5E6SB

Structures of leukocyte integrin alb2: the ai domain, the headpiece, and the pocket for the internal ligand
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
459
structure length
455
Chain Sequence
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRKVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Integrin alpha-L
publication title Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
pubmed doi rcsb
source organism Homo sapiens
total genus 127
structure length 455
sequence length 459
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5e6sB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5e6sB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5e6sB03
2ADFA 1AO3A 5ES4B 1YUKA 4UM9D 1FNSA 1SHYB 1V7PC 3BN3A 3AL9A 3F74A 3AL8A 3K6SA 1IDN1 3ZE0B 1OLZA 1JEQA 1QCYA 1BHO1 4IHKA 3ZDZB 1U8CA 3K71A 3VI3B 1M1UA 4IGIA 2VDLB 1PD1A 3E2MA 3HXOA 3OKYB 1TYEB 4WK2B 4G1MA 1DZIA 4FX5A 1IJKA 3F78A 1SQ0A 1SHTX 4MMZA 3T3PB 1DGQA 1RS0A 5KYXA 2M32A 1JEYA 1QC5A 2NUTB 2WINI 3HXQA 2VDNB 1Q0PA 2VDMB 4Z7QB 3ZE2B 2IUEA 3AL8B 2ODPA 2NUTA 3ZE1B 3K6SB 1M2VA 3TVYA 1JEQB 3EGDA 2VDKB 1U8CB 4WK4B 1N9ZA 2NUPA 3K71B 1AOXA 2XGGA 2VDOB 4JX0A 4Z7NB 2QTVA 4MMXA 1XDGA 4NENB 1MJNA 5E6UA 2I91A 1M1XA 4G1MB 3OL2B 2I6SA 4XW2A 2O7NA 3EG9A 3EH2A 2VDRB 1UEXC 4MMZB 1CK4A 1NA5A 3IBSA 4JDUA 4M76B 4WK0B 3VI4B 3M6FA 4HQFA 4NENA 1MHPA 5KYXB 1CQPA 1QC5B 3IJEA 3PPXA 3OL2A 1XUOA 3Q3GE 1YVPA 1N3YA 3EGXB 3NIGB 1LFAA 4UM8B 1JLMA 2VC2B 1MQ8B 1M2VB 3EGXA 4HQNA 3EGDB 4F1JA 5E6SB 2NUPB 4WFQA 3PPWA 3NVQA 4O02A 3QA3E 4CNBA 5KYYA 1RTKA 4MMXB 5E6UB 1MF7A 1MQ9A 4C2AA 1M1XB 4HQLA 4FWWA 3EG9B 5E6SA 3ZDXB 1IJBA 4CN9A 1BHQ1 1JV2B 4UM9B 1JEYB 2XWBF 2VDPB 3IJEB 4G1EB 1SHUX 1T0PA 3EFOA 4C2BA 3FCSA 2UZYB 2XWJI 3OKWA 1JV2A 2ICAA 3BQMB 1L5GA 3V4PB 4G1EA 3TW0A 3K72A 4WJKB 1OAKA 1U0OC 1ZOPA 2ODQA 4K3JB 1ATZA 5HDBB 4O02B 3NIFB 1PD0A 1YVRA 4HQOA 4MMYA 5KYUA 4O3UB 2WW8A 4PN7A 5KYYB 5KYNA 5KYWA 1IDOA 5E6RA 4C29A 5HGJA 2B2XA 2VDQB 3V4VB 2X5NA 1M10A 3N2NA 2I6QA 4IXDA 3AFCA 1ZONA 3TCXB 3EFOB 5HJ2A 3FCSB 1ZOOA 5LN1A 3GXBA 1XDDA 4NEHB 3PPVA 3EH1A 3FCUB 3EOBI 1L5GB 3HI6A 3RAGA 1PT6A 1U0NA 2P26A 3K72B 1T6BY 3TXAA 1SSLA 4BJ3A 1PCXA 1M2OA 4Z7OB 4MMYB 3T3MB 5KYUB 3EOAI 2NVOA 4DMUB 4HQKA 1RRKA 1FE8A 5E6RB 4F1KA 3NIDB 2P28A 5BV8A 5KYWB 3PPYA 4O3TB 4GZ8A 3BQNB 3ZDYB 1AUQA 1MQAA 4CN8A 1RD4A 3ZQKA 4A0QA
chains in the Genus database with same CATH superfamily
3RIFF 1K6QH 1GKKA 1IL1B 3AL8A 2CVOA 3MRPB 4JGJA 5I18H 3UY4A 1EBAA 2CBXA 1U91B 2IADB 1KVRA 3M7FB 1PK9A 3BIAX 5JDIA 5TF1L 4EN2A 2WWVD 1OM3L 2HLHA 2QQQA 1ANKA 4WV1A 4KOEC 1CIUA 1N2CA 4TTJA 1DBJH 2C3WA 4CEIB 3HNVL 4LGRB 1SN5A 3STVA 1XGQB 4KVNH 1JHAA 4WF7A 4YFYA 4POYA 8FABA 1E2MA 4J3VA 4N9WA 3I3EA 2ZI6A 3GGSA 12E8L 4H8WL 3EFHA 2OXHA 1D5MA 1GTL1 3DX9B 4PS7A 2UWEE 4YDIL 5KSUA 3KPRA 2IQAB 3G5LA 4OBSA 5T5QA 1SVLA 2NZXA 3KZOA 4NNPH 4DLNA 3WFEH 1QUPA 1RWNA 5EN2A 2V4ZA 3AT1A 4BEJA 1U3DA 4HJEA 3MJSA 1CXZA 1YDEA 4Q4DA 4XCNA 1SM4A 5DS1A 4UTPA 5B38B 2PZEA 4RACA 1SJEB 1IIKA 1RNLA 4EIWA 3W2TA 5H5JA 2XXAA 2BVQB 5K1VA 4HS4A 5EE3A 2Q9UA 4EW2A 5IKEA 3CXDL 2JLQA 1A2YA 3NCEB 4CKEA 4PR5B 4Z7QF 3K9GA 4NXNB 1H94A 3EH4B 5H80A 4B5EA 4LZAA 3VFRB 1DCEA 4HLZG 3SAJA 5DGQA 2OK0L 1J5EB 2QSCL 1SIUA 3NIDB 3FTUA 4MV7A 4Z7IA 2COVD 2UY6B 3QUXD 3DLCA 4S11A 3TSAA 4KI1A 2BSRA 2FO4B 3BVUA 5IKCB 2JKXA 3LMKA 1AGBA 2BGKA 3QLVA 2XF8A 1RBMA 3U56A 4ZFOB 4RJKA 4MD4B 2XE7A 4GXFA 1JIVA 1GGKA 1FXWA 1L5KA 1INQB 6REQA 5D1ZB 4FXGC 1R8YA 1MQ8A 3IDIB 1HE4A 1C2TA 4FDTA 4OL0A 4B4DA 4C0XA 3VXPA 4ZRDA 1BH2A 1POXA 4LBVA 1TEHA 1SFDA 2FEOA 4UDUA 2Z93B 4JB9L 4JRXD 2Z3FA 1MDAA 4PJ9C 5L88L 5JAUA 3THYB 1KL7A 1ZE3H 1A3CA 3B8SA 3W0WA 3KETA 4DR7B 1H6DA 4ANVA 3V4VL 1T7XA 4C3UA 4D43A 3QFHA 5I0DA 3ZDYF 5DT1L 4HJ1A 1MFEH 1CS0B 3SKVA 3DVSX 5K03A 3TUIC 4MMZC 5T33L 1KLUB 3LFUA 2WZQA 2WSLA 3OCXA 4F7MB 1BEZA 2WCPA 4YE4L 1RVFH 4EYQA 3ORQA 5G55A 4YCBA 2NY4B 4Y2XA 2R4SL 4P3KA 4JEMA 3VJ6B 3DYMA 3WI9A 2Y05A 4X8OA 4DQLA 2GMWA 2V7NA 1THMA 3SBWC 2ZYHA 4YI5A 3K0CA 3PX2A 2GCIA 2P26A 2EDXA 4FK8A 2O6PA 3FFOA 3NALA 5LZ5A 4PIPA 5CT8A 3K7UA 1V5EA 1I32A 2HT2D 1UKEA 3VI4F 2DJUA 4OHYA 1WAEA 2EICA 2BKUA 1OPGL 4JVOA 4FQCL 4P0QB 1WETA 2DSTA 3EXHB 1E3WB 4Y67A 1MW8X 5B2ZA 1QCYA 3VXQA 4IHAA 2HLDA 4CIDA 3V7NA 3OO1A 4UMVA 3CLSC 1YU6A 4IRZH 2J9FB 3GLGE 4ODSH 2EZ0C 5FO1A 5CFMA 3NZ8A 3A67H 2EJVA 3EJYC 3FDWA 2BMWA 3D6GA 1HDYA 3WIIH 1XDGA 3OA0A 1AHWA 4XASA 4R7NB 2C0PA 4DIBA 3DVLA 3IJEA 5F97E 3S68A 1LA2A 4F9FA 4YCJA 2AK2A 1K8DB 1XPRA 5LLDA 2R68A 3D08A 5IBUG 1HQKA 3U3OA 4BFZA 4W5QA 2XYPA 4J7XA 2CLEB 3MGBA 2NU8A 1W4BA 3D4LA 5CP3A 1HCFX 3MA7B 4FNLL 1K3UB 4NHCL 2BRQA 5JIKA 1FRQA 1HRDA 2E4XA 4KXFB 5CXXA 2FEMA 4A0SA 2Z9DA 1FDRA 1O94C 1A6UH 5I9MA 2IHBA 1KLFA 1R0YA 2Y71A 2VDPH 1W16A 1YFJA 1DN2A 3RP1A 4ESEA 1DFHA 3C3AA 1MI5D 4F5EA 3OOJA 2QQNH 5L9DL 2QVXX 1V1RB 3TN0A 1GGBL 3T7JA 3JT2A 3ULUL 5FXMA 2GM9A 3N70A 5K2MA 2CCWA 2SCUB 5CH5A 4GPD1 1B6RA 4U6XA 4DM7A 2ASVA 2V7BA 4ZT1A 4OM0L 1IGMH 4IHKA 2ZRQA 3DX0A 4KG7A 2ATXA 1FGNH 2ZIAA 4OGZA 1H6EA 4OCYH 1JNJA 2XYQA 3OZVA 3E7PA 1EMTL 1SB9A 3FSRA 4P2RD 4CETA 1I85C 2QGZA 3ESQA 1N6OA 3OC0A 4HD9A 3P11H 5B38G 5EP4A 1IZ7A 2P4UA 4CLDA 4HU8A 1NVGA 1JERA 4OXKA 3TNNA 1FIEA 4X6CB 3B1WA 4W4OA 4X50A 4BFIB 4JO2L 5LWYL 1MFAL 1BOOA 4LGPB 1IH8A 4UM8B 4X0KB 2O2IA 8GPBA 2PMWB 3MERA 5E2TH 1D8TA 1H4TA 5D7SL 3KZKA 4CF6A 3AUUA 2DWSA 5JPMB 5I1HH 2VDRH 4GP7A 3C5JA 4OB7A 4OLAA 4NUJB 3B2VL 3VZSA 1MG2C 2CJUH 1HFUA 3W06A 1GY2A 2ODNA 1Z0AA 4P3YA 1J07A 4JQVC 1KTLB 3PL6A 1DAKA 1GKUB 1SUIA 4DMCA 1ECGA 3PSHA 5A71A 1L7PA 5SWZA 4OFVA 2HHJA 4L51A 2R2EB 5C5CA 1FPQA 3CHXA 5A62A 1LJ8A 3CMGA 4D4JA 4AV4A 3M5CA 1IC5H 3PUUA 4NZFA 3WUZA 1RRKA 3EZYA 2BIFA 2FG5A 4EJ0A 1FFYA 1EBFA 1FU8A 3E27A 3LKPB 1MFPA 4YR9A 5HILA 4EMTA 3VUAA 2XVLA 1ACYH 2VZEA 4HUQA 1VCAA 4CI9A 3HXOA 1MH9A 3BPLC 5BVGB 4RTOA 3I6YA 2O0JA 1FL3B 5LJLA 1QCDA 3G5VB 1QYRA 2PSSA 1N9KA 3O2SB 4M7ZC 4CKZA 1P60A 4C78A 3M70A 1H66A 3K73O 3X44A 5CA0F 1I36A 2Q1YA 4CDMA 4WWKC 3MGCA 5IT2H 3K0FA 1HXYA 4PO3X 1IXRC 2VDWB 1AXSB 4X5PA 4YX2H 5JFOA 1DWQA 4E6EA 4WLCA 5C37A 4PR0A 3THXA 2V1XA 1JZ6A 1G16A 1MHEB 4AT6B 3KCNA 2EABA 5D70L 4TZ0A 2P7HA 1L4BA 5GV8A 2PYEA 2WN3A 1JPTL 1IZZA 2B6HA 2GSGA 4L9AA 3PLNA 1KBVA 4XHQA 2RBEA 3KOUA 3SR3A 3MDJA 1P74A 3OB0H 1FVFA 3ZLQC 3RFXA 2V8LA 4E9VA 1GCFA 1TUBB 3M8OL 4X44A 1X38A 1OLLA 1ZRNA 1DC4A 1EWYA 2IEGA 2XWBA 5FC9A 3DZJA 3GIWA 2PWAA 2EVGA 3CCBA 4O0MA 3OAYK 5B7PA 4LY6A 4BXSV 2HFFA 1KCVL 1JHUA 3QNUA 4TV8B 1CRLA 3W7AA 3KZ8A 4MR8A 1WJ3A 2WZCA 5G4KB 4WKCA 5IVXB 1NJ5A 4XMLL 5KTKA 3VR4H 1CLEA 3TO4B 2Q6IA 8ADHA 2H1LA 2ENWA 3HSSA 2R0KL 1NXTA 4KQ1A 1NUAA 4CPDA 2IX9A 3TM5A 1ZD8A 4G6KL 4KKXB 1Z6JT 1UJ4A 2LXNA 5F3RA 4DG5A 2Y3NA 2H6UA 2BSTB 1E28A 4D5EA 4P46C 3KVQA 4KTEH 4PX5A 1WD8A 2HADA 3ID6C 3QXCA 1QOPB 3QO1A 4EO7A 2HSZA 2ZIZA 2VWHA 4JDZB 4HNAA 3HA7A 3R19A 1NC4D 5F0LB 3PDWA 5F7DB 5CLTA 3DJ9A 1ZVNA 1SGWA 1Z37A 5FOBA 2OFFA 4DV6B 2XQBH 3Q13A 4J8RA 1UOVA 1TNMA 3VOAA 3ZQ4A 5F96L 3WGIA 4NCAA 4P3CL 2PXAA 2XWJI 1IMOA 2YIVX 1VL8A 3SDXB 5HBGA 4HCGA 4ZYZA 5MEQB 3L48A 4ONFL 3DUSA 3EF3A 5D3QA 2YMXL 5AKRA 3GBLA 3DOUA 3MJRA 4WI2A 2DLGA 5DLPA 4JRYA 4FGWA 4TSCL 1KXZA 5LGHL 3W79A 1IQWH 4HDKB 3RNQB 3RT7A 2OL3B 1T80A 4F2HA 1ZVQA 3PHLA 2ST1A 1G21E 1VKNA 1G38A 5IXYA 2WXRA 4DM3A 2PLRA 4PSUA 1RQ2A 4LMPA 1J8MF 4ABVA 1QBMH 5ACLA 4RY2A 1CRQA 4YIKA 4APQB 2EYTB 1MJUH 5E6IC 1JZ3A 3EH3B 3CURA 4HVAA 4MQ7A 1NBEA 1XU9A 2HMUA 2MDTA 2NOYA 4B96A 3NRPA 5FFLA 1V45E 1UXOA 4B34A 1VPTA 1RWOA 1CZ8H 2BHZA 3CLUC 4IIXA 5I16B 2WQZA 4B81A 1Y1PA 3TX6A 4X1YB 1FFPA 2Q3FA 1XF3A 4K46A 4PRBA 2DKSA 2VXVL 2F4VB 3L7LA 4HNUA 4O3MA 4OLVL 3IXQA 4L9WA 4LEXL 3KLQA 4C0AC 1B8NA 4WZAB 5EQDA 4EDXB 1U2DA 5FYJD 1KYZA 4FHEA 4D0BA 3T2PA 4R5TA 1SBQA 1DQQB 2I3DA 5FI5A 3O8QA 1H8NA 3PC8C 3RI5K 4XGNA 2P47B 1HKLH 1JHLL 5KYGA 2HA5A 3UJBA 3JV4B 3WLFA 4PJAB 3LD8C 2NWQA 3U80A 2Y0PA 4BFNA 3VQ1C 4JMLA 2NP7A 3O4IA 5DBHX 1BROA 1GWNA 4P1ZA 4NOBA 3BISA 1BD3A 1I7RA 1R0ZA 4AKQA 1RYYA 3WHXA 5D7HA 4BSVA 5B7FA 5AW4B 3FDIA 4KHZA 3WMPA 4OSEA 3SJVD 2YA2A 2W60A 1Z83A 3DEJA 3CFYA 5BYAA 3NS7A 1QPPA 1YMMA 3SPIA 4LBZA 4QRRB 1U36A 3OJFA 2B2CA 5HK8A 2QG6A 2B4CH 5HVGB 5EQTA 3DOIA 5B1CA 2Z6AA 4HG4K 2HLDD 1CV2A 1IBZA 1U33A 1N1MA 1CQJB 4K28A 1HI6A 4OCXL 4JOBA 1W0KA 1N5KA 2ONJA 3BGSA 1I4TD 1VBMA 5LUAA 3KBPA 4OZ4B 5CCEA 4DDWA 2BM3A 2Y6VA 2CR0A 4E3ZA 3HPJA 1AKVA 2OVFA 3C60A 3H19A 3RGHA 2A67A 3W6PA 3PWVB 1TTHA 2VHWA 3Q01A 1OLUA 3BMQB 1KEML 1T1XA 3QE0A 1NMEA 3OXRB 3GFTA 4OXIA 3EXG2 5I6MA 3EZGA 4ATWA 1H6FA 5DM4A 2PPLA 2PEYA 3WSQH 3FPYA 3X1KA 4U6HB 2PLWA 4ITVA 3KBHE 3MC0A 1R8JA 3D7PA 3AR9A 1EUUA 3HTXA 4OMUA 5HIAA 3T77A 2WJ3A 1UCTA 5C0CA 1CLOL 1GC1C 1P6FA 3I1YA 5EU4A 3HMWL 4FYSA 1RC1A 3NPAA 3R3SA 5FUMA 25C8H 3RWBA 4MZXA 4MARA 3QBVA 2Q5IA 1KZ1A 1R3LB 1KNOB 3CD4A 3V5DA 2AXJA 4AQ8C 1XLVA 3MRQB 1CICB 4MS6A 5KINB 4HYYA 1H9AA 4MA4A 4KK6C 3TN0D 3TU6A 9ATCA 5IUNC 4I6JA 3VR3A 1N0LB 3DZCA 3LPWA 1T6BY 4S04A 4BRZA 4EX7A 1JSXA 1B8UA 4AUNA 3BA6A 4FQJL 1RI8A 4N0CC 4RFEA 4NN5C 2X4OA 2O5RA 1VFOA 5LWHA 4NNYA 3HAEH 4NAVA 1R66A 4ZK2A 2C59A 3M34A 4NERA 2DN7A 5SV4A 3P2MA 4IFEA 4Z5XA 4I9FA 3IF1B 5JLAA 5ALBL 4YO8A 3ADBA 3R5FA 1BFTA 1TQSA 2VSKB 4F20A 2AXFB 5IIEB 3DOFA 4NM8L 4WI3A 3RHZA 1IBHA 1JAHA 4MCJA 3ZJ4A 2O5YH 4P9HL 1ZI9A 2HR1A 1QRSA 4X6DB 5EIEA 5H35A 3ESZA 3N2IA 2FVXA 4DIXA 3AHDA 5DZ9A 1HDRA 4HXFB 4DEVA 2CDCA 5C6TL 1QOQB 4B53A 1F0PA 1TCUA 4KPUA 1IBLB 4BQFA 1QBKC 3Q5EA 1KGJA 1T83A 3UTCA 4XMVA 3V4PL 1UJTA 5CFHA 4E21A 2C3PA 1FFBA 4IVRA 3HW7A 1WO2A 3IDMB 7PAZA 5CCGE 3FI0A 2PWFA 3IJRA 4AKTA 1MA0A 1Z5WA 2L0XA 4DN6A 4YWGL 3RK0A 3R0NA 3PL6D 5LQUA 1WXEA 1L9MA 2OGTA 2Y1OA 2PWPA 3OAUH 5K1NA 4G8DA 1P4HA 4ME6A 2LU4A 5C09A 2F9LA 4FKMA 4U1MA 1C8KA 4HEQA 4YRSA 2XWZA 3WKYA 1QI5A 3R7RA 2XHEA 2PUQT 4XX0B 1NQTA 2LVBA 2PGJA 5LIRA 1TI7A 3SDDB 5DHSA 2AFIB 3DGCR 4LMQE 4YDNA 3UJIH 1YGYA 2DU8A 1Z26A 3I9V1 3AM8A 1MF2H 1QE0A 3UG5A 1GRVA 4YMHA 5E23A 3CX2A 1NJSA 3JQ7A 5HYVA 3MRHB 2JAPA 4HS8H 4TKUA 2H5EA 3D3VD 2BVPB 1EU1A 1V11B 4JZJA 4M4RA 5K69A 3IDJA 3O74A 4KGZA 4JSRA 4J3BA 1R0KA 4U3SB 5JI3E 3DEFA 4B7AA 1EVUA 1WU8A 3L0IB 2HW8A 4B5ZA 1WRBA 4LZKA 2CL0X 2PR4H 2JVKA 4Q18A 7TAAA 2EKLA 2J0UB 5DJYA 4GZ6A 3BWYA 4IKOA 4KMTL 4V1CA 1U3ZA 3L4JA 3RD5A 2DDQL 3CH1A 4L3WA 2Q9CA 5IJKC 4G4JA 2VC2B 4JJHA 1ZISA 1A1NB 3K6FA 2C4FU 1YB2A 3CIAA 2CK0H 3ARGD 3WLWC 2BZGA 3E3NA 1AKRA 2ADJA 4OU5A 5G2OA 2GA9A 2QHLA 1FIGL 3WUWB 1NX6A 2XN9A 2QTWB 3HL0A 1MDTA 4BP8A 2A7QA 4DHWA 1U8ZA 5FYJL 5C4GB 2WXNA 2ADFL 1UDRA 1BVNT 2JB6B 5AI4A 2ZOKA 4HP5A 1IC4L 2XICA 2EC5A 4O4IF 4ZTPH 2ZCLH 3U6XA 4K71B 5G41A 3ZR6A 1KI4A 2BRUC 2I9LB 3KCWA 4PYGA 3RK1A 3UGJA 1FEZA 3BJ91 3B3QA 2CJTA 4JL5A 4Z7UB 2YAMA 1OCWH 1Y7LA 3CRVA 1EXDA 2RGRA 3GLSA 1VFPA 3QTLA 5ESWA 3ZOKA 3NAGA 1OGYA 1AG6A 3DULA 5AK4A 3WO3B 1J5DA 3I4CA 2HU7A 5D72L 1KDTA 2JCCF 2WWNA 5J2TF 2VCEA 4DLBA 4KTYA 5J89A 3I3OA 1H6BA 3U36B 4DJTA 2VIRA 1RZ8A 4BS9A 5IEKB 1ZVSB 1JHDA 2EQDA 3P9MA 2B5WA 3ZDCA 4ZAFA 5KTEH 3ZE2B 1PYWB 3BLKA 4BWTA 4F3KA 3S5UA 1WBYB 4FN4A 2ADGA 3W9SA 5JSKA 3IJ9A 3QQ3A 1G8AA 1C5BL 1I7ZA 4YP9A 3OE7A 4LJYA 4LCEA 5CPBA 4D56A 2Y07L 1JLKA 2GN4A 2P4SA 4QG7A 2UUBB 2QAGA 4PTUA 3TRFA 3EYVA 3GFQA 1F1AA 3GSRA 5ACZB 5JQGF 3HVUA 1ZVJA 5DWQA 3NACH 1JHRA 2NYRA 2ZT8A 4C0BA 5MENE 3PDOA 4CTKA 5DU2A 1KK1A 3FH8A 4Q6IC 4JUAA 2HH9A 1QGAA 4D96A 4D6XA 4KZPA 1XGTA 3ZYJA 4YR6B 3BZ4B 3IDXH 3VNBA 5E2UL 5CLFA 3LS2A 1TJGL 1W2HA 2W95A 1YNSA 2NYYC 2EDEA 2VAMA 1NC2B 4UDYX 1E3LA 4U7DA 4I9UA 1SOKA 1GYRA 4L8DB 3DE5X 1XL4A 4A2HA 2HTFA 2PMDA 1P91A 4WTWA 3HB1A 3VSTA 1EWVA 1L9RA 4NZRH 1ZN8A 5F3HB 4A8JB 2H07A 2XX1A 4NU5A 4ANKA 3E0GA 4XNQA 1GW0A 1ACZA 2WWFA 2AH5A 1CUFA 2EBUA 2WZ6A 1SXCA 2D0IA 2R23B 4TS4A 4QYXA 5FB3A 4P36A 5AB0A 2YS4A 3NYWA 5C8YB 2GEDA 1NOLA 1XMPA 4L5FH 1KH3A 1S7SA 4H40A 2HBZA 3LIZA 2ZKWA 3EO1A 2LWIA 3NSDA 5JQWA 1TO6A 1I94B 1QC5A 1LEGA 1BG9A 3JVEA 3GLGA 4J03A 1GA6A 5LP1A 3ARRA 4R90H 5KI6A 2IANE 1G19A 4OCRL 3DJTA 1KXTA 2G17A 3HN7A 3L7AA 5DNCA 3ALXA 5FI3A 4N8PA 3ZQJA 1T9BA 4QSMA 3KYCA 4XNZB 5F6HI 1Q7CA 3AACA 2ETWA 1C3JA 4BNXA 2Q5FA 5ALNA 2JIBA 5BSFA 1HE1C 3VR5A 4X5XB 4QXRA 3I61A 4PV7A 4ADIA 4CM9A 4RUKA 3LNCA 1Y9DA 4L2IB 5FB8A 3V1UA 3TCKA 2NW3A 1G20A 3DMFA 1WV0A 4JBSA 1W6WA 4WIQA 4AIEA 5ARCA 3BZWA 1WUIS 2ABWA 2HA6A 2BOCB 3FB5B 4XC1L 4X3OA 5GZNC 1DUIA 3WKBA 1N2OA 3A5VA 3DMPA 2GBAA 4LLUA 1YMMD 3W6NA 2XI9A 2NTNA 5DLYA 5BOZG 3AJ8A 4JFDD 3NHFA 3TL6A 4PBWD 1QDUA 4IW3B 5LZ8A 1IJNA 1ZOOA 1I4FB 1YIDA 2APTA 2WWKO 1SLVA 4WMLA 4N8DA 1DBSA 4RHTA 5JRDS 4NE7A 1ZKDA 4LVUA 5HD8C 4J6RH 4HFRA 1Y9JA 2DKFA 2ASEA 1EEZB 3O2QB 4JHAL 1OD9A 1I5RA 3KEMA 4PS1A 1O4VA 4L1TA 5FKJA 1AIFA 2H59A 3A4YA 2DWQA 2NIPA 1D6VH 1NMCC 2QTNA 3C60D 1N6HA 3LZRA 3DUFB 4OV5A 1Y3HA 4WNCA 2WY2D 5KHAA 5GM1A 2XNJA 2OHJA 4NYMR 4LSMA 2F7QA 3KLLA 2QYTA 3GDHA 4LTNA 2FK7A 1KYXA 3OMXA 3N75A 4GOND 5FUOL 1CD1B 4KJXA 3WUWG 2ZU6A 4N0QA 3WGVB 2HCFA 3EDEA 4MAUH 1GG8A 3TURA 2JCYA 4KR3A 2OWDA 4BH7A 1KB5A 1I4WA 5BSKA 1XD8A 3NGMA 2CGZA 1U3JA 1NFDE 3HN5A 3ZUNC 4BWFB 1W72H 1R9JA 4N5DA 2PGLA 3L1EA 4A4DA 3UAYA 1TJIL 5EKXA 2HUEA 4HJXA 3AM1A 4TPRH 5C8DA 3SGJC 3WJAA 3I2CL 3CLTC 4NS0A 1CT8A 5AKJA 4N1EA 4ZBJA 5B3NA 1S7RB 3MV11 1EZLA 5GV7A 2PGOA 1S7XB 3HRZA 3NFPB 2FGJA 1ZHBB 1AKEA 5AAMA 1MB3A 1CJTC 1RPKA 1E2IA 1AS6A 4WSKA 2JNZA 1WWAX 4G11A 4C4KO 3ISRA 2DW5A 5HHOB 1GHTA 3RY4A 3FSEA 4BFEA 2XV6B 5EF3A 4RZIA 5AOAA 1I82A 3QPQD 5FWXA 4YSSA 1SKYB 1OX4A 3CCCA 4YGYA 3EBPA 1O75A 4C03A 3V0WL 1KQ3A 5T3ZH 3M89A 1S2NA 2BCEA 2XNDD 3TA3A 1D04A 4UT7H 1S46A 4M43H 3NJJA 4OBWA 1Y6NR 2RARA 1CU1A 1DZIA 1QFHA 1PLBA 1Y33E 4TYMA 3K1AA 2OMNA 2IY8A 4FN0A 1IFXA 3AF0A 3CGGA 1GRWA 2ORYA 5DEIA 3MUHL 3HZYB 4GAEA 5D4JA 4D9CA 3DI2B 4LRYA 1A9TA 4NRYA 4M7PA 2XKUA 5T5FA 1JGDA 5I8KL 1ZCFA 4CKCA 1QPXA 3RL2A 1GZHC 4ETIA 2GBLA 1NGPH 4Z3GA 4GXVL 3WYDA 4RTLA 2R7LA 1A27A 4S1OA 4M9CA 3I05A 3O7WA 1J33A 3RL1B 2IH2A 4AO6A 4RCAA 3G0DA 5FYLD 4Q82A 3RI5F 4DW8A 2Y2YA 4PI0A 2ZPKL 4L0PB 3UKOA 4KWEA 1YZFA 1A6PA 1DQLH 4Y2DA 2OY0A 1IEAA 2OP1A 1LTXA 4G6JH 2OYMA 1K7CA 2Z31D 5C09D 2IWRA 3G88A 2H0QA 1VGKB 4JM0A 3G0HA 1HTWA 4P22A 2OZ4A 5ETUA 1KKLA 5EUMA 5JZ7C 1Q16A 4NATA 3C08L 1E1QD 2EEXA 1OXKB 2C9VA 3T5BA 1Z4JA 3HPLB 2X4UB 4FLFA 1Z88A 5FI0B 4TYQA 4ODIA 3QE4A 4BOYA 3CFEB 2F54A 1IJEA 4Y0VA 4BLRA 4C5CA 5LC1A 3QBTA 4Z1PA 1UD2A 2HN7A 1RRVA 3NOVA 3A9CA 5JCXA 1T3HA 3ET5A 3RUGE 4NARA 5A2GA 2A5LA 1D5ZA 4JJ5B 3SO3C 3BMCA 4XM1A 4K05A 1C9MA 4E42B 3VRJA 3GH1A 5AKTA 3FO1A 1TVHA 1USVA 3ONWA 2E3JA 4REOA 3K35A 5CVUA 1RYMA 3ENEA 4IGIA 2O1XA 2LLNA 3ARSA 3FOLA 4GPTA 2FLMA 1QYCA 3IS3A 1U5BA 3O1HB 4RD2A 12E8H 1EA9C 1AGXA 2R51A 4X7TB 1J0ZA 2ZWZA 1X14A 3S36H 5DMGD 4YDIH 2O30A 5D7LB 1SZCA 5I9LA 1A2OA 3UANA 1O6SA 2OOSA 2OI9B 3IIIA 2BNRE 3MNMA 3QNXA 5DZAA 5EIBC 4IV0A 4NOFA 1H65A 2UYHA 4QOJA 3I1IA 2OORA 1DBQA 3HLTA 2YKGA 2AXWA 2DI7A 1GR1A 2HFTA 2CGRH 4QJ5B 2ZSHA 3CVHL 3ICWA 4JP8A 3CXDH 2XQJA 1N0XH 5LOVF 4BQPA 1Z0DA 2AEJA 4MO2A 2CLRB 4C56B 4YV1A 3L08A 2OK0H 3TW0A 2XETA 1QVRA 2IVZA 5JLJA 4PYOA 1NUGA 4GWLA 4WNIA 5B6JA 1WMDA 3L3HB 2R4RH 3QHTC 1E5DA 1BG1A 3UUWA 2UY7B 4PGEA 4L5YA 2O9JA 4GT1A 1B76A 2A9NL 2P5SA 3D3QA 4WDIA 4L6AA 4YBRA 2WBJA 1FVCB 1BDIA 4J3TA 3S3PA 1QO3A 4KK9D 2ZF9A 2AQIA 3DBIA 5I7UA 3MBEB 2JJ8A 3ZDZB 1O77A 1GCYA 4KR6A 3VX3A 4KJWC 1R4ZA 4JB9H 3AEXA 1FFNA 3GMLA 1YO6A 1JB9A 3DUUA 2BI8A 1MCNA 2Q3LA 3F6LA 1IVNA 4W9LC 3OE7D 3RX5A 2YRWA 1SUWA 4R2GD 2A92A 1T0IA 4MJ6B 3W05A 3VB9A 2OBNA 4BE7B 4MKGA 5DJZB 5T33H 4I5FA 3GSNA 3TF4A 1H0SA 2GTQA 4EWLA 4YE4H 4K86A 6Q21A 1E8WA 1ONSA 3SYCA 5LP6F 1JLMA 1UATA 4MQLA 4ZT3A 1O9ZA 1ONOA 2R4SH 1FCGA 3EJUA 4E1VA 1XXDC 3HCOA 2VDKH 4QODA 3UPRA 3QJ5A 4CTOA 3DWFA 1M67A 1XN1A 3D43A 3IELA 4KZEH 2D4DA 4D0CA 1E9PA 2AUTA 3LC7O 4D3FA 4Q9DA 4ELMF 4HS3A 3EVGA 4HC1A 1NRWA 2VYFA 1L6XA 4LHUD 1XA4A 1OPGH 2GAAA 5DTRA 4FQCH 4PYJA 4MUBA 5DDHB 4OGXH 4U6TA 3X1ZA 1QTRA 1RADA 1YY8A 1G6OA 1M34E 3I6KB 2XUDA 3BH9B 2RGEA 3Q6FB 1J7VR 4N0RA 3N9GL 4HPWA 4H8WC 3QQ9D 2RI1A 4J2QA 3LXRA 1IZJA 2FUNB 3DVGA 1X9HA 3P71T 1ZANL 3C12A 1P1IA 5EU6B 3H2IA 2QB5A 4ADJA 1B93A 5E7MA 1KU0A 2YJZA 2VMFA 4MWBA 3JZDA 5K0EA 2XR1A 5EUOE 1ZH8A 5KNDA 3U48A 5C9JB 3BVNA 4N2FA 3ZDXF 1SFRA 2TECE 2K4MA 3ELWA 1Q3TA 1UZ6F 4GS5A 4KXMA 1QSFE 1J8DA 5IKXA 1G3MA 3LZOA 4P48A 4KMQA 3VFGH 3Q2IA 2F55A 3ZLJA 2NQCA 4H77A 4D5GA 4J3OG 2QXTA 3FGNA 3WMRA 1BAPA 1UD5A 1J8SA 1C30B 1A72A 4FOMA 4CM9D 5EEUA 4FNLH 4YGXB 3VO0A 4DKFL 4R3NA 3LQQA 2R6AA 1QVVA 4R2KA 1BFSA 3R4CA 3ZU4A 1V4NA 3CLFL 2GM3A 5IHLB 5AG9A 2BE9A 2YOAA 2WWXA 3ASYA 2DPGA 2FX3A 3FRUB 4MA8H 1CZRA 1MXGA 3SD2A 3EJSA 2F19L 3MQFA 2OGSA 5L9DH 5B1KA 1YI1A 1GGBH 4G65A 3TEFA 2CJSA 4KJQC 4IMKA 3ULUH 3NTOA 5TK4A 3AB0C 1RVV1 5L51A 2IXBA 4BVKA 4JJ4A 5FYLL 2WIAA 2V45A 5AJVB 2AMJA 5I73B 5FBVB 3T8VA 4OJQA 3VXUE 2IH4A 5CUSL 3IBFA 4NFDA 1EX9A 1KPVA 5JHDB 4ZI5A 4F2MA 3HJRA 3KL0A 3GRWL 1EMTH 4XCEB 43CAB 4MHSA 4Q9HA 3AAZA 1ZT1A 4AZUA 1Y8QA 1NBMA 4PXYA 5EC8A 1YCGA 3STXA 1OSNA 1TIUA 1YZGA 4XGIA 2ADIB 1BFOA 1DX4A 1QLWA 5IW6A 2LQRA 4HXYA 1ICEA 3TEUA 4LLAA 3C3BA 3VRIA 5ESQA 1BVHA 4RWZA 2PCPB 4ML3A 5CJ2A 4JO2H 1MFAH 4Y5YA 2DTEA 3PP3K 1T6ZA 2WLHA 1NCIA 3SVTA 1F2DA 1UEIA 4QGAA 3E5NA 3GVCA 4TSBL 2NV2B 1NW3A 1E2BA 2J2ZB 5LQJA 4W70A 2EUZA 2Q8QA 5DVOA 4MRRA 5CIPH 3CVOA 1O96A 1NBCA 3GNML 2A9QA 3Q15C 1EEYB 4CV2A 1UL1X 1DIAA 2HPZA 3AUYA 3SHVA 4RISL 3HJNA 1S7TA 2WLNA 1KPUA 1WD5A 2YZ8A 1NCAH 4D0NA 3ZO0A 4JG1L 4WRLA 1A4BA 1T5WA 4AUKA 3MSPA 4EXPX 2UUDH 5EZ6B 4DG8A 2Q9BA 1WTLA 1E8YA 3BQUB 5B30A 2OLKA 4XVUA 2DB8A 2JJSC 4PJHA 1JVNA 3GMTA 3W9UA 2FQEA 3PWJA 2GSIB 4W82A 4OYLA 2BOBB 3PEFA 4J1QA 4B79A 4KHXL 1UKQA 4OZHE 4RCZA 1JIQA 3QC5X 5I1EL 5TE7L 1PLLA 4KSCA 3AW8A 4HUUA 4BMVA 1NNLA 5JNYB 3NPMA 3UIZA 1ORWA 1UQUA 4BO8A 2NY1C 4Z7NE 2CRIA 1QQDB 3GINA 2W6MA 1LDNA 4K3UA 3SKOA 1O5DT 4OL9A 1D7FA 1G0NA 2G3XA 5KNBA 2I8AA 5A3VA 2QMJA 5IMOB 1N2CE 3E3OA 2JWYA 5LG1A 3TA3D 3FFDB 3EGEA 1EM8A 4CDGC 3GB7A 4HK4A 1IX2A 2YFKA 3PFHA 3ET9F 3CYFA 4Y5XB 3BEOA 3Q44A 5IGXL 3NTUA 2ZI5A 1PEYA 4R1MA 4URYR 1CZUA 4WADA 2FJ0A 2ORED 5DMIH 3GY0A 3MD0A 5HYJA 2WSSA 3N6YA 1II8B 3FVQA 1MW0A 4G1VA 2NO4A 4AVKA 1XEDA 3A3YA 4O2RA 2FW8A 3VXMB 5GONF 3II3A 2QL6A 3DUWA 3KPRE 1UZNA 1P5UA 2YD7A 3VTAA 2WQRA 3GRAA 3FRHA 4KVZA 1PGRB 3EIWA 1MJGA 2B5IC 3PBKA 4LYDA 2PWEA 4ACAA 5EDSA 4JJGA 5E8NA 2FJUB 3V9EA 1JHTB 2YSSB 3FTPA 2W83A 2IU4A 3DDOA 4U2CA 1WEJH 1Q0UA 4JSTA 3FZNA 2R86A 4WECA 2IYXA 4M1QA 4B6ZA 4OSUL 1JLSA 3PQYE 2VDOH 1JTOA 1UQRA 5JS2A 1JNHB 1V39A 3C5WP 1PEAA 5KSVA 5HYIA 1G5FA 4R31A 4AZ8B 1Q0HA 1KCVH 4XTRA 3LZFL 2F54D 2DIJA 4YP1A 2B8JA 2X5NA 2YWXA 5AM2A 2JIZA 3NYKA 3CBRA 3ZS9A 3PU6A 2A1WL 4F8NA 3HR5B 2P11A 2K7PA 1F20A 2NNLD 1U92A 1TVMA 3FKSA 2DF3A 1YEDB 5GZ3A 4XIJA 1CETA 1SF3A 3VH8B 1XZQA 2Q4TA 3VYTB 3OHPA 1G7CA 4ZPVB 3LOWA 4ZQBA 2FJGA 3E2MA 4Y2TA 2QR0B 3UJNA 1S1CA 3KXPA 4K9LA 4DW2L 1HSBA 2H9IA 2VK1A 4KREA 4AIIA 3K32A 3W0WE 4BFRA 1BJ8A 4PJCF 1BNCA 5GGXA 4A8HA 2AQHA 1G18A 2WXMA 4PANA 5MN5A 4A7PA 4DWJA 5D7NA 1OWPA 2NZ8A 2H00A 2EF1A 5I1AB 3D6MA 3MUOA 1TSHA 3I0ZA 3SCMB 5EU5B 2A6DB 1ZU4A 4DVBA 3WK6A 1AYOA 2YMXH 2DQIH 1E9AA 1U6AL 3S99A 5BURA 2ISDA 1BVZA 3GJ8A 3K46A 1KI7A 2DWOA 3P3SA 2G3NA 2ZOOA 4I0KA 5I0XA 2YWBA 4WAFA 1EK0A 3V79C 2YXNA 4W9FC 5JR1L 1YEWA 2RKBA 5HA5A 1Z5LB 4S1TA 4HXGA 2Z0MA 3U7IA 1A3ZA 4NWUH 1DBPA 5L8LB 1UD4A 5BZDA 4ZODA 3QXVA 4CM5A 4WUUB 3QUXC 2P5EB 5AAWA 3TBBA 1CQWA 4JFPA 2Y4OA 1JYFA 4PJDA 4PJXA 2WBJD 4GY4A 1AD0B 1VERA 3OD1A 4BVLA 4HMCA 3DYPA 4GW4B 2BMFA 1DJLA 3PIQA 4PBSA 3MV7B 4DAGL 4DAEA 1Z2OX 4RF5A 2VXVH 4WW2C 3IP9A 1OU0A 1UCBH 3CXHK 3SVLA 3AY0A 1CUUA 2P80D 1FFRA 4AJIA 2E0PA 3JASA 2YR0A 1NFFA 1JKMA 1XQ6A 1W91A 3DTVD 2EEPA 2I3ZA 1D2NA 4DDHA 3GXTA 4F9PA 3Q8LA 5IAEA 4ARZA 1X5GA 1UJ3A 1JHLH 3AW9A 4AK1A 4FGSA 3K2EA 2IF2A 5F7OA 5GS1B 5BUAA 3FJ1A 5I6DA 3OL2B 5K0JA 1BN7A 4OLJA 1QFJA 1GY1A 2DQCL 4EY8A 2WIFA 3TZVB 5K9OB 3N1FC 5FYKE 4BSWB 4I8DA 4QD2E 1J23A 5TQVA 5FH9A 4LFAB 1PJAA 2O6DA 1ICTA 4FGJA 5G4LA 4BYHA 1WABA 2CLCX 3HXPA 4QXUH 5KQPA 1ESDA 1KPIA 2F5AL 4BNDB 2X89D 1L6IA 1YVEI 4ZTEA 5E9WA 3BSZA 5F89A 5F21B 5IM7A 4G5XA 4E41A 2B2XL 5G4NA 3OPYB 2BM9A 5TDNA 1NCDL 1XJQA 3PPIA 4CJXA 1DUYA 4OCXH 2HT2C 2KZWA 4HGYA 4W7SA 2E56A 3FLEA 3ZDFA 2WYHA 2ZBFA 1U0NA 4G9BA 5JO9A 4CF4A 3D0QA 3SQMA 3UBTA 1ULUA 2DQJL 4LXIA 4JEGB 1ZH4A 4XB7A 3DA8A 4Q4JB 4O4YH 4L78A 4G9FA 3TZCA 3QIAA 1RHHB 3LM8A 5A16B 3V8CA 3JQ8B 4OQXA 1VPLA 2PUHA 2GPAA 1N75A 4NYMQ 3NW9A 2IPNA 1ZT4B 2A77L 1ZM9A 4ZAVA 1L9TA 5E2VL 1DJZA 5IAGA 4YXKL 1T3FA 3A1TA 3MAWA 5FWYB 2A6KA 1CLOH 4N9OB 1U8NB 1TEYA 4R2WA 3Q1EA 5L4SA 4BNWA 2OXEA 1HCVA 3U2SB 2BP8A 4N01A 3PFCA 4JUTA 4DPRA 4LE1A 3KQQA 5TARA 4DMGA 2FPLA 5H2BA 2QZQA 3VXTA 5SWZE 1D4AA 4Q4AA 5JCZA 5TRTA 5L4NA 4XC3L 3FYIB 3DIFA 2EW1A 3ZO9A 4N28A 3SOBL 3QORB 3IQZA 3GMQA 2J31A 3II6X 3VH8G 2XQKA 3ACDA 2J1YA 3NN8B 4EUPH 2ZCHL 5I0YA 3RKSA 3DROA 4N8UA 3MILA 4FFMA 3EXIB 3KO8A 1JI2A 3CF0A 4FQJH 4BGVA 2CLOB 1ZHLB 1SVMA 1WTAA 5GINE 3QPUA 5F9WC 3TR0A 3A0OA 4TTPA 1NVVR 1F3DH 4QTYA 3I9AA 4M1DL 1S2IA 3S5YA 4KQKA 1SQMA 5U4QA 5ALBH 4L8WB 1OGAA 1FZOA 3FMGA 2XX3A 2H2IA 4ZQHA 2EERA 4FCCA 5E1HB 5DX8A 1IHXA 2FHCA 1P1ZB 4KPHL 3D6JA 4NM8H 5LGJB 5EB9A 1NFAA 4OF6A 4O2BB 3KSZO 1FNHA 4P9HH 3S35L 2WJIA 1L3NA 4AJ2A 2ZSVA 4HGKC 2OCCB 1ND0A 1MIML 2LW3A 4F37F 3ZZNA 2EEBA 2VE6B 3QDGB 3DXYA 3PVCA 2EINB 3AU1B 4A6EA 5IAAA 4EY7A 1BMWA 3TXXA 4WV3A 2NXZB 2PYEE 4D94A 4C6TA 3G08A 3W8NA 1I2BA 3S7ZA 4MDIB 3DI3B 2H1OA 7GPBA 3AFHA 2LTQB 4MV1A 2IHZA 5JDCA 3OECA 4JDTL 1UOQA 5EJ8A 4NPYA 2DEWX 3CNKA 2ZT7A 5JMOC 3WGNA 4YTEA 3H5VA 5DI8A 4TOIA 4S1RL 2EKPA 4ZVRA 4P05A 4DGSA 1CF1A 2FHBA 5EWIL 4ZFNA 2X70A 1ED3B 4HRXA 1BXRB 2XTZA 5HUQA 3DURB 3HZMA 4MA7H 4URKA 1ORSB 1A98A 3DEAA 2PZJA 2UZIL 2QPUA 3WX0A 4D9GA 4X7BA 4QXAA 5CLZA 4RGMC 5JW5B 1C8QA 4NWTL 3O0DA 4MFHA 4L3AA 4NQCE 4OFKA 4HG2A 5E1MA 3PKZA 3H9EO 4LK3A 4HU2A 1CF8L 4K3GA 3F58L 4G7QB 1NN5A 4I5IA 4MQUA 4Z5RB 2PMFA 5FUYA 3OZKA 3RUGA 1KGUA 2R0LH 2AQPA 3ZRSA 1OWMA 1ZPLA 4HUTA 4CA4A 3EUWA 2QENA 2VMCA 2HBRA 4P5PA 3Q2CA 4BHTA 2H1RA 2OMXA 5G40A 4KMTH 3LRTA 4W8HA 2DDQH 4LZJA 1R64A 2RGGA 2DBVO 3HKCA 1RZ7H 1CR0A 16PKA 3FLBA 3CIFA 3LQ2A 1SBBA 3DBXB 3IE4A 1TDQA 5F33A 2NLJB 3ECUA 4U7MA 4RWEA 3DZ8A 2JCVA 2FWLB 2IH3B 1EX6A 2ONCA 2DUNA 4Q7JB 5EIAA 3TBCA 2C4XA 3K6KA 2ADFH 5DS8A 3OIYA 1DJNA 4YC2C 1PQZA 2VXOA 4P3OA 5J4VA 1N1EA 4JRYE 3KV1A 2BTEA 1IC4H 1IGFH 5GZOA 4Z4EA 3PF2A 4G26A 3L2LA 4IGFA 3UM9A 1SXIA 3NIDF 1UFQA 3F3YA 3KB1A 5SICE 3RH0A 2Q2LA 1NAIA 2QQFA 4NFSA 4BEIA 1GCOA 5TJHA 4XTRD 3DRQB 3OG4B 1BECA 4WI0A 2YXMA 1RK0B 3N06B 1BGVA 5A5FA 5KZCD 5T7BA 2MYNA 3RUEA 2RFLA 2VNJA 5HGAB 3SYQA 1E2FA 1KMQA 2ROXA 1SY7A 3MKKA 4G5GA 2XKNB 3DGGB 3K70D 4FXOA 2C4UA 3C43A 4BVEA 2X87A 3DPBA 4HCRL 1YYCA 3IP7A 3T2NL 4TLLB 2VQ4A 2IYEA 3GGJA 1QWUA 1UOOA 5DIZA 2VJMA 1R47A 4WV1C 5EXSA 3KWWB 9LDBA 2Z35B 1FFAA 3PFFA 4ERNA 1ZBQA 1ZJJA 4U3HA 4QFCA 2X88A 4DAOA 1M6OA 1KPHA 1KH2A 1MCOH 2IOOA 1KIAA 1C5BH 2W65B 1QHSA 2Y07H 4EJFA 2A9FA 2DUUA 5AVXA 1XE3A 3UMYA 3OSVA 2QXUA 3NIFE 2A9KA 3U79A 4BAUA 5JW4N 1TNDA 2FZCA 4MZ2A 1HORA 3I2FA 2XZQL 4GVXA 3NBAA 4PWHA 1G63A 2HPAA 2PUJA 4DA9A 4B6GA 3DO6A 2BBOA 3RZCB 1BM7A 1TJGH 1AS0A 3CN3A 3NIGB 5CEYA 2X4PA 3CQFA 1WICA 5KYTA 2AW5A 1YTUA 2DFLA 1VJSA 1DARA 2PT9A 3TO2A 5BMVB 2E6JA 1CUGA 1VLVA 3MWJA 4G5HA 3VDQA 2JHFA 3OKOB 2QVLA 3TECE 4EX6A 4IHBA 4WFED 2DEXX 1P1RA 3I02A 2ZLBA 5F3DA 4I9WD 2RGWA 1GTMA 1B0UA 3W7VA 2P3QA 1HHIB 1TEXA 1UWCA 1AVAA 4KGJA 1IM2A 4GXNA 5DI9A 1IK6A 3GGCA 4YRCA 1RQ7A 4MQEA 4JFEA 1C1DA 4TS6A 1EVYA 1K5GA 2R69A 1MRDL 2XMQA 1AKJD 2ROQA 2H3XC 2NDFA 2JIXB 2NX2A 4CM4B 3SE7A 3TG2A 3MR9A 5I5RA 5FM4A 4CRWB 2ZJYA 3NRBA 4R3UC 1MWOA 4CG3A 1DC3A 1QVAA 4Y1TA 1U2SA 4KJZA 2AV7B 3QFGA 4LZZA 1PX0A 3WCYA 3M45A 2YD6A 5C0CE 2V6MA 4FZRA 4MW7A 4BX2A 1EE1A 5E2BA 5A05A 2IAND 4PREB 4HUVA 4OI1A 1X1AA 3ZHFA 1QSFA 4JFAA 1E5XA 1W2KT 4YIQB 2WJ6A 3E38A 4CIVA 5HR5A 1M73E 1SVZA 1VKRA 4HAFA 5JEEA 4DP4X 4Y1SA 4J0EA 2HEIA 3LFTA 3POCA 3QOYA 1GO2A 2ESVB 3V0GA 1IEHA 2V1UA 1DXOA 5C7XH 2Y7OA 2LP4Y 2IXGA 2SKDA 2ZB7A 1ZJAA 2CLZB 1GN8A 3K0CC 1JKIA 4E12A 2AJLI 5DK2B 4S0TD 3GCWA 2Q7YA 5DVZA 5D1XE 3OKEA 4EEZA 1OAXH 3DCYA 5EKUA 1AN9A 3IDNA 3QEHB 4WCFB 5HXAA 3OCWA 2APFA 4BX8A 3WHKA 5GQBA 2V58A 3IESA 4UNQA 1OEZW 4TNWK 2ZGVA 1Z9NA 4KR2A 3RWIA 4F57L 3AONB 5HJ7A 1EJFA 5IAOA 1FL5A 4AJ0A 1RXUA 1B0WA 2FNAA 2BINA 4X6CF 5FUOH 4PJ5B 2P75A 2IWKA 1A22B 1Z0ZA 3NX4A 4UDXX 3CT4A 3IXAB 1ZUWA 4JR0A 1NYTA 3QUZA 2QL7A 2IWGA 4L8CB 1RZIB 2Q6OA 4LOUD 4Y9GA 1E2HA 3O2DA 3MV9A 1KPGA 1G7MA 3HI4A 2QGDA 2G07A 3G9QA 2DR2A 1BFUA 3HFML 2P2YA 2YQGA 4Q9IA 2M6KA 4F6RB 3DJYA 3AL0C 4FFZA 5C09E 4EPVA 2E7MA 1N3YA 4X7PA 3HZKB 2EQBA 4XP5L 1DYZA 2H0PA 1Q20A 3LRKA 3PRZA 4G8IB 1Y7IA 3N2GA 3FQTA 1UWXH 4I1VA 4RTJA 1HHKB 3AS0A 1GIAA 3IJHB 3H3JA 4QTXA 4RPIA 3CG4A 1PJLA 1XR3A 5K3EA 3QVLA 4QRUA 3TN0C 4F92B 1KTBA 3HBLA 4PHHA 2G9HB 5K3FA 2OV3A 4PLZA 1QIHA 4ZCSA 5LFAA 2C2KA 1M71B 2BM8A 2QXYA 4TT8A 2QN8A 4GW5B 2ANBA 3VRHA 4RWYH 1B8PA 4L6CA 1DUZB 4BV8A 1RI4A 1KDYA 4GE0A 1Z8HA 4M1GL 1PDKB 5HHPB 1R0CA 4KVCL 4O2CB 4OFPA 3JUYA 5C0EB 4TLEA 2IE8A 2XBMA 4DEWA 4IKPA 2IMNA 4R2LA 3Q9LA 2EJBA 2O5CA 4LF9B 1NJ2A 2XKBA 5EXEA 2I76A 3FT3A 2PCXA 4LE8A 3ANSA 5EIVA 1HOCA 3NIWA 4YP6A 3TYXA 3ZJVA 5J59A 1DQDH 4KRNA 2XN9E 4HHGA 2OMZA 4NQVB 4B73A 3X2QB 2PLAA 3OLEA 5I7WA 3HYNA 1S7UA 2G2RB 3C5SA 5IHUL 3PL6C 4G5YA 1PZAA 1ZA1A 4ZOLA 1KXVC 1NBYB 4ZVUA 4GOJA 3C08H 1JLRA 3LQMA 3OB8A 3KPOB 2UZIR 2XB9A 1PG5A 3ZZ1A 2F3QA 4DUGD 3EG9B 3DECA 2C3MA 3SC2A 3MG9A 3PQYA 4MLCA 5C0BA 1JXDA 3O6KH 1Z5ZA 5F70A 2X4NB 4E2OA 4QATA 4LRQA 4AN0A 2IQ9H 2VM4A 5IVXF 3NJLA 1R7RA 1NW5A 4X71A 5I74C 4FP9A 1DL5A 2RGNC 2BCGY 1X5XA 3FQWA 3CZ5A 1CQKA 3EN0A 4FNMA 3NWEA 3EQ7A 2WLIA 3B7RL 3CSYA 3TBTA 4EBBA 4R9HA 4G8GB 1VCBC 2BSAA 1OI4A 2YMQA 3D3EA 3QG5A 1QHOA 1DQRA 3ZU6A 5IDQA 1KJNA 2J45A 5DHVH 5D3MB 4IIJA 1EDEA 4DLWA 3DX6B 1HE5A 2SKCA 1PKXA 2XUJA 5E70A 4KDTC 5CNHA 1VECA 2V5UA 3HFFA 1I6KA 4M6WB 1WAAA 2NPLX 3D18B 1U0GA 1WFNA 4HV8B 1HJBC 5EXXA 2WV3A 3GW8A 4X6BB 2VDMB 4HFWA 5DEGA 2D00A 3R0VA 5CSZB 3SDXF 4YFLI 3LYAA 3CVHH 4PVBA 3DVRX 3OZBA 4B9AA 2ZG6A 1NLDL 2BNRD 3H1PA 3UMJA 1EP1B 2XF2A 3P2TA 4A7SA 3ARGC 1UOPA 3O4OC 3IGAA 3RDTD 4MRCA 5GZOD 1XUOA 1CUXA 5C71A 3ER9A 1N3NB 3QRGL 2YDXA 2X42A 1RJ9B 2QEQA 4G1BA 3LK7A 1RSYA 5IQ9B 1HH9B 5IVPA 2H1PH 2CXSA 4Z4GA 3QAQA 3GZ4A 3QEQA 4IOSA 5ESAB 3GMOB 1PY9A 4ARIA 1PZ2A 2H92A 4DLZA 4JVPA 4B27A 2ZXUA 5AVQA 1E7RA 3MX0A 4PS8A 4K3JB 1J10A 1BW8A 4Q9CA 1NJ6A 4AMGA 1IXYA 3EVDA 3BC9A 1A7QH 4A7GA 1ORDA 2DPMA 2LIVA 1WSAA 1XWWA 2NQTA 3HN2A 1S7CA 1YS1X 2Q99A 2PGIA 1ES0A 2MQGA 4LISA 4JBGA 3TPUB 1EXVA 2YHAA 2NYAA 1XH1A 3EDFA 3GTTA 2JC3A 2REOA 5CZVL 1ZEAL 1XV5A 4F24A 5LLTA 4GB9A 4D44A 1EFPA 1OYWA 2B1GA 3RPKA 2P9ZA 5KX5B 5BW4A 1JGIA 4YK4B 2HMYB 1ZH6A 3M6AA 4PJAF 1Y18B 3ESXA 2WNIA 4KYTA 1U8QB 6PAZA 2FZGA 3VC1A 1H69A 1KSJA 4HAOA 3NZHL 1G20E 1XL1A 1KTIA 1MG0A 4JDPA 3GSXA 4XAKE 2X0KA 2RGSA 3B56A 2NSLA 3PEWA 1MUUA 2WVVA 3I6LE 2P7TB 1ET8A 2R7MA 2JAOA 3TVMD 4H8UA 3JCZA 4RPJA 3T4EA 1OF0A 5JHLH 3HYSA 1T21A 1EXUB 3NJMA 3S40A 2GTWA 4HZUB 2ZXWB 4P4KD 4B87A 2XDQA 4GZLA 4KE8A 3ARDB 3JX9A 2WTMA 1M56B 2F5BL 3EIEA 3AW5A 2WIGA 3JSXA 2B5VA 3K91A 3M1YA 3U6KA 3H9GA 3BP6B 1RHJA 3P77A 1H8SA 4B8ZA 2CAKA 5AJXA 1KDPA 4KYVA 4Y8AA 2DD8H 1LDEA 4BXOB 1M1NB 1WXFA 4UINL 2RACA 2CJWA 4X7SH 3S37L 3GROA 4BP3A 4F8JA 4GMFA 3B8HA 1ZHFA 1XAKA 3LBHA 4X64B 1PR9A 5EZOL 2V5TA 1ZXKA 2PMCA 1VJ0A 4TVPD 1AX9A 4QWWD 2OXIA 4PINA 2W58A 4XLTA 1GCUA 1G8GA 1YRAA 4BKUA 3JAKB 4FT2A 1G1YA 2PMZA 3LLMA 4FCAA 1QQBA 1XD0A 4LLQA 1JGVL 1WUNT 3L3OC 4IWXA 1PG7X 1FP1D 1UJBA 1U2DC 3T8MA 3SE0A 4N54A 3AHIA 4AJLA 3IKMB 3EIXA 2FJFB 1U1FA 2AG6A 1MFBH 1QSFD 1N8TA 2W4MA 1TMGE 4MWGA 4M3HA 4DKFH 4UUOA 1F3DJ 1WHSB 2NPIA 4A66A 4L05A 2YXVA 2WA2A 1FSPA 1OYOA 1I3GL 2Y69B 3WMEA 4N24A 1E4OA 3TVTA 1UM4L 1YQ2A 3KPLB 2O4CA 4LC9A 5LYJB 1DQVA 2JFCA 3SSAA 2GHQA 2VT0A 4UZGA 2HMID 4HNTA 2XLLA 2D31B 2F19H 4FYQA 4QPEA 5JO5B 2MMCA 2BFBA 1OU4A 1OARL 2DQEL 1TQBB 2QSTA 4FXKA 2Z83A 3UMMA 4EI2A 1NFIA 2H51A 1YUHA 2P5PA 5F1KC 3I01A 1VL0A 4WZ6A 1M1XB 4YL4A 3T52A 4F5WA 4K9JA 3WE7A 3JQ9A 1OLSA 4PZAA 1V1JA 1DQTA 1WW2A 1QFWH 1EVLA 4ZQFA 1G1MA 1A7PH 3MMNA 1GXEA 3R0QA 1PSWA 1NVVQ 3GRWH 2J73A 2V33A 1ZOIA 4LYAA 3PAZA 1Q3HA 2FH5B 1VL5A 5HGXA 1CDDA 1OD7A 1UD3A 1RJEA 3VXUD 3PHGA 4M6OL 4XR8C 4H3HB 4JA2A 3EH1A 1E4EA 3EEIA 3C60C 1JXKA 3O4FA 3WLTA 1HI9A 4U7TB 2CHNA 4WBNA 1RI5A 1ZS9A 3T6VA 1A4KA 2QYSA 4LXXA 2BP0B 5GRYA 3UZQB 3QHFH 5CINH 4WWHA 2WXJA 3NFNB 5LU9A 1QASA 4OQTL 3VPHA 3MV9D 1BHGA 2FL5B 4WLUA 2Q6WA 3NT0A 3G9ZA 2D2CC 1F7VA 1WFIA 4LFBB 1FP2A 1P0CA 2C7VA 3BORA 5C8ZA 3L4VA 2AI1A 5EXPA 2FR1A 1LFDB 2TMYA 4GW3A 3C6YA 3NM6B 1SPXA 3CB4A 5IW1A 4F1SA 1DAMA 2EDCA 3AROA 2WABA 3H99A 4ZD3L 4L7QA 3WV5A 4MCYA 1U3YA 4Y7OC 3FO2B 3CHYA 5FFMA 2H0JA 1HQCA 5TE7H 3LKVA 3GJEA 1JSRA 1QQTA 3DP7A 2EP6A 4J7AA 1ADQH 3DMMB 3DW1X 2NX5B 5AHWA 2Q8AL 1G4UR 3AHHA 4N20A 1KGXA 3PUWA 2F54E 5AHRA 4LLMB 3CSGA 4NGHL 5DVKA 4HRAA 2OBYA 4XN2A 4GBXB 4UWQB 1RXWA 5K59E 5HPMA 1TLFA 2CDEA 1VDZA 5KNLA 1NR5A 4DOHE 3LVRE 3Q10A 2N47A 1Y1UA 3MU3A 3QPQC 1RJYA 4FNSA 1DWUA 3MRVA 4YSUA 5L6YL 3T4AA 5IHZA 4EYGA 3IRPX 1M0TA 1VFBA 2HUNA 1BS2A 1P2CB 3TQSA 4F7EA 2I4OA 1UKCA 5IBCA 3FFBA 3I6ZA 4P33A 2A0LD 3K5PA 3FQXB 2HRQA 2JCXA 4NQCA 2FBOJ 4AUJA 3V1NA 3LX9A 5DZPA 1BWQA 3C85A 1V4BA 2BFVL 3GRGA 2ZP1A 3ATBA 2ICWJ 2FMIA 4TLMB 4JN2A 1MLCB 1EFTA 1I5OA 2H9YA 1JVSA 4L1KA 1QFWM 1US8A 3KLSA 3RAPR 2QMQA 4G9DB 3F62A 3KPRD 2IF0A 3HBQA 3ZT6A 5C3LD 1PTZA 1YJBA 4ERXA 4YY3B 3UK7A 2YICA 4FEMA 4YEFA 2PBFA 1RIVL 1TVBB 4GLRH 4LL4A 3N5AA 3WIHA 1E1MA 4WLOA 4MINA 2YBRB 4RIIA 4KUCF 5JADA 2QELA 3CRQA 3DTDA 3QR0A 2G6TA 4N2NA 3TB4A 5AW2A 5K1ZA 2Z31C 1H3GA 5CLJA 2RHHA 2A4ZA 3I76A 1UD6A 1ODKA 5LG6A 1GC1H 1BWRA 3PQYD 1CD8A 2OV4A 3VH2A 5TH2A 3BDXA 5C0BD 5JAHA 1G7PB 4PUBL 1IAOB 2C5EA 4EUEA 3E0QA 4BNFA 2A1WH 3FYUB 5IB1A 3AM8C 1R0LA 5AK6A 2R29L 3GNQA 3PGFL 2ZKLA 5IEHB 3OXSB 4I1SA 3PRJA 3HKDB 4AE1A 3OKDA 5KQLA 4OJFL 2V54A 3KYNB 2DI9A 3M6LA 4JZJC 3R1GH 3OT1A 2D7NA 1U7ZA 3EBOA 1JLLA 2B83A 3OQIB 3TRKA 3ZE2F 4DW2H 1Z2CA 1UCFA 3IV9A 3RR2A 3GMSA 1AZTA 1B16A 3NNSA 4IOKA 3P54A 5U4XA 1PK8A 3QX7A 4NONA 3BO8B 3L07A 2PABA 3SNHA 3DP9A 4QJ3A 2YYSA 3OMZA 4MR7A 3TIEA 5DMGC 1FSKB 3GLAA 4M99A 5EP1A 2F9BT 4C4OA 2GD6A 4TT3A 1A7RL 3HCRA 2Z1NA 4U1HA 3ZI4A 1UA7A 1GDHA 2PYDA 4PP1D 3W0WD 5KVVA 3UEOA 4NRZA 3WB0A 4DTIA 2VSMB 4C14A 4KJPD 5EQJB 1U6AH 5AW1B 5EF1A 2KL6A 3JARB 4Z51A 2XD4A 5CAEA 4PRLA 1RHMA 2IL1A 1RQNA 5CWSA 4HLUA 5SZKB 3RARA 5JXHA 4KNWA 4UM9A 1DZ3A 1O9BA 1M1YB 1DWOA 5B6IA 3T04D 4U7PB 4B7UA 1AO7A 3DKRA 3QEQD 1EBUA 2R3SA 3D2TA 1V47A 3LWDA 4NBYB 1ORQA 2AOTB 4JLDA 1F86A 4LDZA 1NAMB 2WTRA 3B1JA 2WQ7A 4KB5A 1VPOL 5FADA 4PGBA 2DI8A 5HF5A 3N2LA 5C8YF 5HUJA 2ZROA 3ABGA 4X8LA 4I48B 3F65A 4DAGH 4LNAA 3PGVA 1NYQA 4JFQB 2AV6A 1T2DA 2C1OB 3B43A 1ZIAA 2FNWA 2N7SA 3NJXA 1A65A 2EHDA 4Y5VC 4QR7A 4UFOA 5TDPA 4KK9C 1XTBA 3KB6A 4ZU3A 2R1WB 2CHZA 1U95B 4NRXA 1FZJA 2C5FA 1FFOB 4CMHB 3MLPA 1CX9B 3NEJA 4BJ3A 3OKYA 2DQHH 2XKJE 2OGUA 2Y2UA 3ZE1E 3ILHA 4YXFA 2MCG1 1V7PC 1V8DA 3SLRA 3PXEA 4GKAA 2GM4A 3FAXA 2XJKA 3O6MH 3UGTA 5TX7A 2PKEA 3EDMA 4R2GC 2ZYWX 2QAGC 2JXMA 4LHZA 2JNWA 5KVMC 4X9BA 1JDNA 1QCCA 4ZV9A 4L4SA 4V1CI 1JNLL 1NQBA 3ZY4A 4MNQB 2GEEA 3RTGA 4PWFA 6CGTA 3R7BA 3F73A 4EG6A 5FYKD 4D0DB 2X0EA 4EFMA 3V5HA 3KYOB 2O06A 2XGJA 2IZ7A 2NU7B 4FLOA 4R40A 2C2WA 5I17A 4FYRA 3JSAA 4N5NA 2ECQA 1XPJA 3ZU8A 4HIJB 1RAIA 1NF9A 3EHDA 3TR6A 3ZVLA 4GWGA 3G8YA 4UEJA 3I5YA 4WU7A 2N46A 4B3TB 1X9RA 5E7BA 4UNSA 2UZYB 4F2ME 3LL7A 3O4HA 3C5ZA 2IDKA 3FUEA 3I3BA 4OX9B 1NBME 1WQ4A 4G1UC 4JQSA 5EC2B 1IK4A 3UABA 5D1XA 4Z7VA 4M1EA 4H8PA 1GS8A 2OW7A 2A83B 3ZN2A 1W30A 2MJWA 1XF5B 3QKUA 5IJDC 3QQ9C 1E61A 3TQTA 2DPYA 5EJ6A 3AK4A 4HCFA 4QU9A 4YXKH 3S44A 4QLAA 1ZD4A 4O5LL 1YACA 3IC5A 1ZJWA 3ZNQA 3GMRB 3T3DA 3ZKAA 1NOFA 3A6JA 3JYNA 2YIMA 3CN4A 2PBLA 3MBXH 1SULA 3DTNA 2J6IA 4KBFA 3TPFA 3IE2A 4AQEB 2B3RA 4H0IA 2HCRA 4CEHA 4BLOA 4TKLA 1X4YA 2DGDA 1K98A 4M9PA 2AHRA 4AY2A 1KTRL 1G87A 3FB8A 3LYLA 1QI4A 1NONA 421PA 4JLOA 5F7FA 3FZGA 1OW3B 4N3AA 3HXQA 1Z6GA 3FBGA 3R7SA 1LMKA 1UOWA 4PJHE 1UENA 4LWQA 3SOBH 1LC0A 1H2EA 1AOXA 2Q2WA 4LPCA 2GD0A 4JUCA 4RRPG 5JZSA 1GKOA 1E3ZA 2F0CA 3NGBB 3HYLA 5SWZD 3B6SB 1VADA 2CD7A 3IEUA 2V98A 1ZK2A 2QMZA 2J9RA 5D7IB 3G8CA 5G5DB 5DJ8B 2OC9A 2PF6A 2H2HA 1MU0A 4M1DH 4CUZA 2GNPA 4HLQB 1JR2A 1YMVA 3PQ5A 2B69A 3SGEH 4J4BA 5FHRA 5ENWB 2X3BA 1OT4A 2D03L 3IMBA 2GB4A 1VGEH 3GJFH 5JORB 3L0BA 2VN4A 4TNGA 5INTA 4HKBB 3B34A 1FFTB 4TXNA 4AVHA 4A5OA 4DNFA 5CILL 1PF3A 5HYJE 5A2IH 5FQOA 1N34B 4XNMB 3I9KA 4M61A 5FWAA 4P5TB 3UJJL 1CR9L 1DQPA 4C0KA 1R4NA 2DWPA 4Z3OA 4JRFA 3IT0A 5IC6A 4WKZA 1BRTA 1NXQA 4F45A 2BEJA 1CQXA 2J7PA 1R4XA 2A4EA 1VGQA 3GA5A 1FX0B 4ERSL 2H1VA 4RFVA 5ITVA 1C5CL 5C9ZA 2PN5A 3X1WA 4DV0B 1J90A 1L0XA 3EPHA 5TQ0B 2GUOA 4D8TA 1DIOB 4LFHG 4E31A 2PYED 3ZK0A 5EMHA 3ZY5A 2P8MA 3QOFA 4G5RA 1VIWA 1DJYA 1XFPA 3BCSA 4LJ6A 3I1JA 4NSNA 1P8AA 5HFJA 4J3OF 2Z2KA 1ETZB 1T1ZB 2H26B 1RXIA 5IUCA 4TULL 3RJ5A 4XX1G 2PA0A 1K6MA 5EWIH 3NHLA 3EULA 1SU7A 5I8WA 4PJGA 1XR9A 3FDZB 3FQNB 2VXTH 3DDNA 3G8AA 2E5EA 2F7OA 2YVUA 3H9YA 1JKXA 5JPIA 5AAMC 1NKSA 4U2YA 2UZIH 2WUBL 3M9LA 4Q37A 2CM5A 4QDUA 1E96A 4V0MA 1IG0A 2D4FA 4FF9A 4DFIA 3GF8A 1CF8H 3F58H 2ZXQA 1TJ3A 5JYMA 3NEOA 1QVWA 4CVWA 2EVHA 3EFDH 2XUGA 5HDBB 1F6DA 4MQXD 4PV9A 3LKQA 5HM8A 3S8GB 3BVWA 3ROQA 3TA3C 5GJCA 4HFJA 2YIJA 3IDFA 5I8CA 4Z6KA 1L7AA 3EYQD 4NQCD 1SUFA 3LAWA 1QRUA 4MLZA 3FT9A 3OPZH 1KS2A 4QX6A 1C8LA 3G5YA 1IMHC 1QNZH 3OAWA 4RSYA 4IDDA 3E1SA 1GJUA 3BTSA 2PZGA 1JFRA 4PS4L 1VL2A 3HP7A 1EIWA 2GBLC 4J7CA 2W00A 2C7UB 5A1AA 4G84A 1YE8A 3UL4A 3VDCA 3LJKA 3WIVA 3DJZA 3SXUB 3GPDG 3GM8A 2A35A 1OK8A 4LDEB 4GQIA 2VT6A 2WZ5A 4IBQA 2WBWB 3FKUS 1FRZA 2UZ4A 2ICEC 3RDJA 1MX9A 5KVFE 1MJNA 1NZRA 3T95A 4X6FA 2FPPB 3QPBA 1JK9B 4MDJA 2JJ2A 4JRYD 1L4NA 2Z5VA 2DYPB 4WFEE 1KACB 2X0WA 3HY3A 2EP8A 3IH5A 3C8HA 3M17A 4HGRA 4QUAA 4I9WE 1NMBH 1VFMA 5E6SB 3GAFA 4WDRA 4PJDE 4PJXE 1KNXA 3Q5GA 3T2NH 3HEAA 2IXDA 5FO9B 1E4HA 1FTNA 2ZSFA 2OTWA 3TIXB 3O3CA 4YSAA 3PR1A 2WBKA 4XNXL 2VR6A 3MODH 3ZDZF 3BT0A 4YZWA 4LXYA 5IFAH 3MN8A 4JFFE 5CF3A 1I9JL 2DUWA 5IYZA 3KLBA 2F74A 3OCCA 4RTKA 3PCYA 3TW8A 2J67A 1HQ4A 1BA3A 4QRTA 1MN6A 2CDBA 3LQ1A 3W6OA 4AXBA 4R96B 1I8IA 1KJ2B 4YMTA 4ER5A 3C6EA 5F73A 1UM9B 5F7EH 3IMRA 3LIIA 4TT3D 4ZJPA 3S28A 2D8AA 5FTKA 1Z4PX 2B5OA 5K93A 1LCIA 2UZAA 1U93A 4D0SA 4ZT2A 1G9EA 1MG3C 1M1UA 2EGGA 5E5UB 1JKJA 3VSCA 1HMYA 1YNLL 2I7SA 4FZEH 3WEXB 4WKXA 2D0PB 2J48A 4FS8A 2PAAA 3ESRA 1XGRB 4PYLA 3M4XA 1NGXA 1EHLH 2INGX 1F6BA 1N2IA 1SZNA 2Z3ZA 4F7TA 4IFTA 4O2AA 1AQMA 1Y3IA 3B51X 2E7BA 3WJ7A 4PV8B 3SEAA 1Z6ZA 4GX1A 3OJLA 1IG3A 4BIMA 5E2WL 1AO7D 3L6BA 4MZDA 4L4XA 4JOCA 1KUMA 4E41E 3OCVA 4G07A 4DADA 2ZX9A 3FBQA 4OZIB 2PSHA 4NDMA 1P31A 5C51B 4LRUA 1HBJA 4XNAA 3MJVA 5BR7A 4PICA 4W7IA 4YS6A 2SHKA 3X0DA 4G6ZA 4GINA 1T8RA 3HWRA 1KRHA 3OIDA 1PNQA 1UK7A 4HWTA 2WBJC 1W0KD 2J6EA 1T04B 3A1VA 4G9FE 5C0ND 2DC1A 1KG0B 1LPNA 2RGYA 3HB7A 4JRWA 2BFWA 4XJVA 3RTCA 2VJQA 4LYHA 3FU7A 4MKFA 1U1GA 4FKEA 1P2VA 4UQIM 1MAML 5F6IC 1RRCA 2YHGA 3Q8MA 4AJWA 1LI5A 1OAJA 2Z8RA 4YE0A 4ZI7A 3U6BA 5FO8A 3ZQKA 5CNIA 4K9KA 4F5ZA 3ZCSA 5F9JB 4F97A 1U9IC 2RHCA 1TQTA 1Y4AE 5C0CD 1KI6A 1XVVA 1M6NA 2EBHX 2BTOA 4LCCB 5J0BA 4QY8B 3QFJA 1QTPA 3A23A 3V7WA 3MNZB 4PHGA 3W2IA 5K9KB 1NXPA 3L3DB 3ETHA 2J0VA 4DCNA 1VCHA 2RQEA 2OQVA 4OOEA 5EWMB 2OZEA 4E5NA 1D2PA 3V95A 1UZUA 1O9HA 1Q11A 4M86A 5B22A 1X6VA 2WI8A 1V16A 2AT1A 2G40A 2CK3A 1YJXA 1Y4SA 3DYVA 4TNFA 3B5TA 1GPKA 3PA6A 1T20B 3VR3D 4M8QB 3UK2A 4GQAA 1T5IA 5KNCH 1OGAE 1VJ1A 3GZOA 3RYHB 5ALXA 4L8SB 2X5OA 2AKEA 4LGSB 5D1XD 3WRYA 5LZ2A 3WXBA 5C3MA 4F57H 1JZHA 4I08A 1BBJA 1T3ZA 3FOBA 4MD5B 3QYMA 5ISZA 1PV1A 5CB6A 1T2QL 2BBTA 3L0CA 2OX5A 4B50A 2JMRA 2I6TA 1OBFO 3A3PA 4H1WA 1DBKL 4OQNA 5E9AA 1XEXA 5MHSD 4D4IA 1JZIA 4F4JA 3BSYA 4U0JA 4NBXB 2CHGA 1WH0A 4HK0A 4DPAX 4DJDC 3IQGX 3SX2A 1U58A 4EVQA 4ISVA 4QIHA 1CEQA 3TD2A 1N8ZA 4P7BA 3R5XA 1PR1A 1HEHC 4XBGB 3HFMH 2ZYTX 4RPKA 4YAGA 4Q47A 2OV2A 2RC6A 1GSOA 4LKRA 3NV7A 4B5LA 4HIEA 1SVOA 4N5LA 4K6MA 4CN4A 4XP5H 4PRDA 2V6IA 5IULC 3DMHA 2R0ZL 3OC5A 3K92A 1Z13A 3IFPA 5SX4H 4UQ3B 5LMZA 2BEKA 1CJBA 3LTEA 2LU5A 3B2DC 3LDHA 3HR6A 3IVXA 3OKMA 1P53A 4QRFA 4NDNE 2E27L 1XCJA 4HQFA 3E1GA 1QW9A 4ZUTB 3WJLA 3KLHD 4MPPA 1P9MC 3VXSB 4ABQA 3A9WA 5EPMB 4A6YA 2GN9A 2KQUA 3RRYA 1C16B 2Y7QA 1NX9A 3PDDA 1YVUA 3D6FA 2XT9A 2MWCA 4WGKA 2AS5M 4M87A 4PVDA 4DK3A 1S7VB 2NZWA 1F3JB 2LHAA 2CBMA 2PMEA 1ZV2A 4M1GH 1R4MA 5TF1H 1VACB 1A4JA 5AOMA 2E4UA 1OM3H 4HI0E 4KVCH 3RAEC 5KDDA 1JXFA 4IIHA 2ZKYA 3NZEA 3ER8A 4HAIA 1CUBA 4EG4A 3UC2A 3F71A 3HNVH 2B61A 4BIKA 4B35A 3PNSA 3KQMA 2HU5A 5JC8A 3DWGA 2X5XA 1GQ2A 3RAGA 4EF3A 2B77A 4UOJA 1GH7A 4ZZIA 4H8WH 1BQ3A 2BBWA 4P92A 4DBLE 4LOLA 2P5WB 4TKZA 2JQAA 5I19L 4HNRA 5JO0A 1RJGA 1DDOA 1KGCE 3K2KA 1DIRA 2YIDA 2Y06L 2Z6QA 5ADVA 1HOTA 3DO7B 1MHCA 1XEAA 4ZK6A 1P7QB 1IAII 5K0SA 3BPOC 5CNKA 4OHUA 3PWPB 3MJHA 4J0JA 4DFDA 2IUEA 2XN9D 1LE9A 2WP3T 4JUDX 2ZAMA 2W0PA 4ZDKA 4YRNA 4EJ2A 3MLVL 3CE9A 2R2GA 2QSCH 3ANMA 3NBZC 2GO1A 4AUYA 3GJ3A 1RYBA 4FD3A 4Y9UA 1KN4L 3N8KA 1ZJZA 4S1QL 3ZHTA 1ZV5A 4NYJR 5LMNB 1XRPA 4BZQA 1WCBA 1L5WA 1DTWA 4HAXA 5JOFB 3EXEB 3TCNA 1RRFA 1Y8CA 2BWIA 1II9A 3KS9A 4ONGL 3WLBB 1R3HA 2IYLD 2A59A 3DLHA 4Q7QA 3FCSA 2K2WA 1B0GA 4UBJA 3MRXA 4L37A 7AT1A 1Z34A 2QROA 1FHGA 4V0RA 4LHVA 2VPPA 3Q6IA 4TL9A 4XIGS 4EPRA 2XDHA 4DHEA 3N5CA 3TLYA 5H02A 2I65A 1CSEE 2NSYA 3I9OA 4UTBA 1Y6KR 2VZ9A 1MIOB 5ICXB 4MUFA 1QTSA 3RADC 3C4VA 1P5UC 5L88H 5F1NA 1F11B 4NV1A 2RGBA 3NHPA 4GNKA 4HATA 3L5WA 2HL6A 1ULHA 3IP3A 3V4VH 1ETUA 4OCZA 1BBDL 1CDGA 1U7OA 5DT1H 2FG6C 3H7LA 4JI1B 4ZI8A 3FO9A 4JO3L 2XY1A 3NOXA 4H88L 2ZUXA 1I3KA 1HKUA 1NCWL 4E08A 1ES9A 3O45A 4UE2A 5HQ3B 3C0KA 4WTZA 4BJ5A 2M32A 5CJQL 3QRGH 1Q12A 1QIIA 3G5ZA 1ADWA 4MRVA 3FNQA 3GLHA 1ETA1 5FOJA 2H7WA 1TQDA 4F15C 3GD1C 1Z4KA 1OAUL 5AJZA 4H7HA 1GITA 3OEYA 3TQHA 2GPBA 4PNZA 2A5FA 1E79A 4XTRC 4KZ0A 5J2UB 1TZOA 3KVDD 5FD8A 2AK4A 2VUTA 4QHNA 4C2AA 2J3MA 4D57A 1TGYA 5DFVD 1XF2A 4JFEE 4AEIL 3GMPA 4HWKA 2XCSB 2TSBA 1QI3A 4AVIA 3K70C 3OMAB 2YXDA 1XRSB 1TPXC 3U9WA 1KCWA 4KNQA 3WHPA 4TVPE 4ZXBB 2WVSA 3ZZLA 4F2PA 2XCIA 1BP3B 4CR6A 1ZEAH 2F53A 4LMQI 3NVAA 4YQXL 2VXSL 1ILUA 3REVB 3BFKA 1B3RA 1A4IA 1YAHA 3W4KA 3C7DB 4I5BB 4QLWA 2CKBB 3G6JA 4Y19A 2CFIA 4RXMA 5T1KB 4G82A 1SXHA 1F1JA 5C0FB 4CIXA 3NZHH 2GIMA 3GRKA 1S8AA 3KQKA 4MA3A 5K4HA 3JQAA 3B1YA 3ZDQA 2NYKA 4JOQA 5EOCL 4GMDA 2EIXA 3VG0L 3OJEA 5FTNA 3VR5D 2X40A 3VI3B 4K0RA 4CTNA 2F7IA 4IUDS 4LF3B 4U1RA 4DY4A 2IYQA 4NHCH 5JNRA 4G5FA 2YJQA 3GPCA 4L9SA 3HVIA 4XAKD 3TZQA 2R96A 5JOQA 2ICCA 5JFTA 4RETA 2WAXA 4ZICA 1Q1QA 3I6LD 3SYNA 1THCA 2BFDB 2AVFA 1XWFA 3P19A 1Q21A 1NA5A 2PN1A 4UT6L 3UEQA 2GZMA 4FWIB 2FEWB 4AYID 1L7TL 2WWYA 4NIMA 1I7UA 1LRKA 4L3CA 4QHMA 5AAWC 4KLZA 3JBG7 4TV9B 4XQCA 4OM0H 4A27A 4JG5A 3P9RA 3GZPA 1T5BA 1HCYA 4AGOA 4W5JA 1T2EA 1LSUA 5F6HJ 2BWQA 1FZKA 5DS2A 5T1MB 3AY4C 5GGUA 2RHWA 3HK2A 1ONPA 1CFVL 3N42F 5F7MC 3DAPA 3ZLVA 3PR2B 2H5LA 1AGRA 3PXBA 3DX8B 3KBBA 4QXTB 4JPKL 2GUGA 3VHLB 4L0CA 3PNKA 3ZIMA 3BEWA 4RL4A 3JWNG 5CP8A 4G8FB 3E1F1 5LWYH 2LV4A 3MV9E 3TZEA 4FQQB 4WQMA 5HYFA 3EOAI 2G1UA 5FUQA 2B6NA 1I3GH 4GBMA 5D7SH 4KIUA 2PXXA 1E3TA 4D0RA 1UM4H 2XNHA 5FDWA 3BE8A 2X09A 3ETTA 4Q3DA 4CDHA 4DDTA 1JD7A 1K8IB 3FYHA 1U0QA 4EVSA 3B2VH 4IHJA 4Y4KA 4G5QA 1B2RA 1OARH 3FUKA 1MKFA 3RHSA 1SVBA 1I2DA 1KT2A 3VM5A 1F4HA 2I3AA 1DXQA 1UXIA 2PX5A 3AX6A 1OPXA 3P73A 1LNUA 4JZOA 3QZWA 4C83B 1OH7A 2V17L 2QTVA 3BDAA 1KIUA 1EK2A 3ONVA 1H6CA 1NAKL 4QT5B 2UUOA 3ONNA 1OZUA 1ENZA 9GPBA 2NY6B 4OSPA 1QX3A 1IQUA 1TM1E 1ZHNA 3CZQA 3ROXA 5BSHA 4PIBA 3SR0A 4M6OH 5MGNA 5BOSB 3O2JA 4EG0A 4TN1A 4O2BF 5ISZD 1RIIA 1MHHB 4I4TB 1WF3A 2LPMA 1IIIA 2X6RA 2GITB 3S98A 2ICAA 3PDIA 3MUNA 2ZAHA 1KAGA 4WLNA 3KDPB 1ABEA 5A7GA 3JV5A 4PD4J 5F7UA 3IOEA 2B59A 4PRPB 4PRYA 5G0WA 4GP4B 3AF3A 4O4HB 5FFFA 3UHFA 1XCQA 1EINA 2XODA 4XD7A 3ZH9B 5GGVY 2E7CA 3WNBA 1UXHA 3U19A 1DHKA 3AXLA 5E3HA 4GI1A 2YD9A 1F2XK 1TQ8A 3WS7A 2XNAA 1LLCA 5I75C 1TMYA 3HDHA 3ZKSD 1Q94A 2MSEB 4LOUC 5D70H 2FPKA 1VPEA 1LEKB 2LDBA 3NYIA 3QDHA 4H1LH 1JPTH 2WV7A 1GS6X 2WC1A 1CFZA 5AK5A 2JGEA 4FQIL 2DAVA 2HIGA 4G1MA 4HDNA 3ZGXA 2H0AA 3U49A 1W0VB 4GSYA 1R6DA 3SQDA 4G5SA 3MLTA 4Y2DD 1QONA 2WXKA 5JBIA 3LI2A 1Z3RA 3M8OH 4TKVB 2Q8AH 4BNIA 4IDAA 2IWFA 5H37A 1ECFA 5C0BE 4DCTA 5TIIA 3LH5A 1KZHA 1S5IL 2BM0A 2HU8A 3JAMA 1FIUA 1ZGGA 3EBGA 1IZ9A 5CXUA 1RP8A 2W4QA 2QKSA 4DGUA 4MQ5A 3SOZA 1ZA3A 4B6FA 4MVBD 1ZGJA 5AKGA 3QBJA 1E8DA 1UR5A 2CE7A 3IQFA 2EYSA 2RH5A 3R0MA 5JCJA 1P5VA 1WJGA 1UAYA 2D0OB 2V65A 4QCIA 3B3BA 1U28A 1AGYA 4XMLH 2UVFA 1XD9A 3HWSA 5JVDB 4HIXL 1HHHB 4YDRA 4OVVA 5M7EA 3QFFA 4MWSA 2R7NA 2R0KH 3HBPA 4AOFA 3E9CA 4ZT7A 3FUHA 4PN3A 4KK8D 4LPUA 1CGTA 3GKWL 4G6KH 3M1CA 1MNAA 1WXXA 2BSXA 2UVQA 3G9VA 3IVGA 5AW8A 2GJ6B 4ZJZA 4KKAD 4K7FA 3KUCA 3UWMA 2QMOA 7YASA 1UP4A 1CGVA 2PPDA 3RPIA 4QREA 1WAAE 4NEHB 3MBIA 1ECLA 2H32B 3U26A 4ZUVB 4N18A 4QKQA 1KGIA 3PT9A 4A26A 1O0VA 4KAJA 3E3AA 3IUSA 3HOGA 3BX7C 3BFOA 1TJPB 4HVBA 1IKFL 1EJ6A 3C3CA 2YA0A 5CYOA 5F96H 1JCKA 4P3CH