5E6SB

Structures of leukocyte integrin alb2: the ai domain, the headpiece, and the pocket for the internal ligand
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
459
structure length
455
Chain Sequence
b'QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRKVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-L
publication title Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 127
structure length 455
sequence length 459
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5e6sB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5e6sB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5e6sB03
2IUEA 4HQNA 3EGXA 3HXOA 2ICAA 3VI4B 1YUKA 4O3TB 3NIDB 4MMYA 1FNSA 2NVOA 5KYNA 2WINI 3PPYA 3F74A 1M1XB 2XWBF 1SHYB 1LFAA 1QC5A 1T0PA 1U8CA 1XDDA 5LN1A 2I6QA 3FCUB 1L5GA 1PT6A 3ZE1B 5HGJA 4GZ8A 3PPVA 1AOXA 2XWJI 4C2AA 4MMYB 3GXBA 3EH2A 4WK0B 4WK4B 1CQPA 3ZDZB 2VDMB 1U0NA 3ZDXB 1MQ9A 1QC5B 3ZDYB 2VDNB 1U8CB 1V7PC 1CK4A 3HI6A 4CN8A 1M1UA 3E2MA 4CN9A 4HQFA 3AL9A 2ODPA 2VDQB 1AO3A 4O02A 3PPWA 1N9ZA 1PCXA 3IBSA 5HDBB 4C29A 4UM9B 1RS0A 1BHQ1 4BJ3A 1TYEB 4Z7QB 1U0OC 3T3MB 1SSLA 3NIFB 4MMZB 5HJ2A 3TCXB 3TXAA 3V4VB 5ES4B 1OAKA 1XUOA 1N3YA 4HQKA 1FE8A 4O02B 4JX0A 4G1EA 1ATZA 1M2VA 4M76B 1RD4A 2ADFA 3VI3B 2I6SA 1YVRA 3EG9B 5E6RA 3TVYA 4PN7A 2P26A 2B2XA 1UEXC 2UZYB 2ODQA 1BHO1 1PD1A 1MQ8B 3K72B 4MMZA 4G1EB 1IJKA 4JDUA 1M2VB 4XW2A 3OKWA 1IDN1 3BN3A 5E6RB 3IJEA 4FWWA 4NEHB 3EOBI 1JEYA 1MF7A 2P28A 2NUTB 4O3UB 3BQNB 4WFQA 5E6SA 3HXQA 2QTVA 2VDPB 1SHUX 3N2NA 1XDGA 2XGGA 3EG9A 3QA3E 3EFOA 4C2BA 5KYXB 3OKYB 3ZE0B 3PPXA 3K71B 1JEYB 3IJEB 1SQ0A 1NA5A 3RAGA 4F1KA 1M10A 3K72A 2NUPA 2O7NA 1T6BY 3NIGB 5E6SB 3OL2A 1MHPA 2M32A 3EGDB 5E6UA 3T3PB 3FCSA 4UM9D 3EFOB 4F1JA 2X5NA 4NENB 2NUTA 1ZOOA 4Z7NB 4K3JB 1RTKA 2I91A 4A0QA 4DMUB 1M2OA 2NUPB 5KYYB 1JV2B 3OL2B 5KYXA 2VDKB 1YVPA 3K71A 5E6UB 1RRKA 3FCSB 1QCYA 4IXDA 3TW0A 3M6FA 4WJKB 1JEQA 3EH1A 3NVQA 3K6SA 3F78A 4UM8B 1Q0PA 3EGDA 4HQLA 4HQOA 3ZQKA 3ZE2B 1MQAA 3AL8A 4MMXB 2VDRB 4NENA 1AUQA 3AFCA 1MJNA 3EGXB 3Q3GE 4IHKA 4CNBA 5KYWA 1DGQA 5KYUA 4G1MA 2VDOB 4Z7OB 5KYYA 2WW8A 1JEQB 1JV2A 3K6SB 1OLZA 4FX5A 1IDOA 1L5GB 1DZIA 3AL8B 1SHTX 5KYWB 3BQMB 1M1XA 3V4PB 1IJBA 1ZOPA 5BV8A 2VC2B 4WK2B 5KYUB 4G1MB 1JLMA 3EOAI 1PD0A 4IGIA 1ZONA 4MMXA 2VDLB
chains in the Genus database with same CATH superfamily
2A6IA 3UT6A 4BUCA 2WXQA 2HK9A 2X4TA 4BX0A 1N0XL 3CLHA 3ZDEA 1I8MB 5JPDA 5SWZA 4EOWL 4UDUA 3IR5A 1RZJL 1YDGA 3PG5A 1J21A 1JI3A 4P23D 5I4BA 5EPMA 1H2WA 3P2OA 2XKKA 1I7TB 3OAUL 4LFHD 2EG5A 2VJYA 1Z38A 1FYTA 5GXBB 4XOBA 5F5NA 1OHZA 1YEKH 1XTVA 2GCOA 5FO8A 4B53A 3VG0L 2GEUA 1G7LA 1XIVA 2RQEA 1MI5A 2YX1A 2ALWA 2ABWA 4S10A 4FULA 2OOKA 3SGEI 1VBKA 3D0LA 5DZJA 1NGXA 1CF8L 3LKOA 2Z65C 4GUAA 5JIIA 1VIAA 1HRKA 4UOZA 1A3LL 4TTDD 2FWBA 3NQ41 1E9BA 2BGNA 2AV7B 5LQBL 3FD8A 1K06A 1SY7A 2KPWA 3PDOA 5CT6A 3LPMA 3RU8L 1SWWA 2UV8A 4UQIM 3MBWA 1BOFA 5AB1A 4HLDA 4OMUA 2BL4A 4MS3B 3B36A 1OI4A 5L8JB 5C0RL 1PZEA 1OBHA 1WF3A 2IEIA 3R6GA 4XIFA 2FECI 2QV0A 5EU6B 3RRJA 2WKOF 3QBVA 4A39A 3TJHD 4DQUA 3JTBA 3K81A 1N5AA 1HLDA 1H3GA 1U9KA 4KI5C 1OVGA 3U0VA 3BHBA 3PIQB 5LNGA 2BUAA 1SYVB 4ZK8A 3VO2A 3ESOA 3U3ZA 3NW9A 2HG0A 4PAQA 3UHFA 3E1KA 5LJYH 3HXKA 4D9IA 4GXQA 1Z2DA 5K9KB 4PJFA 4JFSA 4JLRB 5DVNA 2K4AA 3P9MA 5SWSB 1DDTA 2C2ZA 3ILYA 3BGMA 3HJCA 1TYEB 2YJ4A 1QLFA 1NQ5A 5EZQA 2BZ7A 1VYUA 3MCKA 3GI8L 3NCEB 2AQ2A 2AW2A 2D7MA 5A5EA 3DYMA 4U5QA 3ZHVA 4MCZB 3V7NA 4ZI8A 1F0YA 3DF7A 1OLSB 2YPLA 5DB4A 2GPSA 3WRVA 1E1DA 1XVSA 3VUEA 3DOOA 2X89A 1R6DA 3V0FA 5AVQA 2YIJA 3N1MC 5F7JA 4QQFA 1HS6A 3UYOD 3CFKA 1JF1A 4QOKA 1YNOA 2N1BA 1NY6A 2GVYA 3E6FB 5I1HL 2PZBA 1QTNA 4CG2A 4FFZH 1OX6A 4DPKA 5B58T 1RZKC 1P7YA 3PDWA 4RBPK 2IUYA 4CKBB 2L0DA 4F71A 4YEDA 4NN5C 4DPAX 3OSUA 2MNWA 2NO0A 4TTTS 5ERWA 4BZYA 4E9WA 2XB6A 3B53X 1JR2A 4NKDB 3ITDA 4DHEA 4MD4B 2B94A 3KS0H 3GJQA 3QJQB 3TBSA 4U3HA 6TAAA 1OFVA 4D9QD 1XA4A 4UTRA 3EYUL 5FUOL 3TTWA 4N8DA 4GDFA 4CGUB 3I5AA 1A7UA 5A05A 2E4VA 2FPKA 1F8UA 1CXIA 4FXLA 1YE8A 3WO3B 3ZY7A 4EB6B 3UDWC 5FGCE 2ZYHA 4ELMA 4MS6A 2Z5GA 1RKUA 3G9QA 3JYNA 1BD2E 3UIEA 4LB8A 3AKCA 4EM6A 4BB9A 5I8OL 5J12C 2YHIA 1KBBA 1T21A 3KPRE 5AXDA 5E4EC 2BFBB 5IQ7H 4HVAA 3E8SA 5EIOA 1OPGH 3D6GA 1IT9L 3RCBA 3CFMA 4GOXA 3DV6A 1KP2A 1GJUA 2KMLA 2MPVA 4PO8A 5KOHA 4O2FA 5DRZB 4OATA 2Q6LA 5FYKL 3VH8A 4B3IA 1KJ2L 1XQYA 2P47B 1M7GA 3E03A 3PI6A 1Y6RA 4P3YA 1R0BA 4X1YA 3D7NA 1IY2A 1JEYB 4RNCA 1AGBA 1PG0A 2FFQA 4KKPA 4LIQL 4AY2A 2HWWA 4FTVD 3U79A 2EDXA 2A1WL 3MLWH 1DG9A 1NMBL 1H23A 1US8B 4MWCA 5FRDA 3TPCA 2GABA 5DGCA 5F6HJ 1GYQA 3GSUB 4JASB 3RVTC 1I8AA 1EMTH 1H0SA 4AQAB 1EXWA 4XRRA 1BWQA 1NCCH 1CF1A 1X5KA 4WCVA 4M8QA 3QELA 4FERA 4F56A 2OZ4A 1N77A 3R44A 4XMKH 2LU5A 1CC3A 5K4GA 4J9UE 2IXFA 1U2GA 4BK5A 4OHBA 4K3EH 3V46A 2FCRA 3B56A 3O6LL 4OQTL 1V7PC 2NSQA 4TRRA 2APWA 4MI3A 2P4UA 2OD9A 1ZJJA 5IBRA 1FTYA 4O4LF 4OQ4A 4KOEC 3D4YA 2JFGA 4QRPE 1E4JA 3IFSA 4QU0A 4RVUA 5EOTA 1BV8A 3KFVA 4L15A 3ZWOA 3H17A 4Y2YA 3N28A 3E3AA 4JO2L 1NVWQ 3V7AE 2PR4H 2Z64C 3AM8C 2JFYA 4HDKB 2E87A 4J7CA 3VR6A 2D5LA 4Y19D 4W6ZA 3DURB 3AEYA 2O05A 5B53A 4BZWA 5C5EA 5AZUA 3K5PA 1DEEB 1JGDB 1YRYE 3RTQA 3QPAA 3CYFA 5A4KA 1FLRL 1NA8A 1XSJA 5ALSA 3VU2A 3NHYA 3RYHA 1IC0A 4MUJA 4FNGA 5DK0A 1SXJC 2HIGA 3NYQA 3WSWA 3UAGA 3QW4B 4I5IA 1OZFA 2LGJA 2LVBA 3KC2A 1Z7YA 4Z8FH 3ESCA 4HC1A 2R51A 3VE0A 1GEEA 1UMBB 1K5NB 3VVVA 5KSVB 1G1OA 4YTEA 1PTJA 3C6LB 1KMCA 2P6RA 3TI9A 5AW2A 5LGJA 5EE3A 3TTSA 1PSWA 5AENA 1XZ0A 4KE7A 4PG9A 4XC3H 4WV1A 1QR6A 3I28A 3EYOA 3CDGB 2VNCA 1IWPB 3SO3B 2LDBA 5I7VA 3TO4B 4BCBA 3D4CA 1U2ZA 1U30A 4JBGA 2AEMA 5ALYA 4RHFA 3V33A 5HDQH 1TF4A 1ZS9A 1Q91A 2QD3A 1WSBA 2HXAA 1HSOA 5FHAH 1ZLVH 3JWNG 1NMXA 3T5BA 5JHDD 3U7IA 4OO3A 4DMRA 4N7MA 4OVKA 2APVA 3UPCA 4Z8XA 3R06B 4MMZB 1OXTA 2N7SA 2G9HB 3H6AA 25C8H 2C42A 3DX3A 1AMUA 1KTRL 4JHUA 4V2UA 5BOSA 4KVCL 2FSSA 4N0FA 5EBLA 3TVDA 1K2WA 3O9WB 2XLBA 4ZQGA 1JBKA 1G8GA 3WWZA 3SJVB 4X99B 3MODH 1OANA 2DIJA 4PRIB 1Q7TA 2KPNA 1RHHA 5EBWB 1ORDA 2FDRA 1RK1B 4P2RB 1OAOC 4EHJA 3H19A 1NKVA 5HYSB 1Y18B 1T7ZA 1X8LA 1UD6A 5AQEA 5AKHA 3N50A 5ICUA 2H6PA 1A4XA 3AEXA 1TQBB 3ULUL 2DWPA 4KRGA 3CQPA 4F2GA 3H5NA 1PZBA 3O3DB 4G6KH 4M8IA 2JANA 3NUGA 3FMFA 4YDVA 5C9JA 4FFLA 1WPQA 3I04M 3E2HB 3I6GA 5IT9A 3S2CA 8ADHA 4EG4A 3WTYA 2E5LB 1DLFL 2Q1YA 2OBLA 3LBFA 5TJWK 4GUQA 2YJZA 5CXPA 1HL9A 4FFYH 1RJLA 4MAYC 3OR7A 3TBWB 3KR0A 4Q5IA 1VIWA 1PQPA 2JS7A 3LQRA 1KRXA 3UJIH 1PQYA 4RD2A 2XSKA 5F1OA 1T1GA 3TFOA 5I01A 1B0UA 5KMGB 4CMAA 2VPZA 3PL6B 2WGNB 4XDGA 3ME0B 3WTBA 1EJ0A 1MAHA 5CJ2A 1J4AA 2F1RA 1U9IC 5JSHA 2XBDA 4TS1A 2D0PB 3G9AB 5WRFA 4DCUA 5AOKA 2P62A 4E09A 2LOEA 3G8AA 3INTA 4RMBA 3C7TA 1FNGB 1ORQA 2W59A 2D1RA 3HRIA 3GNMH 1IEHA 1JKXA 3FDXA 3HFRA 4HGNA 1A97A 2Q0SA 3US9A 3E2IA 3E27A 2CBGA 3WWPA 4IDJL 2BCJQ 5C0DB 3LL7A 4RA9B 3FCOA 2OK0L 1HDOA 1CE8B 2FH5B 4BE6A 5FTMA 3MJ9H 3CBKB 3R41A 1P7VA 4PGDA 4Y16D 1UBTS 2QLVB 3CVIL 2P68A 4W9KC 4D1YA 1UKCA 2OE2A 2Y06H 2GD6A 3DUUB 4JFHE 1ZM4A 4NV1A 2DHEA 2FL5B 5ALDA 1CUFA 2ID8A 1TYCA 4C4BA 2NY5H 4FMPA 3V4LA 3VZCA 3LY9A 3ZHZA 4PGCA 5IFJB 2B4RO 1CR9L 4ZYVA 2J8UA 2ID4A 4U1HA 1L4NA 2EECA 1DBWA 1KZ6A 4EEZA 5D4JA 3RWIB 4ZRDA 3D3QA 3ILPA 4DOHB 4H7PA 2ZM5A 2PX0A 5B3LA 2ZVQX 2UU9B 1WCYA 3FU9A 1W34A 3LCCA 5K51A 3DZJA 3UMNA 1BA2A 3VR5H 9MHTA 2X0FA 1L0BA 3EOAA 3Q40A 2H6EA 5C0AE 1MQSA 5EHNA 3RIGA 2PO6A 1JXJA 4QWWA 3QPUA 3B8SA 3VV2A 3U4IA 3I45A 5DHFA 4PBSA 5AVKA 1VKOA 1ZE3H 1ZVSB 3IGUA 4RS4A 3GK8H 3VV3A 3KQMA 2IDTA 4Q9NA 4K6MA 5BRZB 2Y72A 4TT3D 3TLEA 1RMFH 1R0AL 2R7MA 4ZEVA 1KSJA 4AAYA 1FSKC 1W5TA 3LK7A 4X6UA 4F93B 5CT8A 3MRBB 3MCZA 2A5YB 2QOEA 4G5XA 3TZVD 3MQ4A 3WFCH 2OO3A 2WTRB 4JM2C 3RC3A 4G5YA 3SSGA 4GRDA 1ZR2A 1ZRNA 2I5PO 4APXA 4GE3A 3GSRB 1FUYB 2H32H 4Q6IA 2C9VA 4B80A 5EIQA 3IE4A 1XYYA 5F9FA 1A6WH 2HSIA 2C04A 4L4SA 5JECA 1C7JA 4LP4A 4GAYB 1I36A 3RVKA 3OPZH 3C43A 2D2VA 2B4KA 1SY6H 1R3IH 1KR2A 3COPA 3O4FA 1NIDA 1Q7CA 4MKMA 4AKOA 1UA6L 1DFBL 3EHBD 1P5FA 4N0EA 1JWMB 2QZ9A 3RTBA 3BRWD 4DA0A 4ERXA 3PYCA 4MMXA 2OZVA 4R8VA 1YG9A 3FH8A 1NBVL 3HMWL 2H16A 2X5PA 2Y1XA 2H4XA 1GYVA 2EO7A 1T5BA 4U7GA 1EEHA 2P1DA 2QX6A 3N0RA 2CLRB 5ISMA 3O75A 1BGXT 1DN0A 4X0KB 2AABH 4QAWA 3ZZLA 5DURB 5GGRA 5IIEB 2J67A 3QM1A 3AFHA 4AV0A 1CF2O 3VD1A 3OMAB 4L16A 4BSWB 5AP9A 2I5YH 3VMNA 3N2KB 4BFFA 3IF1A 1EVZA 5F77A 5KVEH 4WKOA 3WKMH 4L0PB 2FPGA 1FVDB 3HJTA 2D3NA 5BV2P 3R7AA 5JI3E 3GXTA 4ZOLA 4AQYB 4JLBA 3L5IA 4Q3BA 1DP4A 3TT1L 3SGLA 4GG6E 4J8PA 4K5PA 2UVQA 3C7AA 4IKEA 3MCWA 4K9EH 5H94A 4F5CA 4OLVH 2J30A 2CUZA 4XXDB 1EAYA 4XCEB 4G7QB 1SHZA 2V3FA 3KOUA 3FFCD 5IG7B 1NG1A 4V1CI 3KPUA 1QGUA 2JGNA 4P5TB 1JDTA 5DLYA 2YLHA 1JW9B 4AUJA 4WUUD 4EKYA 3KBBA 2WTPA 5LBSA 3FB5B 1Q9WB 3L4XA 3KYBA 5C08A 1CERA 5H0IA 3N8HA 2FEEI 4GKNB 2PJZA 3MNZA 5KJCA 3ETCA 1YS4A 4I1NB 1MGOA 3T8VA 1TM4E 2AC4A 3VI4A 2PL9A 4LY9A 3LRMA 4LBZA 4I3SL 5CDSA 2I1WA 3IPBA 4DA6A 1S8NA 1U3WA 2R68A 2EKZA 3U2QA 2ZRKA 5IX8A 4HWRA 1M34A 3WNLA 3ULVH 5IUCA 3H1TA 4UVHA 4XH2A 3JAWB 3WWEA 1J18A 1PVHA 5B3SB 1TYAE 2EZ0D 4F9PA 4IF4A 3QVTA 1P4RA 2IOOA 3AL9A 1TK2A 2ZNWA 4K94L 4WSGA 3ARFB 1QP7A 2GBTA 4KO5A 1BBDH 2CIKB 3WG7B 1C12A 2VRCD 2R7EA 2CFIA 4FFBB 1CP3A 4WZAA 4Y1RA 5I4CA 2IZ5A 3D2UD 2VT3A 2XWRA 3K2BA 1W6RA 1VIYA 4N25A 1QRRA 2V8BA 1TJXA 4DHWA 1BDYA 3CDZB 3I9LA 2DLNA 3OM1A 4L5JA 1CI3M 5D6CA 3MUFA 4HWZA 5DRWB 2VXTH 2ZRHA 3UWSA 2XKUA 4E5DA 2WXFA 2R8YA 2EBFX 4PR5B 4I77L 4YJGB 1H2FA 4IFTA 1U7PA 1WPRA 2JAPA 4G0UA 4I2XE 4K46A 2B7DT 1IM3B 1GGCL 1JSXA 1TUPA 1EVQA 2QE6A 3EO0A 3HG5A 1A6ZB 4N6QA 3ZLUA 1Z7JA 2P8MB 2RBEA 1A02N 1U3YA 2V0AA 2HJHA 4JAMB 2JJ8A 3QDHA 3IQZA 1XSOA 1K5DA 5KKAA 4HWBH 5K3OA 3OJDA 4P86A 2HFEB 2YRBA 5J6HB 4QQKA 1JEDA 4XRCB 2PSJA 3EOTH 3C7KA 4CC4C 4MVBC 2F1BA 4KK8D 1NAKH 4B1FA 4DGIH 2GSGB 1MQ9A 3M5DA 4NRXB 5KVVA 2V7HA 4K3VA 3OG9A 1AKTA 2BEWA 1PZ3A 4XOEA 5CLIA 5EORL 4WWKA 3HC4L 5TQ2H 4PFSA 4FQLL 3VGAB 5BPPA 5EXPA 3V7UA 1JJUA 4EUEA 1GZ6A 4KHPB 3COVA 3QKWA 1OP4A 1DIOB 3V1UA 1ULZA 3CO0S 3N0XA 5TDHA 4DARA 2FMXA 4A04A 4FG0A 5DU7A 3U1SL 5GZOA 1YJBA 1OT3A 3CLUC 3U2IA 3HXQA 1V3QE 3ZXAC 4JUCA 4OI4A 5HJ7A 4ARBA 1AXSA 2NNFA 5DXWA 3JWNE 4LSZA 4UHFA 5EUMA 5EIXA 4OFVA 2DHQA 3U4BH 2LGNA 4M6NL 2JGDA 3IJYA 4HBCL 1V5GA 4NENB 4ODVH 1AGPA 2Q8NA 1EQWA 4ARVA 1QRSA 1VBFA 4GGOA 1IUPA 3O3UN 3CVDA 1V95A 5F3RA 2RH9B 3F3SA 2NWQA 5E7QA 2D1SA 4CVZB 2VNAA 1FF5A 1KCVL 1MPAL 1Y63A 1OF0A 5B7PA 3IJSA 1EINA 4P57A 2O2HA 4Y9BA 2QPOA 1J0JA 4W4TA 4N5EC 2ZBUA 4MRVA 2XJKA 1Z0IA 4UBOA 1P6FA 4G2TA 1Q84A 3H7IA 2DPXA 1ZLVK 3HB7A 3L6UA 4L8SC 2IYYA 4QRTA 1SVLA 1P7CA 1UDCA 2OAP1 2QVLA 1EMDA 1HDMA 5TGBB 5JS6A 2OPBA 3CUEF 3U60B 1AP2A 3SNKA 5ETUA 2VOEA 4DADA 4HIJB 4ERSL 1P9MA 1GY2A 4FNLL 2K9UA 4URYR 4NQUA 1D2RA 1E7SA 5CWSB 4QUGA 2EDEA 1HN1A 5EPUA 4G71B 4JFFD 5C7ZA 5LXGH 5L7TA 3QIUA 4JZNB 3U0BA 1Z3GH 2VLKB 2ZONA 1P6AB 5E2AA 5FYQA 2VJXA 3OMLA 5AVOA 5DEGA 1RHRA 3NEXA 2QSTA 2O2SA 2X4LA 5HYJE 4Q0MA 3U6XS 2PZMA 1K3TA 1CHDA 5DJAA 5DZPA 5HR5A 5K8IA 4QXRA 4JJGA 5FYJH 5JRDS 3QHZH 3R4DA 2J7LA 3ZCSA 5AJXA 4EFDA 1VYVA 4DANA 3IP5A 2WWOA 4PZ0A 4ZZ1A 4YDKH 5L53A 2A0LD 2B4CC 5ICEA 2YMQA 2EG9A 5DBOA 5L3QA 3AREB 4H35A 4L51A 2IEBA 4OZHE 3H2YA 2YQ4A 4JUAA 1MRDL 4FEAA 4I5EA 5FWYA 2VDML 2BNQD 3ZJ4A 4D3YA 4PJ5E 4BH7A 2Y9PB 1QKJA 2EIMB 2GCEA 2XZQL 3HZVA 2V7NB 1D07A 1LO4L 3N0AA 15C8H 3NACH 3UROR 1SIOA 2QIOA 4Z95H 2WM8A 5D70H 1NRIA 4W1SA 3CFJA 4L2IA 5JATA 1TJPB 2AITA 4RA0C 5CMAA 4I08A 1GIGH 3O4HA 1N5KA 2P77A 3GQVA 2VABA 1YMVA 2VN4A 1WF5A 1A5FH 1LCIA 4PLCA 1W8DA 1NUGA 5FYKU 4FOTA 3ZH9B 4ZVNA 3ZQUA 2YZ1A 5I2IA 2NX5A 4TVUA 4BD4A 4YZWA 4FQJH 1YA5A 2FWAA 4J7RA 1LZKA 2JI9A 1BH2A 3BK1A 1LV8A 4G4GA 3BCDA 3K1KC 4IZHA 1CBVH 4BVKA 1CT9A 3SYQA 1DBAL 1AHWA 4BWWA 4LYDA 3K15A 4NZRL 3FCCA 4X45A 4N54A 2NXEA 2OXCA 1B4TA 4LPKA 5CEYA 4AKPA 3O4LA 4AK9A 2AN4A 2MEJB 3H9SD 4I3GA 2F7SA 1TO2E 2I2WA 5DDHB 1KYUA 3GEPA 1GYCA 2V37A 3QB7C 1RMQA 1ORHA 1XF2A 4U6QA 1NW7A 5EZLA 4XMTA 3GIZH 2AI1A 2R85A 1QV6A 4GLJA 2XN9B 5F7HA 2CO1A 2YZ8A 4W9DC 4CIAA 1TCRB 2E89A 4Q3CA 2E6JA 1KGSA 5CSZB 2EW8A 2XNCA 1NLZA 2OPHA 1SR8A 1F8YA 4LBEB 4OI2A 5JSUA 3ZL1A 4P38A 5IFAH 1VRWA 5LG1A 2WHPA 1TR7A 2OZNA 4KAAA 1MFCH 2XVBA 4QNRA 2MR6A 1KPRB 2KS0A 3FFDB 4BO1A 4BNGA 1GGIH 3D09A 3THSA 2IDSA 3BRFA 4PUBH 2GFBB 3C6EA 4RTNA 3U3RA 1C4WA 5E8EA 3W3BA 3PFUA 1DJYA 2PKEA 3VNZA 4XN8A 1AO3A 1Y9ZA 5BXQC 121PA 4BKUA 5ISZD 1LBQA 1H2AS 1T5WB 1MCZA 5C0GB 1BMTA 2Z7YA 4G80A 1SXSA 3FFOA 3GBNL 1ZPDA 3FI9A 1XELA 2AVGA 2B7CA 1T4GA 1V6CA 1T36B 5JJBA 2HCTA 4Z7UB 1P0IA 2YKGA 4BFIA 4G41A 2X58A 3QHQA 5A9RA 2PP8A 3O4OB 4JL2A 5G41A 3MCLH 4G8IB 5B7EA 1Z29A 4D9GA 1LX6A 2OZ4L 4I0PA 2OKGA 5JSQA 2CCLA 4UUJA 1JG1A 1RIVL 1SJHA 5A6SB 1CS4C 3HCBA 1PJCA 1TA4A 3QH4A 1BVLB 2RGYA 3ASNB 3N7AA 3DXAD 4OD1H 3IQGX 4TM9A 5CLQA 4IG9A 4WOKA 3U9UB 5HHMB 3HC2A 4TS3A 3KM2A 3HLAA 3T2QA 1JV2A 4GOJA 1TF7A 2P4AB 4X83A 2QUHA 1NVBA 2NY7L 3HGMA 1YD7A 5AD1A 1UXMA 5TMPA 3KJ4C 3X43A 1J8FA 4KTYA 5IN5A 1DUIA 3T6VA 5DGXA 3DTXB 2NU9B 1NGWB 3OKLA 4CIYA 4S1RL 2HXYA 5LUBA 2UWEB 4H1LB 2R0KL 3ARDC 2VWPA 1BYNA 5EYPA 3GMQA 4IRMA 5IJ9A 1P31A 4EDFA 5EUOA 3BKWA 1OTTC 1OX4A 4ZARA 1VGQA 3PPEA 1YI0A 3CSDA 1X9LA 2P44B 1OPOA 2AG5A 4TN1A 3FYTA 4P3NA 3VPGA 4CMIA 1IJFA 1FX0A 1NMQA 3TTXA 2WYZA 2WWFA 5EUKA 2AMGA 4BN0A 4BLSA 1KXVC 4LDPA 1P2SA 2CL0X 3O81A 1NBWB 5B2EA 2W2LD 3CMOL 3KSBC 2Q6WB 4ES9A 1VMKA 3F12B 3NMUF 4FA7B 2XUKA 4U7PB 4OJEH 3UYPB 3RJ9A 2IPTL 1OPRA 3I74A 4U2YA 4M8LA 3W8EA 5KYVA 4BE7B 2Z92A 2QL5A 3OOSA 1GL9B 1TCAA 3WLFA 4CHTA 1W88B 1C7ZA 1KI2A 5C5CA 4ASUD 3MXVL 4P9NA 1RULH 2VJCA 1QFUH 2FJFA 4LSSH 1DV2A 4HJJH 4IBSA 3HG1B 3PFCA 1XR9A 2R1XB 3BE5A 5DJ6A 4MYSA 3H04A 3WGUA 4JKOA 1A2YB 5HVGB 5SWZE 4XNXL 1MQAA 2CBPA 3D0OA 1BLNA 4DT2A 3B6KA 1NBMA 1FPQA 2HHCA 1EDYA 4JOBA 2DF3A 3FMVA 3DZIA 1UJ3C 2C96A 2F58L 2FN4A 1UXSB 2CLSA 1MAMH 1BZ9A 1YBVA 3HRPA 3VFWB 2NY3C 3IP7A 1H4SA 4F37K 1FB5A 5G4NA 2BKAA 3U31A 4NNYA 1FFHA 3CLWA 5IULC 4AGLA 4YAEA 3FB8B 3BFPA 2VW4A 4F45A 3QYAA 1Q9LA 2FFJA 5MI0C 4MRMB 3X1KA 3MRFB 5KSWB 1MI5E 1ZS8B 5ITZB 4RL6A 1SPDA 4GXUN 4DPRA 3X1MA 1KIMA 3JYLA 4C6RA 5IW8A 1VLVA 1WXGA 5K01A 1BGVA 3RP1A 2OMXB 3P4XA 4NCXA 4HUUA 3L8FA 2AKRB 2GEFA 1I7LA 4KFTA 5LA6A 2E49A 3AXLA 5E8DH 4B95C 4B4KA 3GS0A 4J0CA 2W6JD 1N32B 4QHUB 1GGYA 5FYDA 3L9WA 3NPSC 3DX9B 1OT5A 2X09A 3L54A 3ZQWA 3IE1A 2C29D 3SHFA 2HJFA 1CU4L 1N6QH 4OHRA 4FXOA 3K5SA 2DERA 3MJ4A 4AW4A 2IYXA 2EXWD 2B1GA 3OCYA 4GO8A 3OZTA 4AG6A 1GNQA 1FP6A 1R0SA 1JF6A 1UKZA 1Q1ZA 2AH5A 3NGBB 4PJFE 4CM3A 4BXOA 1CR6A 2YWXA 2C8LA 3BVTA 2I9LA 5EU5B 1EK0A 2XOTA 3CW8X 3CSPA 4EWLA 3QSYA 4IU2A 3AP2A 3UENA 4R5MA 2Y36L 3OIWA 5E1MA 2WWKO 3ZI4A 2Q5FA 5JXAL 5EMYA 2CKBL 1YPZE 1TEYA 4RTKA 3L7LA 1E0KA 1G98A 4FDVA 4RPLA 2AFHB 3TJPA 5DMJB 1XZEA 2QI9F 1T5XB 2YPLE 3L0BA 3UO1H 2AW3A 4B97A 1N33B 2IEDA 3BEOA 1VFNA 2AD5A 5K93A 1IRAY 1NEZA 1A8QA 1UWLA 2BS9A 1GGTA 1QPXA 5FA5A 4Y2XA 1SXHA 2H7VA 2VTBA 1QP1A 2O8DB 4GW4A 2DJ5A 1RI3A 4KKCC 3HLTA 4WGKA 4NQXB 2PUHA 5JDSB 1PEKE 3QOWA 3W38A 3K53A 5TVKA 3CLFH 3KZ8A 4WEBL 4EI6A 1GRVA 1MZZA 1W75A 1QBLH 3GMMB 1UJ2A 3KWWA 2C9YA 1GC1H 1LNZA 4WEOA 3B2XA 1BS1A 2YJNA 5EHGA 2CLHB 4E12A 5ALNA 5EJMA 2HWZH 2V5SA 1ZD2P 3PDIA 4PU0A 4CTNA 4MJ6B 2X41A 5ELLA 2G5GX 3WLTA 4ELME 1NYRA 4AEHL 4YSTA 1VE3A 2R9HD 4OD3H 3P0HA 2IS6A 2QBWA 5F71A 2PXYB 1E1CB 1WSDA 3KB8A 2MPAH 3L5KA 1RI5A 2F3TA 5DJ8B 1N2GA 2E7MA 1GRNA 6LDHA 2Y99A 4KW7A 4NERA 3TE7A 1MOQA 5DZVA 2WSPA 1Q9KB 2FPUA 3V0DA 2KE5A 5FUMA 1N0IA 4RAUA 1FCGA 4FILA 3FZUD 1U9JA 5DBHX 5J47A 1QYGH 2GZRA 4FFSA 2ENJA 3R4VA 2WXMA 1CL7H 4IMLA 4M0PA 4O58L 1UKVY 5HHOD 3HUFA 3QJHA 4PJHA 2DUJA 2J5LC 3HCEA 5J4YA 4LRYA 5CB0A 4WO0A 1NW5A 1MHPH 4ODBD 4OSOA 2R6AA 3ZTNH 1RZIB 5ERGB 3H99A 3DAOA 4RFSB 2M83A 3AEUA 2VLME 1J9ZA 2HCRA 5D71H 4IRXA 2WHVA 2MFNA 1YKSA 3BUIA 4IGBA 2VO1A 4LYFA 5G0TA 4KRPD 3A4DA 1VL0A 1CICC 2OW7A 4MWZA 3KEDA 2G17A 1EFXB 1JQ5A 3AS0A 4H0IA 5E2VH 3G04A 5I7SA 3E7JA 4MAUL 1JIXA 4F9EA 5AW3A 4WJG3 5C0ND 3EJYD 1YVUA 4E13A 3RRQA 4YXHH 2NG1A 2D1FA 5HI3C 4RIHA 3SX4A 4B83A 2F15A 1FQWA 4PV8B 1SBBA 2AQTA 2ZRIA 3RNKB 3PNLA 4FQ1L 1MIMH 2XUOA 4EEKA 4GWLA 1R3HB 2ENSA 1AZRA 4BNTA 3NC4A 2FGZA 5LR6A 2ZWLT 3TH4T 4EG0A 1FZKA 1Z7GA 5J40A 2CXQA 1UWYA 3UC9A 5KBKA 3FSVA 4WQMA 2WIIB 1ZUNB 1KR5A 3F73A 3IALA 5KJFA 3AERA 2DQFB 4M3KB 1NXPA 521PA 1IC4H 3IBOA 3KWMA 5SX5K 3WWDA 4I9XA 3Q9QA 3RKDD 3ZTCC 2D73A 4IMKC 4AIOA 4Q9RH 3FWZA 1N5IA 1WPXA 3IJ7A 1Y5RA 1YY8A 3A31A 1JG6A 4OIFA 1J0EA 4TX1A 2GHIA 2X0RA 4B9EA 4TV8F 4KJPD 1Q16A 1E20A 3Q88A 1BJ8A 4LRIC 2YSTA 3O2JA 5J2UA 3RX9A 5EU3B 5IVXA 5FCUH 1FO0L 5SZJA 3OQIB 5LBSL 1A95A 1M1SA 4OM7A 4EBQH 3L1HA 1YN7A 3ND6A 4JC4A 4EUPA 1T0IA 2FG7C 3KKZA 4RFEB 1K4CB 4JFOB 2SEBB 2FSPA 4J3FA 1TM5E 2KX7A 2JVIA 2J3LA 3BKJH 1V11A 3PUYA 3G2JA 4AS3A 5H37G 4PANA 3DHMA 4PNHA 3NNNA 4ZTOL 5IGXH 4IZIA 8ATCA 2PRIA 2B3TA 3TO2B 3PP4L 2C3WA 1NN1A 3TNJA 3CE6A 4B7XA 4PSUA 3J07A 2FQ1A 2QXYA 1J1PH 1SD1A 4MHSA 3KZCA 4NPYA 3V0VB 4GSUA 3JTTA 4N5MA 3D6AA 4JZKA 4KY2A 2JRCA 1M67A 2X0VA 4GUDA 3F58H 4FI8A 1VZ2A 2JAUA 5ALWA 1Z47A 1Z5PA 2GN6A 4RMTA 3QCUH 3UK6A 1Q0SA 4MB0A 3KCPA 1U5BA 5ITFA 1MUJA 1S2MA 3QIBB 3S96B 3HJUA 2WWTA 2FUG6 1OK0A 1OQAA 3OTHA 4NS1A 2OTUB 3E2PA 4LXTA 3WKDA 3GLEA 2E76C 4KVNH 3QEUA 4HK4A 4NZNA 1D6NA 1Y1UA 4ALKA 3UAVA 1N8OE 3L4SO 4PPFA 4DR5B 2E86A 4BN4A 3MAAC 3OQJA 3ZDZF 3FBWA 4BXVA 4FL4C 1NZRA 2NT0A 3UAYA 5F1IB 1A9ZA 4Y2OB 2XYQA 5HW0A 2ORBL 5D7IF 2WZ0A 1KEEA 1W0VA 4AKSA 1OK8A 3VH1A 4D6YA 3R7RA 2CXPA 3V52L 1LWJA 2ZT8A 4HS4A 1BX2A 4HAXA 4G1EB 2XGSA 2F8SA 4JRXA 3NASA 2VF4X 4K6FA 1X8KA 1LD9B 3WGLA 2B4AA 4B0OA 4DLLA 2ED9A 3BJZA 1F2QA 2QLMA 2ID7A 4WA7A 1BVNT 4CAGA 3IAS6 3WO4B 2W1NA 5D7LD 3HNOA 1WCBB 4DMUB 1IQRA 1MX5A 3EJTA 1JWBB 1KMHA 5BN3B 3RIAK 4AJWA 1B26A 1IC5L 5HTSA 5E9DE 2ED8A 4Q3AA 1NFRA 4A0HA 1AXTH 3BMOA 1P4IH 4LZNA 5FLUA 3B9AA 4FOLA 1BZOA 1BM3L 4DUGD 4KQ4L 8ABPA 4AYFB 3COJA 2W0MA 1FZMB 3ELQA 1T15A 1ZLYA 3PA8A 4PZ9A 5FS5A 1XRMA 2JKNA 3L8GA 2BHTA 3LNTA 4K0RA 1II9A 1ECJA 5DASA 1YUKA 3O3NB 4Y4HB 4J6RL 3RL2B 3HVJA 4DLNA 4YH6A 1SK9A 5AWFC 5D8JH 3T4YB 3MPOA 3BH4A 1OZTG 3UAZA 5IESH 4I36A 4DAOA 1NIBA 3QXAB 5I76A 5LQKA 2R2EA 4M1MA 5L4LA 2WWWA 1RADA 2GK0B 4QODA 5M3BA 4F6RA 5DC0A 1KIFA 4YJHB 3M3PA 3A58B 3J2PA 4E9RA 3Q5OA 1II0A 4P2OD 2UXGA 3GKZA 5JSKA 4ZUSB 3WK4A 1AS2A 4R1NA 2Q4BA 2J7PD 3KQKA 2UXVA 1XZKA 5D5MF 4ENUA 4ZPTA 5F7WC 2AHIA 2K7QA 2VH5L 1GLVA 3SDDB 1KJVA 2FYYA 1K5GA 4A92A 2BY2A 3KAAA 2GN2A 2AI0H 3K30A 4IYRA 3HNVL 1CLCA 2X4NA 4Z77B 1BMFD 2Q45A 2BUBA 2Y5TA 2VXSH 3WZ2A 3EXFA 1DQLH 4B75A 2ITEA 2PJRA 4LE8A 1KJ2A 1E79A 2EFDB 2X9LA 3TEJA 1QOKA 1WVMA 2NZYA 4PJCB 1GZQB 3SKVA 4K15A 3NZHH 4C56B 4FWIB 5TMEA 5DNUA 2BFCA 1RMTA 5CBAB 5EQJB 1MABB 1MVLA 4CKWA 4P3XA 1PJ2A 3I9GH 3RHWK 1OFTA 2C4WA 3RL1A 2OV1A 4HIXH 1ZA2A 3EVEA 3G3EA 3TIDA 4R51A 5ECGA 3GBML 1U9CA 1UIMA 4GBED 1FP5A 5K0ZA 4N6NA 3DC0A 3EJSA 2HMVA 5I30H 2NOYA 4OQZA 4GRLD 5E4AA 4KAXA 5FK9A 1DC8A 3QV2A 2IV9A 2AJ3B 1J22A 1UWGL 3QW2A 4JFPB 3GEWB 5T8KC 1PJQA 3OD1A 3DFMA 3DAPA 1E9DA 5A1JA 2XGJA 1L7MA 2DEUA 1C8KA 5KWEA 1K8DA 3TTYA 2ZJ1A 4GOND 1PL3A 4I8XA 1EPUA 3ANTA 4KGXA 3KH3A 4BQOA 5IB4A 4K86A 3DTNA 2Q3XA 1PR2A 1SJXA 2Z4RA 3E8XA 3PRJA 1ACZA 3CTTA 3S35X 1FSSA 2HMSA 2OBMA 2PUBA 3ETBJ 1NCIA 2W93A 1GTRA 1RYDA 5EOQL 5D3ZA 5I23A 5HHQB 3EEBA 4MDIA 1WCIB 4X42A 1X8XA 3RVJA 1GOGA 4EKXA 2XUZA 3GCXA 4F4IA 5KYKA 1IAKA 1M9WA 3BPOB 1H22A 1XGTB 5CA0A 2M32A 4YGVB 4Y2DC 1WBZA 3JBG7 2R8EA 4FDLA 1C5BL 1ZIXA 2JF0A 3PF8A 5ICFA 5G5DA 2JEYA 3MKKA 4NSKB 2ZX7A 4H60A 1SYSB 5DHQA 1ZD5A 2HSGA 3A1DA 3UXHA 4NYLA 3BDAA 4JW3A 4KGLA 4YIKA 2W0LA 4PTZA 2O9JA 1KEVA 1T0HB 1MN4A 4K40A 2I3DA 1ZNWA 4Q1EA 2JWGA 4PGBA 2XI9A 1U8AA 1CS0B 4U1JB 3D8UA 3GXMA 4I48B 3F4KA 5EIAA 4QSMA 4IDBA 3KMDA 4HD5A 3VXOB 1WEJL 3SHVA 1E65A 4HQNA 5ALHA 1S7QB 1A96A 1JECA 4TVSa 4BO2A 4NMLA 4U7DA 1HYEA 3R76A 4YRTA 3VKWA 4D92A 2OV2A 2QZ5A 3N05A 2FMUA 3POHA 4P2QB 3CSSA 2GM4A 2NTFB 1THAA 1OIOA 2YNMA 4HSQA 1NF8A 4F5CE 4KI5D 4RD0A 1EXMA 3ILQC 3DJZA 1OYYA 3GPEA 2R1TB 4P59L 4LLVB 3A6KA 3GBLA 3DF9A 1XZGA 2QDWA 4MPRA 5ITVA 4FKBA 2E7LC 1RXUA 5T3ZE 1Y8ZA 5E56A 4YP0A 1X7XA 4PRHD 3NN8A 4OSPA 5AVRB 3KBPA 4F7TA 1HT2E 3L3HB 1WITA 3A0UA 4LC1A 1KDPA 2C3UA 3AU1A 2EATA 2HXGA 1HL4A 2E27H 5C08E 4PTUA 1NCDL 4UCWA 2DBVO 4L1BA 5AW0B 4UARA 3UYKA 1YMMA 1LLQA 2EDJA 3VI4E 3C6ZA 4UIKL 3AB7A 1I8UA 4TNFA 4PYHA 4FINA 3SPCA 1F5SA 1T4KB 3EA0A 3QWBA 1HWYA 3RTCA 4XSVA 1VFBA 4WFIA 4GRAA 1M34E 5TDOA 2B08A 4YP5A 3RSQA 2JFPA 1MXHA 4LBVA 3B5EA 5KYWA 4RPHA 1EEYB 3EDFA 1WIOA 2HO5A 3V42A 4H1LH 2ETWA 2J0EA 5L7YA 5JA8B 2QBYA 3H87A 4Q89A 3HFML 1HTTA 1NVUQ 4NESA 1G2QA 4ARIA 4DGYH 4AJIA 4GGMX 3KWFA 3ZQJA 4Q9CA 4EX6A 3HEIB 3NSYA 1ADWA 1JAXA 4L4TD 1TITA 4WZAE 3HAEH 4LSTH 1EX6A 3LECA 3T0ED 1ND5A 1KDJA 1S7VA 2Y7MA 1HHKA 4ARUA 2QW0X 1EERB 4P5SA 2J3DA 1DBIA 2F53B 3WC4A 4CQMD 4NARA 3CJTA 5EIHA 5B1CA 3K8YA 5KUKA 1S7SB 2D59A 5JYMA 3NCJH 3E3NA 5BNWA 4WAUA 1PUIA 2XECA 1XEAA 3ZK9A 3NTOA 5IAAA 2JFXA 1RK0A 1WISA 1V3TA 1D9KC 4QXWA 2VSOA 4F96A 1QFWL 4EI5C 3FNKA 1ETZB 4FR5A 3LQAC 3SKNA 3H6HA 4TVKA 5BT9A 3K1AA 1E92A 1P1JA 1IBFA 3A6HA 2PPAA 3O73A 3VCLB 5C07D 3ZEIA 3PWPA 2OCBA 4RBPH 3W2DL 1NJSA 3SE6A 2ANCA 4XMZA 3LUHA 3PGDA 1O0SA 4QNPF 1NJ2A 3WJJA 4C88A 2R96A 4PPYA 3TR0A 2OSVA 4IIXA 1HHJA 1ZGHA 1QO0A 3G0OA 3VM6A 1C5KA 1MFAL 4DJDC 2FSIA 1CVSC 1E6JH 3V8OA 5LZ7A 1NL3A 3OBAA 1X9UA 3F67A 1JQLB 4F7PB 4O5OA 5ED0A 5GVSA 1GR1A 4FFRA 4IRJC 4EUHA 2M1ZA 5D7HA 4NR0A 5B2FA 2EO1A 2IFFL 3DI2B 3I50H 4A2CA 2AMLA 3C5SB 4UQ2A 4AJEA 1KYOK 5CB4F 5GZ6A 3RVTD 5CCGE 3K09A 4XBGB 2R6JA 2N1MA 4M1DL 4HT1L 2PA3A 4CQLB 5E00B 4KROB 3H2ZA 1P4JA 4MYPA 5C92A 1N7HA 1MH5B 1CDHA 3F6EX 4C0AC 4EQ6A 1FL9A 4YIQA 2BP0B 3WLQA 1FJGB 4OCWH 5EMNA 2BFEA 5CJBA 4LC9A 3ALPA 1NC4D 3CRQA 4D0GA 1YAJA 1S7RB 4PS7A 3SDAB 3B78A 4JFYA 4CI9A 3NCHA 4AT6A 4HWEL 5DD5L 4U1MB 2PO5A 1F58L 4AZ8B 1BJMA 2HX8A 2H3KA 3KB1A 1ODSA 2B34A 2FX2A 9CGTA 1N3NB 4FABH 3H84A 3F7QA 3UXFA 4RKYA 2HYIC 2DTML 2Y1LA 3MOIA 4LW8A 1QK3A 4GQBA 3NAGA 1E1NA 2B7LA 2HZBA 5EJEA 2HREA 3S3DB 3SCMA 4D8OA 2DQKA 4H26A 2WVHA 2ZUTA 2W83A 5BN5A 2G3XA 4XBPB 4N2LA 2VLJD 1O77A 4IL5A 4BP3A 4QDOA 1EEZA 4A8HA 2PA0A 2ZBVA 1SXJD 2WB4A 4PAWA 1WABA 3L8MA 1U41A 4AUUA 4TV9F 5HHVH 1ZD3A 4B6SA 4NGHH 4F2EA 3FMGH 4N0MA 3VXNA 1A1SA 3L0ZA 2IF2A 4XNQB 3A8TA 3MGTB 3P9WB 1VLZA 4HAYA 5H68A 3K9WA 3JWJA 1WKVA 1IG3A 1E3WA 1BWSA 1WTLA 2WTEA 5IXYA 4LMRA 1E3EA 1SGWA 1A9XB 1W94A 4ZMAT 2EEDA 1UM8A 2OCPA 3U7HB 3LRHA 1OASA 4OU4A 1J42A 2DU8A 4M7LL 3C3YA 4B3TB 4LI3X 1ZNQO 3E9ZA 1BG6A 3V6ZB 2XD4A 2YOGA 2WK1A 1VF5C 2RGDA 2OAEA 5HIKA 4URKA 5BVHA 3L7BA 3EVFA 2DPGA 4RIFA 1PV2A 3I3DA 3ORJA 4RTJA 1KF0A 2Y6VA 4NYMQ 3IGFA 1EA9C 1ZWLA 3EZYA 4JODA 3Q0HA 2XF2A 3HR8A 4R2XA 2BT4A 5ENDA 3ZDXE 3WFIA 3V7AG 4LLDB 4MJIA 3E84A 2XYGA 3LUCA 5HYFA 3P8ZA 4YS4A 1AANA 5FW6A 3SS9X 1WO2A 1TZKA 3VNAA 4PXSA 2J87A 3MA7B 1YQTA 4TQEL 5A03A 4IDEA 4MJJA 1A1MA 2OW6A 4I7ZC 2A4MA 1ST3A 4CDGA 3B70A 4FX2A 3X2SA 3TC9A 2K7FA 1Q1GA 4FYMA 3DPBB 4OAOA 2NX5E 4LUCA 4Q37A 4HQQL 2CWWA 3C09C 3QUZB 4K7PY 1W0CA 1UKAA 2HA6A 4E14A 3KR9A 4MAYD 3FNRA 2DQCL 2HLFC 3V2IA 1E4EA 1VTKA 3HEMA 4NBKA 1FFOB 1ZA1A 5MEND 2D0DA 1RQ2A 4RXTA 4M6ML 1A9BB 4OHKA 1UM5H 1F6LL 1HDXA 3K1ZA 1PNQA 1T8YA 4F11A 5FGCB 5KSOA 1WP6A 3CVWA 2I4OA 5K3FB 4QLAA 3ZKMC 3CCCA 4CM1A 1W0WA 1BD2B 3BAYA 3IN2A 1KFAH 1JYVA 2ONKA 2WJGA 3DPDA 3BSSA 3JQFA 5EJAA 3U4QB 5HGGS 4HSEA 3MLZH 5IMLA 3KPRB 2L8AA 3MYYA 5IAGA 2LFEA 4DKFL 2JASA 2GZMA 2NXJA 3FROA 3NP9A 2ZWNA 3WMFA 3QZWA 3A4IA 3QU5A 4NVRA 1D6EA 3EW3B 1T8PA 3DZGA 5I9LA 1YZHA 2CRYA 1RUML 2DT8A 2DQHH 4C83B 3OCCA 1OZ0A 2ZJYA 3SZMA 2WP3O 2E0PA 3KHQA 4J28A 3G5MA 3QJOA 4G56A 4JJAA 3UZEA 3B6JA 5D7KD 1U2CA 4MV3A 2ZI3A 4KPUB 4Q1DA 3MUUA 4EBBA 1ZSVA 4DCQB 1AG0A 1CFQA 2YXMA 1MXDA 1XAUA 3GAFA 1LNQA 1U1FA 3HRZA 1J25A 4KVFA 2AOWA 2PL3A 5TV2A 2ZUCA 3LY5A 3ISVA 5AM3A 5B7MA 4LL9A 3TECE 1D2PA 3RRNA 3ZHOA 3SPGA 1ACYL 3O6ML 2PLWA 3RGHA 1EFKA 4GPD1 5F6IB 1KIPA 5IYZA 1BAPA 2R8SL 3DC7A 2VRQA 5IW6A 4CM8A 2HLAB 4DWJA 1TKWA 1Q0XH 4MX7B 1I8IA 1GPNA 2X6VA 3A6CH 1MU0A 3AUFA 3K96A 2GX6A 2AV1B 3BP5B 2FF7A 2ORED 2VH2A 4OV6F 2OM6A 3KD3A 3RUHA 1X9QA 4Z2YA 4NSNA 2R11A 2J44A 1RACA 5HIIA 4J43A 1IGFL 3IU4L 1A2OA 1QFYA 3C5JB 4AKEA 1JPUA 3US0A 3MQIA 3RFXA 1FRGH 3BD3A 4QRPB 1JEEA 4BNLA 1RHMA 3RUEA 4EZIA 4U1SA 1GV1A 1M83A 5KANG 2IXAA 5E08L 2HP4A 1P2CB 3SSOA 2C9RA 1K7SN 2H4YA 4H13C 4YFLI 5EFIB 2A74A 5KB3A 4DUXA 4BVLA 3ES6A 4X5QA 1CNEA 1VMEA 1GUYA 1LVHA 1K5PA 5IQOA 4CG1A 4RPJA 5EUOE 2XA1A 1NBHA 1POXA 4I5BA 3A1CA 2XXFA 4JRYD 4XB2A 3TVTA 4JM2D 3VI3E 2PKCA 4XJXA 5FF6B 4CVWA 1KMQA 1WR8A 1AMYA 5B58C 5A2CA 5T67A 1JI0A 3P52A 3TBKA 3QVMA 1KKMA 1EGJH 1I85C 4TQAA 4X5XA 5ER9A 1I1CA 2F3SA 3PREA 2FMIA 4J1TA 1XHFA 4ZCPA 3LH8A 3UW1A 4HK0A 2PX8A 4PZUA 3EO1B 4N8VA 5IB1B 1ZHKB 4JBLA 2VDPL 4OHVA 4XMLL 5I24A 5DJCA 2NZ9C 3P1JA 1E6OL 5JU6A 1P1ZB 4BECA 1NT4A 1NN3A 1Y42X 5DJXA 1DBJH 3VH4A 4YCLA 4B3FX 2OXFA 3PRHA 4TL7A 3LYUA 1O94C 1IFHH 3UK7A 3FBKA 1BWWA 2EILB 3THMH 5CPBA 3B7RL 2R2HA 2VSCA 4Q6YA 3ZK0A 3COZA 3RB8A 1OARL 1IEAB 2PV7A 2V3DA 5A6MA 1NBME 4GD3Q 3HNTH 3BZ4A 1G42A 3OZ9L 2AQKA 2GUYA 3EFOB 2OO5A 3IA2A 3A06A 3JPYA 3AVUA 1ESMA 1MCJA 1NYQA 2W07A 1DMSA 3IMCA 1Y33E 3VU1A 2VUHB 4LU5H 5KOIA 4M4RA 1JCKA 1TW3A 3V0WL 3VGJA 3EO9L 5BRQA 4JI4B 3OQVA 1XZPA 5IJZA 4FEYA 4JK3A 5JUEH 1LW6E 3NRJA 4LYGA 1AR1B 1MAVA 1NMZA 3FCEA 4UINH 1G4AE 1XGQA 3V5HB 4RKRA 3R5FA 3FOMA 4U31A 3N6YA 4N0YH 5G4MA 4CU7A 5F7YC 1JTOA 5GOTA 5IQ9B 2GCIA 3CFEA 2W88A 3MO1A 1W8NA 5DS1A 2XKNB 1C0EA 1PO7A 2E4AA 1Q77A 4BMNA 2X38A 3SBQA 4XM1A 3X14A 1T2EA 4G7VH 4LHSA 4DSNA 1IAIH 1QABA 5MFZA 1V3MA 1BEZA 5FL7D 2F08A 1G8PA 4XVSH 1TTAA 3SDCB 3MS7A 3FLEA 5C51B 4M1EA 5FA3A 1P1CA 2CHDA 3MAJA 2OHOA 5DLLA 3LZDA 2EDBA 3ZY3A 1KB5B 2QD2A 2R0QC 1AGEA 1DSFH 3BLKA 4OR1A 3TKLA 3LDBB 5GOZA 1HK6A 4OSEA 4QJIA 1EWRA 2RACA 3QUXB 4X24A 2X1PA 3EOBI 2Q8AH 3UEZA 4HGWA 2J2ZB 5J4KA 5HGHB 1TIUA 4TNVK 3QORB 4YSQA 5JPNC 2XNAA 4AYTA 2HWYA 3CPLA 2UZ4A 5BVJB 1IOLA 3BIKB 3QU4A 4BNWA 2PPCA 4PSDA 4L48A 4E5XA 5CB8A 1C1XB 4X8JA 1RPQA 5AYQA 1F90L 4YYZA 4H20L 5EEXA 1DC3A 5JW4M 4WLUA 1DBBL 3F0TA 5HSGA 1CFVH 1Y9AA 1TTQB 3FQ2A 2C77A 3AUKA 1ONQB 4NBZB 4JI6B 1U3UA 2W6NA 1XVAA 5F7XA 5HYQB 3H5OA 4ZMTA 4UAGA 1EDQA 3AFNA 3JWDC 1UBMS 2FIKB 3Q8EA 4ODXA 3BQMB 4U2ZA 2Z91B 3ZZSA 1TJMA 2IG2L 4KI5F 2ASVA 2ZSKA 1M1XB 1T1RA 2JJSC 1ESCA 4LSWA 1SMAA 2FWIA 5EXTA 5KTMA 2PIDA 1KGUA 3Q5TA 4C78A 3AFLA 2Z6QA 2H1LA 1KEMH 3D4ZA 2RJ3A 3CR7A 1UENA 5DHDA 2I2XB 4OLWL 3JRNA 2AVFA 3PXAA 1U4NA 1MCFA 4ZNEA 4CKEA 2M2DA 2ZSAA 3MUJA 5J9PA 5JARA 3EVNA 5KTKA 2UYQA 1BDHA 1XZLA 4RQTA 3ZQ6A 3BUQA 3WY3A 3PFHA 3VQLA 1F4WL 5EOCH 1ZSNA 3CV5A 4MJ5A 4MVBD 1HZLA 4L75A 1KLGA 2CDAA 2VKXA 2OCIA 2FJGA 1G6OA 1OH6A 2IADA 1MCPL 3QPWA 2PJDA 1P0CA 5JOEA 1AGNA 4UMEA 1E7UA 2E9WA 2EYTB 4DK3A 2P6UA 3NWOA 5EN2A 3T9WA 3EQZA 1BG9A 4TWJA 5C0AB 4APQA 4BC1A 5J5VA 3CO5A 3N06B 3IJRA 1Z9MA 2DR3A 2JFQA 5ICMA 1B88A 3FPKA 3L5XH 2EVIA 4WWNA 1DPFA 3KGTA 2I8AA 1MOZA 2GC4C 1S3SA 3BK7A 3H2BA 4OFWA 5I1EL 1GZHA 1JDUA 4ZVLA 1VI2A 4WUKL 3CLUD 4NOKA 3N85H 2Y24A 3NRFA 3P0YH 3GMDA 1ZUD1 2J3MA 3FQNB 3BCRA 3BXGA 4FXPA 5JC8A 3TZHA 4MB6A 4PJHE 3ST7A 2Z0MA 3OFVA 4COKA 4CDRA 3HC0B 5GRJL 4W9NA 2QL6A 2IXGA 5DQJA 3QFHA 5GONB 4Z0PA 4BX2A 1GWNA 1NW9B 4BDVA 4MLPA 1BQKA 2KERA 1F45A 4NNJA 4LLQB 3E0XA 1AGDB 4D3CH 5HTKA 4N8PA 1OVZA 4YJFB 1T2UA 3OM3B 2MNJB 2VLLA 3M1CA 2YWBA 5CCBA 3WIFA 4W70A 4OCYL 1DUZB 3GFFA 4PJDF 2P9GA 1UDWA 4N5ED 3K6JA 3WOHA 4B6JA 3L3OC 2N3ZA 4IIJA 3TSYA 1T1YB 1V37A 2NDFA 3V6MA 3VC3A 3ROKA 3L5OA 3IWUA 4E2OA 3G9ZA 2FEMA 3LPGA 4IV8A 2X8JB 3U2SA 2P80A 2XCUA 4LARH 1T03L 1AMXA 2GTWA 3V2AR 1QD0A 3TKYA 2XNHA 4IDDA 1RDFA 3CZRA 5AK4A 1JPFB 5AVUB 4C07A 4DMCA 4G1FA 3OZWA 5IMOB 1RLIA 4IHBA 3MQFA 2X0WA 5F2OA 3W8FA 4ENPA 3NH6A 3OKAA 4AE0A 1CR4A 5KQMA 3PQ8A 1Z5LA 2WSBA 5BQDA 4FJZA 1YRKA 4NUGH 3EPPA 1ET7A 4PY7A 1RQXA 1RM4A 2W71A 4GG6B 5EEHA 1U8HA 2X3YA 1H1LA 1KZ7B 1F7UA 3NLLA 2ZZNA 3MLVL 1PWXA 1KVTA 3AL8B 1RJCA 2OR7A 1ENPA 3JQGB 1TNNA 4TTSA 5IXSA 4NFHA 4JR0A 2MCPH 4A1RA 1VRCA 4OQPA 4GG8A 1KJMA 3CKMA 3P27A 1W0KA 4Y18A 3E1SA 3V8EA 2TRSB 1M7DB 4W81A 5IVXE 5KJRH 1NVFA 1ISFA 4M0MA 4RK4A 3ADKA 3OICA 4JI7B 2IY9A 4OMCA 3AF0A 3QSGA 4RNDB 2ZEJA 2PBLA 3INOA 2BP3A 3KM1A 3TQSA 1E8ZA 4E2XA 4R2IA 5GRYA 1T89A 5F21A 3WFBL 3VYPA 3JV6B 4OD0A 1Z73A 3WB0A 1E58A 4ENQA 2DQDH 4WFEE 3D85B 1A3RL 1FMCA 4I4NA 2BOBB 2FLVA 4QO1A 3TLGB 5GZNA 3RJOA 1I3UA 1MB0A 2XMZA 1IZJA 4RSYA 4CR6A 4GZMA 1VQ1A 3JTMA 2WLHA 3PWVB 3UMBA 1M8JA 4AI7A 4Q7EA 2HHAA 3CEHA 5HNKA 2X6QA 3G7NA 3JPWA 2ZOUA 2DIAA 5DGHA 3C3PA 2K2WA 5A6LA 3AEKB 1KA9H 3DDUA 1A9YA 3IB6A 1VSTA 3IEXA 1MCBA 1UOWA 1HM5A 4AVYA 5KYGA 4I50F 4W5NA 1XF3B 4G5OA 3IV7A 1KXTB 3GSQB 2YUZA 4ZDHB 3W90A 2BR4A 4BRVA 2DIEA 1DARA 1A7NL 2JTYA 3HDQA 2R4TA 3T5TA 2CV0A 5IJAA 2XHZA 3K0CC 3UK1A 4DNOA 1ECPA 2DWDA 2WBJA 2X9WA 3MBKA 3O3EA 2C57A 2PBRA 1QPZA 1BMQA 1GCYA 1KLUA 3L4UA 2PWFA 1MVYA 1XCLA 5DHTA 2I6UA 3SZKC 1VHQA 3ABLB 4I2XB 3MLTA 3VYWA 5H5JA 4PQXA 2ZG1A 2G3NA 3M9XA 4YQFA 4X4YB 2MINA 2HJLA 3DLAA 4PBVC 4YHLL 3II2A 5GGQH 1SVCP 2CKBA 1ONBA 5JSZB 2C5DC 5I1IL 3VOAA 3FOBA 4IJ6A 2JBAB 4FNPA 3RB5A 2PYZA 3ECBB 3GTTA 1M2EA 3F8SA 4IHJF 3IRPX 3WRXA 2OGTA 1VHLA 2QDKA 1NBCA 4UOQA 4OQDA 5FKJA 4KH0A 1ORVA 4UVGA 3CISA 3H3JA 3GFOA 2GEDA 1LK3H 4C59B 1QSEA 5JSFA 4UAVA 4AY4A 5MEQA 4LCCC 2H9GB 4RUKA 4PJIF 2FJ0A 1FU8A 5GJBA 1J5DA 1JHYA 5F9OL 1BJ1H 3LPPA 3QTBA 1ZANL 2BIMA 1DOHA 2NVUA 4RZCB 5EWMB 1U3DA 1WTCA 3D12B 2BGTA 2ZK7A 4HJRA 1F42A 1TVBA 1V7NH 1S4QA 2NNAA 1YVDA 3L3GA 4H8QA 3FYIB 3TQFA 2NAFA 4BKPA 1CQIA 4JIMA 5E1DA 1Q2XA 1DKMA 1GTL1 1SBCA 1PWEA 3V2HA 3LEXA 2PO7A 3SBWA 6ADHA 2EEAA 1H3XA 1Z4OA 3CBGA 2CLZA 1OW0A 2B5VA 1JDVA 1NW6A 1AYOA 1JGUL 2VDUE 2FH8A 3JWHA 1V4BA 2I27N 1HXKA 3QVOA 3F9CA 2IOYA 5TGDA 3RJ5A 4ES6A 4EECA 4CE6A 2BO0A 4DG9A 2QU7A 3U0TA 2YQ2A 2A1UA 4DB2A 1QQ6A 1DBKL 4N9GA 1HWGB 3L0CA 4DV3B 4NDMB 1CLVA 3K6DA 4WDIB 5BV7C 1JZ2A 3EN0A 1J49A 1X9IA 4HAGA 5FYKE 2AA3A 1SN7A 2YZMA 3TLMA 3GRVA 1EE2A 2ZRAA 3EFDL 4P5KB 4AG5A 5KC9A 4G4SO 4C3UA 3ARDD 3JYQA 5AZEH 5CVDA 2AJZA 3UN1A 4HIPA 4LPUA 4MJ7A 4G0MA 4MQFB 1U2HA 5JDIA 1MXFA 4FWWA 4LIQE 2DYPA 3VAEA 5JYLA 3OLQA 3TDNA 1TYBE 1HDYA 1TZGH 3FB4A 1TJGH 2EEPA 1QHEA 2HJVA 3L9RB 1T5IA 1R46A 2B1RA 4FCHA 2R97A 3NI2A 3ANXA 4D9BA 5KVFL 1I8TA 1MPTA 4GU5A 1U8LA 1URZA 4PICA 2BDNH 2BJHA 1FYFA 1K8IA 4YGXB 4PYLA 1N8KA 2WHRA 1NPDA 3PJEA 1Q0YH 4E0RA 1KVUA 3PITA 2HADA 2HRQA 1C08B 3F6SA 3OTWA 2RGUA 3WICA 4D02A 1BXGA 1ULUA 5DMGC 1OYVA 4AZSA 4ZFFA 3R09A 4HD8A 1DCFA 1JE6A 1N0LA 3V1KA 5LLIC 5KKNB 1AHKA 2WINB 2ATPA 3V32A 2P45B 2HCJB 2BVOA 3QC5X 4DLRA 3LVBA 5GS0L 4UM9A 4LGPB 2AS0A 2QRZA 2HAZA 4X91A 1T20A 4D8UA 4OZHB 1QO7A 1L5ZA 1UQRA 3MB5A 4XWKA 3KKLA 4M7WA 2NY3D 2WVTA 3L01A 4PJ5B 2L42A 2HRHA 1T3SA 3GLFA 5DRTA 2ZCKL 4DTGH 3G2LA 5HXAA 1ZHNB 3QUYC 3HS0B 3WL7A 4Y4KC 3V1LA 1G87A 2WT4A 1LJ8A 1CYXA 3BVPA 3C9NB 2GI7A 4Q4CA 2PYFB 1FO0A 3BQVA 4YLEA 1WSAA 5K6TA 3SE3C 1MDAA 1N18A 2CEAA 2G5PA 4ER7A 2GPJA 3W4KA 3VDXA 3QYFA 2VOTA 4XCQA 2ZQYA 5FOQA 4JM2F 2HTLC 4MCAA 5JJ5A 2LT9A 3AF5A 3PHAA 3MLUH 3UBFA 2E4WA 5IC4A 3BWZA 2G9KA 4UTBH 4MUGA 3CSYA 4Z9AA 3PXXA 2OY0A 4PQRA 4Z4CA 3RGBA 4KNTA 1U7XA 2SICE 1ZA6A 3GIVB 4AQ1C 4Y9SA 2ST1A 1M74A 1HKHA 3B1WA 1JFHA 4Z7OF 1REIA 2FOLA 4G1VA 3P3SA 3P45A 4Y9UA 1AXEA 4HSGA 2APTA 4Y5YA 2IYNA 1BOOA 2DAVA 4ZMZA 5TK4A 5JRJA 2ACKA 4FJYA 1U93A 1STOA 2F3QA 2R1UA 3ANLA 1SBSH 5BOVA 2CLIB 1CBJA 2GSWA 4DFDA 4YMGA 2PU5A 3T7CA 2ZRQA 5IVZA 2QSCL 2HTKD 3BFVA 1YMME 3LV3A 2G60H 1WZUA 3MX0B 1VMDA 4X60A 3M4NA 3KPSD 2W43A 2AX4A 1AI1H 2E9GA 5C09D 3KQHA 1BQEA 1P9OA 4KOCA 4PJ9C 1B8PA 3ICCA 3APNA 1ZINA 3HUJF 4IMPA 1KCRH 4CCWA 4U6VH 3ULUE 4YI3A 5KPJA 2XKSA 7CGTA 4YBLB 3SJZA 1IEXA 1NI5A 2WJAA 4QREA 2YXNA 5CLJA 4QULA 4OT1L 3DNFA 1VOTA 3O4VA 1PFKA 3ESDA 3T0GA 1CUZA 4AC9A 2LR4A 2QQKL 4KKCD 1YYML 5KOVC 1CDDA 2EUVA 1MNUL 5HZHA 5EZJB 1S2IA 5AKLA 1OSPL 4NN6B 5KBMA 1BXAA 1AN9A 5EJ5A 1ZHOA 5HJ5A 2OX5A 2P7HA 4GT0A 1LS1A 2EDKA 4DQXA 4GOSA 4HISA 3U7RA 3TN0A 2XBMA 2XWBB 1XXDC 4POAA 3TBTA 2WIMA 4HP5A 4M7PA 1VKXA 5KVGL 1EWHA 1A7RH 5D1ZB 3WBFA 4ONHA 3U80A 2QX8A 4CLHA 4K1LA 1MIOB 2AE1A 1R3LA 3ZQXA 1Z62A 5E2IA 4DAGH 3UJ7A 2C0QA 1SURA 2R87A 1ORIA 3AAZA 1JZHA 2UZIH 3C41J 4X8CA 4XFJA 1GG2A 3MBEB 3QVJA 2Y0DA 3ML1A 4N39A 4TROA 4NN7C 4G07A 3B7UX 1ODJA 1XMQB 5GS1C 1ZOLA 2Y3AA 4ZZ3A 1A6VL 2GJSA 5I1KL 4JC8A 4MVCA 4K81B 4KTEL 3PWPE 4FI7A 4ZYKB 1OXBB 3V8QA 4PVNA 5HS6A 3WFEL 4AVKA 1GW6A 2VUIB 1YYCA 4A0SA 3V10A 5E6RB 5DVZA 4UUMA 5ANHA 5K6AC 4CCAA 4IOFC 2HVKA 4YSSA 3IHKA 1PLJA 2CVPA 2NPLX 4PWEA 4F8EA 2WWMC 2PMFA 2ZIWB 1RSYA 1FMJA 3PTAA 4U4IA 3HA2A 2WOBA 5IG2A 4RXMA 4LGYA 5CD9A 4UU1A 4JCMA 4L85A 2MQ3A 1CICD 4D9LH 4PJBA 5I6MA 2EL9A 1I31A 1DSSG 2FDXA 4QX6A 2VCYA 4U8GA 3N0VA 1ZMBA 2EFHB 4BYGA 3EH5B 4L05A 3ZK8A 3T65A 4DKJA 2XV1A 1VIMA 2HV9A 5JS2A 3ILHA 5HI3D 1WTGT 5EL0A 2QN1A 2XRAH 3GXBA 2AJYL 3NH7H 3RWGA 1EFCA 2WMOB 3IOCA 3DX6A 1ZQ1A 2JKXA 2A6IB 3UIZA 2EYSA 2F7OA 3N3BC 5GHWH 2J32A 1KO8A 3BWDD 2X4TB 4FXGC 3OE7A 5BRJA 1MKYA 4G9DA 2VWHA 5GGVY 2A5FA 1GUAA 5SWZB 1C2YA 4KO4S 4YCMA 4UDUB 4PJXE 1UADC 3STWA 1RW4A 4HUQB 3IDMA 3RUAA 5TE6H 2V4ZA 2COKA 2R47A 4O1MA 4C4RA 2G36A 1E7QA 3DS8A 1FVHA 4EHIA 5EPMB 4N8EA 4TTPA 1EU1A 4JQXA 2PZKA 4B6EA 2CHQA 1DL5A 2HJGA 3WISA 1RPZA 1OBCA 3AL0C 4YRSA 4LFAB 2YPVH 4JVWA 5TF1L 4ZV7A 2CLFB 5E7JA 2ZQ5A 5J6SA 3VH8G 3MV9D 2GCOB 1UZ6F 1XHLA 4YJ2A 4Q3LA 1G7LB 1MI5B 4NCC2 3EDMA 4LYHA 3D0LB 3X13B 4X8LA 1NGXB 1PK7A 2FAXA 3LKOB 1PI3A 3B5IA 1C3VA 2FGKA 3ZWXA 4XPTH 4OY3A 2WC1A 3RFZB 4Q6WA 1Q1JH 3ONEA 4EGQA 1AGCA 1C7IA 3IUNA 2G82A 3MBWB 5K0TA 4KQ0A 4OFYD 3EPJA 4WGVB 2Z5LA 3VYVA 1YGYA 1E64A 3UJPA 5TIIA 1NF3A 3OURA 5KNDA 1N5AB 3GRPA 3WSQL 3HCOA 5SX5H 3BHBB 1RM3A 5HKAA 5I26A 5ESVB 4KU4A 1MHEA 1SVUA 2WWRA 3WY1A 1WUKS 4UHBA 1WUNT 4FVTA 4PJFB 1QX3A 3HE7C 4BQPA 3N44B 3ZXIA 4JMXA 4LV8B 3QWRD 2LTQC 1KPUA 4HNUA 2CJTA 4HY3A 3K0BA 4ZQTA 1QLFB 4KE8A 3ARZA 4UOW1 3PQDA 5B12A 1P7ZA 3MCKB 2PANA 4EJ1C 4BJ1A 1YPZB 4KTTE 3IS1X 1PW3A 5JS1A 2YPLB 4DGSA 4F1SA 35C8L 2VN3A 1I3OA 5BV0A 4P49A 1SQ0A 4O1HA 4L0QA 4EDWL 2YQBA 3V6FA 5AVQB 3DVGB 4HEMA 1LMIA 4WFHE 2MQ0A 2YVAA 1ZJWA 4N2OA 2IPLA 3CFKB 1JF1B 3A67L 6AT1A 2WE8A 4Y67A 4URVR 2FX7L 4M03A 4HH9A 2GHTA 4N2MA 2QSVA 2RJNA 3PKIA 3EULA 3K0YA 4OJMX 4E2FA 3EC2A 3FONA 4DVRL 1KCUH 3UTTA 4PJEF 4E7PA 1O58A 5CG2A 2WNHA 4DWOA 1Z7EA 1T4WA 5DTEA 1QACA 1F6WA 2Q4RA 4NK5A 1IIIA 4HLZG 5EU4A 2PW1A 4HNTA 4WHCA 2X3CA 3C2QA 4RVCA 2D3WA 2N7BA 1FLNA 1FRFS 3U1VA 4DDMA 4BX9A 2BWIA 2QVYX 2EDNA 1AZZC 4NQCA 1JPGA 3U7WL 4ELMB 3KJGA 2CWDA 3RVLA 1DOAA 4MV4A 1MD9A 2WLSA 2NZ8A 2WBWB 3FYUA 2YHIB 3D87B 3UOGA 1T21B 3P1VA 3CH1A 2YSSA 4R97C 4XPFL 3NTUA 3L1OH 3B9VA 1QDLB 3KL0A 4GM0A 5D96C 4GSDL 4NCDA 3NR2A 2C9CA 3DSFL 2AXFA 2GKSA 3DV6B 1K9SA 3RU7A 4KZEL 5GMOA 4YMTA 2I34A 1P8JA 5CJOL 3AUAA 5KOHB 5TGTA 4PV1C 4I18C 3FX2A 1BAWA 2ZW9A 1CF4A 3VH8B 3A9UA 1VP3A 4HEPA 4QAJA 1SM3L 4EN3C 4M61A 3WNVA 2IS1A 4KDEA 3PTLA 1AGBB 1SOAA 3VMFA 4Q58C 2MH4A 2DPHA 2A2ZA 1B4JH 1E66A 1JEQA 4DQOL 1DAHA 2ON6A 3IDXL 2EIZA 2APBA 3RVVC 3ZGIA 1T7XA 2Z3ZA 3IAGC 3GXPA 2WUBL 1X5IA 3IVMA 4MDEA 3GCWA 2B37A 3O11A 3VDCA 3W2GA 3KLLA 4NX0A 2IDZA 3Q5GA 1S8DA 5F9AC 4AMWA 1Q44A 1PL0A 1ZDMA 1Y7TA 2OD7A 4Q47A 4V2IA 3IMUA 3VD0A 1DQML 1OAUL 2ZTMA 4DPCX 1C41A 4M8QB 3QELB 2XMPA 3N55A 1FOEB 3NIDF 4TLMB 4IJMA 4QY8B 4CN9A 1JXOA 2CHXA 2WOJA 5EJFA 1PZMA 3BCUA 2UAGA 3AVVA 1SCJA 2VTDA 4LLAA 1LI5A 1XEDA 3VXRD 4W8GA 4BO4A 1K3ZA 4AWBA 1UXLA 2OYSA 5I74C 4HDAA 4HCRL 1ZVKA 1UAAA 3BVXA 3MOGA 1N2RA 3EG9B 3OJ2C 5CLHA 4GAGL 4QJ4A 2WPDD 1BHO1 1JTTA 4XNUL 5ILTH 2J1KA 2O3QA 3GJ6A 3G6JF 3IHWA 1YEGH 3Q2CA 4PLZA 4GI1A 2XX0A 1DKLA 3B7TA 2EBWA 3MRVA 3QARA 2R65A 1SN0A 3TNDA 4UEKA 1C8BA 4Z7QF 2ZGVA 4WTQA 1WUHS 1YC8A 3RYHB 4K9RA 4Z1MD 4AWJC 1FYTE 4AY0A 2CJFA 4J7UA 2XG4A 3DYPA 1JIVA 2JKYA 1ISRA 4DGVH 4C6SA 4QGTA 2ZDQA 2VKQA 3FPJA 3WLNA 3VE0B 5D86A 2QP3A 4AGNA 4JPVL 4FGSA 3BH0A 2YMXH 5E2UL 3L79A 5AW2B 1JR3D 5LGJB 3SE4A 4Y2DD 3IAXA 3KXIA 1CLOH 2X6CA 1XZ0B 4YCAA 1NSNH 2O07A 5E5RB 4PG9B 1Z9BA 2QTMA 3EYOB 4JQZA 1R0XA 1JAZA 5U4QA 4H7VA 1JUFA 1JR6A 2AK4A 2AMUA 3BAKA 4KSYA 5IHUH 4HYTA 1NGZA 3B7GA 4P9HL 3K9NA 5ANRB 1MREH 2IFGA 1XB8A 2YYAA 1FAIH 5G4OA 2PKRA 2AS5M 4EUNA 5JHGB 1AZTA 1T9BA 4JR9L 1T1ZA 4HMPA 1BE0A 3EC1A 5CJQL 4A7GF 4CGTA 5IH3A 3PWSA 1KJIA 3NTQA 4L1DA 4UQCA 3QI9A 4JKPH 4XMPL 4HAWA 1ZTMA 3HN7A 4AWXA 4FYTA 1FC1A 2L69A 3TM5A 4DP2X 1SXGA 5EC1A 3WA7A 3I8XA 4BWFB 3C5VA 1RHHB 5JOFA 3BTSA 3OF3A 3ILQD 5K03A 3TMAA 1GCIA 1KC3A 3LZFH 4KLNA 5HGXA 1NANI 3TFKC 2P46B 2CFOA 2QR3A 1WMEA 1TJIH 3WJ7A 2H6PB 5AB2A 3JWNH 3OCWA 2CR0A 2VPQA 3PXLA 2DJ4A 5A2GA 2NDGA 1I4TD 4RLFA 1LILA 3OLXA 4YDVB 3BMXA 1BVKB 1FNDA 1KMMA 4J2HA 5COBA 5JR1H 3O8XA 4Q01A 4MCNA 3I6GB 2NU6A 4P4KA 1Z5VA 4MQLA 4N87A 4QXGH 3IPCA 4JHXA 3ZCTA 5JQGA 5I0DA 4UUPA 3GMNB 4AEIH 3DE1X 4B4OA 3OR7B 5I9QB 1M1ZA 1PBTA 4QOKE 4O8CA 4RK0A 5F1OB 2JW5A 1BMDA 1JPSL 2CLLB 4FOMA 1GS8A 4RC9A 3ESXA 5ADOL 1QU3A 3DFFA 5TPWL 5E9DB 3O47A 1VSVA 2WO3B 2N42A 1I7SB 3RADC 4JPQA 4PZAA 2XQIA 3UPRA 3FF4A 4GBXA 2LDXA 4UYPA 2FQDA 4QG7A 4OZ4A 3Q72A 1XV8A 5G4KA 4GKZB 1JPTH 3OZXA 5E7MA 5REQB 4IU3A 4EVNA 2O72A 3R7QA 3CHYA 4AF7A 4YHOL 1ORQB 3QUKB 5JASA 2WXRA 4BCZA 3CN7A 4KUEA 3KJ6H 4P46A 3DTVA 2EEXA 3OETA 5CFOA 1LPSA 4JX9A 4M1ZA 4QHKJ 4D99A 1U8KA 5C53B 1I4WA 5IAEA 1EV2E 1PIWA 2NUPA 1M8KA 3HJEA 4W9ZA 3ZYJA 2IV3A 3B3JA 3CZEA 4OLZL 1MEOA 1YMUA 3NBFA 3NG1A 5A3VA 1FP4A 4UVDA 3F7PC 2RD0A 4D4GA 4GZ5A 2I66A 4DPBX 4TPRH 4KXFB 3LS5H 1NFQA 1LO0L 2JV6A 4MWTA 1D9KD 3D6VA 3ZY4A 4AP6A 4FWBA 3IEPA 2DUNA 3IVKA 1GGBL 5FNVA 4EI5D 1NOIA 4OLXH 1MP0A 3LUGA 3O2DL 1XK7A 4JP1A 1AQMA 4PGCB 4FGJA 1OAKH 1DQQA 1FE8H 3BTUA 4PS1A 3GWGA 1WVIA 1FA9A 1R8SA 4MSUA 4U1HB 3KUUA 1U8CA 2C4FU 1A4AA 2WYTA 3R3JA 3CX4A 4MIYA 1DJMA 3ILPB 3S2ZA 5JW3H 1V25A 4XPHH 4O59O 4WU5A 2EQAA 3OFND 2VUOA 3QIVA 3LP5A 3WIIL 2FHBA 4RH3A 4ANUA 3AFMA 3EOAB 2WDZA 4FDAA 3TJMA 2GHWB 4IRJD 3KKQA 2FNAA 2PO6B 4QIRA 2AJBA 1AQ6A 5AW9A 4NJAH 5EMKA 1I7ZB 5K3AA 5CEEA 4JKKA 4RMJA 4XLTA 3H3PH 5JXHA 2LD4A 4DDWA 1XP5A 5DMKA 3GMRA 2JLPA 1IZKA 1GNVA 2IH1A 5CX4A 1HA3A 4E5SA 4PWIA 3K73O 1K97A 5T6MA 2SCUA 3CZUB 3UVEA 1LBHA 4I9WD 3T3NA 3LA6A 2ENPA 3GJXC 1ZD4A 3VKHA 1SVOA 2VP3A 4I13B 1U2RA 1FNLA 4NOMA 4BLTA 2A4CA 3CRMA 3RC2A 1VEPA 4APXB 3BJRA 4RHYA 1MA3A 2PUVA 1R9JA 1ZXLA 4MD5A 3QXWA 4QYOA 1D4AA 4LBWA 3NIFE 5JCOC 3MMEA 4UTAH 4NO0A 3CUPA 3HCFA 4X6LA 4UDXX 1B42A 2IU4A 2VWEC 5FLEX 5JXJA 3W39A 4ZEOA 4LDLB 5ACZB 3UAAA 1E9VA 2OB2A 2IT1A 4DGWC 3AI2A 2WYWA 3FQ1A 5FM8A 2CGZA 5I47A 2CV2A 3SGKC 1DEHA 4FMBB 1NUUA 1HH6A 4UTXA 1TFUA 2A35A 3UBTA 1T3LA 1XB6A 2YIHA 1NONA 1FYHB 1JNNL 3FHLA 2JATA 3L13A 1EZZA 1EAQA 1TZ2A 2FT7A 5AQ0A 4D9KA 2YD0A 1YCFA 5KBYA 2GO1A 4M76B 3UWOA 4MWOA 3IF1B 3MRPA 4CR7A 3FYCA 4PB9L 2FPGB 4D9HA 5JMOC 3AOEA 3IBFA 3H7LA 1WSWA 4ZOLB 3LJ3A 4LSRL 3H5LA 4L8BA 2G75A 1RIUH 4PCKA 1Z4PX 4NPHA 1K3IA 3MM4A 5FB3A 3VPHA 4FD3A 5CT5A 4ZOCA 1HSBB 2RGGA 5JNVA 3JQAD 2VXCA 3BCFA 1O08A 2O14A 3AQ4A 3LXMA 1OXKB 3LZCA 1NOJA 3ELUA 1XX9C 3FT1A 2VYCA 1LM8V 3TBHA 1YJQA 3F1KA 2FMKA 1ZE3C 2HCZX 3DX0A 3LVEA 2CJXA 4D8XA 2BSED 1UCBL 1IVLA 1YVEI 1WZAA 5C08B 3OT5A 4C58B 2AC7A 3MNZB 1DI0A 1T9DA 3DEJA 3L6RA 3AW9A 5KZCB 4AJOA 1QDEA 1F12A 1NJGA 3VI4B 2H1XA 1H5BC 3RY5A 5CFLA 2WO4A 4KFRA 3N58A 2D5BA 2DQJH 4Y8DC 1VHWA 3G9XA 4LJSA 3T5MA 1M34B 1RUPH 3E58A 4MV8A 5KVAA 1N1DA 2P2LA 4J76A 2OMEA 4OF3A 3OPXA 4XH2B 1S89A 4E46A 3HZ3A 1MG5A 4R8SA 1KYWA 4LHJB 5ES4B 4KAFA 3BL6A 1RIIA 2GJPA 2GK4A 4Z7IA 3F2IA 4M93B 5D7JA 2Y2TA 4NIMA 1UD4A 1GAFL 3OA2A 1M6OA 4OXYA 3IVRA 3VU3A 3FYEB 2WQ8A 4AQDA 4H0NA 2R7EB 2EGHA 8GPBA 4WZAB 1TOXA 5HVFB 1XTSA 4Y1RB 4DP0X 3GM0A 4RMRA 1BFSA 2C26A 5JD6A 1G8KA 4UEWA 3DE7X 4F1KA 1KQPA 2BW4A 4LF6B 2XWEA 3KWLA 3A4EA 3QUTA 2NZ1A 2LQRA 3GRAA 5D6CB 2JB6A 4HWZB 5A2KH 4CMEA 2EUWA 3ATBA 5DD0H 2W70A 3LKQB 4WI8A 4N8UA 2F9BT 4UREA 3OVMA 2R25B 1J8VA 4Y5VA 2BKXA 1OYOA 2UY7A 2OXEA 3ISWA 2J8ZA 4MVJD 2I8CA 4L5IA 1ZU4A 3ZKMD 1DEKA 4UCFA 4H18A 2JLWA 4UZSA 3DYIA 2O0HA 5JNRA 1FX1A 4L02A 5I75B 3I6BA 3IAM1 3EO0B 1AO7D 1A6UH 4JB0A 3IE2A 5HDWA 2IYSA 3KPMA 1QHQA 1YA8A 2O0MA 4Y6OA 1YECH 4J0JA 5H3HA 1YA6A 1W9MA 5AOVA 3TJEL 3OTIA 4LOUC 1U58A 1D6VL 4K9EC 4GPVA 3FKQA 4JL1A 3VFTA 2CVZA 2M6KA 3OJDB 3FO9A 3Q15C 2X19A 1XH2A 2GW5A 3LPFA 1Q15A 2QMHA 2JIZA 3R8FA 1MELA 2MHCA 2WF8A 4YFDB 4OHWA 2GEBA 5EXEA 4XPAL 1QSEE 1E2GA 4MA1C 4AW7A 4HZUA 4Z3DA 5IZCC 4RY2A 5CXQA 3VD5A 4RO0A 2RGSA 1XMVA 4R9RA 2YFKA 2V7HB 4JSRA 3X12A 3M34A 3W77A 1SEQL 1YNTA 2BEWB 1BDJA 1A4JB 1XF9A 2GUGA 2J8UE 3IDIB 4WWKB 3TA3A 4GQ9H 5AB0A 1PJ9A 5GS3A 3F46A 4JXZA 5B1AB 2AF4C 1E43A 1YEJH 4K2UL 2R1ZA 4RZQA 1OX5A 3DGCR 5DS8A 1P2GA 3DTUB 2JIOA 4KZKA 3QXTA 4A2PA 2WN2A 1T5LA 4N3AA 2GUOB 2HEGA 3SO5A 1MO4A 4YHNA 1F1GA 3ULVC 4EZKA 4D9CA 4NJ9H 3I02A 3ZBPA 1WVGA 4LZKA 5DN6A 2ZE7A 5F76A 2JGDB 3G6DH 1CXKA 5D5PA 4YDLC 4GXVL 4FQIH 2Y67A 1IXKA 4C4PA 4GT7A 2IQ9H 3ZY2A 4WEQA 2P49B 5I7RA 3NUZA 3UWKA 1VJ1A 2IXBA 1NYLA 5K0NA 1ULAA 1YMQA 3CG0A 4P57B 2XGOA 3N41F 4BGDA 3PBKA 4QRRA 4V1DA 3FUMA 1FORL 3NJKA 4YALA 5IVKA 1BW8A 1XTBA 3TYGL 3LT5A 4TQ8A 4JO1H