZC 3NIDF 1DC4A 4QYOA 3JASA 3FMGA 2ONKA 5HK9A 6FABL 1J99A 1GP2A 3MSPA 5T8IA 4EQ3A 3B7GA 3OR6A 3TO4B 3CFEB 4KRXA 4OV6B 1YVEI 3ARUA 2AV1B 3FDJA 3BRFA 4JHZA 5AKJA 3AG1B 4KN9S 3CUSA 1O95A 1IKFH 4ZAFA 2X8JA 4C47A 5F3BB 3QPCA 3WXVH 1NBZB 1VKXB 4DRZA 4DPCX 4TWJA 4RVNA 3FTUA 2Z2IA 4KHPB 4GEKA 4NBLA 4NMMA 3ZKND 1STOA 1CWUA 5CJPA 1M2JA 1NFAA 1AD2A 4FDAA 1YJDC 2WMOB 4DLBA 4DJFC 5KSOA 3HKZA 1DJSA 5F7DB 1MVFA 1C50A 4CM5A 1I8LC 1NLMA 4M53A 3WDIA 4PJ9B 2CEAA 3Q40A 1P61B 1S9YB 1I1AC 1M05B 1TQCC 4I50B 3R7SA 4AYFA 4D4MA 4LVOA 3UC2A 2I6FA 2FE4A 4IOSD 2C88A 1F2DA 4JUFA 2XTJE 4P5TC 3MRHB 5AOIA 1C7ZA 2MSPA 1JDSA 3EIQA 3DEHA 4QOJA 5J12B 2W9XA 4Z7OF 1DBPA 1N57A 4E41E 1TVHA 3C16C 4HPOH 4HKJB 2O8EB 2P80D 3GAZA 4M76B 4ZUVA 1D03A 1Q9WB 2E56A 2RKWA 2IDFA 3P97A 4YECA 4BO9A 4ASUD 2MINB 1T2CA 5TF4A 3TAUA 4PPFA 1C5BH 3CRNA 3BJLA 3CUEF 2MHAB 3GS0A 4QRPD 1ORWA 2DH6A 3HYLA 1QRNB 3QU4A 5AJTA 2I4LA 4Z3IA 4YHPB 1XIWB 3O6KH 3CX3A 3S8EA 1DQSA 1XF4B 3MQIA 4ZYLA 2V8MA 3RR2A 4Z86A 4UXIA 1E1LA 3QWNA 3ECCA 5HRUA 3OIFA 3L3GA 3NGBB 1Z0SA 1HE8A 5BQ3A 2GBLA 5KSAB 1EEYB 3BDIA 3UMFA 4JUDX 1J0IA 4LSTH 3RRNA 4KQCA 4MMXC 4KL8S 1ZRMA 2C1ZA 4NJMA 2OTCA 1RXLA 3SDCB 2EVJA 3K7EA 3CZ4A 1QIDA 1S7XA 2FPPB 4AUMA 3RJDA 2Q9AA 2LU3A 1TU4A 1V9LA 2RGWA 1I3MA 5HPMB 3QUQA 4H6XA 3WNQA 3PAZA 4RMSA 4F4JA 2ZCKL 5I5RA 3HS0A 4FA7B 1ITBB 1T10A 2IKSA 3RYHB 3T0XA 5CZVH 1WIPA 3D7PA 4M7JL 2W6NA 3KR9A 4A8JC 4KZEH 3EF3A 1X38A 5L40A 1K68A 2IV8A 2ZRKA 4MQEB 1Q12A 1GGNA 2CL7X 5D2NA 1Z15A 2F3TA 4X44A 3E4DA 2J7LA 1YEHL 2H1WA 5LXTF 4M9UA 2DMHA 4YASA 1QU3A 2V54A 4GXTA 2PX6A 1JF8A 3C1AA 2NDGA 2FD6L 1FSKB 3HPRA 2GAOA 1NBVL 4KZKA 4BH7A 1SVCP 1NTOA 4W9EC 1WDKA 3TNYA 4AYFB 4NLHA 1TEXA 2HGSA 5A05A 3ZW8A 3SY8A 2GKSA 1LDBA 4RGQA 3NH7H 4EHJA 4QZVA 2A9BA 5FFGA 2Y0PA 1WLHA 5KC9A 4YNYA 2NMVA 4L28A 1TT5B 5AVQA 4X5PA 2PL9A 4XEHA 2JHPA 5HD8C 4ZX5A 3V9EA 3PQ5A 5KU1A 1NDGB 1B26A 3A4NA 2B8OT 3OKNB 1GVIA 1DX4A 3ASVA 2VDPB 1HGXA 4TWZA 4QGFA 2WAHA 3B5EA 2V7NA 3MINA 1MAKA 3VX4A 2QDWA 1ZVYA 4Q02A 2NW3B 2OQ2A 3NGMA 3PGKA 4OLWL 1EFLA 3BZBA 1T0MB 2ROYA 2GC7C 1V4BA 5E6RA 1G87A 1HINH 2O5XL 2OPHA 3T3NA 3R4DA 2BCEA 2ICAA 3U4IA 3P77B 2YHIB 3INUL 1EDEA 3M3PA 1IQRA 1FJHA 5C4IA 1X13A 2YAFA 1L6IA 1TXGA 1IULA 5EUMA 3D6FA 1J11A 4UAOB 3GSNL 1RPTA 4FF9A 2WTUA 1XGRA 5B8CC 4H6PA 1HE8B 1T24A 4M9SA 4L78A 2F59A 4UBLA 1N6PA 2FPXA 3WL8A 2E4ZA 3TW6A 4MS8C 1S6NA 1FQOA 1UZ8A 3WKAA 5EE0A 2YQ4A 5K6TA 3KB1A 2FZ5A 5GZND 2P27A 3AW8A 4GT7A 3WUWA 2AG6A 3J81A 3MJFA 4TRNA 1T89A 3BZDA 4R90H 2LU4A 1TYDE 2Q9UA 3AILA 3WFJA 1KKUA 3MQ2A 1CY8A 4Q21A 1KB5B 4P6VF 3KM2A 4TSAH 3WSVA 2AXGB 1ZNYA 1GRQA 3ARZA 2GSGA 1BMTA 4S1SL 1U21A 3UPCA 1T1RA 1G7LA 4NRDA 4U1LB 3W78A 2YVAA 3DZBA 4U2DA 4E2XA 4Q52A 1OB1B 5K9OB 5F1KC 1OP5K 5IMBA 3C2QA 4DIOA 4CN4A 3ETEA 4QDTA 4GH5A 2FIKA 3VG9C 1S7CA 2CHZA 4X9HA 4U2GA 2WYIA 2R69L 4KY1H 2VT3A 2WV9A 5EF0A 1PVDA 4UHBA 3IN2A 3BT2H 3S2IA 3LQAH 2YBEA 3VCLB 3K73O 4QEKA 2YFKA 4DEPB 1CUXA 3I9NA 5CGBA 1U8OB 4PBVC 3BN3A 2PQMA 5EE1A 4LPUA 4RVBA 3E6AA 4HFJA 5C7ZA 5DRWA 3VXME 2AQSA 4DOMA 1AVAA 4H7DA 4CXMA 4I5DA 2VP3A 3D39A 3BGFC 4TV9A 1RJZB 3D3EA 1Q0QA 2YQ2A 1RFDL 2I3GA 2P9CA 1KY6A 3FUXA 1LWJA 2BGWA 2CO4A 5D7SH 1SPDA 1J1XL 1P0PA 1P44A 4DIUA 3WXMA 5LGKA 2PGIA 3HJGA 3N70A 3GSVA 4F60A 5HHNB 4L1TA 4OH2A 5LQBL 3DZKA 5A4MS 1DEEA 1GPWB 2F8MA 3DVFA 1TUEA 2PHZA 4NT6B 1W46A 4FS8A 4OHBA 4HKBA 2P2CA 3Q7SA 5LNK1 1ZJYA 4RA9B 5CXQA 1UKVY 5AUPB 4KWCA 1TMYA 3TIVA 4UEJA 2A5FA 4LLDB 5ALPA 3AXHA 2R6AA 1ECCA 2OJEA 2J87A 1R2QA 2BIIA 3QYAA 5G1OA 1V7MH 3BL5A 1FFPB 3IS0X 1USUA 3WLHA 1DC7A 1CE8B 2PKQO 3OGCB 1LO0H 4XYBA 3TCKA 4ZOQI 5MERA 1NQVA 4C58B 2YR3A 4FBLA 4JXZA 4CMCA 4DP1X 5EU5B 3FFCD 3ZY6A 1FVHA 1YU6A 1T0IA 4F3NA 2R00A 3UO1L 5D7BA 4D2NA 1KR5A 3N53A 1R0BA 3F12B 1PS8A 3AG3B 4CL7A 4CLHA 1NP3A 4HH9B 1K5WA 1J1XH 3G5LA 3VXQA 5FGBC 4M29A 2J8HA 1QFZA 1JHTA 5MI0B 4I2XE 1V43A 3O26A 1QE0A 1P4JA 2Q2QA 3O4OB 2PXHA 4IUCS 2ZRAA 3EGDA 1J1OL 2J12B 2WJIA 3LIPA 1USQA 2F5AL 4KQ4H 4CI9A 2VOTA 4PRNA 4WUVA 5KNBA 4PO9A 3HZ3A 3W5BA 3LQKA 4OGFA 2YMLA 3CRVA 1LPPA 2J25A 4WY5A 3H9JA 4EQ2A 2I7XA 4MGHA 3CMGA 5I6XC 1D2MA 4R4FL 3EVBA 1TUGA 4HRXA 4ZOLB 1UTDA 2OXEA 4FXOA 1G4HA 2D7DA 4UVEA 3RIAK 1QHNA 2Y1LA 1RT9A 4KPEC 3CINA 1QLEL 2R62A 1P2FA 1SBCA 3BE6A 1U5AA 3O8QB 4MWTA 4C0QC 2VZVA 4QRRB 4GPEA 1A27A 4RISL 2O5VA 4A1RA 4OU5A 2ZU6A 3S2EA 3T0FA 2L7JA 4RXMA 4DXAA 3RFXA 2QR5A 3IVRA 2PTTB 4HALA 1LJ8A 1KBVA 1M6YA 4CQMA 4NT6A 4FQXA 1I0ZA 2D9CA 1I6MA 3BGAA 4X54A 3MRQA 1PJAA 2AWOA 3DDNA 1LMKA 2G4LA 3CZUB 5K0FA 5BNZA 1DDHB 2FJFB 3G2LA 1KNOA 3SQOL 2C9XA 1N68A 4ZC8A 4AJKA 1TQVA 4P5MA 2KT6A 1E64A 1X7HA 1FL5A 5CVEA 1JWBB 5ISZE 3KD2A 4NJOA 3ZQKA 5CUQA 3SZKC 2HHJA 2H59A 2YK1L 3OX4A 4PZDA 3DA8A 2A8YA 4HADA 1C7RA 2VL4A 4EJ6A 3TMAA 4D4GA 5C8ZA 3MFYA 1DXOA 5IM4F 3SSOA 2Q76B 1C9JA 3HBAA 1K8RA 1MNUL 5CG1A 2F8TA 4P4UA 3STZA 2XKBA 2QE7A 3GZNB 5HHOB 5C0NC 1BXAA 2ZONA 2DICA 3DSFL 2LIVA 1TQBB 4EKXA 3IMUA 2YJ3A 4UBDD 5DHMC 1NUQA 3OKEA 4WN9B 3OKDB 4MA0A 4J4BA 1T5IA 1UENA 4XIJA 3ALWA 1QRTA 4EY3A 1SOAA 1PV1A 5GHWH 4PHCA 3UAGA 3WN5C 4YV1A 4PIVA 1A9OA 2JF1A 3RIHA 1OBCA 1XF2B 5D9SB 5I51A 1ZW6A 5DNCA 3ETTA 4G1MB 4C6TA 4HYTB 2ZUQC 4HDMA 1ZEAH 1VHTA 1N8NA 3UMMA 3BMOA 3KG5A 4PCVA 3MLUL 1IUPA 1AFVL 3KU1A 2XXMB 1GGJA 1KXQE 3D64A 3T9DA 5HTSA 4CNBA 1KENH 4KNYA 2X6TA 1PJCA 3G5YA 1C7SA 4R0LA 2VMFA 4UU9A 3S35H 3AR2A 3NHKA 2RG7A 5F23A 4LCIL 1I3RB 2K6YA 3EZNA 2YHSA 4N0MA 4P83A 2HC9A 2D1TA 4Z3FA 3V1KA 4XYMA 3FT2A 1Q0XH 2E8YA 2HF7A 2BH2A 1VFAA 3D59A 4F9LC 2GBIA 4RKRA 3X13B 4PJXB 5FOJA 5TS3A 3VRJA 3BMCA 4P5MB 1GTMA 2HK6A 1EAYA 3TWCH 1F00I 2FEMA 2I25N 1LWNA 4ZT2A 1P2TA 3RRMA 2HBZA 1M6VB 2IDCA 1RKUA 3HFGA 1JR6A 2F9BT 1AY1H 2DQFA 2KC0A 1CUJA 1OPGL 2W60B 1T91A 2QR2A 3SK0A 1Z74A 2VXUH 1QJ4A 2DQIH 1B6DA 5HFAA 3OQPA 5HYSA 5ISZB 4TXMA 2AN9A 2IFTA 5TXGA 5EXTA 5KANI 1Z6GA 1D7BA 5GZ1A 5EBMB 3AVPA 1DVFD 3V46A 3BULA 1JK8A 5EJIA 2VA9A 3E53A 3TJHC 1S5IH 2WM0A 1T5DX 2DHEA 2DIBA 3PV0A 4FXKB 4HWKA 3V0VA 3P26A 4B4OA 2F5BL 3D50A 1P45A 1FZMA 1EFXA 1M7UA 1C9EA 2GZSA 5AUMA 4X5LA 1KERA 4ZMZA 5FRDA 4HOMA 4IHOA 2B37A 1P2CA 3QW9A 3ZEAA 1IGCL 4HYTA 3QUKA 2GFBB 3IAAA 2OI9C 1JKFA 4N8SA 1P9MA 3NNNA 1NDHA 2XXBA 1WD8A 1YLBB 4LMRA 3W0WE 1I1HA 2NXYD 4GEGA 4WVLA 2BEUB 4P04A 3HVDA 3VGGA 3LNGA 1N6QH 2HFKA 3GG2A 2NY6B 4QYAA 2F67A 4MWSA 4FFMA 4G67A 3W39B 1YR7A 2P68A 2CE6A 1GPBA 1KY4A 1E9DA 2Z31C 3DV4B 1NGQH 5C1OA 4ETNA 5AAPA 3G0IA 5T6BA 3LFUA 2ZKXA 1BHGA 3DETD 3WMQA 1E3WB 4IKPA 1MKFA 4ZMPA 2PUEA 1EFVA 4Z7WE 5JAQA 4FFVC 4CKWA 2ZZKA 2NSHA 4BCBA 3RH0A 3WWZA 2NO7A 2VYVD 6ADHA 2A7QA 4KGDA 3C24A 4P9ML 1FVCB 5EFOA 2P90A 4MJ6B 5AKLA 2ZYVX 4XFDA 4AF8A 4KGJA 1ESMA 4EG6A 3SQBA 3G2NA 3MRDA 4KK4A 1AZBA 4TL4A 5E0FA 3FMVA 2Y1AA 1G4RA 1I1FB 3HFSA 3FHAA 5H59A 2CVPA 2EUZA 4PSVA 5EXSA 1X5ZA 1N6UA 1I6LA 4LLMA 1P7BA 5IR1A 4YXKH 4X20B 4PV7A 3PP8A 2Q1EA 4MIYA 1ZGHA 3RYHA 1C9MA 5L9DL 1RURH 3JZDA 2GHIA 3ZTCC 3B3GA 1V8HA 1EJBA 2WIBA 1XN4A 2W6ZA 3AB0C 1XP8A 4RHCA 2P6OA 5HGBB 1UQSB 2Z3ZA 1LSSA 2X9QA 2ICCA 4L4VB 4RSMA 3UCRA 3U13A 1TVKB 1KGUA 4IJ6A 2J1LA 4X5XB 5HDRA 5AVVA 4AE0A 4C6HA 3KXFE 1RIUH 3BRSA 3CN4A 4FHGA 2E6UX 4YACA 4FKZA 5AVRB 1IGIH 5MEQA 4GUPA 3P9YA 1YNSA 1J05B 3JQ8A 2BM3A 3B5TA 1PHPA 1MFDL 1RUPH 1AS6A 5D7KE 3MOGA 1HDOA 3KJGA 2WSYB 4WEBH 4TTGA 3GJ3A 3S48A 4ZPJA 1CE6B 1J0YA 4JJ5B 1WZAA 3PCRB 1H3FA 1XLTA 3HN2A 1VDMA 4CM6A 5AJWA 3VJKA 4CU7A 1D7OA 3HDJA 3ILQC 3GEIA 2GILA 4DSZA 3QF4A 1W5FA 4YEDA 5AKSA 4R3NA 3BWCA 1P84K 5AL8A 1DCLA 2BIPA 5JROA 5KNCD 3HYSA 4LDZA 3ZJ4A 3M1CA 4FE4A 1MKYA 2B8JA 4UFPA 2WLIB 3SDDD 4GP9A 4R4FH 2JAPA 3D07A 2VJMB 2GTWA 2HPZA 4DYVA 2BSRA 4JJKA 4OZIE 3W0WA 4ODHL 2OBMA 3ISJA 4B1FA 1NWPA 1SYSA 3E7XA 3E05A 3IOYA 4JFHD 5TJWK 5BZDA 4I1PA 2GSMB 2VNIA 2ZYWX 5DUBA 4GKSA 4PH8A 3SMVA 1DLJA 1N5AB 2QRUA 4LQCA 1A04A 2Q5QA 1NYLA 4OJKA 3RVJA 3WJLC 3EK2A 3LS4L 1LMIA 2YBRB 4XOEA 2G2PA 5F5NA 3L1OH 3G13A 5HX7A 2WP0A 1TO4A 3OKFA 4OEHA 3MJ7A 3UXMA 5NLLA 3KLAA 1PX3A 5AAWC 1P6XA 1PIGA 3GBLA 1YF3A 1D5BA 3BH7A 5HKOA 4EGQA 5TJHA 5B36A 2X9WA 4L0MA 1J5DA 1GY2A 4PS3A 3QOFA 5HWSA 3KJFA 1CY7A 3F8TA 1L7PA 1TZIB 4DZ8B 2LBPA 4KUHA 3APDA 5KMGB 4R2MA 1R17A 4WKOA 4Z7UB 4P4KB 3OE5A 4GY4A 4K26A 4OHMA 4R4JA 4LC0A 3HRPA 3CM0A 1HOTA 3SGJC 3ET5A 4MA5A 4KITB 3Q8EA 1IY2A 4Z0XB 1EAMA 5A9TA 3AXIA 5A4KA 3QORC 3TW8A 5J59A 4PRHD 5I17A 1G5FA 1CDGA 5L3ZA 2P1YA 1K4CB 4XCFH 1LI5A 4PJFA 2O7NA 1GPKA 4O2RA 3BXZA 3QEAZ 4JO2L 3VZBA 2DETA 3QUXC 4PJAA 2IHVA 3T5MA 4MIKA 5JXIA 2D31A 1Z07A 1V1MB 2OXFA 5A7BA 1NW7A 1JDDA 3H8JA 1UKCA 2QRPA 1NLDH 3AL3A 1U36A 1XBDA 2D59A 4R7NA 4K3JH 1OYVA 4YO7A 1UKAA 2ZOLA 1XTQA 3F7PC 2PWDA 2B8TA 3FHEA 4FINA 3LYLA 3HFJA 3PPIA 3WUWB 1DEEB 3UERA 3IGFA 2DUNA 5MI0C 3PHHA 2C3VB 1BBDH 5BUAA 1FTQA 3VRIB 3DOSA 1RPJA 3STXA 3FYIB 3S3SA 3F3MA 3OT1A 5GGTA 3AL9A 4EECA 4QO1B 5I7VA 4RH1A 5EOTB 4F7MA 2HRQA 1WFTA 4BO4A 4GGOA 2YD9A 1N78A 4Q1FA 4J3OC 4DP8X 4AVHA 2PA3A 2D00A 4WY8A 2KSQA 2WIMA 3C60D 5DYOA 4NFDA 1GILA 5A0VA 4X94A 3CURA 2CFRA 2GA8A 5JO5A 3JALB 5G5DA 1K9VF 1EK6A 2DQHH 2V65A 4E5KA 1VSVA 1MELA 1OZTG 2YBGA 4Q4AB 4FXGA 2EP5A 2AK1H 3DEJA 4Y2DC 4OMFG 1ZY9A 3BVVA 4HEPA 4BZQA 3U0TB 5IGXH 4N6RA 1D5BB 4IDFA 3RSGA 1KOJA 5LA6B 5I8OL 3QORA 1JN6B 5TFSL 1S7SB 2WXKA 2D8MA 4HH9A 3F6IA 4Y19A 2UKDA 2OLDA 2BINA 4DKTA 3S3JA 4HUKB 4NDNE 5A2CA 4PRPB 3SG0A 3RI5F 2JKLA 1KYDA 4P7BA 3CFKB 4U1KA 3R3XA 2D7TH 3EADA 4ZT7A 1GS7A 4V0MA 1Z6PA 1KPIA 4BLQA 2C7FA 2PX3A 4M8VA 1J5OL 3MN8A 1Z0DA 1JKMA 3O2NA 1UKBA 3DVRX 2W6PA 4YRGA 4HGKC 5MEPB 3H1GA 3MBXH 1L0BA 4MUKA 2WABA 4QT5A 4LOUC 4ZCLA 5BN4B 2AZUA 3MLEA 3N7UA 1KYUA 3WP1B 4ZJ9A 2BUCA 2EXYC 3R40A 2FEEL 1U91A 5KDLA 1LJUA 3HZYB 1KPUA 3S8WA 1FSZA 5BW4A 3IF1A 4D42A 3BJIC 4EZJA 1KQGA 1TU2A 1CFNB 3BIWA 2ZREA 2VKQA 3W5AA 2OJEB 4ZTPL 3D3KA 2EKQA 4BUQA 2O3JA 5FF6A 1SCBA 1SRRA 5CEEA 1V71A 4Q1AA 2PW2A 1BP3B 1G19A 2PSHA 3KXDA 4PV9A 4H3KB 3LRHA 5LYJA 1FDLH 3RX8A 4I3HA 1GZHC 3AMLA 4CT5A 1ACMA 1OP3K 2H1CA 1EYZA 1UACL 1LP9E 1CLEA 2ODBA 5ITBH 3TW0A 2QKIC 3AS2A 5DQDL 3D2TA 4NZUL 3FOFC 2AF3C 5SWSA 5J56B 4BZ2L 2V6HA 3X1ZA 2ZUFA 2DB3A 5A6SB 1G20A 4QYIB 4TXLA 3O92A 3GGWA 3M1BA 2Q9CA 1TO6A 5F9MA 2QMJA 3Q0IA 5LCXA 3LMJH 4NHCL 5IB5B 2PCYA 2PGLA 1H3WM 5F3HB 2YAPA 4AMKH 4H7HA 2PT5A 5HHME 4QKXB 3JALA 2AXWA 3GC6A 4E5YA 2X13A 5IWLA 5TF1H 2O8DB 4ZUSA 3BEDA 1P81A 4BGEA 4JM2D 1PJZA 4P2BA 2PR7A 1KGXA 1YQWA 3JTSA 5IY5B 4U1RA 1X2EA 4NRZA 2YXNA 1I3GH 2BVPA 1V5FA 3IMRA 4NNJA 5AFAA 4OGWA 1QBLL 3H3PH 4O02A 5C0AD 3D8HA 1NVWQ 2BOBA 4JYPA 3F7YA 1G5HA 2VAXA 3DFIA 5FUYA 3COYA 5B38B 3KJ4C 1BX2A 3N6VA 4K03A 3QYJA 1G7JB 2QYOA 1LC0A 5C0CD 3P9MA 4H88L 1YZUA 3RIEA 3ZDRA 5IKCA 1AMYA 5G3YA 4KVGA 3VQTA 5BSVA 3ADOA 3ZWNA 3AVUA 3NTRA 4QRSB 2DCUA 3DGCR 2ZG2A 4TL8A 4LF7B 4RISH 1E5QA 5KS9F 1S9VB 2VYQA 2PSDA 2CG9X 2PH5A 3B5GA 5DFAA 1J0BA 1HDIA 1Y80A 1MTZA 1M76A 1TU2B 1ID1A 4M6AA 1NCDL 3RWJA 1JXAA 2P3YA 3DMMB 4F56A 4L5JA 4Y4KB 1B76A 3MCWA 1TVCA 4Z7JA 3I4LA 1DDOA 1ONQB 2YQBA 4XCEA 2VRBA 1SXPA 5BYKA 1TW3A 5K7SA 1HE2A 4J7AA 3MAAC 3OZFA 1E79D 8PAZA 3HUJA 4IEEA 3UENA 4Z4HA 3SZ3A 1Z0IA 4ZOEA 4Y4FA 3MYRA 1VIWA 4UTCA 3ZL1A 1DL5A 3P0HA 3LCCA 3PJGA 3H0TA 4Y1GA 3S7TA 2FPOA 1KFAL 1U3VA 2AGJL 1ZHNB 5F6HJ 2VR9A 2ZR7A 3DYVA 4J4PC 4GC5A 4S1VA 3H87A 4R8WH 2BGNA 1VPEA 1A7NL 2HJ9A 3V33A 4GYBA 3CVYA 2CM5A 4JFRA 1BFOA 3MPOA 1Q1EA 4ND2A 4JI1B 1JFFA 3CLVA 5KANG 1GSIA 1H0RA 3BXNB 1NMXA 3GAAA 4XFKA 2G17A 4F5WA 4QRQB 1B8PA 1YKSA 1LVGA 4FJZA 4L8DA 4FGJA 2DMKA 3VNYA 4BVHA 4DAEA 1OALA 2XN9D 1EHIA 3NJ4A 1I7UB 3GELA 2GK2A 3RQSA 2PF6A 3EO9H 1RXUA 1Q14A 3DYBA 3HDTA 5CIPB 4M8QB 3NYIA 1B6UA 4MLZA 3SHWA 4ZMAT 4XWTA 5JAMA 3CJJA 1DIHA 2K6WA 3U7AA 3BAYA 1Q94A 1VF5C 4JDEA 3TO2B 1G94A 1QFUL 1UM5L 2C4FT 1ENYA 4NQSB 2OWDA 3P4NB 5HHNA 3TQIA 5BT9A 1EGVB 1JLLB 5A6MA 1M75A 1U42A 3W5DA 3PP3K 4ZXPA 3L1OL 1WTCA 2BLLA 4M6MH 5DNWA 1O7DC 5DBGA 2H3KA 2DQEL 4BZXA 3T3EA 4QGAA 6NULA 3KYMB 5DT9A 2O7QA 1QKZH 4Z3EA 1FLNA 2O0LA 4LGYA 3OO0A 3VHXA 1A50B 1GRWA 1QFMA 4TXHA 4FI7A 2ZUEA 4HDNA 1CIJA 1F2VA 4LN1A 1C1XB 2IH5A 1TZHA 3LBFA 1YL5A 2XPGB 5CJXA 1MHHA 1NINA 4YI3A 4KBYA 1G3MA 1Y7PA 2BI8A 5HEKA 1IKNA 2C3GA 3TU6A 1UAYA 2M1XA 2NVWA 4I18B 2O2YA 4L22A 2RQEA 1P7HL 2JCCB 2OBFA 4M4RA 2B4CL 3QZOA 2PD4A 4JFAA 1RUQH 3KLHC 4HQLA 4PGBB 1UM6L 1ZIPA 1WZCA 3RS4A 5BO5A 3BW9B 4U31A 4Y0GA 3NDYE 1ZJ4A 2PT9A 4DJTA 4ONHA 2LRHA 2Y4OA 3RSLA 1KNQA 3EXHB 3QEQD 3ITNA 3UTZA 4G7YH 4Y2NA 4CUZA 1RQ2A 3C2AH 4OYRA 2R0LH 1GYVA 4F9LA 3U7HB 4P23C 5AH0A 1HHGA 5IDYA 4ZD3H 3H4VA 2HRRA 3Q01A 1XHFA 5DCWA 2H2PC 2IV3A 5B7FA 3F58L 4G6AD 3SGDH 3HKEB 5IK2D 2NSQA 2XCIA 2A77H 4F7PA 5BV1A 4F58L 4ZI7A 1E79A 3WKBA 3LY9A 4PWGA 4WEQA 1XMEB 3AREC 4PLNC 3C5ZB 5THQA 1XZCA 1J1ZA 2RAFA 3O0DA 2DQTL 4HIHA 4PRYA 1TLMA 1LLAA 4JEGB 1KSJA 5CXXA 3GINA 3DIVA 1VPOL 1J00A 4H0CA 5CP7A 4N8VA 1OXVA 2UUCB 2GPSA 1RHUA 4NCNA 3WLRA 4EB6A 1YZQA 2E76C 1G21E 1JGVH 3VWJB 5ITZA 3GHEL 2VTFA 3FZYA 1NXPA 1Y0LB 1QVZA 3L49A 1RZRD 3H9SB 1N5DA 3KG2A 1QTRA 4ATNA 4B5ZA 2PYDA 3T4AA 3X1WA 2AXHA 5CDYA 1H2ZA 4DGIH 1MVYA 4P82A 3TDNA 1GNVA 4DDMA 4WNQA 1CNMA 2XMDA 1FPMA 2QUAA 3QI9A 4NO2A 5BRPA 2RE8A 2BGKA 2ZZUT 5JCOC 3JY6A 2I5YH 4DO5A 3GVPA 2K7PA 2N0MA 4FLOA 3UZEA 2H9AA 4OLYH 1N1DA 4HATA 4TUYF 3OT5A 1V1JA 3HCAA 5EGSA 2XT9A 4YHMH 1B3BA 5C3IA 3GSUA 4NSKA 3ZTDC 5FYJH 1E8WA 2PG3A 1PLGL 1KN2H 3PFFA 2UU9B 2LW3A 1XAJA 1QWHA 2NADA 3B1ZA 1FQWA 2PTHA 4UQ3B 3WYEA 1G0NA 1DJMA 4MKIA 1L8OA 3A1DA 3BH9A 2CA4A 3IAPA 3EYSH 5E51A 4IDNA 4MJ2A 2X9GA 3GXDA 1ADQL 5DO2D 1FN4A 2PNDA 4ZK6A 3NP9A 1CDDA 4Y2JA 4A55A 3KR0A 3VKVA 4YREA 2Y05A 5ICZA 1NMCC 1JAYA 5F5LA 3SC2B 1PWZA 1DMSA 2CXOA 3OURA 1CICA 2H8KA 2AOVA 5AIBA 1F6DA 4LHQB 4Z7WF 4I0CC 2L3BA 3MN1A 1HYHA 1K8YB 4M61B 3QUYA 3QBTA 1GT6A 3VU0A 4CKBB 1Z4KA 1KTVA 4LC9A 3TE6A 3F5SA 4L3EE 3RLIA 3EZJB 3K5HA 1TVBB 3HEMA 3QWHA 1O97D 4O58L 3OKPA 3RTDA 4HXBL 4BDTA 4GSDH 1G8FA 1O3YA 3C5ZA 1W0KD 3WE6A 3SOBH 1K92A 2YSTA 3L9RB 4FDLA 1KGCE 3ESVF 3ZDZE 3PHCA 1WHPA 3L4UA 4FVTA 3HAEB 2R9HC 4DLSA 2OHOA 3ER9A 4ZUUA 1XMSA 3NYQA 1I3RA 4CYMA 4GMTH 1CUHA 4Z3KA 3UUWA 1TQ4A 5A4IS 3G8DA 5EKUA 2BHRA 1ZN2A 4HH1A 4NG5A 1A1NA 3E2MA 4ZDWA 5T3ZH 4I08A 1QDEA 3I37X 3WV4A 3O9WA 1AP2A 2XV3A 1NGWA 3BWEA 5HHVL 4BU0A 3IKMB 2X4DA 1N6IA 3OMLA 4Q4DA 1SEQH 3L0IB 1S7UA 1DQVA 3M6IA 1Z9MA 4UAUA 1AQMA 1LVEA 1JW9B 2I29A 3VMNA 4AS1A 4EG7A 1IKOP 1Z5PA 1UM9A 1MOSA 4JPVL 3L07A 2G9KA 3KAPA 1XCGB 2UXGA 2WG1A 3P9XA 1T3FA 3KKZA 1YA4A 1QSZA 3A25A 3E81A 2FR1A 1DQNA 3D3VE 5M94B 5MN5A 1Y8RB 4GI8A 1VDZA 1SHUX 4QTXA 5A4JA 4IDEA 4OGAD 4PJHA 4C7OA 2QX8A 1RWXA 5GM1A 1Q19A 3GW8A 3R3WA 4ACTA 1V4VA 3H8WA 2NZYA 4X61A 2HX7A 5DHRA 2P65A 4MS4B 5AW3A 1S7WA 1SZJG 3U9WA 1ESCA 4WTXA 3IAFA 1AQNA 4LHWA 2ZBGA 4LRWA 1X44A 4UM7A 3RRBA 2OZEA 4L73A 3V6LA 2EV9A 3SDSA 3SQWA 3TUIC 3A1FA 3WVNA 4MKFA 3G3EA 2EQ5A 2OAQ1 1T03H 4AVKA 5FO8B 4RD3A 4YFYA 2VEOA 1A8PA 1F0KA 1LO5B 2R5FA 2VZOA 5EVCA 4N6RB 4KHZA 4HC1A 1H1LB 5AAWA 1HHHA 8GPBA 2FJUB 5CM1A 2NAPA 2CJWA 3B6ZA 5JI3E 4G84A