5E6SB

Structures of leukocyte integrin alb2: the ai domain, the headpiece, and the pocket for the internal ligand
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
459
structure length
455
Chain Sequence
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRKVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-L
total genus 127
structure length 455
sequence length 459
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5e6sB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5e6sB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5e6sB03
1PD1A 3PPWA 4O3TB 5HDBB 3EGDA 3TCXB 1L5GB 4PN7A 4CN8A 2IUEA 1SHTX 1DZIA 1JV2A 3IBSA 3EGXA 3HI6A 4Z7QB 4UM9D 3OL2B 1RRKA 4G1EB 4UM8B 3ZE2B 1IDN1 3EOBI 3AL8A 3PPXA 1OLZA 1RS0A 4HQOA 3ZE1B 2I6QA 1N9ZA 3IJEB 4CNBA 1M1XB 1ZOOA 5KYYB 4XW2A 5KYWB 3TVYA 2M32A 1YUKA 3T3MB 2WINI 2XWBF 2ADFA 4JX0A 1JV2B 4NENB 2VDLB 3AL9A 2I91A 4O02B 1U8CB 3ZE0B 2P26A 1M2VB 2NUTB 3EFOA 1YVPA 2I6SA 1BHQ1 2VDQB 1XDGA 4WK2B 1ZOPA 3OL2A 4UM9B 5HJ2A 4A0QA 1AO3A 3Q3GE 1JLMA 1ZONA 3AL8B 4O02A 1U0NA 1XUOA 2QTVA 1IJBA 4NENA 1UEXC 2VDPB 4Z7OB 3VI3B 1IJKA 1CK4A 2NUPA 2O7NA 1JEYB 5KYWA 3HXOA 1PCXA 4IXDA 4O3UB 3BQMB 1TYEB 2ODPA 1QC5A 3T3PB 3V4PB 3EH1A 3E2MA 4HQLA 3NIDB 4DMUB 2VDNB 5E6UB 5E6RA 4IGIA 3K71B 4FX5A 4MMXB 3BQNB 3TXAA 5KYXA 5KYUA 4C29A 2VDKB 3TW0A 4GZ8A 1M1UA 4JDUA 1MQ8B 3QA3E 4C2BA 3VI4B 4MMYB 4WK0B 3F74A 5E6UA 4HQNA 1MJNA 1MQ9A 1QC5B 2NVOA 2ICAA 4IHKA 5KYXB 3OKYB 4FWWA 4WJKB 3K71A 3M6FA 4Z7NB 5ES4B 2VDMB 1MHPA 1M2VA 1V7PC 3EFOB 3PPYA 2NUTA 4HQFA 2X5NA 1OAKA 1RD4A 4MMZA 5KYUB 1YVRA 4CN9A 2VDOB 4F1KA 3RAGA 3NIGB 4G1MB 1M10A 3EH2A 2XGGA 4MMYA 4HQKA 1JEYA 2XWJI 3HXQA 1PT6A 1CQPA 1SHUX 5BV8A 3K6SB 2VDRB 1FNSA 5LN1A 3EG9B 4M76B 3ZQKA 3FCSA 3V4VB 2P28A 3K72B 1IDOA 5E6SB 3IJEA 4MMZB 1MF7A 4NEHB 4K3JB 3ZDYB 1XDDA 3GXBA 1Q0PA 1AOXA 1ATZA 1BHO1 3ZDZB 4G1EA 1LFAA 4WK4B 1RTKA 3NVQA 1SQ0A 3FCSB 3AFCA 1N3YA 4BJ3A 1NA5A 3K72A 5KYYA 1M1XA 1U8CA 1AUQA 5HGJA 3EG9A 3PPVA 3K6SA 4F1JA 1M2OA 5KYNA 3EGDB 5E6SA 2ODQA 3N2NA 1SSLA 2B2XA 3EGXB 1JEQB 2VC2B 1T0PA 4C2AA 3FCUB 3OKWA 1PD0A 1QCYA 1U0OC 3EOAI 1L5GA 3ZDXB 5E6RB 2NUPB 2WW8A 4G1MA 1DGQA 4WFQA 3F78A 3NIFB 1SHYB 3BN3A 1T6BY 1JEQA 1FE8A 2UZYB 4MMXA 1MQAA
chains in the Genus database with same CATH superfamily
6REQB 2KQNA 4W9DC 1A77A 4J7UA 3OUZA 3GPBA 4V2BA 4D5GA 4OFDA 1BS1A 5CDHA 2QT0A 2L0XA 1IBCA 2XVYA 5AJHA 4YP0A 4Y19A 2IWEA 1DBJH 3D8BA 4D0CA 2JLZA 4JREB 4IIHA 4N2AA 2VWGA 2NY6B 3VTAA 2CXOA 5T5FL 3GMPA 3DKVA 4OGGA 4GOKA 5EMNA 4ZPTB 4HDSA 4KKLC 5LP6B 1WMEA 3IKLA 3VPFA 1JKJA 5BY2A 1WS8A 4WTZA 4JGUA 1WX1A 1U6JA 3ULSA 5DUPL 4N8PA 2Q3BA 3G9QA 1N6VA 4UDUB 2Z9BA 5IJVB 3S97C 4G4JA 2PO6A 1T2XA 2ZUEA 3GA0A 4NMLA 3HCCA 3UT5B 5A04A 1P2UA 1BZ7B 2A2QT 3C74A 3D3QA 5JH7F 4NPYB 5FYKH 2UV8A 3OZUA 4NKRA 5EOCH 3NASA 5DJ8B 4TV9A 3WKYA 3FYHA 2FWBA 3ON5A 1ACMA 2J45A 2D06A 1U3VA 1G21A 2XN9B 3KJ6L 1XF1A 4HJUA 3LD9A 2AEOA 4DQVA 3ORJA 2X10A 3KT3A 1HGXA 1BQ5A 2ADJA 3JQBC 5DZJA 5DHAA 3T5TA 4HPHA 2MMXA 1CBUA 4DR4B 4ZEOA 2WPDD 3RPBA 1BHJA 2Y1OA 1QZUA 4D9EA 2WGNB 3TBHA 3F3SA 3RVLA 3MS7A 1G7JA 3QEQE 3QFJD 1TAQA 4MVBC 2J6EA 2DY2A 3DO4A 1EGVB 3BWDD 5IM4A 1DVXA 5L8VA 4WVLA 1YACA 1CLOL 1YO6A 4WFQA 4RTRA 4PG4A 4CF4A 3AHEA 2XU9A 4JCMA 3MPOA 5GADl 5E9DA 3CFBB 1W5BA 1WKBA 4B76A 3MLEA 2KQMA 2IOFK 3G8BA 4UEOA 3BZBA 3SGLA 1F17A 3MCVA 2JK0A 1Z16A 3L3GA 2R56L 4AJNA 3F62A 1XLUA 1BVKB 4PV7A 4DV2B 2EDTA 4PJCF 1IAVA 4X7TB 1RUQL 4N4YB 2DKMA 4GRWH 3SF8A 5BUSA 4TS3A 2J3DA 2OILA 3QZWG 1OTUD 1E4WL 1Y89A 2WVAA 3SYMA 3K5HA 2Z7YA 4IS6B 1ZGGA 3D39D 3E4DA 3ZX4A 2L0DA 3OF6D 1I24A 5EUBA 5EUKB 2WG1A 2P46B 1M1UA 3QIUD 4E9WA 3ZN6A 1UWXH 1XZEA 1SVZA 4CMMA 5BMFH 3HZKA 1E3QA 2E4XA 3POCA 3NACH 1P80A 3FOWA 3BPCA 2P4UA 1TYDE 3U2JA 1QFJA 1N6KA 5THXA 3NPAA 2H6PA 1AQHA 3QNZA 1B0GB 4F4DA 4TUYB 3D8UA 1PG7L 1EXDA 1VLLA 1H3WM 4IH1A 1ODLA 1Y8ZA 2E5EA 3QRLA 5SZHB 1U93B 5FOQA 1RIFA 4QWWA 2OHIA 1CJTC 4UE6A 1L4UA 2AFIA 5KTNA 3GLGB 4LFAB 3A7EA 2JEOA 4G0ZA 2YC1A 1F2VA 4XRGA 3TCTA 3PXEA 2Y07L 1JRHL 3N8IA 3O9MA 3SD7A 4XNZC 4MW0A 4RF2A 2H0EA 5G1OA 3UTTA 4X4YA 2I8LA 3AEXA 5EERA 3RJDA 5IN4A 4RVSA 1IJ9A 3N9IA 1K6QL 2LIVA 3KD2A 1E9QB 5E95B 2X23A 2G7ZA 4P07A 4M54A 3CV3A 3ITKA 1ZOLA 3RC2A 2FBOJ 1KT2B 1M83A 4HIXL 4A68A 1Y6GA 3V0DA 1MC1A 3TM6A 5AW2A 2GJRA 4FAAB 2FKNA 4HLDA 2DMCA 1BM3H 1UQSA 4ZGGA 1BZ7A 5IQ9B 2JCSA 1ZANL 4YHYB 4CLEA 3VI4B 2A4ZA 3RP1A 5AW2B 4KY2A 1FIGH 1VOTA 1GU1A 2FGJA 3NIDE 5K0TA 3LHKA 4C4KO 2M9MA 3FR7A 1KARA 3WKAA 5KQGA 1OANA 2FV8A 2F90A 4O5LL 3TIVA 2OWEA 3G5ZB 5K59E 1OARH 3IE0A 2NY3D 4O08A 3MK31 4DDWA 3STZA 1R18A 4TV9F 3PXJA 1QM5A 3SS8A 1IDOA 5DSZA 4A7GF 2UZ4A 2ONZA 5LAXA 1M2FA 2O3TA 1XXHB 4HJ0C 4E5KA 5C0AA 1QNIA 3W56A 4LRUA 4JKMA 1ZVJA 4LHVA 4ILEA 3FGZA 1QUFA 2XDYA 1TZIB 2C3VA 2B2XA 4CYMA 3DOUA 1SXNA 2YV2A 5ELLA 4R7TA 2Y1VA 3K7UA 2O50A 4XFJA 2MQ0A 3TB6A 2Y92A 3VM5A 2I6TA 2QUIA 3WK4A 2HFEB 4JBHA 5DBEX 2EH7L 1V7QA 3EWNA 3T9DA 3VFWB 4JBYA 2F54D 1IWOA 2VCEA 2BP0A 3TAHA 1MAMH 2UZ1B 5BNFA 4NQUA 4E14A 3Q8AA 5LQBH 2PJUA 5JHDD 4Z8XA 1E8MA 4EZMA 2HMSA 3FFCB 3WYAA 2VDNL 4P4RA 4ZUUA 5GS1B 5FBWB 1D8TA 3U4QB 3HJFA 3EXIB 4BCCA 1KHHA 1CUCA 1KIPB 2FEXA 5JQGF 2W0FB 4ETNA 4IBQA 4E5XG 5KANG 3TA3A 3TBSA 4Z0BH 2VDVE 3LE8A 1WEKA 5IT0A 2J44A 2FN3A 3ZX1A 5B38A 2F4NA 5I7FA 1XNQB 1L9NA 2ZT7A 1U7ZA 1L5HB 3KX2A 3AIIA 1TCUA 4D6PA 3PNVA 1DJSA 5DCWA 3KXLA 5CD5C 3H5AA 2ET6A 1D4ZA 5JAPA 4FABH 5B7FA 3U3JA 5A4IS 3SI7A 2EJTA 3QORB 5F52A 3DL2A 3QWOA 3KVPA 2Z09A 3KVVA 2X1XR 2D0GA 1GYWA 1YA8A 3AIKA 1DEEB 1BJRE 3U0VA 1G20A 3F8UB 5HI3C 1B7GO 1Z73A 3KPVA 3HR7A 4C0HA 1ZM4A 4Q9QH 1NKTA 4JI4B 3ULUL 1NGQL 4DABA 3KLSA 4N3NA 5K2OA 4E9VA 1F86A 4F58L 1IUNA 4JASB 4U49A 1D2HA 2G40A 4JLUA 1XZGA 4E36A 2FSPA 1U1FA 1ISJA 3MV7E 2WP0A 3CVHL 4EF4A 1S7VA 5GZOA 4Z9FA 5A3SA 4EAEA 4R3UC 4DGVL 2GRAA 4UKDA 1U8KA 2B08A 3PP3K 1IBRA 3NEOA 1QIFA 3JWEA 3M6IA 1NJ1A 3TZVA 2P11A 1XE3A 4V3CA 2AE1A 1W2HA 1F8TL 1IOZA 4AZ8A 3L6EA 4HCRH 1F6BA 3WSTA 5CNJA 1P1FA 1FJGB 3UHAA 2OMXB 3TR6A 4TNEA 3LDGA 3DPUA 3VFVA 1E7UA 1MH5B 2IBGA 4ABWA 1DKRA 3HRZA 4KVPA 4IDHA 4WFFD 4AEHL 2M1XA 1U9IA 2MJWA 1YRQA 3AP3A 3FPCA 2G5UA 1RZFH 1C30A 2ZP0T 1F02I 1ISIA 2QKYA 2FUQA 4HI0E 4E5SA 4OHPA 4L5YA 5KOIA 4QTTB 2LBPA 3KDMA 2QSCL 3A9UA 3CS3A 2ITFA 3FPLA 3NTRA 3TG8A 3ZYZA 3F7RA 1J11A 3QQ4A 4EI5D 5CFHA 2YD7A 1EAYA 4JFHD 4M1YA 2V9TA 1E6JH 1NUDA 3GB7A 1PBTA 3CNQS 3LRSB 1IVSA 4IDLA 2JCYA 3I9KA 3AF0A 2RGNA 2IQIA 1MCKA 4I1RA 2JI7A 1P84K 1JXGA 1MFAL 3CZMA 2K9FB 4OLFA 5ABZA 1JWBB 5FT9A 4P5TD 3C1AA 4X98B 1KBQA 4BP8A 2YARA 5J89A 5K3BA 5B6JA 4WCYH 1YCFA 1KS9A 4GW1A 5SYAA 5JD3A 5E2TL 5GGSA 3ZE1B 1O0CA 4PO3X 4APQD 4Z9BA 3OIYA 2K6ZA 2GI4A 1BRTA 2DAPA 2QZ4A 1KEGH 2Q3CA 1XN4A 3HTXA 3SZKC 5B53A 2A74C 3DT8A 4LOEA 3HE7B 5J43A 3L7BA 1E79D 1UM5L 3NBFA 3JQQA 2H5LA 4CTJA 3V2UA 3TTTA 1WYJA 1X7ZA 4Q00A 5IMLA 1IPHA 1QVWA 2CAKA 2DL9A 2YWFA 3QVMA 3Q13A 1GPMA 2ZJ8A 4Y19D 3KWJA 4KBYA 4KMQA 4QMEA 1SIBE 1C8BA 3CPSA 4MINA 2X9XA 4WGKA 1JD7A 5JHLL 5K01A 4IFIA 1ZHLA 1F1AA 2W5UA 5IJVA 1A3RH 1FK8A 4ZYTA 3QPXH 4ZNEE 1J5IA 3B3IB 3RIXA 1JEYA 2C1OB 4Q3DA 3ROFA 3AT9A 4J0QA 3AESB 5KMGB 1FWXA 1O97C 1KMGA 2AOXA 4Z4CA 2I4IA 3WUWA 4H7DA 1NIBA 3BK1A 4MEBA 3MJGX 1B0GA 1B4LA 1NKGA 1NVXQ 4Q9HA 5JRZA 1B8OA 4Q3NA 2XUPA 4DEPC 2ZZKA 4JHVA 1KYOJ 4P9HL 2OSLB 3QMPA 2XNHA 5JBQA 5EF1A 5JASA 3LXRA 1HT2E 5J63A 5CM1A 1MHTA 3UM9A 4RE5A 3MBEB 1RYEA 5LKNA 2YV5A 3BO8A 3D6HA 4EAQA 3LVBA 3GMLA 1GV0A 5P21A 3ZMRA 1GYVA 3I3BA 4XM0A 2GYUA 2JH9A 4NESA 5DF0A 1MHHA 5HVHC 2ZVPX 2OGWA 1SU8A 4YJGB 4UQOA 1NC2D 4PY8J 4L9DA 1WPRA 3SPGA 3GOHA 2C2MA 4AJLA 1OX5A 3SFZA 3WRVA 2BP3A 3WXVH 2I5YL 4X7TA 1QG0A 3CSSA 2BZCA 5DYTA 1IGJB 1E3WA 5IHBA 2YW9A 1SBQA 2IPTL 2WWMC 1ADJA 1F3JB 1Q7GA 3AXTA 3ESYA 1SIWA 3CR8A 2V6BA 2V5TA 4AICA 1KCUL 4R96B 1HOXA 5LQDA 1N7MH 4Z7WE 2JFYA 3QEGL 3VYNA 3TT3L 3B7TA 2I27N 4ZQCB 1U2GA 3PUHA 1MR3F 5IHZB 3QG7L 1SVSA 2XB9A 3DDZX 3QUQA 3VWJD 3DT9A 5AYUL 1WDAA 2NZIA 2IS4A 3M4XA 1K63A 4OCZA 5J3HC 4WERA 5D1ZI 4QGHA 2JAWA 1Q0YL 2YNMC 3IR6A 5ALRA 3TEMA 4TLDA 3S7TA 1HL9A 2PO5A 4C57C 1ZT4A 1XCJA 1NMBH 2X4SA 2J8UA 3MLPA 3FHOA 3D0OA 2PXXA 1DFBH 5I5RA 3NHUA 3O6ML 4IBWA 5I7EA 3B2UC 4J4PC 2GB2A 4WEBL 4ARIA 3CPUA 3UTSB 1U8LB 1ZLDA 5HGHA 2FZCA 4GWLA 5J2UA 4AQ1B 5D71L 4GI2A 3QELA 5FBHA 2AW3A 3KOOA 2YY7A 1RPKA 2LW3A 1T29A 3I2YX 3O0TA 4AMUA 2NY5C 4DJEC 4E2FA 1ONBA 3UPAA 3SBXA 2I9LB 3GN1A 3IBCA 2PKCA 3EVGA 3IDNB 1M8PA 1REQA 3GFOA 3SX2A 1W16A 4J1TC 4K28A 3OR6A 1U8FO 4KAQH 2QENA 1IBYA 2PK3A 2V3EA 4W5QA 2ZXEB 4AB1A 1FZQA 1SUBA 2IZOA 4ZTOH 2VDQL 2TECE 3ZS8A 3BGDA 3MN8A 4UM8A 2JCBA 1XAIA 2X53A 2RC6A 3B9DA 2PXYA 2X8AA 5TPZD 4FCWA 2VRNA 4UTZA 3TJEL 1W5EA 3ANTA 4CN9A 5DT1H 5GTDA 3H5NA 4ABTA 5ALLA 5DNWA 3O3BB 5JNWA 1RZJL 3ZGYA 4DN6A 4KAAA 2D7QA 1E0AA 1US8B 4LEIA 1KPIA 3VD5A 1KYWA 2AAVA 3B1KA 3W38A 5AG9A 4GDFA 3I23A 4RH4A 1J7KA 4MP3A 4B87A 2FF5A 2VE6A 3AXLA 3CUTA 4PNPA 4XHJD 3U7QB 4PZ0A 1T9ZA 4QRPE 5T3ZD 3TN0B 3A1UA 3M5CA 4JVLA 2DUWA 4ZRNA 4Q1BA 3IX7A 1NLFA 5IG2A 1XT6A 3IMKA 1KE1A 4O5LH 1WHOA 3HK2A 5CCGE 4JBXA 1Z3IX 5DHVB 3T4XA 4OMDA 4PSCA 3NBMA 1A7QL 1AQ6A 4H5SB 3W6PA 3QUAA 2Q1SA 2VR9A 1J8RA 3OPZL 4JLSA 4UTBL 2YS7A 3Q98A 3QFJE 5E3JA 4TROA 3MLXL 2IXFA 2I4TA 1DQLH 3H9QA 2H6OA 3A5VA 3L8DA 3L3KB 4GLLA 1W96A 3U2SB 2HWWA 2HQOA 1HE2A 1HWHB 1IH8A 5J4MA 1JL8A 4FNSA 4W4OA 3QX3A 4C7OA 4KOAA 3J2PA 1E2FA 5JXGA 4N40A 1L9RA 4EVNA 3GEEA 4K86A 3BILA 4QM6A 4OQTA 4G41A 3GHYA 1PFWA 3KYIB 3R19A 1VGEL 1DEHA 4P5MA 5AUMB 3B2NA 4WTOA 1ZA3A 2OJEB 2FZ4A 4DA8A 1RUAH 1NCTA 2JJUA 2VUKA 3WK7A 1P4HA 3MI6A 1QO3B 3NV9A 4AYXA 1Z6JT 3DBRB 4DCOA 4LVHB 5IJKC 3FBTA 2PJRA 4EOWH 3X1YA 1E6OH 4CGTA 4XPFL 4XHQA 4P23C 3NETA 1KJYA 4OAOA 1MLCA 5EXTA 5TY0A 2F5AH 4E11A 3FU7B 4AYFB 3U2QA 5F7XA 4S10A 2VH2A 1GUDA 4K9LA 3B5TA 3IXLA 4WUUB 2PAAA 2R00C 3F0TA 1XG5A 1JZ7A 3LX6A 1UDAA 1EE2A 3EW7A 4IBSA 4IF4A 1J5OL 3OKYA 4KNQA 3MTBA 4AWBA 1BGWA 1LTHR 4PJCA 1OAZH 4FZRA 2VN7A 2YLHA 2GG1A 4EPRA 1N5RA 1IZKA 3L8QA 4X6LA 2N1TE 1MH5A 2Y27A 3ET4A 3LO8A 4EK9A 3MACH 4PJEF 3VW3H 1S9XA 1UGKA 5AW8A 2DTDA 3ECCA 4PJ7B 4TRJA 2KLHA 3JWNH 3S88H 1TKCA 4MR8A 5FL7D 1N1EA 3K6FA 1DVQA 4B31A 2V0AA 2GVNA 4ZRMA 2ZKHL 4BFTA 2YWGA 1EFLA 3PF8A 2YR3A 5HJ5A 4N26A 5KVDE 2VKTA 2YQGA 4XFKA 3IRZA 5DO2D 3DTYA 4ENVA 4HSCX 3WNBA 2QRJA 4KMOA 3IFLL 3T99A 2B4CC 1L7XA 1PSZA 2ZTUA 4FF9A 1DUYA 3IUMA 3V7MA 4Q9KA 1CD1B 4JS0A 4MQ6A 3PAZA 4L3ED 3NPZB 2RHEA 5JWHA 5KYKA 2W58A 3GLDA 2Y2YA 4MWBA 3N58A 4ZDIA 5BS0A 1ADBA 3NEXA 3WS3B 3RDTB 4N2FA 1UXHA 4CDRA 4FTVB 1C2TA 2OG2A 4M1CC 3IMGA 3AOEC 4LOUD 1YPZE 3WIVA 2IVFC 13PKA 3O4RA 3ZY2A 3SDYL 3CQFA 5B39A 2Z2KA 3VH8G 2YD0A 3JWHA 5IKCB 4YYEA 2X89A 4UOW0 4XCNB 1G55A 4LLMA 2I2DA 4GW1B 4C05A 3IA2A 4W9LC 2QK4A 1NVAA 3GAMA 1Y0BA 5F1IA 3O3AB 5AWNH 5IKCA 4OHFA 4J6RH 2R48A 1AD0A 4QHYA 1KA9H 2WT4A 2IG2H 1PZSA 1NM9A 4WWKA 3E5HA 2D7PA 4NM8H 4B7IA 1YZKA 3FNRA 3PPSA 7REQA 1ES0B 4HS6B 3SBOA 4MNHB 1BF2A 3LPPA 4Z49A 2PWPA 4U1HA 1LC3A 1PPIA 2VS1A 221PA 2QVXX 5AWNL 1JDPA 5DURD 1DE4A 3SDCA 3AQIA 2BWDA 1LRLA 1AGBB 2JLPA 4OL0A 5EZIH 2HFGH 4I5IA 2BOVA 1IGJA 3DLQR 1VSUA 1HJBC 3VYPA 3RIYA 4PPQA 4JKYA 1K3IA 1SXJC 4JA0A 3F5SA 1J05B 1U3HC 4AKTA 2XTLA 3PVSA 3GUVA 2BCKA 4K15A 5ECGA 4CJ1A 1SLUA 2IFFH 1PUJA 3E84A 4Q93A 1ZR4A 1I5OA 2W6QA 3CW2A 5EBWA 1Q0XH 3FQYA 5I5EA 2Y5QA 5EUKA 3C6LA 3PTZA 4G89A 3UJHA 5ALNA 3RS3A 3NGXA 3QPVA 4YL9A 4LLDB 1B26A 4J23A 3C5JA 2F1AA 3QULA 4ALKA 2JFNA 3HBNA 1UC4B 1ECBA 2HPOA 1QQAA 3SMQA 3IQEA 4DIUA 1YMMA 3JTTB 4S1SH 5LDDC 2QN7A 3MV01 2EYQA 4TUYA 2AC7A 1RKUA 3KXDA 3LHSA 1RRCA 3V0EA 3GKWH 2XXCB 5DT1L 3EC1A 2GWHA 2VN3A 5EIBC 2GHZA 1W5FA 4US1R 2GK0A 1E5LA 2FIKB 2PSSA 1AMOA 5ALHA 5EWMA 2C31A 2NDFA 7PAZA 4P80A 3BL6A 2CZNA 5T41A 4WOPA 3WL4A 4MARA 2WMNB 4IP0A 1Q44A 4N6QA 4CUCA 3K0CC 3PE6A 4FTWA 3U83A 5IGXL 3GK3A 2VLLB 3E9EA 5EXEA 3B2PA 1ECPA 2CFRA 1NW7A 1ZR2A 1SA0A 1R4XA 4RDQG 2O1SA 2YBGA 4RFEA 1U28C 3OJFA 4LF5B 3ABGA 3BSFA 2EE9A 5AKYA 3GMMB 4HWZA 4B33A 3ZXYA 3Q1SL 1L5OA 5D6CB 1WCIA 2ZSIA 5ISZA 5CZXD 3FZEA 4J1UB 4MVBD 3AH8A 2R25B 4TTVA 4U1NB 2N1KA 1KVTA 1VZHA 3IAM1 1TJMA 5A6SB 3K46A 3QDJA 4X6YA 4WHDA 2IANA 1KJQA 3P54A 3SKVA 4UT9L 2ZF8A 3PDOB 3WRYA 2I7SA 4L85A 4EBQH 4M6WA 1FI8C 5E1GA 3UQZA 5CN1A 4KQ4H 1BEYL 2KMLA 1KTDB 4Q12A 3CRZA 3HO8A 1AS6A 3QUMB 1TQWA 3FCTB 4ZYXA 3HRIA 2X6BA 1VL5A 5DO9A 1LPSA 2XHZA 3RNLA 2GPZA 3WQBA 3NJMA 1GZPA 1JW9B 2AEWA 4URYR 4NB7A 4YXWA 4UQLA 4WQMA 5FTMA 1GGUA 3BOVA 1I3KA 4QPZA 1M3IA 2YJ5A 3C85A 3CKMA 1XUOA 1N7ML 2ZIVB 3MLSL 4F1WA 1GPJA 2DVMA 3LV3B 4UT6H 2AYYA 3U82B 4BWYA 4D9NA 1B0IA 5JPNC 2PT7A 4BFGA 2WXPA 1EG7A 2Q9AA 3RFZB 5C0BE 2F0CA 2ADFL 1N4XH 4MQEB 1MJ8H 3D5EA 2RIRA 4UAOC 1FCGA 4YMWA 3DJRA 3HR8A 1E9BA 3H3PH 1CMOA 4PIPA 3UJAA 2EDLA 2O8DA 3QUHA 3PAVA 3OQBA 4HQ0A 2GVZC 2AEPH 4PV1C 2WB7A 3OAUL 2Q5OA 4LYYA 5LBSA 4YWGL 1H2BA 3CX8A 2ZGVA 2VI5A 3IQDB 4XPAL 3THMH 1H0DB 4J16C 3ABSB 5AHKA 2Z1NA 4DVJA 1XF2A 1EX9A 1JSZA 1Q94B 2Z31C 3DOCA 4KQ2A 2VJMB 4FLFA 3SSAA 1WIPA 4UT7H 4QOKE 1U8HB 3NZUA 1BIFA 3GBVA 3WIHH 4NZJA 4B44A 2X2IA 4I4TB 4JPVL 1SMDA 1H3PL 1PTJC 5BR4A 4QJ5B 1UH4A 3OBIA 3RL2A 1JWMB 3EHBC 5A2KH 1OVGA 3HM9A 2R69L 5INCB 5JA8B 3DUFA 2PYEE 3D69A 5LQMA 1I30A 1O5IA 2XMZA 5JFGA 3GMTA 5T4FA 5D4JA 3QIWA 3BE8A 2ZWNA 3SIKA 1XVVA 3WY9A 4KTYA 3KKQA 4YDQA 1T2UA 1XSJA 12E8L 2OZ4H 1QR1B 1T1WB 1BIHA 5DQ9A 1E4HA 4UNIA 3L0DA 4JUIA 4J9VA 1T9CA 4I2XA 4EDXB 3BDYH 4H44C 1WA0X 4KK8D 2FL5B 3CJJA 3KAKA 5DLPA 2HLDA 3C4VA 4BFKA 3OAZH 4JFFD 2IYSA 1NTDA 4ZZ2A 1EH5A 1W2GA 1ULTA 5A4DA 2AVDA 5G4NA 1E30A 3TX4A 3MS2A 2BSSA 4WOBA 1NPJA 1ODUA 4Q03A 1I8KB 3BWXA 5EFZA 5JPNB 5EV7A 1QZ1A 3C48A 3MOBH 3B3JA 1CQPA 4D9JA 1DXHA 6PCYA 2ZYSA 5CJQH 4EWLA 5D1XC 4K1LA 4C76A 1OE3A 1TOAA 1JZJA 2WHPA 2AK4D 3MJTA 4IKEA 4UWQB 3KCWA 2CE7A 2DHEA 3QKRA 4G5GA 1N5JA 4H8VA 4HB2A 2FE0A 1JHPA 5C08D 4NDAA 4U0JA 3AC0A 2HEGA 2CW5A 4JD5A 4QNNA 3ODPA 3TBBA 4CCSA 4CKXA 4K9EH 5E1QA 2WQSA 2NUPB 3X11A 4RESA 3T3EA 1HKUA 4L73A 5L95A 4WZBA 2Z8YM 1AKJB 4Y9EA 1PD1A 4XSVA 2QX6A 3VX0A 3MBOA 4R41A 4GUPB 4L23A 4UB0L 3M88A 3I12A 4YHIA 3U6XA 2JGKA 3BH7A 3X13B 4P3OA 2XWXA 4ZU6X 1C12B 4M8VA 5JZOA 4F7EB 4F4CA 2OY0A 1NVFA 3V3KA 5HQ3A 4MA4A 3EISA 3WOVA 1NBYB 5I5IA 4WEQA 2FGWH 1TA0A 3OFJA 3AL2A 1WXHA 4JG5A 2IY8A 2IFFL 1TTUA 2HJLA 1BQHA 1K5HA 1T4DA 2OA9A 2O4CA 3M2PA 1Q0TA 3W8FA 4G1BA 1SF3A 2Z91B 3K2MC 1CG9A 2RKWA 2AZDA 3FPJA 4MSWA 2CVFA 5F1NA 5CDFA 2UVDA 4Q7MB 1HDZA 5GRJH 1P3JA 1VHLA 1WB4A 3L8ZA 5E9AA 1VRVA 3USCS 1ZU4A 1SWWA 2BY4A 3M1YA 3OTTA 4N49A 1R0XA 1Z1WA 1VIVA 3B8YA 3ZW9A 4P2OB 4OZ4A 4XNBA 2RTTA 4LOHA 3QR1A 2LU3A 2R1VA 4JE4B 4IIQC 1FNSA 1M6OB 4P2QE 1BQEA 3P94A 2KLBA 1QFMA 2QX8A 3IAHA 1I3RA 1U0QA 1PUXA 4LDJA 3DXAB 4WK4B 3AP2A 4PLKD 3CZQA 2FLWA 2GDJA 4JHLA 2V4ZA 5HYIA 1V3VA 1NW8A 4GW3A 1J5HA 3VWJC 3T04D 4PRHD 5EEUA 2IUSA 1JI2A 1EP2B 1JTEA 2OMTB 5L2JB 1YJQA 3ME0A 4D99A 1TCRA 4NQSB 4PJ6A 5SWQA 1P1RA 2XYRA 3N8HA 4K05A 2GK7A 1I3OA 4K87A 2BSRA 2VR8A 5KSVB 4UIKH 5J5AA 3O8RA 4ADSG 3USES 4ZCMA 1DE0A 3H65A 1ULSA 1NCNA 4YJGA 5FYLE 3PAYA 4N2GA 4IDJL 2BGTA 5EUOF 4EDWH 2YD9A 1IC6A 2BIFA 3OZ7A 5DI9A 4FFYA 3QVJA 5IABA 2FOXA 2D3JA 4N0YH 1AQDA 5D9SA 1G9TA 3F6CA 4Q02A 5C1OA 3DLAA 4UTAL 1SXGA 3OX8A 3PA8A 5TE9A 3ELQA 3TBWB 1UD8A 4OFPA 5KPJA 4XGQA 1E59A 3WGVA 4RBPH 4R8LA 4X3OA 1NGYA 4LY9A 3RRBA 3G9UA 4Y9UA 1KXHA 1PGRB 1ODJA 4I3RH 4TVPE 1YZNA 3TNLA 3E3OA 1OP9A 5DJ2A 3PTAA 1KYDA 3WUWB 2E7BA 2WU0A 1KMHB 4JNCA 1ZY9A 4X6BA 3B60A 3E1ZA 1UWVA 1CCZA 3IS0X 1DVFB 4PTZA 2NTFB 2BM8A 2CFIA 3EUDA 4D9BA 5CP7B 1RWBA 4FE9A 2LWIA 1OFVA 1U3FA 2F67A 3TBYA 1Z2KA 3ORFA 3BRQA 5G02A 2NTFA 2REQB 2X4QA 3I61A 2C1PA 2JKYA 4BQIA 4A2DA 2EZ8A 1Y9EA 4PD4K 3EKCA 4FE4A 2DWPA 1L8AA 4X4YB 5JS6A 3FO0L 4OLZL 3L1GA 1U7TA 3D31A 1EO7A 4K23H 2NO5A 4IJKA 3EAFA 2PX8A 1JI0A 4P4TA 3UIYA 1LZKA 3E61A 1SOWA 3RSZA 1E40A 3ONFA 2Y1DA 3P9KA 3CXDH 2J2ZA 2P1YA 4DDUA 5LNK6 3KG2A 2NNAA 2B0SH 3MOQA 3IFPA 1J22A 3R77A 4PJXE 4YQEA 1UBLS 5E8DH 1U2RA 2D54A 5TGBA 2ADOA 4R2JA 1PTZA 1IN8A 1RKQA 3R7SA 4L76A 4FKEA 3O6KH 2YYYA 1ZVNA 3F7LA 4MCJA 4KRFA 3HG5A 4G8GE 3SKNB 3ZKNC 5BO1L 3H4IA 2WQ7A 4FYHA 4TL4A 3BHMA 2UUBB 1ZNZA 4AK2A 1OT3A 1A50B 2YBEA 3KOXA 2A9PA 3UPRB 3I9JA 3NSXA 2G1KA 1I1FA 3NW9A 4RJLA 3MR9A 4HLNA 1SFHA 4QTHB 4P93A 5IBTH 2CHGA 3S2SA 1H69A 1HPLA 1KFBB 1NP3A 2ZUDA 4W9CC 4WHYG 3GEGA 3NFRA 2V45A 4S1OA 5F33A 4IWNA 3RFCA 3U7QA 4TRRA 4J6IA 1YUBA 3ASWA 1IEXA 4F3TA 4CF5A 2VH5R 3QXDB 1ZS8A 3QHTC 5LVAA 3FT2A 4BB0A 4NZRL 1JHLL 4YH1A 1QTRA 3G6JF 3GGJA 3ZVKA 1E32A 4AMKH 4N5MA 5I8CA 3GLIB 1YI1A 1TG8A 4GEKA 1KZ9A 3GHBL 2OS7A 1GPH1 3BVNB 5I1AB 2MCG1 2XSZD 2Z4SA 3MN1A 2W5PA 1P7HL 1KVSA 1IM9D 4OZHF 5CT5A 4JBNA 4PHCA 1AVTA 2JIXD 2JZNA 3QGVA 3K15A 3QB7C 3ROLA 1LRKA 3OTHA 4ZPVB 1P0QA 3RG8A 3V1NA 4Z7OE 1M1YA 4TUJA 1MZZA 4MAYC 3RY6A 1P1BA 2PXYB 1WQ1R 3IP7A 1EZZA 2Y72A 3EDYA 3N2JA 3T34A 2YKLH 4ZAFA 2W2NA 1BU8A 3ZCQA 4LRIA 4NKOA 2NP6A 1VCMA 1AG6A 4XWOD 2GJ6A 4IHKA 5EHFA 5E6ID 1KQ3A 5B3KA 1Q9LA 4BNWA 4PG7A 1SQ2N 2H0QA 4FGJA 4YDVA 3WSQH 1OPOA 3UO8B 2FT8A 2QXYA 5CIYA 1JXJA 4Z95L 1SEPA 1RCYA 2JD0A 4Y67A 3OKMA 1NY6A 5ECDA 4CHTA 5INTA 1MI5D 2XOXA 4ERXA 4YIKA 1WZCA 2IADA 4KQHA 3SJVB 4C83A 3ZDFA 1M6UA 1PIGA 3I85A 2FQWA 4XX1G 5D7SH 1QX4A 1UJ5A 5KC9A 2NXCA 3GT4A 3LRHA 3HVHA 4AXWA 1KDVA 2J1XA 1MVOA 3GJFH 3R7BA 1MA3A 3GLAA 4W68A 3GSRA 3W0WA 3SZGA 4RABA 2ZG1A 1VC2A 3EZ2A 5BMVF 2GAZA 1GZ4A 5IB5A 4C0QC 2KDYA 4HRAA 4KPEC 4J43A 1CD0A 1KR5A 1B8VA 2FDXA 2HVKA 3V52L 4XCYA 4JBGA 2D1QA 4L8VA 2YEQA 2RA1A 3FYEB 1MFCL 1KNQA 4E1BA 1CE1H 5I9QB 4UAGA 3SN6N 3DX6B 1AJ7H 4EKGA 2JFHA 1KCRL 2G5RA 4N8VB 3QA3B 1NGZA 4Q5IA 4FK8A 3OQOA 3GLGA 5BQ7A 1J39A 1I0ZA 2YY5A 3NVKI 1DT5A 3RC1A 1ZWLA 3NOOA 3VKFA 3O7WA 4XB1A 3Q2NA 2C9VA 2DE0X 1YEKH 2LKCA 2GN6A 2RDMA 3MRMB 1F4HA 4A7PA 3JV5A 1MW3A 2RHRA 3IETB 4PJ8B 5L2KA 4DBLE 2GZSA 4G9DA 3QKIA 2PLWA 3KAJA 2KI6A 1NBVH 1P7ZA 1MX9A 2K2QB 1UEYA 1X39A 1FDSA 3WHLA 5KN5B 1KEEB 4CMHC 2C92A 4LLWA 3A1DA 3BAIA 3TP4A 2IAMB 1C29B 2Q9CA 1N2GA 1Z47A 1RC0A 4WUUD 3ICVA 3MV9E 1SY6L 3ZTDC 4ALAH 4ODXA 4ZMNA 5EPMB 1MOPA 3FG9A 4TTTS 2OFQA 4QFDA 3UGKA 1QIMA 4RWZA 1XDTT 1AI1L 5DC0A 5G55A 2VSOA 2FP3A 1Q57A 3H9UA 1UP7A 4QWMA 3PPIA 4PNZA 2C4TA 3GM0A 2OJZH 5GS0H 2ZUVA 4I3RL 1UFRA 1RWWA 2BWJA 5F98A 3MGBA 2HUHA 1A7RH 2A67A 4U7TB 3HRPA 1TQHA 4YQXH 2O1XA 3IKKA 1TZBA 3SZMA 1MENA 4F3YA 2YX1A 5DMHA 1M1XB 1HI6A 4L3FA 5KKCA 5T1DH 5E5UB 2GTPA 5TMDA 3BEDA 1ISGA 1T6BX 4F06A 3F7OA 1I7RB 2FDBP 3V4OA 3CDZA 2JFPA 4IIEA 1S7UA 3MREB 4M1WA 2BP8B 4A1RA 1CFQA 4WPGA 5EEVA 3T3PB 3VQ1C 4TYYA 3C5ZC 1IHPA 3T71A 4OQLA 1F6AB 1JTOA 3TZBA 3ZY7A 4MGEA 3RIMA 1K5PA 2H4ZA 4YLYA 4BK4A 3P2EA 5E3HA 4CDGA 2APSA 1DCLA 3MPCA 3TEWA 2P6UA 1ZO8A 2H57A 3VU8A 2MSWA 1ZIYA 4BSVA 3DBXA 3FTCA 2XOEA 2RHBA 4KJPC 1KY6A 3TNNA 5I18H 4NMXB 4EW3A 2P5EB 3JTMA 4MA3A 1J5DA 3QNYB 1ZRMA 4TLSA 1LP9F 5HYJA 2OK7A 4X99B 3DDOA 3SD2A 3HN6A 3RLIA 1V25A 1A95A 3FOMB 4MRNA 3A1WA 4GIOA 5DWQA 1BM7A 3BE1H 3MV8E 3UTTE 3ZCPA 5ALOA 3PHJA 1H19A 4EY4A 4MJLA 4OB6A 4RTMA 1LLDA 2R86A 2JKJA 4OAWA 4O2BB 4HU8A 3H5RA 1XTIA 3MBEA 5DMXA 3ZXIA 4D8YA 1ODAA 2OQJB 2OTWA 1C7TA 2IH9A 1Y1QA 3DTVD 2EEDA 3V6LA 2YOAA 3AERB 1H6TA 3WIHL 1RQNA 1U0LA 3TSCA 3ZXAC 1X5HA 4Z7IA 1Q9KB 4YVNA 4MZ2A 4ZFZB 5FJJA 2I2AA 1UIRA 4DJ5X 3M45A 4DQKA 2YAQA 4LHUD 1LI4A 4DIEA 4JPKL 4CDNA 3OMZA 4MKIA 4W1TA 3BB1A 3L7LA 1DQIA 2WZPD 4C54A 3ACDA 1NUTA 1STOA 5KI6A 1USZA 4JO1H 5K0SA 1I2DA 1KP3A 2WANA 1P5VB 4HQLA 5GZ1A 2VLLA 1NCJA 1XGYH 1H6BA 2PMWB 3HYCA 3EPJA 2V9QA 5JZMA 2L19A 5D5MA 1KRHA 4ZDJA 2ZAGA 3NCEB 4E51A 5I7AA 3ESQA 3TZCA 5K05A 4IHOA 3H56A 1Y80A 4WI7A 3BB3A 3WBFA 2EVWX 3V4RA 1GUAA 1A9XA 1IC4H 1L9MA 4BDVA 3B83A 3JBG7 4PBTA 4YMTA 3E9QA 1NEZA 5L9DH 3QIAA 2HZHA 3VGJA 2ZOWA 2WZ0A 4CLDA 4AT6A 4IJUA 1OBFO 1QWNA 4LSQH 2GZHA 4ZU3A 4ZS6D 1PEZA 1PSKH 3C87A 1BHSA 1HETA 1H3VA 1AK1A 5LLSA 4QTFA 3AU8A 4H27A 4IGAA 3PNBA 2CO3A 2F74A 2PRJA 3MOSA 4JO2L 3V4VL 3LOPA 3JQ8A 4JKKA 2Q3LA 5EE3A 4KJYA 1ZKAA 1QABA 1GY8A 1QOQB 3QYFA 2TMYA 1HHHA 1Q3HA 3CMMA 2W80C 2WFLB 3V1LA 4R8WH 4PN7A 1I2MA 2EWVA 4Z9AA 4AWJC 4GSDL 4JLJA 5MFZA 3DZCA 4D43A 4BNZA 3EQ6A 1B0AA 3BMXA 1G4AE 1KO5A 2OCIA 4JVMA 4ZO8A 2V33A 4WVFA 2XETA 2P30A 4KK6C 3DXAD 3QYJA 1J48A 4DIBA 1LQSR 2WHQA 2LVCA 2HRPH 1NDUA 2YXFA 4XNMA 2BTOA 4BMNA 1RP1A 1KO1A 2RBEA 2R4QA 1GCUA 1I8UA 5DYYA 4Y19B 2R0KH 2CO6A 1FG9C 4FTVE 4EGFA 4JFDE 5KX5A 3HV0A 4RK0A 3IGFA 3KPOA 2YD4A 1A7NL 3D09A 3DDNA 5JR1H 3U5ZB 1I82A 2VR5A 1SU4A 4FNTA 5HUQA 3WJLA 3M81A 4F5WA 1OAYH 2N0SA 2GJ6D 2W93A 3CWQA 5KQRA 1D5IL 4GF5A 1S2IA 4FNUA 3R74A 2V7BA 4GSUA 4Q1EA 2FPIA 5IU6A 1V3UA 4B81A 1O7JA 4HAKA 2JFFA 1EGJH 1SHUX 1PLKA 2K1MA 4HIHA 4L15A 3TOXA 5CITA 1ECYA 4MRPA 5CLLA 3LUAA 5JOEA 4FNLL 3ICOA 4J2TA 3A26A 3EJYC 4O63O 3SDAA 5CHNB 4OMCA 3VD0A 2GUOB 2ZRNA 4OFWA 2PJZA 4UUMA 4PYLA 3G7UA 1D5RA 5J12C 1GG2A 4HX9A 4JVWA 2X4GA 3JARB 3T1YB 3NZSA 1NVWQ 4OM8A 3FFOA 3STHA 5A5GA 2OZVA 3FTWA 1QW8A 2G9VA 1K1EA 4GPAA 3I74A 3NIFB 4F8NA 3WJAA 5AZ2L 5C0EB 1OAKL 3AB0C 5CT8A 4EYEA 2ADFH 4HFWA 1EFRA 4B9IA 3S28A 3ZDQA 3RWBA 3EOYG 4NBVA 4WOKA 1NJ9A 1L4IA 2HAZA 1A14L 1WTGT 1T0HB 3HCEA 1SEQH 5DHQA 1T8UA 1DC3A 3KOZA 5IC4A 4I9NA 1JGIA 5E8OB 2P26A 3F01A 4BHUI 3LVRE 3VI3B 4HS9A 3TBFA 2J4DA 4ZD6A 1E6UA 5FA5A 4HVTA 3DDCA 4QT5B 3GJ6A 1ECZA 2LKDA 3LKZA 4BV9A 1MJ5A 5HF6A 1DL7H 1MCDA 4M0CA 1J9CT 2R0LL 4PJIB 3D6UA 4RV5A 1EEZB 4NQCD 1Y8QB 4QQKA 2YUVA 1P5UA 1N0HA 4JO1L 3NRJA 1J8MF 3JQEA 3AV3A 1N2CE 2CUHA 2IYFA 2I33A 2CNZA 2KZ1B 2AFIB 3WTYA 3VCLB 3TNJA 3NIGB 3WL5A 2LCFA 1X5KA 3F46A 1XCTB 3N04A 1RSZA 2FJFA 4QRPB 5FFGA 3QVUA 4NOLA 4PC3A 2ADGB 2WWMD 2BFPA 2PMFA 2W0LA 1T3ZA 1PLJA 1OGTB 2H0FA 3LN4B 2CT8A 4JFPA 4ZRGA 4RW0A 2OQVA 5DHRA 4ER3A 2Q7AA 1SXAA 3QISA 4EJSA 3RS8A 4JT2A 2QN8A 4PRPD 4IUBS 5LBGA 4B32A 4NI6A 4IKKA 1GAWA 4Q7LA 4PSPA 4LBYA 4LPCA 2GBLA 1M6WA 1N2IA 4KOCA 4NOKA 2MTPA 4NR0A 1SHXA 2QFPA 1VSVA 5FO1A 1OQOA 3KAPA 3I02B 3OD5A 4YDSA 2GC4C 1SHTX 1ZNXA 5L3QA 2WWFA 3U7AA 3LS2A 3T2LA 3KXFE 1ZGJA 5HYSG 3NHPA 1APBA 2ZONA 3OOEA 1UYWH 4U3CA 3B82A 3W6ZA 5GS2D 5C08E 3T7JA 1QBLH 4OI8A 5KSWB 1YEDA 3TZHA 3WG9A 2NU9B 2BM9A 3STZB 1Y7PA 1N5DA 2H4FA 3AF5A 3IFOB 1D2NA 4DUGD 3V1UA 3QZNA 4O4LA 1LEGA 1RH8A 5KYVA 3C6LD 5EZYA 4PCAA 3D5TA 5J2TB 1X9LA 3DQPA 4ZVQA 3KYKL 5KYUB 1N9GB 2C5GA 1U8PA 1E50A 3R7AA 1GZ7A 3JTSA 1WUHS 2CGRH 2HJLB 2Z64C 1S2MA 1EUCB 3QWAA 4FZEL 3PGJA 4P2QA 3ABRB 4B4VA 4X5XB 3PJRA 2I8CA 3C60B 3VTZA 5CJXA 5MP6L 4TTPA 4YSSA 1YR6A 4IOIB 4LI0A 4H6WA 5I1HH 4GY4A 2IPKB 2AJVL 1A1VA 4M0LA 1M9SA 3VW3L 4RETA 3EJYD 5C1PA 1M8JA 3UB4A 1DCKA 3GT0A 4FW9A 3VD1A 3R3VA 2W6IA 2C20A 4H2CA 4JZJC 4GLOA 5I2IA 4RMHA 3PNWA 1U8YA 3IUEA 1XH3B 4KHTH 3CH1A 3DSFL 4LRYA 3HXTA 5GISL 3KLPX 5LA6A 2XJ4A 1CL7L 1L7DA 4TWIA 4AH2A 1HFUA 2PM8A 2PL1A 1GTL1 4N2KA 4FX2A 2FX7L 4PW3A 4GMDA 5KOHA 3G2JA 4JM0A 3ATDA 5FOUA 3VYOA 5L6YL 3WKBA 1ELOA 1VPDA 2JGFA 4R2IA 1AURA 1LZLA 1AUOA 3LWNA 3S37H 5AOLA 2UX7A 3FH5A 1U8OB 1K6QH 1ZK1A 2RB8A 3PWJB 3NCCB 1NW6A 3UJ8A 2BKEA 2CDRA 5KVAA 4K5PA 3H2ZA 1DBIA 3N2YA 2O1AA 3FUIA 4GT7A 4H8WC 4HQ6A 3D64A 1HURA 4Y4KD 3NTVA 2IDKA 4MJ4A 5B8CC 4PYKA 4G5YA 2WOYA 1YOVA 2YXBA 4I18B 4HPYH 3RRQA 4OFYD 3LG2A 3I2KA 3FQXB 5EKSA 1YA6A 2Q7YB 4PG9A 4OHCA 1CFMA 1MFMA 1U0GA 2VTDA 1DBWA 5JYLA 4P2RA 1CVIA 1SKUA 2X6UA 4ZVNA 2D3VA 3UK2A 2HTFA 2F8XC 4N1AA 1FL3A 2HCRA 1DDHB 2D4AA 2NO4A 2NZXA 3DLIA 1BFDA 2NY2D 2WIDA 1A6WH 2WQAA 4P23D 2V8OA 1ZHBB 3UTTB 3REGA 2G9HB 2CKDA 3DFZA 1UPXA 5FI0B 3MSCA 2QVCA 1U2DA 2DQKA 3FMVA 5DH9A 1MDTA 5AK0A 4GXUM 4IRJA 4PZUA 1LL1A 2X4SB 4E3ZA 2WXNA 1D7CA 2NU8B 4JK0D 2EZTA 3WNJA 4WU7B 1HT1E 3KL2A 4DR7B 1O9WA 3DT6A 3VR5H 5F8RC 1GGBH 2EC5A 1SG0A 3FKSA 5EWLA 5CEYB 1E4WH 2J46A 3SPCA 3L2OB 3W05A 4F9PC 3EOBA 1JF1B 3DE7X 4ZPXA 3GG2A 2FO4B 4AM0Q 4D5EA 3D8MA 3QVKA 3LKRB 3GH1A 1YHYA 2IHJA 3K9QO 3D1MC 3WJJC 1SBTA 3A70A 3V2GA 1ZYUA 4OFKA 5EBMB 3TJHC 1MT0A 4ZVUA 4PG6A 1FNSH 3UIEA 2UXBB 4A36A 3I6GB 2LD4A 5I0WA 4X8GA 4NC1E 4XRRA 3CM0A 2ORBH 2XTJB 3EG5A 4RIFA 2Y05A 1OTTD 3OAZK 1NOFA 1BVUA 1E3ZA 4WI2A 2J9XB 3SHOA 3P4MB 4DARA 5A6MA 3DKRA 4W6XB 2R68A 4DP8X 3FKJA 3R3SA 2TMGA 1HESA 4B3XA 1RULL 3LW8A 2QL7A 2QE7D 3GMNA 1EA5A 1A0QL 1G9ML 1JA0A 1XX6A 2BC4A 1CUYA 1JKIA 4KXYA 3BE6A 4NJAH 4J3UA 4V2IA 5FKJA 1SPDA 2JEZA 3RU8L 4IU3A 1Z6AA 3M1LA 1N6NA 4YGVA 1X9UA 3L6FB 5DU7A 1H2ZA 1JNNH 5BMOA 1CUJA 4XPHL 2V6GA 2PU7A 2GBFA 2I8AA 2Y77A 2VBCA 3V6ZA 3BHBB 3DEZA 2DQEL 4Z7WF 1J1PH 1VFAB 4WO0A 4JX0A 2IGFH 3S2CA 3LQRA 1IV8A 2CXUA 2MQGA 1E62A 3CC8A 4HH1A 4Y9CA 4HLZG 3K7EA 1AB5A 1NONA 4X63A 3HAEB 3HE7C 3EZXA 3AIOA 3W1VA 5JSZB 1F18A 1BDYA 2V4UA 2R5FA 3QTBA 5FOWA 3JWDH 4IM8A 1FEZA 4BQ6A 4C0JA 4CM8B 4OXRA 2JB5L 2HDHA 5GISH 2J1YA 4PJ5D 4S2UA 1LMIA 2ECKA 2A9OA 1SN7A 4IG9A 2OXHB 2PMBA 1CBJA 5DW3A 2CVZA 2VC2H 3KWVA 4PQYA 1C2YA 5E5MA 1BX2A 3FRUB 3GGWA 5D2NC 4HUMB 1JG7A 1T2VA 1I10A 4LKOA 1NJ9B 1TEHA 1AHWC 3H11B 1VPOH 2D5CA 2XV2A 4PJEB 1FGNL 4UU8A 1OIWA 1ZHNB 4IHJF 5FYKD 4BM7A 4B4KA 4BAGA 4LPUA 2C8KA 1D4OA 1LD9B 4JANA 5A5FA 4X0KA 1K3TA 2Y24A 2YWJA 2A99A 1DQJB 1IZYA 4L5FL 2P80A 1RXVA 4JUAA 3QUGA 5E2VL 2NUAA 4TQGA 1CK0L 1TCMA 1S3IA 4FQCL 2SECE 1Z4KA 3NAAH 3DC7A 1OZHA 3FULA 4UMGA 3C6LB 3NCBB 2VYFA 4FC7A 2OR8A 2FQFA 1WEJL 1MU0A 3FYUA 1CY8A 5JZVA 3TNFA 1D6EA 1I2ZA 4HMQA 4ODWB 3WMGA 2XDHA 5BORA 4LDRA 2C1XA 2JLAA 4FI8A 5C1DA 1U2DC 3K9FC 1IGML 2YZ7A 3EO9H 3NK3A 4DUVA 3UCFA 1UIMA 2FPRA 2QSJA 2QSQA 2A1UB 1OWRM 1TTRA 1PSWA 2J3QA 2NMVA 4KQ6A 5AH0A 2CXQA 4JHBA 4CKBA 1Z5WA 1XMWA 4AV4A 4MO9A 2CO1A 4C83B 4ZI5A 3L0YA 4KMTH 1RQ7A 4TMZA 3DYPA 3WQQA 3MA7B 3UUEA 3A06A 2PSJA 3D1LA 3ZE2E 5C8XA 4EI0A 1JJ7A 4UMEA 2X4PA 1GLVA 5TH2A 1IXKA 2VLRD 4R2GD 1XGTA 4XBGB 1K3FA 3IRPX 2IS6A 2R6DA 5M7QA 4NGHH 1G8GA 1VKJA 3IE1A 1KORA 1FXWF 4QRHA 2OX5A 4OCNC 3VFNA 4QNPE 1NH6A 1DQTA 2BOBA 4COKA 5ALCH 4Z3GA 1UDWA 2QKIC 3BZEA 1E2LA 5LG1A 1U6KA 1ZRSA 3BPNC 3FYSA 3COWA 4UEJA 3CZGA 2BONA 2V6FA 4G0VA 1WRFA 1CBVH 4ECNA 3HA0A 2VTBB 3KJGA 4KYTA 1YJCA 3GG9A 2RAPA 1A4AA 5HHOA 4CDHA 3GFQA 2PP8A 1I4LD 1R6UA 1Z74A 4I6EA 2CGYA 4KHZA 1N9GA 4ES8A 2QVYX 5FWYA 5E1HB 4JLRB 2AK4A 2DKNA 2ARJQ 3RFFA 2J8UE 2XE7A 5BWCA 5K3AA 1O54A 1F2XK 1QHOA 2HT4C 1J1IA 4L8DA 3CLSD 1B3JA 1X5ZA 3GZ4A 4OHYA 2BX5A 3R8XA 2UZ1A 5IVZB 3A1SA 2VLIA 1L4MA 3I30X 2BZ7A 2NQDA 4GH5A 2QTMA 2W9DL 1O58A 1U58B 5HKKD 2CIKA 3C5HA 5I48A 4CCYB 3UXHA 3BWVA 4WUKH 4UI2A 3QEQB 1RFLA 4B74A 3GIVA 3OLIA 4G5HA 1W91A 1T13A 3BAZA 1UD5A 4JPQA 2XXFA 4MS6A 4LDLB 3OSVA 4BA0A 1XZQA 4MYHA 1QACA 1KI6A 4HCRL 1VAHA 4HG2A 3UG4A 1W2WB 4HH4A 5CNIA 2NY6D 3DOIA 3K3QA 1PGJA 1YE3A 2FFHA 2I87A 3E15A 4D92A 4KH0A 1VFBA 2W2QA 5HHMB 2PUDA 1N12A 2IDZA 2E3VA 5EWIL 4HKXB 3X1KA 1J2TA 3P5BA 1K89A 3HKBB 3HUFA 4P3YA 4OYYA 1SM4A 5CUQA 5EC1B 4HVLA 4XN5A 3DVSX 1CD8A 1MRNA 2R6ZA 4R1TA 5IEHB 1OYOA 4X93A 4MA3B 5C0CA 2TSYB 2X1HA 4IBYA 1O4VA 2VBGA 3BT2L 2ESVB 3H4VA 3INRA 3OZIA 2A5YB 1ZWIA 2Q62A 3NJ8A 4C4XA 4XFDA 3WIBA 4PJBB 3P7MA 5T8KC 5LU9A 1UZAA 3DBVO 2BSQA 4OP2A 3OIGA 3NHAA 1MLCB 1ZUIA 3F00A 3PFUA 4G4IA 1X1AA 5AJYA 1BJTA 3LXMA 4K40A 3RBSA 2LAGB 2IU0A 1BROA 1TFRA 4R2XA 1RVV1 1TO1E 2Q8AH 2OFPA 4JX9A 3HY6A 4XXCA 5CG2A 5K0GA 2YD6A 4DKTA 3OP4A 1P60A 4YDMA 4PZCA 4WW2B 2G06A 3E38A 3TWCH 5K3OA 3FOFC 4B7ZA 2XC8A 1KPVB 2QRHA 4V0KA 1P6UA 4LT7A 3LB6D 3ESUF 2I67A 2O8EA 4B79A 2WAYA 1GRRA 4BELD 1G5HA 2HDWA 2ODHA 3FVWA 1CJCA 2CDFA 2EIJB 4DLLA 3PBKA 2IFTA 3KHQA 1NTOA 2CFOA 1OSPL 4UUOA 4I1SA 2P7IA 1R8JA 4R96A 4YIHA 3HJGA 3CH6A 4C5AA 1FQWA 4BXOA 1XD8A 1Q20A 1XR9A 1GUBA 1X86B 3BKMH 4B27A 5I8KH 5EI5A 3SDBA 2AQTA 1SPBS 3LTEA 3IMSA 4R2GC 4K2AA 5A4JA 4F45A 3P2DA 4B6ZA 1CZNA 1T5WA 1IEWA 1U8AA 3O6VA 1IC4L 4M5ZL 1UWGL 1JR4A 3ILSA 2XKSA 3BMQA 4OD1H 4KO3S 4IRSA 1JHDA 3WIDA 1X6VA 1ZIPA 3EYWA 3I39X 1ZPLA 2QYTA 1T6NA 3SJAA 1Z33A 2BGJA 4GSLA 1Z9PA 2QV4A 1Z0ZA 4REQA 3C4QA 3MYZA 3FDJA 4NQSA 3S5LA 1JHQA 4JJ7A 1LSSA 1JHTB 4YR6A 1Q6YA 1HHIB 2ONCA 3ARDC 3VXUE 2C7RA 1QD0A 4HUNB 1E9DA 1MP0A 5AOIA 3A10A 1OPGH 1USKA 4IIQB 4DV0B 3BVPA 4EP1A 3JYPA 4FFBA 1L7RA 2Y7OA 3HJUA 3BT7A 4MEAA 2XZQL 2Q3JA 4F21A 3C1OA 4R2KA 1OM3L 1UJMA 2E4WA 3DBLB 1CWVA 4HQRA 3FBGA 5TQ2A 3P3SA 3B9KD 1EGJL 4DH2A 2E7HA 2V2TA 5KWSA 3MRGB 5FKAB 4R16A 3RX7A 2DPYA 2HU7A 4ONFL 5A3VA 3CFDB 3QIUC 3PD1A 1IVTA 3H9BA 3SCMA 2FPMA 4KXUA 5FW6A 4BQBA 4WAUA 1SVBA 3UTOA 1UKCA 2IG2L 1CP2A 1MV5A 1AHWB 4RAUA 5T3ZL 4BOYA 2DERA 1XB6A 4ZZIA 3I6LD 2ST1A 5IVXB 1SQFA 1XRRA 1MVUB 1XK7A 3PXUA 4MAMA 3LZLA 4AF7A 3SBQA 4MB4A 3EYSL 2YMLA 1JNLH 5AALA 5CWSA 4Q18A 3MCZA 2FD6L 1GPOH 3W57A 3DUFB 1O94D 4RDCA 3ZDDA 1MJHA 4ZKDA 3RO7A 3UHPA 4GG8B 3PZBA 2ALAA 5L3VA 2ZRCA 4FMPA 4QO7A 5BN5A 2F62A 2FUG6 2YVQA 3M6XA 3KPPA 3HDJA 2PFGA 3UJCA 3LEYH 4NKOB 2WE8A 2ZUTA 1KIRB 1K0UA 2WJ5A 2AZUA 5BRZD 1JHOA 4DEXA 3H7BA 1T24A 2LU4A 2QVTA 2R6CA 2O4UX 4E9RA 4HMDA 3JRXA 1H0HA 4Q6KA 3BKXA 2BVYA 4KQFA 4FFSA 3WHXB 2YS4A 1UMCA 4ZX4A 3OGCA 3V6MA 5D7IB 3RVKA 4O2FB 3LHPH 4LOKA 4FLRA 2CD7A 3F9CA 3IU3B 1GAFH 5L2KD 3VH8B 2ZRMA 3L4WA 4FGMA 1WXGA 4YX2L 4IXWA 1AQJA 3FNIA 3G04A 3EIUA 3MBXL 2WIMA 4HGPA 4MJ6B 2B6NA 1XGUA 3MMEB 2NQ3A 4JEGB 4WNQA 5IB2A 1UANA 3DHPA 4LE8A 1SRDA 2HBYA 3AS2A 3FL7A 3IAS6 2G2NA 4NBYB 3TJPA 4HHAA 1K6EA 3D2CA 4DBZA 2V17L 2H1RA 2ILVA 2WW8A 4XZUB 4TWRA 2XZZA 2PCJA 5CMLA 5DTRA 5BSGA 1MKYA 1BYUA 1UDRA 3ZUCA 3FBKA 1T5OA 3T54A 1U0SY 1S8NA 1H3NA 3C4JA 5E9NA 3SQDA 3QXDA 32C2B 3OPQA 4RM2A 4TUYF 1JHLH 5LLIC 4GS7B 4BQCA 2J3MA 1EWKA 2XKJE 2WO4A 4M62H 4PJ8D 2H2HA 5IHLB 2QADB 4B5ZA 3PX7A 4YH6A 3PWUA 3BSWA 1EQWA 1T89A 3QPKA 4P7KA 2QT6A 3OKKA 4U1IB 4YFEA 2W22A 4P9ML 4PF1A 3I6YA 2ID7A 4YDIH 3D2BA 4HWTA 4LCCC 3A9RA 1JXFA 2R2GA 3BGVA 5BQFA 3IKTA 3K5WA 4KMMA 3NEYA 2AKAB 1MGOA 1R46A 1P1HA 4Y2XA 5J6GB 2PPVA 4JLWA 1IAIM 5DTQA 3W3AD 3W9EA 4C0BA 1O9HA 5JO5B 1RMFH 2I9LA 1JDBC 4A03A 2XECA 2V2WA 1EHNA 1ID2A 1CDYA 1FL5B 4OIAA 5A4KA 1DEDA 3RJ9A 3THOA 4MX7A 4PM1A 4UCFA 1E3IA 1LFAA 3BPLC 2XVXA 3R06A 4I3GA 4XO3A 3ZVLA 1XXLA 3PFHA 4A92A 2F54B 4W4TA 2VTFA 1P4RA 2VLBA 4NE7A 3K9GA 3CNBA 1IB0A 4GKOA 1UBUS 4I6GA 4QLBA 3G1WA 3RWGB 4E5UA 4IL5A 5KS9A 3U0PA 1JALA 4EMTA 4LSUL 3LF1A 1JFVA 4EO9A 1SZCA 4JOQA 4QARA 2QTZA 3PHOA 4TULL 1XVIA 3EJJX 1VG9B 4FMDF 4NQCB 1NI4B 1PZXA 1U99A 2JGIA 3Q8FA 3H8WA 3WE1A 2EVGA 3ZW8A 2D0OB 2ZJBA 5ISZE 3RLSA 3SJCA 2VKQA 1RSYA 2OXRA 3ABOB 3DJYA 1E0JA 4NN5B 4KTTE 5IX8A 3L7IA 4ZX3A 3BVWA 4JJ5B 5FK9B 4CEHB 2BM1A 5DSXA 4HKBA 2J20A 3RYIA 2CCWA 4MQXD 4N8VG 3IVKB 2AZAA 1Z25A 4TVOA 1ID5I 1G7QA 1ZSDA 2QLNA 4MUJA 1NRXA 1RPAA 1YQVH 3GGOA 5HHOD 2WM9B 1SGKA 4BGEA 5I7WA 1MQ9A 4HN2A 4ZU1X 4LCCB 4OAWB 4Z7NE 1P6XA 4RWEA 3NH7H 5ECJE 2DGDA 1L3BA 1FP7A 4R7DB 1G1YA 4ALAL 3H9YA 1I7DA 5FFNA 1QYRA 1FE8L 1NAIA 3U1BA 1RK1A 3KPQB 2I3BA 1OXKB 4LBEB 5D72L 2F6RA 1ITBB 1E77A 4RNRB 3KBPA 4YJDA 2XMBA 4H17A 1E2NA 2B4AA 4DWWA 3H53A 2O05A 4OQTL 4L0MA 2OG1A 1DFHA 3CDGB 4Q0XL 4DP5X 3M9LA 3D25B 4K7FB 4JW3A 3L7AA 1BD2E 1A6TB 2FHPA 4YIQB 3V97A 1E9SA 5HHME 1N6OA 3KQOA 5ESXA 3IIEA 3WGIA 4RGMC 2ETWA 5I1IL 4PWGA 3L3DA 4D94A 4BNUA 4WCFC 2EINB 5I9QC 3RKDD 3REVB 1MKFA 2OYKA 1KIAA 4Q21A 2O5YL 4GC5A 2HFFB 3MJVA 1BEEA 4BFZA 1YVPA 5A16A 3BERA 2W42A 4M5YH 4U1GB 3FMIA 1A21A 4KYUA 1N2RB 3DL4A 5IVHA 4RK6A 4MDJA 1S6NA 5EA0L 4G9FE 3HFJA 1MB4A 3KXFD 4O4IA 1E9EA 1ID1A 3IILA 1YMHB 2WBJD 1CXEA 3ZDYF 5EU6E 1D2MA 3BWAB 2KM1A 4G6ML 2W4IA 4OZFG 2E6KA 1NU6A 4E6EA 3JXAA 3H8VA 2GY7B 4ODTH 3FPGA 3J8F7 2CLLB 2Z34A 1VBFA 1PR9A 3ARDB 5D7EA 5GZND 3TIDB 4GAYB 2EYTB 3D52A 3K4HA 2P2DA 3AM8C 1H5NA 3FRPA 1KBWA 5ANHA 5BUAA 2GUYA 3T6VA 1WABA 2NX2A 4K23L 3QPBA 1YDMA 1CFVL 5KYNA 2AC0A 5EU7E 4LESA 1KBVA 3Q41A 4CT5A 2VUHB 1PD0A 1V7NL 2DLTA 1CEXA 4YCDA 5KN5A 1I1QB 4IY1A 1GSKA 2CMKA 1UQTA 1SXJA 5DVOA 1N8ZA 2BNRB 4YR6B 5AW3B 3RJTA 5E38A 3KGSA 4J3SA 4P82A 4WCDA 2QR0B 4BVHA 4TL5A 2X4NB 3AREC 3IDYC 4KVZA 1FG2A 4M21A 4EX7A 4P7GA 3F3MA 4Q3BA 4LHUB 5GINE 3PP8A 5BMVB 5BP7A 1M6OA 3GWGA 3ENNA 4EB6B 2P5YA 3QIBD 5H37H 4U1GC 1S8DB 2ODBA 4GAEA 2JTYA 4R84A 2QD5A 2VLJD 1MFDH 2WD0A 3V6OC 4MQBA 1FW6A 1BFOA 1KB5H 4L07A 3S34H 2UUDH 4GRAA 3CN9A 4ZMTA 4PRDB 5JW5A 4U02A 4DKDC 3ZE1F 4BVBA 2YSSA 2IHZA 4XYBA 4Q9NA 2VR4A 2XRAH 2KS6A 4G80A 4HK3J 2WTNA 5DKFA 5F71A 5LLTA 4IDJH 1E3LA 2WJIA 3MRPA 3J7HA 3ZIYA 3NOQA 4BNHA 5B3JF 4W6WB 2Q8NA 4A6YB 3ULUC 1BV8A 2A77H 1CU1A 5JHDA 4PJ5E 1MRZA 5SY6A 4AENB 3PVZA 3LUDA 3EVZA 1BXRA 4P2CG 4KI5F 3IBYA 1R4MB 4WD3A 4OZGA 4RU1A 3P3YA 4IRSC 2VM9A 5C70A 1IQRA 1ICEA 5IW6A 5FUOH 1WXXA 1T8YA 3V0FA 4F7MA 1R5WB 1JAEA 5D1QE 1S1CA 3B1FA 1GHFH 3D8SA 2BUCA 1DQQB 4WTZG 4ZCLA 1GP2A 3R4RA 15C8L 2B5WA 5JCPA 1NPTO 3OOHA 3N6XA 3W1ZA 4ZANA 4LF6B 4P31A 3Q6NA 3L13A 1GD1O 3DF9A 1YNSA 3ZVMA 4GKLA 4ZI7A 3WNIA 2WPGA 4ZAXA 3WEAA 1HKHA 4R26H 1D5ZB 5JQ6L 3IUJA 2HKHH 2PL9A 4V2CB 2NQCA 4N2NA 3CU7A 4F27A 1AGXA 3U6RB 4LDNA 2C9DA 3O3EA 1I8TA 2DFDA 1EEHA 1C5CL 3NWBA 2I7CA 3FNHA 4Z0HO 2V7HA 4FE7A 1XRQA 3N0PB 4YS4A 2G0TA 3BQNB 3E82A 3IGAA 4IEEA 3HDHA 5KSAC 3TZEA 4I9FA 3HNTL 2JIPA 1PU2A 1DQML 4MUYA 4R1PA 5MP6H 3W11D 2EX0A 4RVBA 5AZ2H 2WF9A 3WGTA 1TQCB 1IQDA 1C5DB 2FFQA 5FBVB 4TXVB 4KGLA 1DX6A 4IKOA 1OGAD 1K4DB 2QN2A 1V47A 4AJEA 4I5BB 1ZJBA 1OY3B 4NPJA 1DCTA 4TKMA 4A38A 2B77A 2B6HA 3I28A 4DGYH 2E55A 3MYYA 3NDJA 5IR1A 2GTHA 4R3SA 1O95A 1TJHL 2WP3O 2JKNA 1T3FB 4U7KA 3TA3D 3HQ4O 5KJRL 3NHYA 3D9AH 2PZAA 4DMKA 5ALGA 2FIRT 1UJ3B 3CISA 3GJ4A 4ZCQA 4REQB 5JQGA 4NIKB 3LYAA 1WT5C 4KKRA 5FUCC 4RFNB 3EULA 2Y36H 4J3WA 1X77A 4BD4A 3OZEA 5PGMA 5IJCC 1NAMA 4X9HA 2VAPA 2ZDQA 4UEWA 4NIMA 2XZAH 3D0LB 3FT3A 1REQB 4X6FB 4R1UA 4BNXA 1L7VC 1VDMA 2DM7A 3T5CA 2I4NA 5CDTA 1IAIH 4RFEB 1QK5A 1EK1A 2ZCUA 3Q3HA 3GJ3A 3ZE2F 2EC8A 3R9WA 1H4SA 2XZAL 1B0RA 1E2EA 3JRWA 1HZZA 3BAEL 4F5CE 1GAEO 1YEJH 2GBPA 1N25A 1FVFA 1DHTA 3AGVA 1XRPA 5SX4I 3PWSA 1IAII 2YYSA 1KB5L 3VGBA 4XCVA 5CSZB 3ZHLA 4I0PB 4IAOA 5T5NG 3MUGA 2R9VA 3FU3A 3IMCA 4DZBB 3CLUC 2D3WA 1G5TA 5CEZD 5FFOA 3PV6B 1AHHA 3ZV4A 1E5BA 3B2UD 5BNTA 4LNUB 1QDLB 3D18B 1QV6A 3T41A 2W2LD 5FYKU 2V8BA 4FWBA 1VL0A 4MJ2A 1XAGA 2DRUA 1QLRA 3HM2A 3NDZE 1JQ3A 4KLAA 4WACA 1JK8A 4PGZA 5FWXA 4AZSA 3C8KB 3S8MA 3P9MB 1UM4H 3DWEX 3F7PC 1P0FA 1CTNA 2ZTBA 1THAA 4POUB 1J49A 5IVOA 3IP8A 4R31A 3KPSD 1EBAA 4F7WA 5CJPA 4C20A 2RGBA 5FUYA 2B7CA 2GJSA 4M4SA 3B3BA 5I1LA 4WUKL 2G71A 1AC6A 3FCCA 1TVHA 3B1UA 1J20A 2X7LB 3SX4A 3VSCA 4P8RA 2BOCB 3ROQA 1H15B 3NKLA 1CPYA 3OHXC 1NIPA 4OVKA 1BMGA 1FMLA 2C5BA 2VJBA 2HJSA 2GEDA 1M5UA 3E2MA 4I50B 1P2SA 1U28A 2FWMX 2MNJB 2ZRPA 1PR1A 1MWAB 4LMBA 4P5TA 4RA9B 3KPNA 1HXYA 2CLKB 3D85B 2ZJ1A 3H6KA 3B5HA 5ALUA 4WJLA 3Q7JA 3H42H 1VM6A 3TPCA 4M6OH 5LUAA 1Z7JA 1HO3A 2H29A 4LLYB 5EPOA 4DEYA 5IMKA 1G42A 3JQAB 5BRNA 1D1QA 2UYGA 3GJRA 1JAZA 4LFHD 1ZC3A 4EQ6A 1PJSA 3O9WB 2IWGA 3V5HA 2G9RA 1W34A 1I8LC 3OQHA 3LP5A 5I19L 4CFZA 5JSHA 3CBRA 3DZFA 1R0LA 1JN6B 2O6PA 3Q5TA 3DR5A 3EE6A 2E6PA 2W8CA 1PL3A 4PFJA 2AJBA 4KMLB 3WBJA 5TQJA 4I7EA 1TMCB 3F12A 3WTWA 5FJIA 4LTNA 2G36A 5B3LA 3P9YA 2RHCA 3QRGL 3FFCD 2DU8A 3VMFA 1QJCA 1YY9D 4MRMB 2EXWD 4X7EC 4GG6F 3ZWCA 2P9FA 1MFDL 3F7YA 4YRFA 4RBNA 5M5BA 1EK3A 5JROA 4UCQA 2DWEA 1NPYA 5IFKA 2L17A 5CH5A 3LQ4A 1YFKA 1VSQA 2R8RA 1U2HA 3H5VA 3Q3IA 2VO1A 4GQBA 4FB5A 3MLYL 4JCLA 3E53A 4Y2PA 3JD2A 4FN4A 4Z4FA 2VSDA 5DMGD 4XOCA 2BMFA 2Z6QA 4FXOA 2Z9TA 1Z0MA 2ICEB 1OLLA 3KS9A 2R8ZA 4Z0PA 2ZI4A 4EY6A 1IN7A 4CC0A 2IXDA 3L5IA 5HTOA 1JGUH 2BNQA 1J5EB 4D56A 3OY7A 3PQ3A 5KSBB 3GQFA 5FTWA 2IBZY 4XTRA 5KO2A 4ODIA 5ICYB 2WYWA 1V7ML 4JFQA 1IZ8A 4Q39A 3EH2A 1FVCA 4MJIE 2YIHA 1OILA 3H5TA 2QLVB 4YDRA 2YQ2A 2JJSC 5SZKB 1UT8A 3T3GA 2EGUA 1FFOA 2O8BA 3T4UA 2VXSH 1V5GA 5EHZA 4FZ3A 1NVMB 4LJ7A 2BDTA 3QEQA 3EGDB 1Y18B 3HVRA 1X1RA 3QJHB 4ODVL 2P79A 1TTAA 3CW8X 3QDGE 4MUGA 3MFFA 5BW8A 3C3MA 3FZQA 4FXGB 3FVVA 2PN5A 4RA0C 2OQIA 1RIUH 3IXTB 3UROR 3UZVB 1PZUB 1TPXB 4P38A 5FTJA 4R4ND 2X8LA 3T8VA 1FYTA 3APMA 4PYGA 3IQZA 5LA6F 3MLBA 2KE5A 2N9UA 5FUBA 4D02A 4BFYA 3KL0A 3KALA 3R4VA 4QXPA 1PK9A 5TK2A 4NH4A 1O95D 4KFTA 4JYAB 2WKOF 4AI7A 5BSUA 5H7XA 1LWHA 4AGQA 4FZ5A 3LS5L 3N43B 2V4MA 4NOFA 1HMPA 3OZ9L 1OV4A 1C50A 1O97D 3MXWL 1AQNA 4Y2HA 5H59A 3LC0A 3LVFO 4IXMA 1AKEA 4N0EA 4KH2A 3D07A 4FZ8H 2R3SA 2VKXA 1W6UA 2XI4A 1YPZB 4EQ2A 3TLJA 4X8OA 3G6JB 3PVCA 4XPTL 1CE1L 2ICES 4PJ9C 2Z58A 2D5BA 2WM0A 3DOHA 1G4HA 4JY4B 1JIUA 3UOGA 2BFCB 5JW3L 3L1EA 2LABA 5ENDA 2UWEE 1VIWA 3C09B 4FFWA 1MJFA 5H4YA 3S34L 1AGCA 4CW1A 4B3GA 4OFZA 1H4VB 1K5DA 4EZEA 2HIAA 4F7TA 2WXFA 3EH5B 3FT4B 4JRXB 3KEFA 1VI2A 5IXJA 2W07A 4QRRA 4F71A 3VVCA 2EDRA 2RG1A 1P5HA 2CDEB 2A1TR 2CL5A 2P4AB 2BFEB 2A9MH 5TPWH 4NYMQ 4D8PB 5L4NA 2A73B 3KLHC 4ALIA 4XNDA 1NUFA 4OZIA 1ILSA 5EESA 3OLYA 3HRZC 2J5QA 4FQIH 4J3OC 4IKNA 3C3DA 4X8LA 1ML0A 3OF5A 3Q7QA 4KHPB 4FL4C 2G2RB 3RVBA 4DV6B 4WTXA 2X3BA 4MYSA 4Q9BA 1MN4A 4CF7A 3HJHA 4YHOH 5A1TA 4PJAA 2GF0A 2P8LB 1SBSL 4FYMA 3BKCH 5FPIA 4HBZA 2JKXA 2OO7A 3UWKA 2VMDA 5EU3A 3ULVD 3DMRA 4Y1AD 1IC0A 2AX4A 4WXMA 5KTOA 1N5MA 4YBHA 1MX1A 4ZAYA 1XXHA 3EY9A 3HFGA 4JFZL 5E5LA 3W7AA 1VPOL 2Q4RA 4GOOD 4OFBA 1NNLA 3AQ4A 2X7HA 2K4WA 3IAS1 3FFDB 4AMKL 4D0GA 2BEVB 2IZ7A 2JGMA 3DTXA 4R98A 1V5WA 2LT9A 4ZI2A 4MNGB 4J3BA 3QORC 4FTVD 2XGSA 4QLAA 1OB1A 1Q14A 4P5KB 1QOPB 3C43A 2Z04A 4IJVA 4ND6A 5HGJA 3JTSB 1FP4A 5AI0A 5KUTA 1NXWA 3RWHA 1WQVT 2HFGL 5K8JB 4DETA 3C09C 4KRXA 1T1ZA 5JHHB 4TOYL 1EVTC 4R3NA 5DDHB 2F00A 1W72L 3VD4A 1BECA 5LMUB 3FO9B 4KIWA 5KOJB 3BUIA 1E9QA 1WLYA 1JFQH 2C7GA 2DHRA 4AUUA 2A38A 4L8WB 4N2BA 3TQIA 5LPNA 2EZ9A 4DG5A 4FRWA 4IBZA 4JXXA 2WSDA 5ABDE 5GAJA 5A0VA 3UMYA 3PUYA 4AKGA 1KO8A 4CDMA 1PLBA 1HT0A 5D96B 1H85A 4F33A 3VX3A 3QUXC 2EG9A 2X8JB 1QIEA 1DLHB 3PNLA 35C8H 3IFNH 4LU5L 4GIPD 3OKPA 1M1SA 2X05A 2VITA 1KB5B 3FI0A 3LECA 3D0RA 4TMPA 5E8EB 5MERB 1ZGLB 3D4BA 3X1BA 3X1WA 4DN3L 4Y2DD 3NZEA 1C16B 1EO8H 1L6IA 4HT1H 5EN3A 3ME5A 1V9SA 1ILEA 3HBZA 4ONHA 1U3GA 4X7MA 3H55A 1NG9A 5T1KB 3TQTA 1IRAY 3CX4A 1Y8AA 1TU4A 4U31A 3W2IA 3U7YH 1BX1A 2PWBA 1ERNA 3L7YA 2I65A 3EJQA 2R79A 2APBA 1K85A 5JDCA 2JJVA 5CJOL 3NOVA 4JRFA 3RVUD 4Z53A 3ZZSA 2WIJA 1J9QA 4DKXA 3TRHA 4HHWA 2L18A 3ORQA 4FHZA 3NWJA 3MLRL 3O9WC 1N36B 4LSRL 3PQ2A 1MXGA 2ZCLH 5EMLA 2FSIA 2ITDB 2X8JA 2ODQA 5HVNA 3A3YB 3OLQA 2DI7A 1MB2A 5DI3B 2P9EA 1GTFA 3GJZA 1A9EA 1Z3GH 1JAYA 2AQ8A 5KX5F 2JFUA 4Q3OA 4CN1A 2C88A 5I8KL 4MB5A 3S4SA 3K30A 1CDHA 4QHLA 2HUNA 3MJHA 2F7IA 4ZTOL 3V32A 4XBPA 1IQWH 1HEUA 5CDGA 1VGKB 1Q0RA 3K2IA 5DVZA 5HYQB 1WV7T 2HYMA 1A4JB 5MI0B 2CXXA 4CG3A 1CDCA 2NUTB 4IS3A 4YHNA 2PYEA 4LEEA 4I0KA 3KH3A 1QS0A 1ZGZA 2FH5B 1E4KA 3UO1L 2FHBA 1FTNA 3U44B 2X89D 2D73A 2IE0A 3AI2A 4LMRA 1K88A 4BWTA 1RZJC 3B89A 4FPXA 2XTMA 4JO3H 2OK0L 4DXAA 4NKIH 1QLWA 3UABA 3INUL 3AY6A 5FLYA 3O0RH 3C6SA 4GUDA 2I6GA 3LT2A 1QHHA 1WFOA 3DE1X 2VR7A 2NR6A 4CM4A 1ULUA 4G7VL 2JGNA 1GZ6A 4GG6B 5BSKA 3BK7A 2AK4B 5EP2A 1I9RH 2FRDC 2ZROA 4EEXA 1Z4NA 3P9CA 3W8DA 1XZHA 4NSNA 3VC2A 2F9LA 2DSNA 4UQ2B 4YECA 4MO2A 1N3NB 1IHYA 5CO1A 2Q1TA 1NUSA 1MRCL 2F1HA 3R0IA 3BXGA 2UY7B 1KCKA 5BV7B 1RVDA 1NPDA 1JJVA 1YZUA 5FOXA 4I5GA 2IFGA 4K03A 1B93A 3I73A 3D4LA 2BELA 1XA0A 3OZ9H 1TXKA 4AP6A 4LZPA 4UAVA 3BDXA 5CK4A 2H11A 3E18A 5FUVA 3KSBC 2ZUQC 1D2OA 4LVOB 2FZLA 4RGVA 3THYB 3HPJA 2DKFA 3AQDA 4WZBE 5JW4N 2HVBA 1JH8A 4QXUL 5EUOB 3UYPB 5F9HA 4MB3A 1S78C 4TYPA 3THML 1LVUA 4L4TE 4CAGA 5E6IB 2VP9A 2EFYA 1H4TA 4GP9A 1PT7A 3CNLA 1PFYA 1TU3A 3IM1A 5KMGA 1AZWA 4XP4H 3W2FA 2ZCVA 5LLDA 2EKPA 1MEEA 2VJLA 3HR4A 4F7DA 3BDBA 2QMJA 2DWDA 2IY9A 1OP3H 3NCXA 4CA4A 3QE9Y 5C6TH 1I1AC 5B1YA 3Q8KA 5E7MA 1IM3A 5ITBL 4GQPH 1DVTA 4GLJA 3LX8A 3S1AB 2YXWA 3BHJA 2DBVO 3RGWS 3TRJA 2ANCA 3FHAA 2CXNA 1SJEB 3UC0L 1NW4A 4HNUA 4F1KA 5A2BA 4HWEH 1AFVH 2CHEA 4XM2A 4XTCS 1UT6A 4LARL 4UMVA 4IDCA 3WLTA 1NGWA 3BIBX 1PLGH 4GKZA 2R4RL 3LIZH 1WLHA 3BGAA 4DV3B 5DJ6A 2AR0A 4WZAA 4OB5L 2WJPA 3FPSA 5F7EH 1CB7A 3V34A 3SPIA 2I9TB 3OTQA 5K8UA 4Y6OA 1ORTA 1CDGA 3F78A 2VUTA 4JM2A 3RKDC 2FBRA 1FDVA 5HYSB 1B41A 1DAPA 3QEMB 1EI9A 1G5RA 4XSHA 2OI9C 2DUMA 2V7QD 2B9BA 1KZGB 3ZE1E 2IEIA 2WIFA 4ZO7A 2ZVJA 2D31B 5IJ9B 1FJ1A 5CB6A 3WNMA 1AHKA 2FUCA 2XN0A 3SXPA 3UG5A 2AXJA 1YS2X 4NECA 5EEWA 3W4IA 4CEIA 3U7WL 5ES3A 1XL0A 4L08A 5D4HA 2EZ0D 3BD4A 2I5PO 3LL4A 3HEAA 2HHHB 3RUCA 2PT6A 3LUCA 4D80A 3LPDA 2WLHA 3O0RL 4GP4B 3PL6C 2EW8A 1YN6A 1HM5A 3VA6A 5IGXH 1UVQB 3GMQA 2HMIC 2X15A 5AKZA 1XYVA 5C52B 2WMPB 1M10A 2YVLA 1MHHB 4X4XA 1AGEA 2F48A 1ZJZA 3O73A 1BXZA 1EZSA 3SY0A 2Q7OE 3PS6A 3EK2A 4OQXA 5DVMA 1ZGLP 5C80A 5LL6P 3QEGH 4GRWE 3RYCA 3O2DH 4X20A 3QXAA 3BXNA 4RZIA 1C3JA 1IHDA 1PO7A 2ZQKA 2O93L 2OORA 4LRWA 4ZOQI 1P7KB 4URWR 4W6QA 3TG2A 2HH9A 4YCSA 4NLAA 1GPYA 1ZW6A 5CFQA 5J2UF 1LKZA 1YK1A 2ICWB 4HLJA 4LSSL 5I1GH 2IJ0C 1JIBA 1KGYE 5LAXB 3ORYA 4ANWA 3RUGA 2OYPA 4BZ1L 3UTTD 4J8RB 3MOGA 2EVJA 1DXYA 5I9NA 4PRAA 3FUXA 2YD5A 4AL4A 2QPSA 1BGXL 3Q9LA 3PP4H 3SCZA 2R69A 3FFCE 3BIOA 5D2CA 1UXWB 3ZWBA 2PPCA 5EDXA 3TLGB 2IV2X 1P19A 5TARA 3AVTA 3L0CA 1SBIA 1TJNA 3K8ZA 1SOMA 2WU8A 1XGRB 1I2AA 2UZ3A 5TF1H 2SBTA 3T4PA 4UT6L 2XWJB 1FFAA 5HHNB 4ZAKB 5TDHA 4DMLA 4HTFA 1KTRL 4N20A 5K1JA 4K0RA 2N0KA 4UMDA 3S2ZA 2OHHA 1ZEMA 4ZT5A 3LC1O 1XTTA 1RD4A 1C3XA 2YDXA 2XTJC 3HKEA 3QQDB 4OLWL 1DBKH 5JYEA 4AJ4A 3OJ2C 1LU9A 5KANI 3EDEA 4GO6B 5KG9A 2PWZA 4I1YA 5FYQA 4B8YA 1XJ5A 1XDDA 1QR6A 2ZOKA 5EBGA 4RPGA 4BZ2H