5E6SB

Structures of leukocyte integrin alb2: the ai domain, the headpiece, and the pocket for the internal ligand
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
459
structure length
455
Chain Sequence
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRKVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-L
publication title Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 127
structure length 455
sequence length 459
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5e6sB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5e6sB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5e6sB03
1L5GA 1RD4A 1MQ9A 2P26A 3T3PB 4JDUA 1YVPA 5HDBB 1SSLA 4FX5A 4WK4B 1IJBA 1T0PA 3EGXB 4WK0B 4HQFA 2NUPA 2VDPB 3EFOA 4DMUB 3ZDYB 1M1XA 3IJEA 1MF7A 1SQ0A 3NIFB 2B2XA 2O7NA 1N3YA 1ZOPA 3ZDZB 1DZIA 3K72B 3OL2A 4XW2A 4Z7OB 2ICAA 1T6BY 1L5GB 1JV2A 4JX0A 4IXDA 3BQMB 1Q0PA 2WINI 3PPWA 5KYUA 4C29A 1M10A 1SHYB 3EFOB 3EGDA 1M1XB 1LFAA 1XUOA 5E6RA 2NUTA 3EOBI 5KYYA 4MMXA 3ZE2B 1N9ZA 1PD1A 3K6SA 4K3JB 3OL2B 3NIGB 3NIDB 2UZYB 1MHPA 3PPVA 1JV2B 4O02A 5LN1A 1M2VA 2I91A 5BV8A 3QA3E 4A0QA 1U8CA 5KYUB 2ODPA 4UM9D 1JLMA 3TVYA 1MQ8B 4BJ3A 2I6QA 1BHQ1 3EGDB 5KYNA 1OAKA 2I6SA 2NUTB 5E6RB 1IDOA 3M6FA 5KYYB 1FE8A 1AO3A 3OKWA 1JEYA 3K6SB 4CN9A 1CQPA 1RRKA 5HGJA 4CN8A 3TW0A 4O02B 1ZONA 2XGGA 3N2NA 3ZQKA 2WW8A 3OKYB 3EH2A 1U8CB 4O3UB 3ZDXB 3ZE0B 1XDDA 2VC2B 4WFQA 4Z7QB 1QC5A 2NUPB 3F74A 4HQLA 2M32A 3IJEB 1IDN1 3TXAA 1MJNA 1JEYB 3HXQA 1ZOOA 3RAGA 1JEQA 1BHO1 4PN7A 1SHUX 3AL8A 4C2BA 3K71A 1DGQA 2XWBF 3V4VB 4WK2B 3GXBA 1ATZA 2VDNB 4NENA 1PCXA 4O3TB 1QC5B 3VI3B 1SHTX 5E6UA 1M2OA 5KYWA 5ES4B 2X5NA 1MQAA 4F1JA 4IHKA 4MMXB 1FNSA 1AUQA 1JEQB 4MMZA 1V7PC 3HI6A 3EGXA 4HQOA 3TCXB 4F1KA 3K71B 3AFCA 4G1MA 1M2VB 2QTVA 2XWJI 3BN3A 3PPXA 4FWWA 1U0OC 3FCSA 1PD0A 4M76B 1U0NA 1TYEB 3K72A 5E6UB 3E2MA 4WJKB 5KYWB 4IGIA 4NEHB 2ODQA 1M1UA 5KYXA 5E6SA 3ZE1B 4MMYA 2NVOA 3PPYA 4MMZB 1IJKA 4HQNA 3HXOA 1YVRA 2ADFA 3EG9A 4UM8B 4G1MB 4UM9B 3T3MB 3BQNB 3IBSA 1YUKA 3FCSB 1RTKA 3VI4B 1XDGA 2VDKB 4G1EA 1UEXC 3EOAI 2VDOB 2VDRB 3AL9A 1AOXA 1PT6A 4C2AA 5KYXB 4HQKA 2VDLB 5E6SB 1RS0A 3Q3GE 2VDMB 4MMYB 3V4PB 3EH1A 4CNBA 3FCUB 3F78A 3AL8B 4GZ8A 3NVQA 3EG9B 5HJ2A 1QCYA 2IUEA 1OLZA 1NA5A 4NENB 1CK4A 4G1EB 2VDQB 4Z7NB 2P28A
chains in the Genus database with same CATH superfamily
4BAUA 1VHWA 1TLMA 2PKEA 4R1UA 2VT6A 2FW7A 5TXGA 3QLVA 3BK2A 4M8IA 3EA5A 3Q7EA 3CLFL 2O5YH 2ZVQX 3T7EA 1SCUA 3LQKA 4XJSA 3SE0A 4B97A 3Q43A 4RD1A 1L0PA 2YUXA 4PPQA 2ZBPA 4J2OA 4K6MA 5KJ4A 3BD3A 4HDKA 3KJZA 4CL7A 1BOGB 2Z58A 2ZTBA 2G4EA 3QUXD 3H11B 2DPGA 15C8H 1JDAA 1Z25A 2HN7B 1AUOA 2HH0L 2B1HL 1G291 3LO8A 4CW1B 5FXMA 4F33B 4FJ6A 3FPHA 2AJUL 3VXPB 3M82A 2F8MA 3LLVA 1ZIAA 1P8AA 1P62B 1UH3A 4F37F 4PTZA 2JB5H 1FFPB 1OZHA 3HVRA 1J5IA 4QRAA 4BLUA 3FA2A 3LHPH 4I9WD 3I6QA 5EE0A 3EJZD 1Y3HA 1P9MA 1BE8A 1BOYA 4A66A 1FZTA 2GEQA 2Z3FA 2Q8AL 2DLDA 3KYMA 2KC0A 3QELB 1KSJA 3O45A 4RS4A 2A0XA 3OM1A 1UBKS 5CB6A 4OGQC 3ROPA 4OM1L 1XVLA 4HR7A 1QAMA 2C7BA 5ESQB 1DEHA 4Z9KB 1QGED 2WQZA 3S34H 4WKCA 2R85A 3G5UA 3KLQA 1UACL 3ARSA 4IYJA 2NUAB 2XB2A 3PQYE 4WZZA 2OBYA 2TMGA 1QDLB 1IJBA 2X4UA 4IRSA 2G9HA 2IYPA 1MAWA 1NXOA 3T4XA 5GJBA 4HYQA 2WWMD 3HUJB 2GBLA 1TTFA 3VM6A 4E5XB 2Y1ZA 2XWXA 1NCHA 4PCYA 1T9ZA 3FFOA 4U7GA 3IEMA 2YRZA 1NVDA 1U0FA 2X9NA 4Z53A 5IBLD 2DPMA 3OEWA 1KORA 1H5QA 3YASA 5I82A 2ZRQA 4OJDH 4TQIA 5L8JB 5C7XH 1X6LA 1FJ1A 1JDCA 2B5WA 3GPEA 4RMSA 4XGZB 3VFRA 5J9PA 4YX2H 3DYPA 1RI1A 1G1AA 4P7JA 3SYKA 3FPLA 4RGNE 5D7NA 1IATA 2Z91A 4NJMB 2ADOA 2DJ4A 3KQVA 3S2YA 3P30H 3IMEA 2VJXA 4V0NA 4GSXA 1J2TA 4K9SA 3WLSA 1XZMA 2WIJA 2HUNA 4OSEA 3EGOA 5LA6F 5ICFA 3LB6D 3GYRA 1L3BA 5IMSA 4F6RA 3G79A 3HRIA 4IS3A 1H9CA 4E5NA 1T7XA 1CXFA 4XNXL 2VXVL 2DECA 3PV6A 1GGBL 1PLGL 5LB1A 1CGXA 3UJ9A 2EFEB 3RO7A 1N36B 3T77B 1Q7CA 3GQFA 4HEJA 4AN4A 2G88A 4ZTUB 4J0GA 4PBDA 3CFTA 1I8KB 4MA1B 1Q7GA 3O6MH 2I4MA 2OV3A 3BO8B 3ZJVA 5EO1A 5I16A 1FP7A 4QRFA 4NN6B 4LXIA 1QMPA 4QO8A 4AI7A 2EZTA 1JYEA 1V96A 3A06A 4Y9TA 4BWTA 1SBCA 1T8SA 1Y1UA 4HCRL 3FBWA 5KKCA 3RWGB 3NVDA 1MFUA 3FRIA 2XB8A 3ZHOA 4K2UH 4RTMA 4AXBA 5A4IS 4R4ND 2IXBA 2TMDA 5DM1A 4LVNB 1NGYA 2MINA 3DOJA 1J2UA 1WMEA 3F9RA 4UMDA 5IFJA 1JNNL 4HAZA 4ZT7A 2F6AA 1AKJB 1HNFA 3AGQA 4XCVA 5BXYA 4WGKA 3B1VA 1PJWA 3NPMA 3P69A 5HI4D 2QYSA 4P82A 3RGWS 4KN8A 3EDMA 1HSAB 3NZ8A 1MLBB 3CC5B 2WFLA 4C4XA 3AREB 4JC0A 2CMHA 4CM1A 3HNSH 1XZBA 1QRSA 5E3JA 1QO0D 5B7PA 5IF0A 1GA6A 2QQGA 4NF2A 3IBCA 1TUPA 2IOHA 5AP9A 2HT1A 1R3JA 2AK2A 2P68A 1V7PC 1D8TA 4YASA 3ZZSA 1CUSA 3NCXA 2HVKB 1P84K 1KAEA 4HHAB 5FORA 1VHPA 3Q7SA 1L4LA 3H2HA 1FL9A 1GQSA 2A9NL 1EEHA 2G9UA 3UTOA 2YWEA 4JXXA 5KSAA 3OE4A 1U42A 2VLRA 1P2FA 4HFWA 2AXGB 3TYGH 1YHYA 2K8MA 2G0TA 2NSLA 2B15A 1U1DA 2HEGA 3L6BA 1AY0A 5HE9A 1Q1GA 1G9MC 5DI8B 5JOFA 3O6FA 2EIBA 4N0RA 3SLKA 1DBMH 2BNQD 2J2ZA 1V7NL 3ZE9A 2H0RA 4FJYA 4AVJA 4W5JA 1LEKB 2DY0A 1BVUA 1R0AH 2Y24A 1XZ8A 5IT0A 4Q3BA 3GK8H 4R0LB 1AI1L 5B1BB 3WZLA 3O8OA 3VWJB 5F73A 4RQQB 1EHNA 1PGPA 3I6MA 1IJFA 4MJJA 3H1AA 4Z3JA 4LSPL 1G8GA 2WSSD 1MC5A 5TF4A 2Q1XA 3GY0A 3L5OA 3TOZA 3V2HA 4D4IA 3F5WA 4BSJA 4ENED 3T5TA 3VOAA 3DV2A 5BSHA 1K3FA 3L3IB 4CKQA 2JBAB 3CLSD 2V3FA 4YQXH 5AVUA 4ALNA 1WHSA 1O4VA 5HDQH 1U3NA 3JQ6A 1GGNA 1HDIA 5IMLA 5ED0A 1IBFA 1LK2B 3I9V6 3Q5OA 5HD8C 4LEXH 2DKFA 5BR4A 4PV8B 2L19A 2XF8A 5ADPH 1XD1A 1PG5A 1R37A 1E9AA 2XD4A 4MZ3A 2DLTA 4M60A 1ZC4A 4F72A 3NTCL 4CG1A 5D5PA 1HQDA 4X20A 3TLCA 1ZSDB 1TJ4A 1KMHA 1M1ZA 2WLTA 5IQ7L 2R15A 1IG0A 5L4FA 3VDMA 1RSYA 4QL3A 1EMTL 2DPHA 4R84A 4LQDA 1G6RH 2IALA 4BZ1H 1FYTB 3RIHA 2QENA 1GSIA 1E4KA 1DWOA 3BVWA 4BEVA 1LO3H 4LHVA 5D4JA 4HX1B 2VN5A 1ZIOA 3SQLA 2XUZA 3UCQA 3QJYA 3FSVA 2ZJ0A 4GF5A 5KYUA 2Q21A 2PWFA 3T1VA 3D08A 3P77A 1Z8DA 5LZ8A 3RY5A 2JFCA 1SQFA 5TE4H 4EA8A 3PR3A 4BP3A 1ZCBA 4REOA 1V10A 2WICA 3BSGA 3ORYA 4TL7A 3UA4A 4UNTA 3IMVA 5E6IA 3CU5A 5B4MC 4YDSA 1IQWL 1NMCB 4YWJA 2PYZA 3EZ7A 4P32A 1T5XA 1YQVL 5M7EA 4QPNA 3OR6A 5EA0L 1F6FB 3IRCA 4GS7C 1O97C 1BVLB 4HUJA 2Q7OE 1D9KD 4IJMA 4QFMA 1G1MA 3D5QA 1KJ3H 3OF6A 2L42A 3GDCA 1RQNA 5AB2A 1WUNT 1U3HC 2WHPB 3OQ1A 1LDNA 2NAFA 3E9CA 4OJTA 5AIAA 1QJ4A 4ZV4A 5D70L 3N7AA 1B93A 4MQEB 1MX1A 1V2GA 2J59A 4V1CB 4ZS6D 4Q58C 3SSAA 1E1CB 3TEUA 1Q84A 3IX7A 3MWDA 2MTBA 3WGVA 3K0BA 2FR8A 4KDCA 4LF8B 3RJMA 3MJDA 4LJSA 2F68X 5DQJA 2GFIA 1YEGL 4X9BA 1IB6A 3L8QA 4Q4EA 2KM1A 4CIWA 1YUBA 4ND6A 4N2FA 4GPBA 4UUPA 2EC8A 2O50A 3EW3B 2ZUDA 5I7WA 1RZ7H 1CURA 1M7HA 3E9ZA 2PXCA 4EL0A 3QORA 3MCAA 1L5HB 3U62A 3GI8H 4X6YA 2NO7A 3ET5A 4NXMB 1QG3A 2Y27A 2BDNL 1A0QL 1ENZA 1Q1AA 4BUJA 4KRGA 1BM7A 3PPEA 1PGQA 2G9RA 1X3LA 3B6ZA 3AHJA 3KL2A 3L5XL 3L54A 2IITA 5JISA 1GTSA 3FRPB 3LA8A 3FB8A 5ESVB 5I9QC 2WVJA 3T2NH 3T1NA 4B6EA 3DVQX 5HQJA 3NOQA 2I9KA 4DN4L 2AK1H 4C1BA 2ZCHL 1CRWG 1U9ZA 5C0AA 3SZRA 3VD1A 3UT6A 5EFIB 1DU4A 1X70A 4I9XA 2JVJA 2P9HA 1JX6A 1MQSA 2UVPB 1QOKA 4LSMA 4UTVA 3L05A 3RKSA 3KUKA 3X2SA 3TURA 3K1ZA 3FQUA 3I6SA 3SODB 2F5AL 3U82B 4KK8D 2PAFA 4Y5VC 5C5IA 2IHNA 5E0FA 3S3CB 1MRZA 5FM8A 3R9KA 3LQZB 3AU9A 2FX3A 3K1YA 2H31A 1KIPA 5F76A 3C74A 3ABKB 3U6RB 5EQDA 5BV7C 4MXWL 5E1MA 2HI0A 3KLBA 4XUGB 1TAGA 1A7PL 2DBLH 1TJIH 4A2MA 3FLMA 2C7QA 1QQBA 1N2SA 5J2UF 4DUZB 4PJCF 4TS6A 1CD1B 4OJAA 3K1AA 4YIQA 3SYTA 3GFQA 4ND3A 1H19A 2JEYA 3DVAA 3HI1B 5CLXA 4GXTA 3X1BA 1RKVA 2G60H 4JU8A 4WDIA 1AY1L 2IRWA 3E9YA 5L6LB 3QXUA 3ZGOA 4R7NA 3PRJA 1N2CB 1YQXA 2G2RA 1RQXA 3FSGD 2FJSA 5HP5A 1RHFA 5I9SA 4N0CC 1QSEA 1DBBH 3NFRA 2PT6A 3QZNA 5KOVC 1OSPL 1MO6A 1R4NB 1JH8A 1U5CA 2H0JA 2OK7A 2WHXA 2HSWA 4J49A 4EIGB 4QU0A 3I9NA 2XG4B 5D7IA 4D8OA 3VR6H 3ZCUA 4HB0A 2YZ1A 2JH2A 5K01A 3RRNA 2JCGA 1Z2PX 2V5SA 4MSUA 4IDHA 4JDPA 1B88A 3H4HA 4KMSA 3ECCA 4RHEA 1WCBB 4COOA 3H4VA 5DN6A 4K6KA 1A6UL 4JJ5A 2ZUCA 4YH6A 4ALAH 4EUPA 1CZ8L 2KZBA 3I75B 4HUQB 3TV8A 2AMVA 1EZZA 5CB0A 3WE6B 1ZKAA 5DLEA 3U4EB 3BMNB 3EZFA 3K16A 1QBLL 3U2QA 3HC3H 2PTUA 4H13C 2F8IA 4C56E 2CXTA 3KHSA 1R9MA 5D7KD 4W4OA 3AZUA 3QVTA 1I82A 3ETEA 2PGLA 2FQXA 1BDYA 2V7BA 3TUZC 1AK2A 3ZTNH 1HZZC 3N1UA 5IN5A 3KAPA 1L9XA 1CDHA 1V11B 1Q20A 2H32H 4U1GC 3V46A 1EGMB 4ZD3L 1YZTA 3L7LA 2NR6A 5F44A 1SCNE 1MO5A 1GSHA 2COVD 1EGJL 5HTKA 1NCCH 3PWPA 1ACYH 1DANU 2OZPA 4JL2A 3RY6A 2C07A 4JC8A 3CNKA 2CHZA 3RVTD 3L7YA 4BV3A 2BEUB 2XUGA 2IEIA 1JKIA 2PV7A 2B21A 3AJ8A 4PZEA 2FQ1A 2X4QA 4CMEA 3WLMA 1E5TA 4ZMOA 1H9DA 4PHHA 5DMKB 1NGXB 4IVPA 4XC1H 2YOAA 4BJ1A 3WL9A 5KQMA 5IMKA 1MFEL 1O7DE 2I7TA 3TR0A 3MBED 1LPPA 4WNIA 4CN9A 1YJDH 3W9UA 4W93A 1R88A 1ISIA 1I6WA 2F8SA 2IDCA 5EC1B 2BNUA 4O00A 2DBVO 3MRKB 5FCUH 3D0RA 3WRYC 5KC8A 2Q3MA 2IZZA 4OMFG 1U58A 2F1EA 3TVMA 3RGVA 4LZWA 5I7UA 3QIBD 2C4UA 3L48A 4BTEA 2B6HA 3QFJD 1DPGA 1Z3RA 1CR1A 1PR1A 3BKJL 3D30A 5JZBA 3JSXA 5ACLA 3CUPB 2FGKA 4PJ5D 2YJNA 3KEFA 3FYCA 2R751 4OCSL 3HS0C 3ZZ0A 4I7ZC 4W68A 1NMXA 3RFTA 2Y93A 4QT4A 4K3GA 1PMYA 3UYOD 5LOVF 3GD1C 3PFGA 4ZODA 5AW8B 3S96B 2B8TA 5IUCA 3SBEA 4YSUA 4WEQA 5ELLA 3WLPA 2CNDA 2M26A 4ZOLF 3NRBA 2Y7MA 3A11A 4NQRA 4YJFA 3EZ8A 5DLPA 4LPXA 2OK0H 3TGXA 3F05A 1Z6GA 2EKDA 5FBQB 4IZIA 3OQOA 3VPCA 1OBHA 3NVKI 3B7GA 3ADPA 2W80C 2Y6VA 1EAYA 2AE2A 4GKNA 4P4KA 2P3LA 2ZCLH 1ZTXH 4P5SA 2X3YA 4GAGH 4PJHE 4KDVA 1Q7BA 1HCZA 3AUYA 1NJ1A 1DBAH 2R7EB 2DH3A 2IP2A 3WBJA 4XNYH 2BVYA 2IV3A 1V41E 2ZATA 1K4DB 1W59A 2VR5A 1KJIA 3K2KA 4X6BA 2GJPA 1YYMH 3PLRA 4QXPA 4A6PA 5BMFH 3G6DL 2AZTA 2GK0A 4PJAF 1JG4A 3GEHA 4DM4A 3G6AA 4M83A 4G65A 1Q74A 1C2TA 3GFPA 4KO8A 3PC7A 2J45A 1AJEA 2XKAA 3RPIA 1RJCA 1MEXH 5I5GA 1T7ZA 1N9KA 3SDDB 1QFWI 1U33A 5E8OB 2A84A 2DT5A 2JATA 4YS6A 4PLCA 3LKQA 3Q1SH 5CD3B 1DSYA 3VTZA 5LBVA 3CSDA 3E3LA 3QZUA 2ENPA 3LUFA 2H1VA 4UB0H 4X6CB 5TC4A 5K3OA 4PRDB 1M1UA 2XN0A 4BNVA 1NOAA 1T8RA 2WB4A 3P3TA 5K9KA 1CFNB 3EQ6A 1WIPA 4DUXA 2KBFA 2EXWD 4OFKA 2VRCA 3H8JA 4FYVA 1A4JA 1XKXA 4KVCH 1XXHE 5AJXA 3WGLA 3OQIB 4BB5A 3P7MA 4WVRA 5FDWA 4Z77B 1KEEB 3M4NA 4I3SH 2VHCA 3FFWA 1KFJB 2Y07L 1QATA 2VRQA 1AO7E 5EU7C 2JAPA 2FNAA 4XVUA 3CG4A 2ECKA 3VXRD 4TTAA 3UDWA 1T7YA 2AG8A 5IB3A 4Q18A 5DEGA 3OT1B 5E03A 3TFQA 2I7CA 4B3HA 4C83B 1P7PA 4QGSA 1HI9A 2QL6A 2TRSB 1XNRB 4QDZA 5LZ4A 3PAZA 2Q87A 3M46A 2JI3A 1THZA 5HW0A 4LARH 1IUOA 1G7LB 4IEFA 1OCZB 3UMSA 3PGDB 2HHAA 5DVMA 1QQDA 2O2SA 3BH7A 1CXHA 4ZQEA 1TTAA 2H2WA 1HESA 5DHMC 1M1YE 3AB8A 1JS4A 1J10A 3BWUF 4KNTA 1Z39A 2BF7A 3K96A 1XA0A 1CY0A 5IS2A 3GXBA 5FB3A 1HLGA 3OTOB 4WW2C 4F1JA 1FC0A 1I9CA 2QVLA 2DBRA 1VKRA 3UHJA 2XXFA 3UHAA 1L4YA 2VOJA 2C5EA 4L8SB 1H2AS 3PGA1 3HB4X 1UBSB 3EHDA 3EYSL 4AN0A 1V39A 4XMWA 3HFGA 3ALXA 3TW8B 3U0PB 3H0CA 2RJOA 2A3RA 2NZ8A 1NF9A 3I1FA 3ZXYA 2GN1A 3RJ5A 1N78A 3HNRA 3QQ3B 3HJGA 5F6HI 1R74A 4LQFL 2Y8EA 4OI0A 1HLDA 5J9FA 3PA6A 4LMRA 2XQBL 4CBPA 1C3EA 3K5WA 1BFKA 1JJUA 2IUEA 4H17A 5IHUL 2X3UA 2C42A 3D64A 5F78A 1UBMS 1AFVL 1F1JA 3L5JA 2MYNA 4UBLA 4MNQE 1NINA 3W5MA 3FZGA 3FWNA 4HUTA 1FNGB 5GJSH 4WLVA 2GUYA 1E8NA 3BHJA 3K0SA 2IPTL 4Q01A 3RJOA 1DZ3A 4CDMA 2ZP1A 4EJ1C 4RRPM 4MWOA 2XNAA 1WSDA 2W8BA 1F4WH 4ZOQI 2WKPA 3HBFA 4IJKA 2P9EA 4LF4B 4R2HA 4B43A 3LNEA 3CWZA 1BD2D 2XRFA 4F8YA 1NN1A 1JLLB 3PAVA 3VFVB 5JQGF 4PGAA 4N0FB 2YJGA 4Z7QF 3FPFA 2FQQA 4ZU6X 4M8SA 4DLUA 1BVHA 4H1HA 1RUPH 2V0GA 1CGUA 4UV4H 4N8UA 4QQFA 1B4JL 5J5AA 1MHPL 3PNOA 1A7OH 4HNRA 3C3CA 2NVWA 4LBEB 5F7NC 2ID7A 3QJQB 4JQIL 2FGJA 1E9BA 4UOEA 4EW6A 2DL2A 5DRNB 4XNMB 4GMSH 1NX9A 3FDXA 5EKDA 2Z4QB 3S8EA 4L8FA 4Y6LA 2VQ6A 4OCYL 3E7DA 4I4WA 4X6EB 1ZKDA 5CCEA 4FQHB 5WRFA 3PDIB 3GLFA 1GQRA 3RX5A 1CLOH 1QP1A 5L2KA 4GZLA 4TULL 2CDBA 1MCDA 4JI5B 4EIZC 1BF5A 4TKWA 3WEMA 2QRVB 4MGYR 1KXJA 1TCRB 2ZI3A 4ZK8A 4QWWC 2BC9A 4L37A 4TOYH 1G3RA 3LPDA 1UOLA 2ITDB 2MR6A 4XBPA 1V9SA 4UTBL 1DZIA 1JAHA 1XPRA 1T4GA 4EYKA 1IIIA 5ALSA 3TGPA 3N0WA 1GY8A 4JB2A 5I9MA 3CY6A 4LCYB 1BIIB 3Q6FA 4PJ9D 3MTRA 1V5WA 1JGEA 2YHBA 1KNOA 3AONB 4G2AA 4OPMA 4URYR 5DEZA 2DOCA 1P0QA 4JXKA 4YRBA 3L8FA 3U4CA 3EFEA 2BKVA 1EUCB 4ZJPA 5KBPA 2M6SA 4WLEA 2ZJZA 3F1LA 3ARWA 4DLNA 2QN1A 3C3AA 1QB7A 3EXJA 3L7MA 2Z31C 3OHXB 3AM3A 1B2YA 5JZ7D 2ZOSA 3GHBH 3E9UA 4N0QA 4XWWA 1IZJA 5K0SA 4IHKA 2VEOA 3N1FC 3RVNA 1U8IB 3FI9A 2ENQA 5TVGA 3TLEA 3BYZA 3DRTB 1H8EA 2WJZB 1R0YA 5IEHA 1NJGA 2P78A 2DHCA 3TJMA 3SKOB 2VJCA 1KSFX 2RB4A 1T0HB 2FV8A 5IYZA 4HDRA 1YV9A 2I66A 5AI4A 4R83A 4BIIA 3Q8WA 1JGLH 4YEFA 1RM3A 2CNBA 4MCAA 2R2BB 5E6ZA 2NTEA 1EU1A 2AP2A 1NM4A 3UBGA 3TCNA 1EIBA 5ECDA 3WKNA 3IRVA 4QC2A 1T03L 3H2PA 1E40A 5MERA 1PY0A 4UINL 5B39G 3ZJTA 3R23A 2X9LA 1RIHH 4KL8S 1NIFA 4PG8A 4J0KA 1Y6KR 1VBNA 4PJGB 3IP7A 5DFTA 3EDDA 1FZJA 5ICXA 5AUNB 4P83A 1T66D 2K6WA 3U4DA 3D0LB 1OAYH 1HEUA 4O4JF 4OFIA 4Z9XA 1M9NA 2O1EA 2JS7A 3GYGA 3IAS6 1II8A 1GIGH 2AD1A 3SVZA 1LE5A 5I47A 1A4AA 5EZJA 2R0LH 4F6LA 5FOXA 2E4VA 5K3FB 2NW6A 1TVKB 3PXUA 4UM7A 2CWRA 1FRGL 5EZYF 1LVGA 4YT5A 3TBSA 4H0HB 3WD5L 2UY7A 3O9WD 3GNML 2VOEA 3TDKA 2Y99A 5C92A 3DTXA 1ZXLA 2ZXUA 3NYRA 4CCSA 4RMQA 5AW7A 2PLWA 4KFSA 2VOTA 1SU4A 4P3YA 1YRQA 4X6UA 2FZ5A 3QKSB 1J9TA 1I36A 1ZT7A 1RP9A 4PB9H 3QNUA 4OGLA 3T9BA 2BSCA 2QPUA 5IULC 1IGTB 4OBXA 1BF2A 3GSQB 4NXSA 1F8XA 4IIXA 4X7SL 4OREX 1JSCA 1EVJA 3L5WB 2HDHA 3HXMA 3PWNA 3IJHA 4IBVA 1T36B 2MSLA 2FJHB 3EULA 4WHCA 1R6DA 2WU1A 5CXQA 3T0EC 3WGZA 4BGIA 1EDDA 4Y4FA 4DPCX 5HCIA 1NQWA 4HXYA 4OXKA 2FSSA 4H4EA 3PJSB 4LJ6A 2FEWB 3CUTA 1UMDA 3O3EA 5KZCB 2AG6A 3KJEA 4FDMA 4IL5A 2PFSA 1JPGB 2OCYC 1SVKA 4JQVC 3GH1A 1NAMA 1P4IL 2DBJA 1N6OA 1TZGH 4KRFA 4DLTA 1J0JA 3F3YA 2ZRMA 4AIRA 2H0PA 4BO0A 3AJAA 2VNHA 1GJWA 4OJKA 3MPCA 1UC6A 3NJ4A 3UC0L 2QMJA 4HBGA 1KCRL 2CK2A 3QHAA 2YRPA 4QKXB 3PQ4A 5FHQA 2EUXA 2LFEA 3ULVF 2HYIC 2D3LA 5C8JA 5T8IA 4OAPA 4QQRA 2YD5A 3KE0A 4ENZA 3FO0H 4KFTA 2Y1KA 3IQDB 3SYCA 1G8PA 1AMOA 3QFCA 3B2QA 4KJYB 3BSYA 3HB3D 4F2WA 5C6TL 1A65A 4MAUL 2QX9A 4BZ2H 4K03A 4XPBH 1AD9A 3BRWD 1IXZA 3RFZB 3V95A 2F00A 3HA7A 5TEWA 4W4NA 5HYIA 3ZU4A 4GXUM 1A4BA 3NHJA 1EEYB 1JXQA 1I1AC 4M7ZB 2ZPKH 4JY4A 4KVNH 1XEWX 1CFBA 4CM4A 5CN2A 3LX6A 3QUAA 3IXTA 1LMIA 1J09A 3CC1A 1CXLA 3NVQA 4TQEH 1R17A 2FE1A 3J8F7 4PBWD 2QADB 4HUNB 1XNGA 2ZJOA 4M0MA 2WY2D 2AWOA 5AM4A 5AVWA 4N0EA 3HE6B 1XAUA 4YMUA 4MCZA 2FSPA 1QTIA 4KAXA 4OQZA 1CDYA 1A1NB 3LOUA 2GAOA 4XAWH 4PIMA 1R64A 3MRMA 4WOKA 2IOFK 2X6MA 2P9JA 3JWNH 4B9JA 2E8ZA 5FYJD 2YQ3A 1FCGA 1QQ6A 2C4KA 3TNMA 3Q6GL 3ZWDA 1QP0A 4LOIA 3DHJA 2BS71 2AGVA 1RU9L 5AYQA 2JK0A 3Q8FA 4LE2A 4LNUA 3FAWA 4KXUA 3M2TA 1TJ3A 2IHVA 2OBBA 4S1VA 3FFTA 3WL7A 3HR7A 1JQ5A 1MB3A 1T7VA 4Y2RA 5C70A 1EINA 4CHTA 4WSKA 3TI9A 3BS4A 3ZQ6A 2ZREA 4LJ8A 4XP1L 1UD3A 3T5AA 3QXDA 1U8PA 1OZ0A 5AAPA 2VYFA 3P2TA 1IC0A 1JSLA 3GPBA 4Y16C 3KWUA 3JZFA 1NZRA 5F5NA 2YD0A 1NM5A 1UIMA 2XVBA 1EE9A 4DC0A 4WOPA 2PO6A 2EDNA 1MENA 5KAMA 3U7FB 6FABL 4RGQA 2VLRE 4NEHB 4QFDA 1CFQB 3HVDA 1YR2A 1HCFX 5JARA 3D0QA 5KS2A 3RASA 4BFSA 4UEJA 2J0SA 2QMQA 1G38A 4Z0XB 1A6WL 4XUEA 4ONGH 4AL8H 2C4WA 4IBSA 3SJBA 1UASA 1Q94B 4YI5A 1I2DA 1R3KA 4U63A 1G3QA 3TAXA 4OCWH 3RILA 1VAHA 1ZK5A 4LY9A 1M1XA 4DNPA 2E4ZA 3JWOH 5JLZA 3TNLA 4Y4KD 1NYLA 4FYYA 4DSNA 4DVRH 5AW3A 4AQYB 1TUIA 2VSXA 1C1YA 4C0XA 3IV7A 2AOWA 2O6PA 5AVXA 5TE6H 1KZ4A 1T5DX 1N3NA 4F7TB 4X50A 3KZCA 4WBNB 3MYJB 3BKWA 1M2HA 4X7PA 2HL6A 1STOA 2CNYA 1QZ3A 4TKZA 3DE4X 4QUAA 2WT9A 3QYJA 2WTNA 1N2EA 4WNYA 2H3XC 2Q5LA 2Z08A 4ZVRA 1VFOA 1XRPA 3CX3A 3VB8A 5INCB 3VPSA 3QX8A 1K8IA 5I0XA 5AZEL 5HHMD 4P9NA 2C5SA 1TKWB 1BX0A 2WFZA 3NWJA 3OUZA 4D4MA 4XZ4A 2DLCX 3U4MA 4QIHA 4N7RA 4HGNA 2KHZA 3VB9A 2GVDC 2D03H 1OX4A 1S7TA 5DD0H 2ICWA 5E3IA 4KGLA 5I0ZA 4DAGL 3HCPA 1S96A 4X7CC 1DL7L 1G2OA 5DM2A 1ZRNA 5K6AC 1KG0B 2EZ9A 4RZCB 1OP9A 3M6DA 4XZUA 2BK8A 3Q8LA 2P27A 3IH5A 4U0KA 5FYJL 3V4RA 4XVJL 2WPDD 4EDFA 2XWQA 5I1LB 3OQPA 1NFDA 4FI6A 2VXYA 2MTPA 3BH4A 4KH1A 3RBAA 2R1YB 4PVNA 3EQ2A 1UWKA 2IVZA 1RLWA 4UUBA 1X19A 4CVUA 1XT5A 3BUPA 3T4UA 2H7VA 5EFOA 2P5WB 2QRQA 5G55A 3G6WA 4PJIB 3STLB 4X0KB 3OIUA 3ISVA 1MLCA 1I9RL 2X1PA 1S7UB 1M3JA 3RCBA 2VT0A 2G1JA 3CZPA 2GSGA 3KYBA 1XCXA 3OQBA 4ABUA 4TKUB 5KWSA 2P91A 3W8NA 3HR6A 4TS9A 5AIBA 4K94L 1N3LA 2EYTA 4J6IA 3BJLA 2Q6VA 3VXSB 3IKMB 3G13A 4LMAA 4PGEB 5MEND 5EY5B 1ZQ1A 1YUNA 3EGEA 4XQ0A 1T29A 2V33A 3V5KB 4LT7A 2W9EL 3VD0A 4Q9LA 1BD3A 4AYMC 4U1MA 3F12B 3HFFA 3NKFA 3WXVL 1OF1A 2E86A 1PIGA 5FV2A 3S35X 1ESCA 4KX5A 5TGBA 3QFFA 3MJSA 2VIRA 4HUXA 3SCMA 2I27N 1E5ZA 4YFLI 3NQKA 3FOWA 4Q0XL 3VTFA 1HCVA 1NVEA 1NBMA 3GEFA 4K9EC 4O9HH 5E95A 2BVQA 1ZINA 3LKSB 1TADA 4LSRL 1PJ8A 5G1NA 5ES3A 4LVHC 1R3HB 2QZQA 4H8WH 1KJMB 2WCGA 5ALVA 5HRAA 3FVVA 4XVOA 2OMWA 5CH3A 3WIHL 2HFGL 5ALBL 4JENA 1OF2A 3IEIA 4WMLA 4I3FA 3EGDA 2XZTA 2WUBH 3HG1D 1L9TA 4YDKH 5TQJA 4JPKL 4TT8A 5HDBF 2YC1A 3G7TA 4EPYA 4P2OA 1WV0A 5H7XA 2IJGX 4U6TA 1FNDA 1KCBA 1SZNA 5DV9A 5FTWA 3EOAA 3VAZA 2RALA 5F1KC 4EEEA 5C0AE 3EYFB 1P4LA 1DC6A 5I9BA 3LC2O 1XF4B 3P2JA 4HLQB 4FNUA 1O5OA 3KYKL 1S2DA 1C2YA 2P2LA 3TDMA 5J0BA 2PLNA 1IGYB 4BO1A 5M3BA 3VI3B 3MWEB 3RWBA 1AOHA 9GPBA 2ZOKB 2XXCB 3BPLB 1LQTA 2IPNA 3CR8A 3QFDB 4P3OA 5JW3L 3ORQA 3U1QA 5M7QA 1H66A 2BUCA 3HB0A 1CB0A 1GUYA 2YMXL 4U3XA 3MN1A 4BQNA 4WNQB 2MWCA 2BCEA 3VYWA 3WSQL 5SWSA 2A86A 5LIRA 4IMKC 3QQ4A 3NACH 1BX2A 3ZCSA 2I78A 3TF4A 4FZEH 1N1GA 4EHBA 1KELL 1SCJA 4DDTA 5ICSA 4URVR 2AUNA 3DLAA 4WWKC 1UK6A 4X4YA 2XG5A 2QVBA 3PQ5A 4GKLA 3V5HA 3PYLA 1V7CA 5JXAL 2P26A 1Q0LA 1E9PB 2VE6A 3FQ1A 3TSYA 1QSEE 2IYVA 3REVA 3APDA 4HWRA 4UOZA 3VXOB 3VPBA 1RLBA 3RAJH 4NYMR 2LTQB 5D7IE 4DP8X 4E0RA 2JZCA 2L4OA 1QHXA 2VLKD 3E05A 1KBGH 4RBNA 1GUAA 4N2BA 3ULKA 3UBXB 4BFUA 1C8VB 2P6MA 4Y1TA 4MGXA 3L81A 3S0JA 3D4YA 1G3MA 3CLHA 5A3ID 4WWOA 1U0JA 3TT3L 2UXCB 3MBWA 3LGAA 2AB0A 4IDJH 2A6PA 5H3CA 1WWBX 3BZFB 1AS6A 1JFHA 2FYYB 3W39A 1XU4A 4KMTL 1F8FA 3VR1A 3T1OA 1OFUA 2VPIA 1E3QA 4W9MC 3MRCA 3O8XD 2XY1A 5EWLA 4MS1B 4MX7B 3CZ4A 5DSXA 1I4TD 3UJCA 3OJVC 3RREA 4HWGA 4DCCA 4L8DB 3WB1A 5E6UA 5IAOA 4RH4A 4BO9A 4C4OA 4LBYA 4V1DB 3BRFA 3U0BA 2FPGA 1IPFA 4U0RC 5EQTA 4C4UA 1DWPA 5HDQA 4E07A 3HXOA 3VHLB 3BK7A 1AKYA 2EKBA 4HYYA 1RU3A 3RTAA 2TRHA 3PWPE 4S05A 3GJFA 2JIDA 5DGRA 4DREA 1KMCA 5IROC 2ZFUA 1HA3A 5CWSB 3ZY3A 1M83A 5ESAB 3CXRA 4F9FA 3IJYB 4J9UE 2ACEA 4B9GA 3QUGA 1NF8A 2VPPA 5FF6A 3L8GA 1AZLA 1T6YA 3DMDA 1AHKA 3IAUA 4RV4A 1Z5WA 4OTXH 2IOYA 4JO3H 4KXYA 4M9PA 4AY3A 4XR9A 1NTOA 5ERWA 4LC0A 4P38A 4Y1RB 1G6RA 2HMVA 5U4QA 4BZ1A 1TM4E 1EA5A 3BUDA 2MSNA 3NH7L 4P2RD 2P5EB 4G2NA 1JP7A 4LJ7A 5GS0D 4O3FA 3WL4A 2WZPD 4WI2A 3KB1A 3JYBA 4WX2B 4DKXA 1T6NA 5A0FA 3VXNA 4OL0A 3MS4A 1LDMA 4K7FA 2W65A 4J3JA 4UMGA 2DWDB 1CLCA 2WIKA 2YRBA 1GYUA 4JGMA 2C5BA 1UWLA 1M67A 3GKWH 1M73E 1ZGAA 1V6AA 2MFNA 2QRHA 3EWAA 5HJGA 4DGIH 3T95A 3MINB 3EJCA 3ZV5A 1DSFL 4LGSB 4MQTB 3FB1A 5J3JA 2COEA 3IEXA 3D8RA 3ONNA 5E2WH 1FG2B 2LLGA 1AQ8A 1SOVA 2NVOA 4HTFA 2WMPA 3NEYA 5JR3A 4EVRA 1NEPA 3PGKA 4JJ6A 5F2KA 5KEIA 4QXAA 5AM5A 3D18A 3KKKA 2YR0A 3W38A 4F9EA 2D74A 2CDFA 5CJOL 2GDZA 5JHGB 2Z7ZA 3SKVA 1H0KA 3ENZA 1YECL 3NQ41 4NAQA 3WTYA 1YA5A 4PVBA 4C87A 4R2LA 1R4AA 4RF3A 4E5PA 4A39A 4X7TB 5E8JA 2YNMA 3S37H 4Q34A 1D07A 3SM3A 3LFHA 25C8L 3WV4A 1L6IA 2YYSA 3ZI7A 1WNFA 4R96B 2XXMB 3WLIA 4PCTA 1Q0XH 1GV0A 2WBKA 1K3IA 1UGKA 3FETA 4JM2F 2FBJH 3OURA 1PL3A 2QQFA 1YS4A 2GTQA 3BAWA 3FB5B 4UNQA 4BVEA 5B22A 3B3IB 4Y2OB 4XD2A 2VKTA 4YDRA 2VYND 2YK1L 5AB0A 3ORFA 4RWYL 2YAOA 1ZLXA 2RGWA 4LQLA 1QAOA 4NI3A 4V38A 3WTBA 2W22A 3M34A 2QTVA 5F9OL 5L3SB 5F9JB 4GYJA 2OT3B 3PNYA 1B8OA 1VIYA 4R7TA 4GAEA 1DCEA 3PP3K 1GAEO 3KUDA 4JVLA 4HNTA 2PWZA 3PGJA 1NNLA 1PF3A 1HIML 3AIOA 3Q8MA 5E6SB 1K8DA 2W4MA 3QE9Y 4RLFA 4M0DA 2Q7AA 4F9PA 2BOBB 1FFTB 1IC7H 3MV9B 2JJ1D 5GS0L 2GETA 2QKIC 4XPIA 4YIKA 4G56A 4NNPL 3ONEA 1DUYB 5IC4A 3RABA 3M33A 2VRWA 1YKSA 3KGTA 1Q0PA 4INPA 2OTUB 1FJXA 4Z7WA 3ZVRA 4DMGA 4FILA 2H1PH 3ZE2F 1TT5B 2YJ3A 4ZGBA 1AURA 5B55A 3R06B 5JRZA 2W58A 3IFOA 2DQYA 4HOXA 1ASQA 3U4BH 2WVTA 3O2DL 3VR3A 4DBLC 1I3LA 4U6XB 4TUKL 5D3KA 5KDOA 4NKDA 4I0PA 1GRVA 4JANB 1NQBA 4NL4H 4RSHA 5I9LA 1HG1A 4QOEA 1Y1TA 4LWOA 2Q5IA 3DX6B 1NQOA 2PL1A 2UU9B 1B15A 3QWHA 3F7YB 3VR6A 3LPFA 4N8VA 2YUZA 2ZJ7A 3CIAA 1F4PA 4JVNA 2C04A 2LU3A 3H2YA 1F4XH 5GRVK 3DCIA 3D25B 2F3PA 1VI2A 3G1WA 3U83A 3NIGE 4ODIA 1S1MA 3QEUB 3NCJH 1IE4A 3RVVD 4PZDA 5NLLA 4DEVA 1HEZB 3JWNG 3FMIA 2LU4A 2ZXAA 5DPMA 4X4ZA 4BQPA 4RDCA 5FOTA 4L0MA 4JI3B 2LW7A 3ZKWA 4JRFA 5JSQA 2AAAA 4NO5A 2WOYA 1T8UA 2H16A 1EQUA 2AC7A 3DDWA 4PW0A 1IM3B 4DK3A 2ZG1A 3KG5A 3NZUA 3EO0B 1KIQB 1DKPA 2W0LA 3LL7A 3ZKND 5ERYA 5A6SA 3EOBA 4L3CA 2J9YB 2H2HA 4ZAWA 1T0PA 1KNQA 2I85A 1MCOH 1GKIA 2QVXX 1OAKH 1SBSH 5AKSA 5CCBA 4OK6A 1XTBA 1AMXA 1M1SA 4KBFA 2ZJ6A 1Z12A 1CPYA 2E1RA 5E9NA 2H32A 4PJ8D 1W36D 4E9TA 1MQ8A 5JFTA 3LDHA 3PJRA 2D7PA 3I3DA 1N0WA 2CDGB 2FFQA 4TT3A 3RIGA 4ENQA 5DUJA 4XX0B 1IM9B 4EIBA 3HXTA 3B83A 2EP7A 4BH8A 3FROA 4LC1A 2IY8A 4M00A 2BO0A 3H2KA 2DAVA 1DIBA 3EYUL 1SA0A 4HBZA 2J0QA 5E8EB 4BX3A 3JVEA 2OO3A 1H8SA 4C89A 1H5BB 3AG6A 4XGQA 3RDTB 2CVPA 3LEXA 2G1UA 2J0UB 5SYNA 3GB9A 2C8JA 1BC5A 3GLFE 4JYAB 3IQIX 5L2KE 3VQTA 3O3DA 4KTYA 3ESAA 3MRLB 5I7HA 2R1VB 3NJMA 2FN9A 5LYJA 2ATEA 4MRVA 4KJPC 1LDBA 5CHNA 35C8H 3SDSA 3LA6A 2WC7A 1E61A 4HX2A 2AMFA 3KKNA 1HDGO 2FWNA 1ETZA 1A1OB 3CBGA 3HWRA 3K0WA 1YZNA 1WTCA 2OR7A 3NFNB 4U6HA 3UV7A 3LZPA 1X7GA 3V97A 4YONB 2GJ9A 1IULA 4C4KT 1T1IA 2WUWE 3WBDA 4ERSL 1J7KA 5L3QA 5J1AA 4YHZL 4L76A 3R6GA 4HIHB 1M6YA 4QQNA 1SUCA 4YNYB 1U3CA 4HCJA 4U1SA 4XHJC 1ZMOA 5KNBD 2R69L 5U1PA 2AEPL 4EG1A 3BZ4B 3VFTB 4C5CA 5BNZA 1EV2E 5BUAA 2DMCA 5L51A 1GAFH 1UT9A 3FR7A 5B1SA 12E8H 4XE5B 4EF6A 2Y5QA 2VJYA 3KZVA 3SJAA 4R31A 1DEXA 1CYDA 1SBNE 3BPNC 4JFQA 2FPMA 3HVUA 3TBVA 3KPRD 5CA1B 3L7EB 4FDLA 5NULA 4PZZA 1D6MA 4V2UA 3NCFB 2PTTA 5TS3A 3GZQA 4RISH 2L69A 3QDGB 1IH8A 3C15C 1Y34E 2EAEA 1KBPA 1G87A 1ZMXA 5D5MB 2FEDD 4GT7A 1QFXA 3P9RA 3DJ9A 3DW3X 5D96B 1KLFB 4R97C 2CGZA 3QEOA 1GR0A 3V4VB 3DMHA 1WW3A 3NBKA 4LASL 4G0NA 3DFIA 1HO3A 2GNAA 4N2EA 5DQ9B 2G0NA 3DX4A 2HTFA 3QJTB 1PBNA 4NS1A 4BQRA 4EGQA 4TSRA 2OXGA 3FGOA 4OBEA 2JXMB 4G7SB 1XGYH 3I9MA 4JVOA 1MRFH 4D2NA 1LB1B 3VI4B 4DJ5X 3BIAX 4G26A 1KQFA 3P4NA 4NQUA 5HKKA 1QA9A 2ECFA 3LJKA 3DMPA 3BVNB 2AN9A 5BR7A 2UZIH 1UK8A 2H0QA 1EX7A 3BP6B 3FZEA 4JI6B 2G1PA 1RURH 1GEGA 5AUOB 4ZYZA 1X7SA 1UBJS 3M6VA 1PJQA 2YICA 3L4CA 4YZFF 4GOSA 3WFDH 5CHYA 4ZX3A 4A23A 1NC4D 3DV6B 4FIDA 5FWAA 4PYLA 3K9FC 1NW4A 5HGGS 1CK0H 2ORBL 4U2EA 3B7YA 1JWMA 4O4HF 3ZOZA 1MCRA 4JBHA 5I2IB 4DNOA 4BDTA 5J58A 2NXCA 4PGDB 3UTSD 4FA8A 1KC5L 3OJDB 3BP7A 5DK0A 2HLDA 1P9RA 1UJ3C 1H2YA 2G5PA 1PTJA 2YTZA 3B3FA 1JEQA 1PX2A 4O08A 1IT9H 5IB1B 5DTIA 1E6OH 1EFTA 2BHUA 3QF7A 4DN3H 3BOVA 3KU1A 3LS5L 4W6XB 5E5UB 3HABA 2GF9A 1DJZA 2W0SA 5AW9B 3QR0A 4MJIA 4N5HX 1TYAE 4XSGA 4AQ8C 3GNLA 4RWZA 5HYJA 3U3MA 2XRZA 2DQFB 5EUMA 2ITCB 3RHWK 1P9LA 3FO2A 3B3QA 1X1AA 1FTGA 4QCIA 5DWUL 5HPOA 4YHBA 2NY4B 4P3WA 4J7UA 1ZGGA 3AFNA 3G2PA 3P20A 4G86A 2DHEA 1ZAGA 1L4BA 5JQWA 2JB9A 2OFXA 3L0CA 3CXDL 1QJCA 2R8OA 3ETSA 1Y0BA 3CZMA 2OWDA 3RJQB 4IKKA 3H9GA 1KOLA 1F9EA 2NUPA 4QUGA 2PMKA 4WI5A 1FH5H 1QHGA 1MVYA 4Q4JB 2V9QA 4TV8B 5KVSA 3MZTA 1CUJA 3JQAD 1HL7A 2ZRFA 1N5YH 1RI4A 4M1OA 3KLHD 4EY8A 5K9JH 1BKDR 3H75A 1SMDA 4MAYA 1J1OL 3R5KA 3U0WH 1GXSB 4XXWA 2XHEA 2AI1A 2E74C 1L7BA 1SYSB 4TQ8A 5JBQA 1M6VA 1PJLA 3B5EA 1T80A 1DLFH 4JFXA 4BEIA 3TNYA 3AWGA 2Z65C 4CVZB 1EWRA 2WQWA 3RVXC 1URPA 4NP9A 5DTMA 3EUWA 3PGCB 1CR2A 5K9ZA 5CEYB 1K4CB 1E6JL 3GM8A 1DWUA 1VEPA 3RNQA 5F72S 4V02A 4RL4A 3EXFB 4EO7A 3BT7A 4S1SH 4EUPG 3LLSA 2DZDA 4G0PA 5BWCA 1IZ0A 3BICA 3FCTA 1IKOP 4I3GA 3LRPA 4WLOA 4GKJB 4QVKA 4N3NA 4W9NA 3Q2IA 4WWPA 3BLBA 4X83A 2VSMB 4KX3A 2XX1A 3FQRA 4K9RA 3T0XA 5CCKH 5L8KB 4Q5IA 2K78A 2BY4A 1WWAX 5IBTH 3S6JA 1Q0UA 3AESA 4YLGA 3WGJA 3UUGA 2FDRA 4UEKA 2B08A 5CGMA 4QRQB 5A7HA 4HXEB 4AULA 2O0HA 3SY8A 4P4SB 3GG2A 2PEZA 3SKNA 4WUKH 2BOLA 2WQSA 3NWBA 5E7FA 3PRKE 4MKRA 1NQXA 3U81A 2VM9A 2G2PA 3WBBA 4D3XA 3RX7A 1ZV5A 1B6GA 4KG7A 4OFVA 2PRIA 4Y8DC 3EF1A 3QRGL 2XVYA 5GSRA 1AB5A 3ITKA 4PAMA 1FRFS 3D3VD 3SDAD 2E9BA 1L5OA 1ZCRA 1OXMA 1FFRA 5DR5H 3JTBA 2XTJD 1V4BA 2P65A 1DQKA 2JDIA 3WV5A 4CKWA 3WMWA 3MLWL 5LLTA 4MW7A 1A9OA 4DGYH 3OMXA 1SFHA 1OARL 4AY6A 4I1IA 4QRRD 2F8XC 3ECAA 4NKQB 1NUQA 4YAJA 1FXSA 2XT0A 5CXPA 2C8LA 4U6YA 3VW3H 4FQXA 4JFYB 1I5OA 1OXYA 5JOPE 1W72B 2C3XA 1L8AA 4ME6A 3OPZL 1DVSA 1PR2A 5KNCD 4AY5A 5ACMA 2NYKA 1EFXD 4QX6A 5ICYB 3FUHA 2WRZA 4KVAA 5LYYA 2FX9H 1ZUWA 5A0TA 1D3AA 3RZCB 3IB6A 4NQCA 2PH5A 3S8FB 1RXUA 1I3VA 4AJIA 2CL7X 3EVZA 1W88B 3Q7IA 3EPPA 3PIIA 3DURB 5LDSA 4QNPF 4LLVB 1BA3A 3OO1A 5BSFA 2IHZA 3TAUA 5KYXB 3HE7D 1HDOA 4H77A 4HMCA 4Y1FA 3QDHA 3CCCA 4L4VB 2XWTA 2P6UA 2ZX5A 1A3ZA 3K2IA 4KVPA 4CC4C 2CVZA 2XOXA 4HJIA 3KL0A 4PGBB 3TS1A 4Q74A 1BYUA 1HEJC 3TA3C 2XVXA 1IAOB 3ZWWA 1SHLA 1IOLA 5K8CA 3QVLA 3L1OL 1X92A 4H16A 3MMEB 1KE2A 1MJ5A 4EKYA 4B2LA 1BU5A 2DQHH 2BRRL 4C43A 4KUZL 3V6LA 2ET6A 1BOOA 5AFAA 3ABSB 1AMNA 4C4RA 1S8AA 4MQ5A 1ODJA 2RGXA 4K87A 3GPDG 3O41A 1T15A 3RU7A 1ZXQA 4OXRA 1SVOA 1GU0A 4DZ8A 1CRPA 3ORHA 2I4NA 4N3GA 4L8GA 2XQIA 1IX2A 3T3NA 5C9JA 1E9QA 4CGTA 2UXVA 4S3MA 2H4FA 4ILKA 3DWIA 1XCMA 4EQ6A 1TCAA 1A27A 2HTEA 4HBCL 4J4PC 1B0RA 5CDFA 3W5IA 3DDGA 5J12B 3UUWA 2GJ6A 2ZX7A 3O8CA 1KIRA 2XBDA 3SYOA 1B9ZA 5JHLH 3FYUC 1NFDE 4XO4A 4IICA 1U6AL 4X99B 5B3JA 4WCDA 4Q9HA 2E7CA 5ETUB 2E4WA 2YVKA 3JYHA 1AHIA 1HMPA 1KIAA 3GCXA 4AUUA 1JG1A 1PE0A 1ZJAA 2HREA 4EY4A 2JQMA 1S7XB 1S02A 4UT9L 1GKKA 4KO5A 4R1QA 4C0KA 4Z4HA 1Q83A 2O3UA 4OK3A 1LWHA 4D92A 3TRHA 3Q6MA 3AWDA 5IG7B 1XDBA 1FQJA 1T6BY 4KKLD 1QTYT 2NSJA 4C4SA 4WY7H 4NDMB 3K30A 4DA7A 2NYZA 3WJMA 1CY2A 3P9NA 3OX8B 3V8OA 4IHJA 3DZFA 3CLEL 4XBGA 3PNVA 1QTRA 2DWPA 1QPKA 2NUTB 3N8DA 1KS2A 1W0JA 2YC2C 2WPGA 1JNHA 5B8CC 4BFIA 1JHLH 3IDIA 5BR8B 4KXZH 5EVJA 2Z2YA 4BB9A 2PXAA 3KUUA 4XQGA 1CDBA 4X66B 2A1TS 4AAYA 4NRZA 2EIZB 2UY6A 1FLRH 2REQB 2FSHA 3PEEA 4GH7B 5BNWA 3B6MA 1XZKA 1QLWA 2WYWA 3IJPA 3CEPB 4P5DA 4APQB 4DV3B 4P81A 4ZZFA 1A6AB 2GKGA 1NHGA 2AFIA 5B1YA 4MYSA 4FHGA 2GJRA 4ZEWA 3LX4A 1N5AB 5TS2A 3X3FL 3H3JA 4AVHA 1NBME 1YVDA 2XLLA 1CUVA 2FQGA 1WLHA 4BLWA 1QYGH 1W6WA 5CB8A 3ORJA 4EZJA 4FXOA 2GO1A 5EF0A 1PUJA 1G8YA 1SXGA 4KC0A 1RFLA 1SRDA 4BZ2A 3FJYA 4MR8B 1P4BH 4G1EB 4AT6A 3IS0X 3UWSA 4QHLA 3QXGA 2P2GA 521PA 3X1YA 1KCVL 1SQGA 3KR3L 4Q4HA 4S1RL 3ATDA 3RRQA 1IQ0A 1CZNA 3O8DA 2DWTA 1J5OL 1XT6A 1GG8A 1U2TA 3RVOA 1JW9B 3FTCA 1H6CA 3B7SA 3PQEA 2QTEA 2GVNA 5DD5L 4K2AA 3PL6A 3WFHA 3H19A 3ETTA 3RKRA 4YH1A 3BPSA 5BRZA 4ZPVB 1D8AA 1YJAA 1NW3A 3QWIA 4EJ2A 3HUJF 4DRYA 4W8HA 3KQHA 4P2CG 4P2QA 4EYGA 3QC5X 4JU9A 1OGIA 3RDJA 3EH2A 3OZCA 2KPNA 5ETJA 3QA3A 2CO6A 2BD0A 2H41A 2N1MA 3P9ZA 4DRZA 4KKAC 3P94A 4N85A 5JXED 5C0IA 2FLVA 5D87A 4O3MA 4XCYA 2FKNA 4LOFA 5SWSE 4HGWA 3DOFA 3L6FA 1T4BA 5LDGA 1PPIA 3VFUB 2HHCA 2Y7QB 1A6ZA 5D3MA 5T4FA 1OLXB 4MGZR 5G41A 1IAMA 3PG5A 4Y0GA 3D39B 3QAZC 5KOMC 4LOJA 5B21A 3OG6B 5E8DH 1OROA 3Q1LA 1BMFD 4BXSV 3TIXB 4P0QB 4H88L 3E38A 1K7FB 4JO2L 4DADA 2UWEF 2IJ0C 5KVVA 4GBXD 1ZLWK 4MNGA 1XCLA 1K0UA 3U3DA 4NIYE 3H6HA 2OULB 5F71A 3F46A 1KENH 3IK2A 4O2EB 1S5HB 4YUXA 4GQRA 3V5DB 5C0CB 1FFAA 3OZIA 1GCOA 3S2GA 2J48A 4XI5D 4B4UA 4Y9RA 5F2OA 4IIZA 2WAQA 3CEHA 4XW2A 1EG7A 3ZE7A 3KOYA 3D81A 2CV1A 1XEXB 3W5AA 1BX3A 2FECL 4MYWB 1XCPA 5KX5A 2H52A 2NXYD 4QOKD 1ESDA 1MNUH 3T8XB 1KO1A 3EO9H 4AQZA 3HJCA 1NUUA 2R86A 2PSSA 2W0KA 3OGCA 3GJFH 1M6UA 2QGNA 5CITA 5C8XA 5KYVA 4LL4A 2XFGB 5AXAA 1CEYA 1OT1A 4OFYA 4MB5A 4QPEA 1D4FA 2HA2A 1X5LA 3IOEA 4QTHB 4O3UB 1AKEA 5CB4A 4OZ4A 1ZG3A 5EXEA 1DSWA 1V1MB 3BD9A 1CUEA 3AITA 1ULTA 3SE8H 3BILA 4R2GB 3DBXB 3ZH9B 1MFDH 1ZNXA 4IDNA 1A69A 3C41J 2Z0BA 2BJVA 4LZPA 1RH8A 3RFFA 4YXHL 4NQSB 2EP5A 3PXEA 1XLUA 2O7VA 4ANXA 3QQ9C 3AETB 5JHAA 2R6HA 5I66A 1AGNA 3AHHA 4L8CA 1CYXA 3FDZA 4NZRH 1WT5C 2YXVA 5J5EA 4AJ9A 1LD9B 4PYOA 2CDEA 4HDCA 2XQVA 2OCFD 3OAZK 3JS5A 3KWTA 4KKCC 4WN9A 2XMRA 4UTOA 3ERCA 3UWPA 4QRTB 2VDQB 3BXNB 1NV9A 4I1UA 1VSCA 1V1RB 3QE2A 1VLLA 1S4MA 4QELA 5BR1A 5CPBA 4DXAA 4CUKA 4X94A 3KEMA 2ZYSA 2CBXA 2EE6A 3L08A 4P5TA 3SE4C 1DBKH 1U93A 2ICWI 2E6PA 1SVZA 4UYQA 4P46D 4GSDH 3H5AA 4QLWA 1ZQ9A 1QDUA 3UH0A 4ZMSA 2G67A 4MUJA 3MAGA 5C4IA 4RX4D 1YAJA 2J3SA 1XZ0B 4UQPA 4G84A 1N7IA 4ZHQB 1IBMB 1EFCA 4BWFB 3RWEB 1L4GA 3A3KA 3AY0A 1QR1B 4XYGA 1BAGA 3B20A 1Q9KA 5CNJA 5H82A 1XVSA 1ORVA 1EO5A 3L8DA 1WU7A 2YV4A 5KVDL 2B92A 3OC0A 4KYTA 4TPKA 4PVLA 2ZWLT 5KBDA 5GTDA 5FBLB 3JQQA 5HHQA 1AS7A 1P1RA 4WHMA 3TONA 2A3TA 2W81C 3TI7A 1JIKA 3QE4A 3HNVH 1UCTA 5IEBA 2EDFA 2R2HB 4E21A 3T0AA 1FTYA 5D1ZB 3JZYA 4JNCA 1QPPA 2PRYA 1M7IA 1KBZA 4KQCA 2H4XA 1XTVA 4FGZA 2XVAA 3APFA 1SKQA 1XJWA 2GZ3A 3P45A 4RK4A 4GS7B 1OREA 5DJ5A 2J1XA 2SECE 2X2HA 4RENA 1I1YA 5D7LE 1QNZL 1SXNA 4I50A 5AO9A 3HNTH 2QYHA 2GFBA 2W98A 3KJNA 2QE7D 4YBRA 5HYQA 1YJ8A 2VMEA 5I17A 4F7EB 4JY6B 4QEGA 5B57C 4TLKA 4R68A 1LPSA 5C08A 5D7EA 1SVSA 4BUQA 4P2AA 2E2WA 3AW8A 3QO1A 2JGRA 2YWZA 2PKWA 4O4IB 4MLIA 4D9IA 4QPZA 4AUKA 2YHGA 5CVDA 2K1MA 3QCTH 4AQ7A 3TAHA 4HAKA 4GPTA 2I71A 1JZGA 1VLVA 1MQKL 2HA6A 1PLAA 2E7ZA 3IVKB 1DX6A 4NNYB 4YUZA 3VRIA 2ISQA 5E0OA 1IZZA 1KY6A 1OW0A 2OZLB 4XMPL 4QMEA 4Y0NA 2OJ1A 1CUGA 5ERXA 1NDGA 1R24A 2IDUA 4H0CA 1YJCA 1N4DA 8LDHA 4CMMA 3U16A 4QRUA 3HEAA 4NQDB 3LG2A 1G4AE 1KGSA 3SZUA 4HDIA 4TUOA 3SFTA 1GTJ1 2PU7A 1EHXA 5TB5A 3EOAI 3U60B 4WU7B 3A25A 4UD6A 2OCGA 5A0VA 4YPFA 1P17A 5E5LA 3OCXA 3S28A 3EW7A 2NVUA 3I6GB 4OSOA 5FNVF 4CF3A 4H6PA 3WTWA 3GLVA 3A6PC 1TLLA 5AL8A 2APBA 2C7UA 3MA9L 2HTLD 3LBHA 1CI5A 1F38A 3QEQA 4NV1A 4L07A 1P74A 3PDOA 1OD9A 4U5QA 4RSRA 2D3JA 2C9PA 1LUAA 3KJ4B 5AVVA 4Q7QA 1HLPA 2ILLA 2ZRLA 4GX2A 5BPHA 4YRMA 5ARDA 4JKMA 3QV2A 1XMJA 4NC1C 4YRJA 5KMGB 2DLFL 1HE5A 3ZGIA 4P5MB 3A1DA 1VC2A 3DBSA 4HH8A 4GINA 3JV7A 3ANMA 3WG7B 3SDCB 4ZU3A 1PX0A 3WLWD 1ECPA 3X1XA 5EU3B 3W0WB 1BHQ1 2AOVA 1P2UA 3VVBA 4G1BA 2CZNA 3FCEA 3TTUA 3O0LA 3RAJA 5J4KA 1IAKA 3IDJB 2J8OA 5EO9B 3A2MA 1P4RA 4G5GA 3GLSA 4OSUH 4WDRA 3I02B 3RC7A 5CDGA 3H9JA 4QJ4B 3NHFA 1E2GA 3HKEA 2F2HA 4ESKA 1TE2A 3BVDB 4NWUH 3RTQC 2OHIA 5K4HA 2HIGA 4JROA 4KQ3H 2GN2A 1XCGB 5E8NA 3QJFA 3RTLA 1EX1A 3S36X 1V8BA 3LLMA 3LNTA 1T5WB 5CKGA 5SWQA 1WZIA 1I8UA 1OI4A 3OLXA 1TQ8A 4ZFOB 4LHYA 1DTWA 1SXQA 3L7KA 4YSRA 4ZMAT 5DEJA 1CE6B 4WXYB 1UA6H 3MV7B 1EEUA 2V7QA 1KYVA 3L4EA 3T35A 1P72A 3GPLA 2GD6A 3C5SA 1C29B 3OWOA 3RUHA 2IAND 4E94A 5A5GA 5JHDB 3JV5A 4J0QA 4JI2B 3MROA 2OP4H 2ZXBA 3VU1A 3K5SA 1FP2A 3QXXA 1XHHA 3LRSA 1OY1A 4TRPL 1S78D 5BO1H 3KSMA 2ONZA 2QGCA 3HFMH 1Q8MA 1AKWA 1Z5VA 4WU5B 4QEDA 1Q1JH 3BRDA 4TV9B 4DIKA 3LS4H 3STWA 3OTWA 5K8IA 1LQ2A 4U7TB 3IAHA 3CXFA 4N03A 4XTRA 4EHIA 3F2IA 4JPIA 4TLTA 4M99A 2VWEC 2DWXA 1ECCA 1A4CA 1QSFB 3GA7A 3FTQA 3L84A 3SY0A 1E90A 2DYPB 3EW9A 1QVAA 4FE4A 2NQCA 4ZPJA 4K3DL 4F3KA 1WO8A 4WCYL 3CKYA 3AFHA 3ENWA 1V16B 4AC4A 4F80A 2VPTA 1K8XB 3T0GA 4BFRA 4EN3C 5IT4A 3LX5A 3NHSA 4H31A 4AGMA 3IUJA 1G43A 1BTOA 3EY9A 4QUBA 4QDJA 3GLGB 1NLFA 5KDLA 4NU0A 5JH7B 2BWJA 4A2QA 3V3KA 3N85L 1EEQA 3QBTA 3C5JB 1KHHA 1GTNA 3I1YA 1POXA 4AC2A 3DE0X 1TPXB 2K6GA 3SXUA 4N6RA 3N6RA 4REQB 1ZRUA 3ULVD 1II9A 3UWKA 1Z0AA 3ITDA 5FIEA 5KZMB 1SUAA 4IIQC 1VQ1A 3MGOB 1IJKA 3NJIA 4IRJC 1P60A 3TYXA 2P42B 2NLJB 1UT2A 1NCWL 5CBEB 2AR9A 3PC6A 1YRBA 4HXAL 4HWSA 3IELA 5C0JB 3LC7O 4X3CA 1J22A 3RARA 1X6VA 2QZ5A 3LXAA 5DJ8B 2D0FA 5IVXA 1KYFA 1V5JA 3GBNL 5DYTA 1V48A 2NT1A 5JXHA 3FN4A 2OC9A 3ILQD 4ND1A 3FNHA 2TMYA 4LXYA 3PNPA 4ABYA 2W92A 1ID2A 3QUZD 4JO1L 1K85A 1E6WA 4MV5A 5T8KA 4NZ8A 3LM8A 4P92A 4IGFA 4NI6A 4FXGA 3VXTA 3B2PA 4BFNA 3NDIA 5E9JA 1E6KA 1P7HL 3HS0B 1T91A 2OAEA 5JFOA 2O3QA 3TEYA 2QXUA 1RACA 3FZNA 3C14C 4AQEB 3HVHA 2WABA 4ZW8A 1ZTXE 3EAGA 5SWZA 2WD7B 1RWMA 4HK3J 3Q3CA 4TM9A 3WRVA 4UUNA 1UWXH 2ZRIA 2N4IA 3GUTA 4TXLA 2YWDA 1YDHA 2JCBA 1DKLA 1QG0A 4BCYA 2C4VA 1EI9A 3Q8AA 5J8OA 3AGVA 1MDFA 3G9QA 2K4AA 4CW7A 5JR1L 1JTOA 4KTTE 4KNUA 1ZA3A 4F24A 3RTGA 2C2XA 4GRLA 4R3UC 2F4VB 4NENA 4HUMB 4IIEA 4BNIA 3Q5DA 3QUKB 2PABA 5FGSA 4N8PA 3GD5A 2YXPX 4UCWA 4GG8B 3W1WA 4A7PA 3KPTA 3F7TA 4TXVB 4MS8C 5TF1H 1ABFA 1UBFA 1Z16A 3L0IB 4NV3A 3C6LD 1WXIA 3OEEA 1DVFB 1R0RE 3PIRA 5C0ND 4CDHA 4FXKA 2IWFA 3W2IA 2ZAHA 2IPUK 2FKAA 3OESA 3SXJA 2BP3A 1PNDA 1ZD2P 4N0YL 2GF2A 4MV4A 1A5TA 4K9JA 4ZYLA 1I1OA 4UQ2A 4PJBA 4AYID 1EWVA 3AQDA 1RYYA 3KDPB 1Z9NA 2O2XA 3NRQA 2X40A 1AHHA 1HQ4A 2G5BB 3HLKA 2ZU0C 3HB9A 3RTBA 1NX6A 3GZJA 3HU5A 1E3SA 2Z5GA 5AKHA 2WLLA 4PP2A 3FOBA 2JWHA 1XWIA 3R0JA 1QVVA 4AUJA 4XC3L 4PRLA 5H80A 5A4JA 2IGBA 3T0FA 4QR7A 3HMXL 3K2QA 4YLEA 4YUWA 1KYDA 3L04A 3S3JA 5CP3H 1TD1A 4X4KA 2OECA 3SYNA 5AI0A 3BULA 3WBKA 1ZRMA 3BXEA 3ZTJH 1N68A 5TDPA 3ULVL 4PHCA 1YMMB 4CSZA 3TKAA 2BH2A 1ZPUA 5IDQA 4B0PA 4MVWA 2AJXH 4MJIE 4RQAA 2Q5HA 1XGUA 3OO0A 2WUDA 5HYJE 2A7QA 3H1FA 2Q9BA 1P4JA 4WEBH 2X0IA 5DRTA 4CV1A 1OEZW 3EK2A 2AJ3B 5HILA 1CN4A 2ATPB 2PCPB 3M3PA 3GP3A 4KN5A 1FNEA 5FLKA 3VX0A 3RS5A 5AYUH 1QP7A 2GIXA 1ZX1A 3C6YA 1U7HA 4M1MA 2AH5A 1Y3AA 4PW4A 4M87A 3OSUA 2EZ0D 1YEEH 3IDAA 1ZH8A 3C1AA 1H05A 2GG1A 5TQ0B 3E5RA 1MH9A 4ZHSA 2BFOA 3B9VA 1KB5A 2ZIXA 4OATA 4PGGA 1L6PA 2BY2A 3TASA 2JTYA 1ESEA 4BK5C 4JFPA 3ARYA 1KA9H 4JLKA 1YNLH 2Q5BA 1GADO 3OLVA 1MCWW 2PS9A 4CKVX 3IDNA 4JUAA 5EUOA 1GGHA 4WW2B 3G8BA 4LFHD 2Y1XA 3TD9A 1M1NB 3RTCA 2B0JA 1BXVA 1XU9A 5L9AA 4EECA 4IGBA 3ELQA 4TXJA 3SZKC 4LIQH 2C1PB 4BIKA 4BQIA 3VFGL 4J6RH 1IC1A 4NZDA 5I51A 1AANA 3R3SA 1MP0A 2YXEA 3FHCB 2OX5A 1CICA 1FQWA 2XQJA 4PG4A 5AM3A 1HYHA 3Q7JA 2Z6AA 4A03A 5E99L 1SXPA 1OAKA 4NGHL 3R3ZA 2YA0A 2OJZH 3W5CA 3UJBA 3TTXA 1RK0A 4APXA 3L4BA 1D1TA 1YO4A 1I1CA 4MYUA 3CVXA 3EC1A 3JPYA 2YJLA 5GVSA 1UXSB 2RBKA 4JHWL 5FI5A 3U0TA 2A0FA 3D9AL 4N9GA 2ZSBA 3COWA 3LVQE 3N5KA 3GSRB 1FNFA 4ELKB 1ISMA 1DAMA 1XZQA 4WW0A 5J2TA 1UQRA 1X7XA 2X9GA 3NQIA 3R1IA 3IBTA 2JIOA 3SKJL 1E1KA 5D4QA 2A7XA 2XDQA 1T3FA 3HB5X 5HF6A 5DFVD 4TVPH 1NCTA 1JXMA 5EIWA 3I05A 2NQ3A 2NY2D 4UOJA 3OQVA 3Q3VA 3WNNA 4CNIB 4CSPA 3G9TA 2PCFB 4L9LB 2ZX9A 3AXIA 2X6CA 4KVFA 4DUGD 4L4RA 4FYWA 2G76A 3V7WA 2FPIB 1CS0A 1UWGL 1ECLA 1WC7A 1U2SA 4FMDB 5K9QG 3IC5A 5LXVA 1CXZA 3E2IA 1P2DA 4YAUA 1ODIA 1DDTA 4WWID 3MRRA 2ED9A 1G5AA 1WSBA 4OH7A 1EKXA 4AW4A 1X5FA 1GV1A 1N6VA 2YS7A 4GR5A 5AD1A 3IMKA 1IVYA 4DVBB 3F6PA 1Z0DA 3RU3A 3SPJA 4AD8A 2GLXA 5BS0B 5MEPA 3H4FA 3WGGA 2XWSA 1MG3C 4MSWA 4TTIA 1JR2A 5AKJA 4QWMA 4OXYA 2I67A 3MRFB 2BEVA 4TROA 1DBJL 3SZGA 2ZWMA 2Q62A 2ZDGA 1YBHA 3MLPA 4AUNA 1ZUNB 4YWGH 3BORA 2AJZA 4Z9FA 4YRIA 1PQZA 3QI9A 4UOW0 1GT91 4Y0VA 4R4BA 1VJ5A 3HAEH 2FB4L 3JWDL 3GLTA 1E2LA 2VAWA 4NQCE 4FFZH 2HPTA 1PCXA 3DBVO 3JSSA 2CK0L 4TNFA 5CJXA 5MEQA 2R23A 1G84A 3CLUD 1NWCA 2I4TA 4OD1L 3DVNB 1IFRA 4MKHA 3JVGA 4EKDA 2JKRM 2ESVB 4PN6A 4B41A 5IOKA 2TSBA 4HP5A 4UPEA 1M71A 3Q8KA 1NAKH 5H4HA 1SIUA 3KV3O 1T2UA 1QTQA 2PK3A 3RADC 4LWQA 2BNRA 3L07A 1FVCB 1YT5A 2Z31B 3MF4A 4URFA 2NSXA 3DO7B 1WJ3A 3HG3A 4H6WA 1E4XH 1WIOA 4Y2PA 1XELA 4LOKA 5CFMA 3HFRA 5G0WA 5I71C 3ARZA 4ZEVA 5ADOH 1JEDA 4FMPA 4HVBA 4OQXA 3F5SA 1QPXA 4LF6B 1COWA 1JQLB 5ECGC 1I51A 1UD4A 5MP6L 4GZ6A 4UMVA 1E5XA 3R9XB 3AUJB 3F67A 1A64A 1WB6A 1G21A 3FRUA 3NHAA 2NSMA 4JS7A 3CX2A 4RKFA 1N6RA 4PLWA 3NCEB 3Q9QA 1MC1A 3TN0A 5KVMC 1N8ZA 4CTOA 1IEAA 1VTKA 5CA0B 3RD5A 1ZLVH 4M9ZA 2JLUA 3V4LA 3CDGA 2XOEA 4G9DA 5KWJA 1IZ8A 3SO3C 5AI6A 3PLNA 5CDFE 4ZQKB 4EAEA 5F88B 2YN0A 4IMPA 1R5OA 2GJ6E 4ALMA 4GG1A 3FUVA 4G8EB 4Y1EA 1F6AA 2PTGA 3WJLA 3W04A 4PO3X 3GLAA 4CGZA 4UNPA 1IN7A 3HHPA 3BN3A 2DERA 4I5IA 3F8TA 3ZDEA 5B3JE 4EJSC 3RVRA 5TDNB 3FSJX 3FTYA 2O8DB 4OHOA 1CRLA 5CN1A 3KTAA 4N5ED 3UIYA 2DJIA 3CN7A 4QPJC 2CGRH 2AW2A 3CFCH 1OH6A 4CU5A 5IKCB 4GLOA 5IK2D 1PJAA 4R8MA 3CXHK 2A1WL 3O4OC 1UODA 2OGSA 1KEML 3Q8CA 4AEHL 2OXCA 2E7LA 1JV5B 2X8AA 3H1TA 3LVFO 4Q3OA 1MF7A 5CLTA 3M17A 3GQVA 1QGAA 2XE8A 2WNSA 3P0EA 4RPHA 3I6KB 1BD4A 3I04M 3CSPA 4Z4IA 4DLVA 4BQBA 1LH0A 1FUEA 5J4HA 4Q24A 4NM8H 5T1MA 4GW4B 4E51A 1QQAA 1PY9A 3RI5F 4DKAA 5F52A 1PU0A 4Y4HA 2C3HA 3FIJA 1FIGL 4UOQA 4R0VA 3QKRA 3DL4A 4BB6A 2KLTA 5IWLC 4IU2B 1YRHA 1NYTA 2BXZA 2JF1A 3T0EB 1XF5A 3LXBA 4PJGF 4H8QA 2AFIE 5BQ7A 1Q91A 3HXLA 4NO3B 8ABPA 3RBSA 3U3JA 3OFND 3NP4A 4HVTA 2GH1A 4YSOA 1XVVA 1J9RA 3W34A 3TJEH 2Y1YA 4N8VG 1R3IL 1TQCC 3VMPA 4ZXBA 2GBVA 1FFYA 2E5WA 3QXAB 3UPRB 1Q9WB 1FFWA 2DQCL 5HGXA 4TWIA 3JQ7B 4WZ9A 1S3IA 1EIZA 4X84A 3T1FB 3GGDA 3O9VA 1I3RA 3IXAB 4UT6L 5BUPA 1ODLA 2Y4OA 4TQAA 3NHWA 1HC7A 4PZLA 3B7PA 3J27A 3E3NA 5BRNA 4PEEA 3ES6B 2QNIA 3KZMA 1NYRA 4J23A 1NL3A 5E2TH 4EXPX 4RIRB 5ALFA 2B4QA 1UZ8A 2ENUA 1XCTA 4GAJL 5H16A 4UEWA 4Z6AT 2JLAA 2VCOA 1RKBA 4TMYA 2R6CA 2Z04A 4PLGA 1D5ZB 1U2GA 1Z2DA 4M0FA 2VP0A 5BRZE 4C29A 1AHWA 2HAEA 4NOFA 3S3BB 5H35B 1UBLS 4PICA 4P2QE 1RV6X 3QYMA 2RH9B 3H65A 1EO8L 1F0NA 1U8MB 1XVIA 3QM1A 3EJ6A 3QA3E 1MJUH 2E56A 2CUAA 3EPLA 3JWNE 3JW8A 1OA0A 3S27A 4PG2A 3JTTA 4RKWA 3C60C 4YEEA 4RNRA 3UZEA 1X1TA 2OMNA 4GGPA 1O0VA 3IGAA 2H3KA 2C8KA 3AS1A 4ZN6A 5B3NA 4R2JA 1AKPA 1G5FA 4ZRMA 2JCCB 3UIZA 1GIAA 3AF3A 4XASA 2QJFA 2WLIA 1E0SA 4NBRA 2BY0A 4DB4A 1MCZA 1AF4A 2IHUA 5BNXD 1Z0FA 1T22B 3EE6A 1L8QA 2B0SL 1G9XA 1QK5A 3QEBZ 1VZ2A 1HGXA 2BMAA 3AP3A 4JM2D 4YJGB 3JQDA 1FGVH 3MB5A 4DCNA 3S29A 4DUWA 5IG2A 5JJIA 5F7MC 3DMMD 1AQYA 3QRWA 4MNGE 3W7VA 2VKXA 4KI5E 5AW1A 4I1PA 2FSGA 5AHRA 2GKSA 3GLEA 2JKJA 3ZGHA 2JFZA 1PT6A 4KVZA 2WUCL 5FO9A 1CFSB 4K6FA 2GJ8A 5GGUA 3EGVA 5HJ2A 3O4FA 1TR7A 3MRTA 5FWYB 2LNDA 2XBTA 3BVXA 3M1OA 2PD3A 3WMXA 3MAWA 1KDRA 3EZ6A 5GONB 3AVTA 1ID1A 1GC1H 3C09C 3I5MA 1IC5H 5IFLA 2UVFA 4AWXA 1H3WM 4GW5B 1NCAL 4CXMA 4RSYA 4TQUS 1OBFO 1DQPA 2VATA 5LUAA 2IIQA 2OE2A 2UXTA 1WO2A 3DRQB 1RHQA 2BZ1A 3GCGA 1NSNL 1OWMA 2I9PA 4CUZA 2YPKB 1OC2A 4J2QA 2GLUA 3PGLA 3DV0A 2FATL 1VFBA 2BVEA 5GS1A 1XA3A 4TZTA 4UHHA 1YDMA 1P7WA 1KPRA 1VSTA 4X1IA 3VR2D 2DFPA 5C1MB 5E7IA 4JFHD 5GZND 2DM2A 2X0WA 4FCVA 4MDIB 3ZBPA 1A7QL 1ZHKB 5AW2B 1PKOA 2B1QA 3K31A 3I50H 3O93A 4UU1A 4GXVL 3K2UL 4G8AC 3FPBA 2XA2A 1ADCA 1QRRA 2VK4A 3O84A 4UBKA 5ID0A 3ZE1B 2PD4A 1UWVA 1Y3FE 4XNQA 3US1A 3PFNA 2GM4A 2PSJA 1Z5LB 3NNDA 2CMRH 1C7EA 2FWJA 2LCIA 3MOBL 1IGCH 4JPVL 5I1IH 1C8QA 4WO4C 1Z9BA 3TVDA 1LLCA 4E42B 5G02A 3TINA 3D7SA 1EXMA 4IDPA 2ED6A 1K2WA 2XA8L 3EXLA 5JHLA 1A7AA 3HKBB 5FFOA 3JV6A 1PG7L 3HDYA 4PC6A 4HS6A 2WWWA 4AQ1C 4JX0A 1MABA 4CETA 4ANVA 2F64A 1N8NA 4Q48A 2CYBA 1ONPA 4XQ9A 1QHOA 5K9OB 3LEYL 4AXWA 3DHWC 4U6VH 2RAPA 2FQWA 1EJ8A 1IMHC 1OE3A 3ASUA 1KCSH 4I55B 2R66A 5FAKA 4LJYA 3I9GL 4HWBL 3AZQA 4LCIL 1GA1A 3ARDC 5DW3A 2MNUA 5CR1A 2XHNA 3DLIA 3G2MA 4HK0B 3LVRE 4JFFA 3V8RA 3HG7A 1QHSA 5AJUA 1BQHB 3QCUH 5IREA 1OWRM 4RAUA 3MNDA 2FLWA 4Y9GA 3K09A 3KUCA 4DWHA 3ADKA 2NX5B 4ZI3A 1FORL 3ISWA 5EU6D 2O54A 1RXYA 2H4YA 3Q9PA 1I33A 1AZSC 1CF8L 3NJRA 5JCJD 5FKPB 2IOMA 3A6BH 3QGVA 1KIMA 1X7WA 4Z7IA 1JGTA 3H7BA 3T9WA 1HJCA 2GPTA 4L29B 3OZKA 4W7HA 2DCMA 1R5WB 4OLVH 3NEOA 4PCLA 2H8PB 3DUUB 4NBSA 4TUJA 3D8BA 1HOCB 3F98A 4K46A 3PSHA 2ROYA 3CFDB 1VADB 4Q7EA 4RAHA 5C08E 4BPRA 2GHRA 4MULA 1F3OA 2HT3D 1VIVA 4IMRA 1KJ2L 4CMHA 2CL6X 1U8NB 4XP6H 4LY3A 1BMDA 2OESA 5BNTA 2IUSA 3VX4A 4NXNB 1WVGA 2CRMA 4YR6A 3BJZA 3DMRA 5BQXA 1RI3A 1M2NA 2IUYA 5CLYA 4DIMA 2OCPA 4YUEH 2WA2A 3O1HB 4FQLL 3MLXH 3KVYA 4EG0A 1YEDA 1A8ZA 1ROWA 4PJIF 3IBYA 4ZO4A 2APWA 4G82A 3FWPA 1KFAL 1DQSA 2GJKA 3WUWA 2ERCA 1XDDA 2OY0A 1ZR4A 3ROOB 2YIDA 5IKOA 1G8SA 5D1XC 3A8TA 2FUKA 2IEZA 4HPYH 4M8QB 1XI2A 3EVCA 5FA6A 3RLFA 2R1WA 5B4VA 4G43A 2H57A 4MB2A 3AR5A 1FQOA 4PR0A 2ZIEA 5L6YL 3SJVA 2HMUA 2ONCA 2RGNA 4NCIA 5HNKA 3MODH 4Z78B 4FC3E 3BZEB 5DHQA 3MXWH 1NI4A 1QFOA 3T34A 1RXSA 2OBFA 3MRDA 4ZFFB 3BRQA 3QPCA 4ZOCA 4L6CA 2ERJB 1JMXA 2IDQA 1ZHLB 1Z2AA 3SIKA 1TEYA 2IEYA 3BKMH 2EDXA 4A7GA 1HX0A 4YHOH 4QT0A 3WN6A 3K20A 5GM2A 3M7OA 1FFDA 3QEQE 4HS3A 1H6DA 2XB6A 2EDWA 4M48L 4QARA 2WGXA 3Q9SA 1H0SA 3GA5A 4R1PA 4LSQL 3BGFC 3VRJB 4PRIA 4FD2A 4RVBA 4R81A 2DD8H 1L3CA 4Q6BA 2CXPA 1UKEA 3V0GA 2Y06H 3ZDYB 1SM4A 3V52H 1XMIA 3O03A 4O51A 2R2EA 2YRXA 2AK4A 3RWFB 3OICA 3I2HA 1QU3A 5M5BA 1T4DA 3WZMA 3WWDA 1ORHA 2WWOA 2CE6A 1P0IA 5DZLA 3ZQ4A 1EG2A 2AI0L 2ZEJA 1H0RA 4WWKB 5FPHA 3LVTA 1B8NA 2NRDA 4NN7C 3ZIAA 2AHIA 3D8UA 3WXWH 1JHAA 4E3ZA 1UQSB 2PQ0A 1REQB 2G4CA 3KB6A 2OYCA 1GSAA 4DDVA 4HQLA 3HHRB 1MWAB 5TH2B 5TD4A 2P5TB 3ULUC 5AKKA 3V7NA 5LLIC 3FYDA 3NM4A 3FB7A 4TTTS 5CUSH 4YRTA 1G4MA 1A3RH 2XN2A 2ZKHH 4FHJA 3BE5A 3ND7A 1UH5A 1QX4A 5EF1A 1SJHB 3BZWA 5A2IH 1ZGLA 4WNJA 2VDNL 4NOKA 2KB0A 3LNFA 3PK0A 3MUGA 3LN4B 3BUYA 2EDQA 3LX8A 1OT2A 4XGIA 4UANA 3GFVA 4G8GD 3QF4B 4U1HA 4RZQA 2VF5X 3X43A 1CQKA 3VI3F 1W91A 4F4CA 5K8JB 3CFKB 1PJCA 1SFDA 2XKNA 3PGFH 3P2MA 2CJWB 1JYXA 1ZM7A 5LDHA 4DYDA 4NO0D 3QVUA 4KMRA 1HU8A 5C0GA 3CFJA 4MQMA 2ZTVA 5F7DA 3EIXA 4JWKA 2EDTA 4M7KL 3V8QA 1KCUH 3PX2A 2BGMA 3PHOB 3KDMB 4IXDA 4AGPA 4B3XA 4ASUD 2EKZA 4AP5A 3E8UL 4ID3A 1G98A 4U0RB 4Y19B 1B43A 5JO0A 4KO1S 1SKYE 3RHFA 2NYYD 5DRYA 1ZGLP 4NQEA 1UM4H 3HCVA 3DETD 2NXWA 3DZCA 3ZOKA 1RXVA 2BSSA 3UJIL 4RU1A 5DOZA 2NYUA 3H7LA 1G1YA 3QKWA 5IU6A 2AEMA 1YFLA 4JCWA 3JTEA 5KN5B 3JZIA 1YN6A 2O5CA 1YIAA 1GNLA 3RA7H 3UEOA 4DKDC 3H83A 4RL6A 2HRLA 2AV1B 3QEGH 4LOUD 1UC8A 4PYRA 4IOIB 1BGXL 3OB0K 4BO5A 2DPKA 3TLGA 4CEJA 4J3BA 1Z7WA 2YQZA 3WL8A 1VFNA 5SV2A 4EKJA 2GR9A 2IWKA 5IR1A 5AL0A 2AFNA 2ABWA 5IW6B 2OD2A 2FR4A 3C1UA 4WUVA 3TKLA 3SJUA 3M49A 5BYBA 3G08B 4GAFB 1AKUA 2YPLB 3VXMA 3WHE1 4M7LT 5IVXE 1KI8A 1XRRA 1V05A 4AZ3A 1LO4L 2Z98A 4CDNA 2JIZD 3BL8A 5KSBF 4REMA 3F9IA 4K71C