5E6SB

Structures of leukocyte integrin alb2: the ai domain, the headpiece, and the pocket for the internal ligand
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
459
structure length
455
Chain Sequence
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRKVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-L
total genus 127
structure length 455
sequence length 459
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5e6sB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5e6sB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5e6sB03
5E6UB 4UM8B 1IJKA 1CQPA 4IHKA 5HJ2A 3FCSB 4K3JB 5KYUB 5E6SA 5KYYB 4M76B 5KYYA 4DMUB 3OL2B 1T0PA 3EGXB 3FCSA 1OLZA 1PCXA 2NVOA 5E6UA 3HXQA 2ADFA 3QA3E 4WK0B 3ZE1B 1MQAA 3EFOA 3AL8B 4HQOA 3EH2A 4O02B 1JLMA 1Q0PA 2VDRB 3K71A 4MMYA 2VDQB 1YVRA 3K71B 3V4VB 1BHQ1 1UEXC 3NIDB 4O02A 3AL8A 3EFOB 5E6RB 4C2BA 4XW2A 2VDMB 2ODQA 1T6BY 3ZDYB 3EGXA 3OL2A 3TCXB 5E6SB 2VDKB 4GZ8A 5KYWA 1RRKA 1IDN1 2NUPA 4UM9D 3AFCA 1M1XA 5KYUA 4F1JA 2WW8A 4MMZB 3GXBA 2QTVA 1JEYA 3T3MB 3PPVA 4HQLA 1YVPA 1XDGA 3TVYA 1FE8A 4WK4B 3M6FA 2VC2B 5ES4B 3VI3B 4O3TB 1IDOA 4C2AA 3HI6A 1AO3A 2M32A 1CK4A 1MQ9A 1SHTX 1SQ0A 3NIGB 2XGGA 4WJKB 2XWBF 3F74A 3K6SB 3OKWA 3EG9B 1N9ZA 4C29A 5LN1A 1M1UA 1PT6A 2X5NA 2NUTA 5HGJA 1DGQA 4Z7OB 1JEQB 2VDLB 2UZYB 3IJEA 3IBSA 4G1EA 1RS0A 2WINI 1L5GA 1SSLA 4JDUA 5KYXB 1XUOA 1PD1A 3T3PB 3BN3A 4MMXB 1U0NA 3ZQKA 3K72B 1JV2A 4NENA 3ZE0B 3EGDA 4G1MB 1U8CB 1QCYA 3FCUB 3BQNB 1ZOPA 3PPWA 5KYNA 1M2VB 4G1MA 3EGDB 1SHYB 3N2NA 4HQNA 2XWJI 1JV2B 4NENB 1QC5A 3K72A 3ZDZB 1YUKA 4O3UB 3HXOA 3F78A 2P28A 2ICAA 2P26A 5KYXA 2O7NA 3AL9A 1JEQA 1OAKA 4FWWA 1DZIA 4HQKA 1N3YA 3NVQA 4JX0A 1ATZA 4FX5A 4Z7QB 3K6SA 1SHUX 1QC5B 3ZDXB 1V7PC 1M2VA 1MHPA 3BQMB 4A0QA 1PD0A 1U8CA 1TYEB 4WK2B 2VDOB 1LFAA 3Q3GE 1XDDA 4IGIA 4MMXA 2VDPB 1ZONA 1L5GB 1AOXA 1AUQA 4G1EB 4PN7A 3IJEB 2NUPB 5HDBB 4Z7NB 2VDNB 4UM9B 5KYWB 3OKYB 2NUTB 3E2MA 3V4PB 1MQ8B 2B2XA 3EG9A 3RAGA 3TW0A 5BV8A 1M10A 3EH1A 3EOBI 3PPYA 1M2OA 1RTKA 1MF7A 4IXDA 1RD4A 3EOAI 4CNBA 1U0OC 2ODPA 5E6RA 4CN8A 3TXAA 3NIFB 3VI4B 1FNSA 1MJNA 4HQFA 4F1KA 2I91A 2I6QA 4NEHB 3PPXA 1BHO1 4BJ3A 4CN9A 1JEYB 3ZE2B 4MMYB 4MMZA 1NA5A 1IJBA 1ZOOA 2IUEA 1M1XB 2I6SA 4WFQA
chains in the Genus database with same CATH superfamily
2BFPA 3O94A 1A3RH 1AGBA 2BFFA 1TIKA 2ZWSA 1JFHA 3ZY5A 4MVXA 1SGWA 3SKOB 1OLUA 4EYKA 1FLNA 4KNYA 1BFDA 1O4WA 2WTNA 2QD4A 3VH8G 4F80A 3USES 4N22A 2IPOA 4ZZ3A 3DDFA 2YVKA 3FRUB 4G65A 4NFSA 1JGDB 3E0GA 2ZYVX 1JFFA 1V5EA 1C29B 2EVWX 2ZRMA 5CEJA 2EJBA 3IFNL 4WUUA 3WLKX 4RBNA 1YF3A 3D2LA 1KTLA 1D0IA 3HACA 1SHJA 3HCFA 5DYOA 4F5WA 4FX2A 4MSWB 3U31A 5JHHB 1TUBB 3Q1EA 2NTEA 4C56B 3AM8C 3FFCA 2JGDA 3E70C 3RDTB 3B9QA 5EIOA 3RCBA 2QIOA 2JI8A 3ROFA 1Y1TA 4J3SA 3ZV7A 5G0TA 3PGMA 4KNVA 1KDTA 1A5FH 4ZUUA 3C6ZA 3I72A 3C98A 5T1LB 4ARCA 1DC6A 1R4MA 3C5WP 3QS3A 2COKA 3DETC 4ZARA 2RHJA 1NICA 4F7EB 4JLBA 1RMTA 1Y7PA 2E4AA 3T0EB 1G87A 5T3XD 1IUNA 5ECGC 1TM7E 1Y6MR 1W6WA 2WVVB 1NVUQ 5EZ5A 3F01A 4RKEA 1D1PA 4JGMA 1P5VA 1LO5B 2W0MA 5CVUA 4IEIA 4OB5L 2RB8A 3DOEA 5TVGA 5GV7A 1OF0A 1QQTA 5CTJA 5DHQA 1M8GA 3NEAA 1JZSA 4TKUB 2DQ4A 3WV4A 4TVUA 1JLMA 3RUCA 1HHHA 4FZEL 2HFTA 4JJIA 2CWRA 2YOAA 4NQEB 4QJ3B 4NATA 1O75A 1TAGA 4M89A 3SJVE 5FHBH 3RU3A 1KNQA 2X12A 5FYJD 2IALB 2GSMB 4RNRA 1QF9A 4J1QA 4PQYA 1V1JA 1R64A 2DUMA 2XRAL 4F8JA 1MCOL 5ILOA 1UK9A 1OIWA 3SDSA 4WWHA 2X9QA 3HA3A 1UC8A 3EXFA 3ZZ1A 3LQAH 1VHTA 4GB9A 1R50A 3BVUA 1L0BA 3NI2A 3VD0A 5I2IB 3UQZA 2UZIH 3MB8A 3KJQA 3KVQA 4KZDL 4IDJL 1SVWA 5CX4A 2X58A 3UTOA 5JPNA 4L2IA 1YHZA 1X94A 3RU2A 1A3CA 2CDFB 4MX7A 1FSGA 3K35A 5BW5A 2VLRA 3DE5X 3WEBA 4OZGE 4QGTA 2KZBA 4FN0A 4YRSA 3BWEA 1N5AB 1QR1A 1N68A 4NHUA 3V00A 3C8HA 5IVXB 1LFAA 2J2ZB 4FNOA 4WIAA 3TIEA 2X1XR 5TQVA 3A58B 1DKLA 5EN2B 2X4QA 3BRSA 3TU6A 2BS9A 2QKIA 4E5SA 3OZBA 1VCAA 2C83A 2JIDA 5JHDE 3HCRA 5IK3A 1WO2A 3UG5A 4WUUB 5TE7H 1GAXA 1JPGB 3KT6A 1S7TA 3JWHA 1OVMA 5G40A 1ONQB 3ARGB 3HCOA 1PG7H 3KGUA 3H9CA 5I8EA 3QJ5A 4M6NH 5E8EA 2NNAB 3UO8B 1FFPA 1DN2A 1VESA 3QBDA 3QVWA 5HBRA 5FUZH 2WM3A 4GIBA 4C4ZA 4JZNA 5I3ZA 4N8DA 4FCHA 1UUNA 3P0JA 4XPBH 2OG1A 1GPDG 1DV2A 3W8DA 4QDXA 1VJRA 3T6ZA 3O3CA 5ILTH 4AYSA 2V65A 1U0JA 4FYXA 2GHQA 2GX6A 5FBWB 4AP5A 1E2KA 3ANYB 3PDOA 2A5LA 4GP7A 4QVIA 3CH1B 1C5DA 4FQCH 2P49B 1MW8X 3VDRA 5I9IA 3V7UA 4J2QA 1RWQA 4HAFA 2Q8QA 3EARA 4AMVA 2IU4A 4ML3A 4UVIA 5FFOA 2ZBPA 5IHXA 2VZSA 2BIOA 3N5KA 3RVUC 2MCMA 1L5VA 2Z64C 1EHNA 4OMCA 2ITEA 4KN9S 4RISL 5TPZD 4FWWA 5BPFA 1TVMA 1ZJAA 1PIWA 2FJGB 4HTAA 4LI0A 3UBXI 3CZFB 4HJUA 3IPLA 1K4CA 3V9PA 5G4KA 4ZAXA 3WN5C 4PI2A 1FC2D 2YKKA 2YJ5A 3SE8L 4K6HA 5C08E 3SGEI 4F2HA 4U6HB 3JALB 1A3LL 3N8HA 5LD2C 2EL9A 4HAWA 1OR8A 1R1DA 4RVHA 1Z2KA 2YA2A 4RPHA 3GXDA 4UUBA 2IGTA 3PQ7A 1YBVA 4L75A 2H6OA 2BVPA 3ICQB 2DLIA 3HCDA 5FA5A 4BVLA 2FHBA 3MTAA 3BEWA 1KIPB 3KBEA 5CFHA 1L3BA 2EWVA 1V1MA 3REVB 3Q5DA 2O1EA 4LP5A 1U0BB 1V55B 4XXDA 4R7DA 3HMKA 2FMTA 3L3JB 1T6NA 2C4WA 2EG9A 1V11A 2WMPA 5D1QE 1YRAA 2A9OA 3VJMA 1L5HA 2XTSA 1W0VB 2W6ID 4PO1A 3MCVA 1JIXA 1M1SA 2CD7A 4Q05A 4JC4A 3CX6A 3RTCA 1N25A 4CKQA 2IQ5A 3T65B 3RG1C 3K0AA 1NGPH 4RVFA 3E0XA 3CXUA 1H2WA 4V0OA 3BWDD 2AF2A 3IJEA 4HX9A 5CGQB 4S12A 4ENED 5DGHA 1U0NA 1MHTA 2QD5A 2PJZA 4QYIB 1M2GA 4U1MA 1T4KB 2VWPA 4W5HA 4IHJB 4JM2B 1XELA 2HG5B 4TNWF 1LS6A 3TBCA 1HQCA 2FHSA 3ECAA 3K4HA 3U4CA 1V5IA 2O61B 2GCOB 1VL0A 5E2TH 4WOKA 4M8QA 1N2EA 3KR0A 1UOVA 3G9ZA 5F0PB 1R6UA 1O7JA 2O3TA 3EN0A 1I2ZA 2WUDA 3NA9H 3GBDA 5IB3B 4ITUA 3RBSA 2WICA 4MQLA 3RZCA 3C6LA 1QNZH 5DBGA 4QWWC 1WU8A 2R59A 3VM5A 4WADA 1KU0A 3ER9A 4OFXA 1RZ8B 1H6FA 4RPJA 2PT9A 2GZDA 4N7BA 2R2EA 1SXNA 4ZVNA 2AL7A 2JELL 2EAEA 3CFBA 3IBFA 2WXPA 3UPAA 4LKCA 3D8TA 3KV3O 3K2UL 3GGSA 2C7UB 2DQYA 4O2FB 3B1KA 3ARYA 2O5XL 3T2LA 4EQZA 4P93A 5I0DA 3HS0B 1SPBS 3SGKA 1UURA 4JHUA 3SGKC 3C15C 1XZIA 3AVUA 2W70A 5BZDA 3ATDA 1BS2A 2FPGB 2RHBA 1GGTA 4G9FD 4KROB 3N9GH 3V6OA 4DMCA 2V5RA 4Q9IA 3INGA 1EFVB 1RCYA 4GGMX 4WXPA 4WLUA 2X4TA 2RGRA 3CPEA 5FR2A 5AVZA 3HUJE 2SEBB 1CURA 1RI5A 1RXCA 3C3PA 3HKEA 4AK1A 3PX2A 1U0RA 2QI9C 5DN9A 1BP3B 2WUGA 3CX3A 3IQDB 2NMVA 1GLNA 4HVBA 3WUWA 1ZHOA 1Z15A 2BFDB 5I19H 4L02A 2B5VA 1VACB 4L95C 3OMXA 4G5FA 3PWTA 5E2WH 3UYOD 1M9SA 3V7MA 3K0CC 1T20B 2ESRA 4KI5F 2ZSEA 3CUYA 4P5TC 2XNKA 5A4FS 1P2GA 3KT8A 3BH0A 3THSA 5I1AB 2IZ5A 2QMJA 4HO1X 2BHYA 1JF5A 1Z8DA 4FQQA 5KOHB 2LDBA 4IXDA 4PZYA 4AXBA 3NGMA 3BGMA 1I3CA 3PC7A 4BZ1A 3KOUA 4US1R 3I73A 5TRTA 3ZTWA 2VKTA 1JGDA 5T8IA 1CR2A 5JORB 2QX9A 5ICGA 2BOVA 1WFTA 1Q3TA 2QG9A 3GRUA 4KTEL 4LKXB 4FILA 2W88A 1FZMB 1GNSA 3VWJA 5CHYA 1WU7A 3V4UH 4QPJC 1KDVA 2Q41A 2EH8H 1I4FA 2GFBA 4D9NA 2Z5LA 1CLOH 1DVUA 3JXAA 4JHWL 3DXAA 2X22A 4HZUB 5HM6A 1UBRS 4EN3C 2ZQ5A 3CUKA 1HL5A 4MMZB 1B3BA 3T8YA 3D85A 3O6LL 1G0NA 2BKEA 3OEWA 4WK4B 3BH9A 2Q8PA 3QDJA 2AI3A 2CZCA 1P9WA 4N0UB 6TAAA 1QO3A 1VMAA 1PLLA 4IOSD 2X2YA 1DJGA 4G9BA 3TD9A 5E4YA 4KV9A 1J7JA 3PE4A 4PIVA 3T0AA 2IU0A 1NW6A 4NQCE 2YFKA 4TNVF 2WZBA 1ZT7A 1BZDA 1VXOA 4WI3A 3TF4A 1Q0HA 2P2LA 2ID7A 4AYWA 3TAUA 3AT8A 1MCPH 2XSZD 1NJGA 4WY7L 3VFRB 4C7KA 4NFDA 4NBWA 4ATNA 2BTOA 4DETA 3K5IA 1DPGA 4H9GA 2VR1A 4L4UA 4WZ6A 1BXUA 3WBKA 3P1JA 1T2QL 1A9RA 3AQZA 4YE0A 5HDBB 3ZI4A 4F6RB 4CR6A 3LKQA 2DZDA 1JF1B 4LARH 1H1DA 2JIXA 4MZ3A 3PFUA 4LGMA 1E79D 3CFEB 4GPZA 1JW9B 1GKEA 4OH7A 5FKPB 4BPBA 4H0HB 4Y5XB 2ORBH 2QTZA 2ARWA 1CZOA 1QV7A 4EBFA 2DQMA 2WMNB 3KQWA 3KZ8A 5IJ0A 2WOYA 3NA4A 5JQGB 3O7WA 1G8YA 3EFEA 4LCJA 4BAUA 2E5WA 2D5AA 3WFEH 3UP1A 1XZDA 2RG1A 2WHRA 3NG1A 5EU5B 4DNFA 1UB6B 2ONKA 3EPKA 1DKQA 5AW3B 3SBRA 2E0IA 4R0NA 3DA0A 5HYIA 1SC3A 5IJVA 5JCJA 4JO1L 1HT2E 3FLAA 3GFGA 4LSUH 3WMEA 2L17A 3A2LA 2F8VA 5CDGA 3ZCTA 3ARDC 1M7IB 3DNPA 3O1IC 4PV9A 4ZSOA 3TRKA 3H5WA 5AK6A 4GI2A 4OUOA 4R4FL 2EERA 5BQOA 3GSUB 5BO5A 1XF3B 2PO6B 2NY7L 4KGDA 2Y71A 1YI0A 2EQDA 1MKFA 4RMQA 1BEXA 4BFGA 1TZOA 3RRBA 1ZS8A 4IIEA 2Y2TA 4BQRA 4TM8A 1GY8A 1JHKL 3P52A 3HCNA 1NSTA 3NIBA 2IH5A 4PH8A 4LIQE 3QQDA 2G77B 3KKNA 5I1LB 4GVPA 4MJLA 1JFTA 4U39A 2JIZD 4MXVF 3DTYA 5D5MA 1B1CA 1CU4H 4Z9BA 3QX7A 1WNFA 5JPIA 4F97A 5IHZB 2FW1A 4FBGA 2YVAA 4CIYA 3MREA 2Y1ZA 5JRDS 2WOBA 1YC5A 2FMFA 5J6GA 3WO0A 2BDNH 4F9FA 3BZEB 4RESA 2XOXA 2NU9A 4J43A 3DO8A 1JI2A 1FFOA 3CBRA 4D0CB 4IGKA 3X11B 5MEND 3PXCX 3QKWA 3IV7A 4OM8A 1TF4A 3HN3A 3QJYA 2CIIA 2V96A 1EERB 2WLSA 4QNPF 1LDGA 1I1HA 4IU2B 1KTCA 2OJZH 4NX0A 2MPAH 3WDLA 4MA7L 2X8WA 5CJQH 4JBGA 4EFKA 5I82A 3BUIA 5A16A 4B4VA 1JK9B 3PX3A 5A4MS 4PJEF 3QGMA 1YR8A 3WLQA 2X0EA 4BEVA 1Q1NA 1FFRA 2NOYA 4LRWA 3GN1A 2YK1H 4S11A 1I6KA 3F3YA 3AP2A 3TVMB 3N8DA 1E9PA 4WA8A 1PLCA 2RHLA 3ZL4H 4MWGA 1OZGA 4ONHB 3DXYA 3OX1A 2X6RA 3AM5A 5I0WA 4AG5A 3UG4A 1MRCL 4FNSA 4JM4H 3RTLA 4MVJI 1II8A 2F58H 3TPFA 5IHZA 2OXTA 5HCNA 1AD9A 4HDMB 1F8FA 3HRZC 1N6UA 3N1MC 1R9GA 4BYGA 4OGZA 1ATZA 4HLZH 2P28B 2BH9A 4K6MA 3N43B 2YXNA 5EGNA 5AYUH 5DO2C 1JMKC 4OFBA 1AGEB 4E32A 3HA2A 3OPMA 3CKYA 1EGAA 1EUUA 4PP1D 1SO8A 5E1DA 5JD3A 5EHXA 4JNCA 5GZND 1BF8A 3V10A 3LP6A 3WYEA 1JZHA 3FT3B 1F6WA 4I1IA 3U2JA 2QAGB 2ZBRA 2G71A 2WE8A 3QXAA 2RGAA 3PP3H 2H6PA 4NC1E 5DJZB 1ZANL 3O8XD 3LO5A 3U17A 5G0SA 3VFTB 1IC5L 3AM8A 4K9KA 1ND5A 2WQ8A 2ZTBA 1U1IA 1WMBA 5KQRA 1RYYA 1VG0B 3FNBA 2ODQA 3UAFA 2JD1A 4HWSA 5FF6A 5CAYB 4G5ZH 4KQ4L 4I1PA 3HOGA 5IMOB 1CRWG 4KNQA 1LO4H 4R2GC 1M1XA 3IGKA 2YD5A 1JP7A 3K0CA 3QOXA 2PRIA 4CR7A 1JUFB 3RAPR 3B1YA 1IBGH 4W9IC 2IPAB 2UV8A 4V0LA 4RLFA 4KDCA 3HJTA 1YNSA 4KSBA 1EKXA 1KGIA 1WP6A 4D7AA 1EMTL 5LXVA 3FQXB 1DBKL 3ML8A 2CC2A 2BZSA 2CKBH 3NAQA 1JHLL 1SHYB 4HF7A 3WTXA 1G7LA 1Z2AA 3QFJD 3T38A 5HGHA 3KQVA 1V8BA 1MFUA 1NUDA 4MXQD 1P7ZA 1R12A 3CM0A 4M1EA 5B1IA 1TAHA 3FOLA 4HNAA 2AV7A 3UPTA 5ACMA 4HK0B 1ISFA 2J0VA 1CLYL 3FCAA 4PJ5E 3X1BA 5U1PA 2YLKA 5LGKA 4QTHB 4JFDE 3V8MA 2NX5D 1QGDA 1T3ZA 4YPFA 5DRXB 4OQMA 4A1FA 4HNQA 3AY2A 4FOSA 4CBPA 5CA1A 3AY4C 3V6LA 1QR4A 1OCCB 1AO7D 3N40P 3NKVA 4RLHA 5LDGA 2QGNA 2YUXA 4LHWA 2DN7A 3Q7EA 3QOWA 3V0DA 3D59A 3W0WD 2AJUH 3U0PB 5I6NA 2FPWA 3E7XA 2O5CA 1EH5A 3ACCA 1IZ0A 3WRXC 2ZPKH 2WLNA 3UV6A 3I23A 2ZT6A 4GGPA 4ZTBA 2IE8A 4XOBA 1B2WL 1FSSA 3FZQA 4FEAA 4W6YB 2FF5A 5IJWA 3TH2T 1F86A 4K1XA 4YHZH 4IWNA 2AANA 2X3FA 5HYSB 3Q8XB 3SR0A 1D2OA 5FXMA 2Z5FA 5JNVA 4YAIA 2WWWA 4IHOA 2WJVA 2UKDA 3TIDB 3BUPA 4K3JH 4PS4L 1IBZA 4YDQA 8FABB 3BKJH 3HJCA 5DC2A 3DVQX 2WIIB 3G6JE 4I13B 3BZWA 5T4EA 4UQAA 4UQCA 4BC0A 2DJ5A 4HUWB 3QHFL 2RHHA 3INOA 2FDBP 2BSQA 4G7YH 1E0DA 1RKXA 1UPAA 4O6VA 2AOUB 2AF3C 4DWVA 4LLDA 4RF3A 3P2TA 3OQJA 3O0DA 1DQTA 2DLFH 1NWHA 2C5HA 4H26B 2ZXDA 4XIIA 4OCWH 5DJ2B 5JQGF 3QCVL 3O9ZA 4OEHA 2VXQA 5TQ2A 1Y1RA 1MH1A 3DZJA 1RTKA 3IQFA 2EEBA 4R0LB 4QCIA 4MHTA 1KCSL 3H97A 1UH3A 3PWZA 1OB2A 2NY5H 4OHWA 4EN2A 4MDJB 1P73A 4IBQA 4M49A 1ZLWK 5JG7A 1YEEH 2AYXA 3KNZA 2R7EB 1SMOA 1C9SA 4GRWE 3SEQA 3BWVA 4QHNA 4DGYL 1QH1B 2BDTA 1B43A 4RGYA 3U7AA 3PQ5A 3W5UA 1KIRB 5L7WA 2JMRA 1FMFA 2F6AA 4NQED 4YHPA 3NCXA 4RM2A 4ZRNA 3BZUA 3H1AA 3O3EA 1F4XL 4EL5A 4LRSB 5ARBA 4NOMA 3T2OA 4P3DA 1MJUH 1KN4L 2Y1YA 3QW9A 4QRBA 4OM7A 5JYBA 5C6WH 1D2RA 5JAMA 3TPKA 2D1SA 5HFJA 4L8SC 2XZOA 3CN1A 3RWDA 3U48A 4IQHA 2XZZA 1A72A 1C5CH 5K0GA 3CNBA 1P6UA 5T1KD 1Q1BA 1W5EA 1G3MA 2H1HA 4U2BA 1NVKA 1I3MA 2GTZA 1ZK1A 4C0LA 3A31A 3K1KC 1QQBA 1G20A 4FGSA 5BN5B 1B00A 2V8OA 4CW1B 2PRYA 4AKSA 4LAQL 4S1TA 1RNLA 3VHXB 4HV4A 3PQEA 5FF9A 1PDKB 2Q45A 4KTDH 2DH3A 4HZGA 5AW7A 2XKNB 4FXPA 4Z3EA 3CHSA 5E5UB 1N0WA 4N82A 4B6FA 4RDXA 4FQHA 5BW4A 2KS6A 3PR3A 3GMMB 5HIMA 4P46D 4EY6A 3AHFA 4S04A 8ADHA 4F8OA 3KVPA 1L7XA 4GG6F 1E9SA 2DM6A 1QO7A 4F1KA 5AAWA 3MAGA 4K9EC 4MNGB 5BUQA 2EVFA 5T5FL 1KN2L 2DQHL 1JNXX 4PUBH 3DVNA 3BXXA 3NCBB 5D1ZB 3H87A 3HTLX 2W9DH 4OD1H 2BVQB 4LJAA 5E1OA 1VOTA 2I4RA 2XUQA 4A63A 2NM0A 4RGNC 2WXFA 1JL3A 5D01A 4MJIA 4TNVK 3CZRA 4MVJD 3Q3HA 4LCCB 2AK4D 3BEWB 1W8DA 4HUMB 3MSCA 3IDXL 3TSYA 1U2GC 2WABA 5I01A 3DOSB 2X1PA 4FI3F 1TO5A 4OJYA 1CTQA 4QOHA 4CMIB 4D3SA 2JZNA 1NUTA 5TDOA 2NSXA 3LOWA 1RD6A 4BMOB 3MTBA 3FI0A 1TZMA 1XTIA 2HTKC 2OMWB 4UC0A 4TROA 2XV2A 1PR3A 2J21A 4XP4H 1LBHA 1MD9A 4WFHD 4BV9A 2PZLA 1Z5OA 1YG9A 2MDTA 3JTSB 2VJLA 5TPWA 1DZIA 2XXBA 5JXEA 1FZKA 5ALSA 1W48A 1MU0A 2CFRA 3GPLA 3WNMA 1CS0A 2XQFA 5DWQA 4MAAA 3WADA 1H6TA 4JZJA 1GU7A 4FA8A 2AQ8A 2IH2A 5E08H 2YXWA 2ZUTA 4JNKA 3FKQA 3I02B 3VVBA 4DLUA 3ZTJG 4H44C 1ZWIB 1Q7CA 4Q01A 1CDBA 5FA3A 1NV9A 5B5SA 2JSFA 3HG3A 3L13A 5EF3A 1BW9A 3GJFB 2Y1CA 2EKSA 2W2NA 2PVSA 5B57C 5IJ9B 4UDOA 3BIKA 1X9GA 4DZTA 2PBLA 2VLRE 1AO7B 5I16B 9ABPA 3D64A 3OH8A 2A74C 5HJDA 1I7UB 2ZZMA 4FFBB 3SDXA 1FFCA 5DP2A 2GCYA 3MJTA 4N8UA 4AKOA 1BYOA 4R8LA 3V6BR 5C0IA 4H8HA 3KR3H 1MIOB 5DYFA 4UMEA 3P9PA 4DG8A 2V17H 1CJSA 3RUHA 3SCMB 5AHRA 5BVHA 3KXIA 2DQHH 2WM8A 3KLHD 5DHRA 2JK1A 3POHA 5AI9A 1KH2A 3EMKA 3JAKB 1CVRA 4CC4C 5EAIA 4PSDA 2B16A 3AXHA 3QVMA 4E2XA 1VDGA 2H8GA 4MA1B 2FG7C 3OC5A 1ADBA 4KVZA 3UT5A 4M1DL 2F1BA 4PLYA 4NHUB 4ZO9A 1UEYA 1MHHB 1CFZA 4H1VA 4G1MA 1FJHA 2ZOUA 4IRSA 1XH0A 4PAOA 4YP7A 1D4OA 3WDIA 1VFAA 1UBNA 1RACA 5I1JL 4OI8A 2FZEA 2JKLA 1XF5A 3HZYA 3CCFA 4BX2A 1GRQA 5KB3A 1P2CA 3FRJA 4D1YA 3QG7H 1EXDA 2XNAA 4JUTA 1R24A 3EOYG 3FOMA 5HRCA 2V8LA 3G2PA 4L3EB 5HI5D 3ATFA 4GS7C 3R23A 3OB0K 3MI6A 4EG1A 3ZWAA 2R56L 5C7LO 1HFWA 3P9SA 1I0LA 1FTSA 3CUUA 2AG8A 3K92A 5CVVA 4M5YH 2HA4A 4NNXB 2RAUA 4K8RL 2W48A 2D5BA 1AQLA 4ZICA 2FTAA 2OSLB 2PMBA 3IQGX 3I62A 3CWZA 5FO8A 2X4IA 1PNQA 4WRRA 4POAA 1V16A 3T95A 4ZI5A 2R11A 1NAHA 4M29A 2JH2A 3MV7D 1ISGA 4UVDA 3RWMB 4YRKA 1OH6A 4HS8L 3QJHB 3SC3A 5LP6B 2JI4A 5C0BD 4P34A 5IM4A 1A6VH 4ZT2A 3S3BB 4X4MA 4X8HA 2C98A 2OECA 3HPRA 5LXGL 2X76A 2XGGA 2OV0A 1I8UA 1Y6RA 4CFYA 4Q7MB 1AURA 3H5RA 1FMTA 2A6DA 4JDUA 4GKNA 4A7PA 3B3JA 4EIGB 5A3VA 3VRHA 4DLRA 5DDIP 4E1BA 2FLMA 4MEAA 2XMGA 3RVUD 2QS9A 3C9NA 3WFCH 2WHXA 3G7TA 1FQWA 4IKOA 4C0HA 5F7LB 3B9RA 1OAQL 1XZJA 3RC3A 3AXTA 4J3BA 1XGQA 4GFDA 1XZBA 1JKFA 3UTTE 5DNAA 3V8QA 3QEQB 4QIRA 3QELB 2NTSP 4LYJA 5CA1F 3BPNC 3ENEA 3VX1A 1K06A 1EHKB 1E4YA 4KLCA 5BSWA 3OG4B 2GYYA 1DQMH 4DN3L 4QHYA 4KJWC 4YXHH 5CR8A 3V7NA 2YD2A 4BB6A 3C2QA 1LDPH 1AKWA 4HT1H 4MS8D 3ZV5A 3OOSA 1XD2A 2PRJA 2WVJA 1TKWB 5HI3C 4NE9A 5EHFA 4D3DA 1CZ8L 1NQOA 5FGBC 1YPZF 1ONQA 2AX3A 1LK5A 1RUKH 3SY0B 4MDRA 3DAOA 2XQKA 1L5NA 1DL5A 3VC2A 2HBQA 2CJFA 5DRTA 1KGCD 4RHYA 1Z9SA 1DFIA 5JNUA 4OD2A 2R00C 4BZ2L 2FWLB 2IXAA 4F1JA 3QUSA 1W72H 3ZJ4A 1XMOB 4BSJA 4OAQA 4B43A 1A7KA 3R0JA 5ES4B 1CIVA 4JFFA 1TRKA 1NCAL 4EKEA 1KQOA 2JFNA 2ONYA 5JS2A 3JTBA 2WYTA 1M1UA 4WOJA 3HEIB 3GVPA 3QSKB 4YRBA 3WR5A 4X44A 4BHUA 2VHXA 3HUDA 3B89A 1XL4A 4ZX6A 5A6SB 3MBED 1U3WA 1FSFA 3H4IA 2REOA 2E2WA 4LHEA 4YJ3A 4RJTA 3FUJA 1FZKB 1DUZB 1ZR4A 4BZQA 2PUFA 1TI7A 2G28A 1A50B 1Z0UA 2O6EA 3D4LA 1ZA1A 1PKQE 1CR4A 2C5EA 5JT1A 1KEKA 1X2BA 4AC9A 4MDIA 1C4OA 4K0RA 2WSMA 1JUFA 2VYVA 5F2OA 3V1YA 2KS0A 1HPLA 4YCMA 2UZ4A 4UOW0 4PJCF 2IHJA 1P7QD 3DPBB 2PUJA 1JEDA 1T0MA 3H1FA 4LCUB 1E9EA 2NU7A 4QXPA 1IX2A 3HCWA 2W4QA 3BIFA 3KT3A 4F21A 4BVGA 1YWGO 1HQ4A 3VPAA 3PIQB 2IIVA 1G3RA 2RJ3A 3AUFA 1MC1A 2FNBA 2UY6B 4QOJA 3EA4A 2FGWL 3D5EA 4H8PA 2BSEA 1T66D 2AZ4A 3SKUD 1MZPA 1LV8A 3ADOA 4JEUA 1VE6A 1APBA 2LE9A 3OHMA 4UXHA 5U9CA 4M62H 1WJ3A 3CX5J 2YXFA 1ZRMA 3K09C 1J9CT 4UVEA 5AM4A 3N8IA 4KVCL 1A1SA 4XPZA 2G5BA 3UTTA 1QTNA 3OKWA 4GUDA 4FI3C 4Z3FA 4M3HA 3EXG1 5BNFA 2VQSA 1IATA 3PWSA 1N78A 2C1PA 3PJFA 4WZBA 5ITBH 3O9VA 5CB6A 3ODGA 2OP4H 4G1MB 2Q76A 1XX6A 1JHDA 4QHKJ 4O2LA 2XQJA 2WKGA 1G7RA 2EX0A 1UKBA 1R46A 2GZMA 3NXKA 4Y0NA 3IDJB 1BXZA 4MB2A 2O6CA 2EE9A 4I2NA 3UW1A 2WU3A 2GUWA 4PJXE 4G8EB 1AN0A 5EMLA 2MOGA 5DD6A 1F2VA 2WDPA 4ZXBA 4KPUA 5JCXA 4ZJYA 2J9FA 4QJ5B 1FFXB 2ZTSA 4EZBA 4L74A 1M42A 2B4AA 1XH3A 1CRZA 4Y1EA 2CGRH 2CGEA 2F17A 4X9GA 5FYKL 4IIDA 3QNXA 1Z5UA 1XA4A 4J7CA 2IBTA 3JSSA 3P5BA 2RIPA 4FQ1L 3LO8A 1BQHB 4QC2A 3LA8A 4ODBD 4RAUA 1XXLA 3A1CA 3RU9A 3STYA 5BV2P 2CNLA 1V6AA 1YGYA 4AJPA 4V1CI 4C76A 2MPAL 5AUMB 2PUGA 2RD2A 4JAMA 3ZHLA 3STLB 4AWXA 4QRPE 1EDHA 1WRFA 2ATKB 4Q4JA 3QGVA 4XRCB 4J1NA 5FAKA 3QY9A 1K4YA 1BFTA 4IDHA 1NGWA 3FT4B 3HMQA 1CJCA 3O38A 4OATA 2IAMC 3OSKA 4AXXA 1A3ZA 1ZS8B 1KQ3A 3Q8BA 4BN0A 2GZRA 5AWFC 2BNUB 3OMIB 3GO1L 4LB8A 4TNFA 1CWVA 3KPLA 3AHDA 3JRXA 4Z49A 1QFPA 4PZDA 4NKDA 3DE2X 4YWHA 3RPEA 1HCYA 3L1OL 5K3DA 3VH2A 3BMNA 3QPQC 1V3JA 1H2EA 4L07A 1I4EB 1FW6A 2C4XA 2BHSA 1DQDH 1OGYA 1C3XA 3REWA 4RTMA 5IR1A 5T4BA 4BP8A 1P61B 4JRLA 1P17A 1KH3A 1DJYA 4C4KO 3KEOA 4KOEC 4IBLT 2NY7H 1YSCA 3FB1A 1RLMA 1VGVA 2ZATA 3WJ2A 3B3AA 1Q12A 2YYAA 2C31A 3VB8A 5E9QA 2B7LA 3MYJA 3K5RA 1ZKMA 4JKMA 1GRRA 1QTRA 2XXJA 1E2WA 3STLA 1NC2D 3SPHA 1CQYA 3C5JB 3WIHL 5JNTA 4GRWH 3HB5X 4YB8A 3DI2B 2BVTA 1U8MB 2GARA 3T1HB 3UHOA 1ORIA 3KQOA 1TYBE 2Z31B 2ORBL 4IRSD 1A6TB 5MEOA 4ZHSA 2CLRB 3U36A 5LGJB 3HNSH 4RKQA 3HV0A 3JYNA 3TV3L 1GW6A 2X7XA 1WIOA 4JO2L 1SEQH 4OLZL 5AVQA 4ZEOA 3E3LA 4Q9NA 1PZSA 4RBPH 1PP4A 3ZO0A 3BMOB 1JA1A 3LT5A 2V9CA 3IDUA 3CDCA 2JJ2A 3GWGA 3AVQA 3TT3L 5IR1B 4FZ3A 4IOIA 4DCMA 1E8NA 3N3EA 5ACLA 5CYPA 1B26A 3VGJA 4OTXH 1KZ9A 4M7LL 3N2YA 3OZDA 5EZJB 1QM5A 1K4DB 3GQFA 1QO3B 4B0PA 1ZESA 3ZS8A 4WV1C 5H8DA 4F8LA 3OXRB 1LJUA 4GUCA 1RMFL 5TV2A 1WVMA 3E22B 5AXAA 1TCVA 2FPRA 3IKMB 1Z88A 2I25N 3WK9A 1YA4A 2R1YA 5TH2A 1KPIA 1J2TA 1S1MA 1AD0A 2XXCB 3NDRA 4CSPA 4TT3A 1EVEA 4ND6A 5FBQB 2FI1A 1QLJA 1UWVA 3BPLB 1Z82A 4MGYR 3RTQA 3KQKA 3BBPA 3UC0H 1YQ2A 1JGVL 1QHOA 4Y5YC 3TN0C 1T9AA 1O95C 4DTGL 1D2NA 2Z2XA 3V4PL 4MARA 4UAGA 1BZEA 5BN3B 1U8YA 3OOYA 2P11A 2X5XA 4D96A 2BVQA 4WZAE 3P4LA 4QYOA 4F8NA 3ZZMA 1DQQA 3JYLA 1JDUA 1D7AA 3HWSA 3WGMA 4V2IA 3DX2A 2O57A 4XVRA 5EORL 2AVDA 2WYOA 5DNYB 1E2DA 5DHEA 3GI9L 2Q9AA 3GF8A 1CPUA 4MA3A 1PG5A 5GRJH 3VFOA 3MTXA 4PV8B 1RFDL 5THKA 4JA2A 1PW7A 5K8CA 5JW4R 4HSQA 3GR6A 4YAEA 5GM2A 3U82B 2H9AA 1XI2A 3ZWYA 1CZLA 3B1JA 3LPLA 4H25B 4IVQA 4EKDA 3CMCO 2QZJA 4BK5C 5DULA 5IHPA 1WVZA 3V80A 1ZVSA 3TBYA 2VJNA 4KO9A 3ZDQA 3T1QA 4QYSA 3NHMA 4M4RB 1RAIA 4ZDKA 2XOTA 2X3BA 4GG6E 2HRPL 1XLVA 1D7DA 1EJFA 4M56A 2PLWA 4NAMA 5CP7B 1QFXA 4FRWA 4HUNB 3ZY2A 2VN5A 3CEHA 2YWEA 3L7YA 5JIMA 1OGAA 1P45A 3U7WL 4N7JA 4A6DA 4IIHA 2PWHA 3PDOB 1KSGA 12E8L 3LU1A 4LEBA 4X8MA 1ESMA 4AKQA 5L3VA 4N2MA 1LI5A 3TJZA 3QFTA 2E87A 1NW5A 4EUEA 5A4DA 2G1PA 3AGQA 1Q50A 2NRDA 3I50H 2O5XH 4TTJA 4GUAA 3V0GA 4G5HA 1WABA 2Y9MB 2A6IB 3PXLA 2B82A 3FF1A 2PGXA 4CMHC 1E9RA 1T1WB 2YPLB 3W8EA 1BX3A 3DTXB 3HC2A 4N2IA 3N0XA 1YEGH 2FN9A 2O8BB 3A9RA 2YMQA 2ZLBA 4UCXA 4D26A 1QSFB 5KMGB 1RWBA 5KNBH 1IC0A 2X9GA 2OGSA 4Y4FA 4U6HA 1GARA 2WV9A 5HHMB 4CNIA 1B90A 1M0SA 2VNKA 3TO4C 5ADUS 2ASVA 3MUY1 3A04A 1PAUA 3L8MA 2WHEA 4K3UA 4LYFA 5GADl 3ARFC 2IP4A 2LTAA 2UX7A 2UUPA 3WKMH 2VXBA 4DMMA 1WY7A 3A26A 3HUJF 1Z36A 3W9SA 4IOSA 2D1FA 5DVPA 2EJWA 4QAQA 2PSFA 4XMPH 1M0WA 1MW3A 3DX9A 4GC9A 4P99A 3DECA 4GO1A 3JVFC 4MCZB 2RJOA 1O8CA 3RZCC 2IADA 1NDGB 3PYCA 2G4EA 3LD8B 3E7DA 4D98A 3Q1SH 3VR1A 3VFNA 1RZUA 3E1F1 4I85A 4B3RB 1PDWA 1NP7A 5ERXA 5DK6A 2VSMB 1QMGA 3FJTA 1SOKA 2QORA 3BUYA 4GVLA 3OZCA 1POXA 1PJQA 1MCZA 2GN8A 3F7TA 3N1GC 5J5VA 1HDIA 2R2HA 1C80A 3DEJA 5K8TA 4YHIA 1MFZA 3OL2A 3EJ6A 1KDPA 3H16A 4QL3A 5LM3A 1A8SA 1QMUA 2ZYSA 2D31B 1TW2A 1H15A 4JDZB 5BXFA 4QKQA 5FPHA 1WG3A 2O1AA 4KRNA 3OZAA 3D4GA 1FL9A 1ZLUH 3GJEB 3N04A 2P62A 2ROYA 1KEWA 3NORA 43C9A 3O83A 4ZIRA 3RRQA 4TPRL 2QQLL 4F2FA 1MPAH 4MYSA 2NR6C 1IEVA 2IEDA 4A0FA 3E5MA 1GZPB 2PA3A 1DTSA 3QUYC 5GPBA 3P2OA 3NVKI 1X3DA 4C7XA 5LGHL 2UAGA 3PJGA 4XJSA 5L2KE 2YPKB 4QWWD 3VG9C 5AIBA 1YYLL 3GB9A 2ZSVA 5IBUB 4E08A 1G5HA 3ETHA 3FFBA 4K26A 1SYSB 3LJ3A 2ZIXB 5JQWA 1LDPL 3KTAB 3G8DA 3FTNA 1MHPA 2UZ0A 4EHFA 1NYTA 5JI2E 3RYHA 1SEBA 4TYUA 2ZJOA 2X8JB 4JQSA 5HHXL 4KK6C 1ZLXA 4L8DA 2ROXA 1A71A 3MRPA 4W5QA 4D3CH 2ORVA 5AKZA 3DB1A 1P53A 4JFDB 3H6AA 3QW2A 1NMBH 1XKQA 4Y2XA 1DQYA 2ZK7A 5IQMA 2PW2B 2Q7DA 1JPFA 3W2EA 1T8TA 1PZBA 1G2QA 4QRDA 4I50A 1VE5A 3VTTA 3B2PA 3BK7A 1AP2B 4CTKA 1AQDB 3QA3E 4OFDA 3JCZA 4RMUA 4L05A 1HHHB 1JPGA 4TSBH 3NBFA 1T03H 4XCCH 3MGGA 2G2NA 3C6LD 4LGCA 5A71A 3V42A 4WFKA 1P4AA 2QX8A 3IE1A 1UEMA 1GEEA 5GY7A 4PJHE 1ANKA 3PX7A 3SIKA 5EOCL 5BQ3A 4U1NA 1R5IA 3EZGA 2VDNH 3GZNB 3L9EA 4IBVA 1HE2A 5SWQA 2O8DB 1Q91A 3T4PA 3TGLA 2PO6D 3SYMA 4J7AA 1Y8CA 5EOTA 3GS7A 2A3NA 4JZOB 1RAHA 1ZJZA 2ZI4A 2GOYA 2PXXA 3U4GA 5E9JA 1IGIL 2OZPA 1T0BA 2AHRA 3GJ8A 2B8JA 1O9HA 3H6HA 3ZU4A 3ZDFA 2PR4L 4GI9A 2B94A 3R6DA 1FNLA 4PRHA 3DC0A 3V79C 3P4OA 4P23B 3UTPE 2XETA 1XTUA 4LLWA 3VXRB 1VHQA 2Z31D 1M75A 4RDIA 2F1JA 2AJ3A 1MFDH 2X6UA 4LPCA 5JVDB 5FOUA 3AHEA 2V4LA 3L8HA 2C61A 4JM0A 1E96A 3TFWA 4A82A 4DJAA 3X13B 1WL8A 1SXJD 3O8XA 4WXYB 5I6XB 4XGNA 1RVFH 1R5OA 1JL8A 1Z83A 5DHXB 4EJMA 1MJGM 4FC7A 2FQDA 3CONA 1IQWH 4AITA 3D0LA 1FDTA 1R5VA 5JS8A 1YYML 4B3DA 5K0TA 1A4JB 3GW8A 5E3IA 3KWLA 1BPLB 4NNPL 2CCLA 5C09D 1JXAA 2DFPA 2AFIB 1CY4A 3UUGA 4CTJA 2A1WL 3SF8B 2ZYWX 2GCYB 1W5SA 3K46A 4HPOL 1ZHKA 5BSFA 2WVHA 3RSZA 1W85B 3WGVB 2W5PA 1JILA 2H8PB 1DJMA 1L7TL 3ANSA 2UVPA 3IH5A 4DTIA 4E15A 5EJMA 4WNIA 2ADJB 3VNAA 4OHXA 4JD5A 2GFQA 5ITFA 4L0YA 1GRVA 3E8XA 4BLSA 3CE9A 3LPNA 1ONBA 3NUGA 3G9QA 4WKGA 3P7MA 4PJHA 5BMFH 4N7RA 3LOQA 1C30A 5HF6A 2G75B 2A9PA 3CZSA 4P2QA 2VXSL 3D9AL 4BVHA 4MJIE 1F97A 5D70L 2J12B 1GA1A 4TL5A 4JZJB 4D8UA 3QORA 3WS3B 1ZBDA 3A2MA 2GUYA 3HZVA 1EEXB 2NZXA 3ZCQA 1UR5A 4GBXC 4XN8A 2CJUL 3H9UA 5I5EA 1DAOA 3HZRA 2WXKA 4JPIB 1BCSA 1U7TA 4NN7B 2HJKB 5IM7A 3CNKA 5EA0H 4PYIA 4MW9A 5BPHA 4N8CL 2PH7A 3MRFA 5DHVA 2DT8A 2FZ3A 5DNDA 4WVLA 5CCKH 2AHIA 1CR0A 1SU8A 1CDDA 1NSFA 1SBHA 2QPTA 4YAQB 1GL7A 3P96A 4HF5H 1ZGLA 2C3MA 4GUPB 5LZ5A 2CO6B 1Y82A 1G9NC 1QS0B 1H8NA 4KKAD 3K1JA 1KJ2B 2JH3A 2EV9A 3OQIB 4EAQA 4QNMA 4RELA 1NBME 4BRUA 5D1NA 4NMHA 3R0ZA 3QK0A 4R6XA 4NSNA 1MV8A 2VDMH 2NPFA 3CN0A 3ZTTA 1MIEH 4QRFA 1XLTA 2YYZA 4ABQA 3T0FA 4P22A 3EB9A 1BEYL 4YAWA 3V34A 1KWKA 2R4RH 2X2FA 4RKFA 1A76A 1TM2A 4FFWC 1IV8A 5HZMA 4I6JA 5ICCA 3IEPA 1SZPA 4LLUA 1TO6A 3HUJB 3O82A 3UUFA 2A84A 3BSZL 2HU8A 2VRWA 3ZCUA 2OMUB 5C9ZA 4ZOEA 3NT4A 5EIFA 2PM8A 4BFTA 2RCSL 2ZBFA 3QBTB 2FZ3B 4WEOA 4EA9A 1TPXC 2ZUXA 2DLGA 1ILSA 1JG4A 4C83A 1UCFA 4K8RD 2WWTA 5HYJA 3V5DB 2Z1DA 9MHTA 4R3NA 4D42A 5HGBB 2H1OA 3HVIA 2FRDC 1DL7L 4HEMA 2MWMA 4CGTA 1G3IA 2V03A 5AW1B 1IOLA 3NCFB 3BPNB 5EEVA 2O6LA 3IDYB 3AQDA 1F41A 4LGPB 4MGKR 2IBZX 4LJYA 3T1VA 1YIAA 1VPOL 3PQDA 3K0BA 1OROA 4ZD3L 2X5JO 2WTAA 1HEZA 1JI1A 1A4KB 1XSIA 4QKTA 4QO1A 4NQSA 5JHLL 2EDBA 3HNVL 5JTTA 3C8ZA 4CODB 4IHJF 4F7PA 3D6UA 4F38A 4NZPA 2GJ8A 4BV3A 2EXSA 4U1HA 3O3DA 4I0PC 2WXOA 5C2BH 2YS6A 1CUUA 3LFUA 3PC8C 2R2EB 4ER6A 3ZWNA 5I7OA 2PTTA 1WEJH 1XSEA 4TMVA 4LP8A 5BQ5A 1GGEA 1QI3A 3RHTA 2XT1B 4L4YA 2R00A 2E4YA 3PF2A 4MVJE 4H20L 3TVMC 1PKQB 4CQMA 4KXZH 3JQFA 2HYIC 3I9NA 2DEUA 3D8MA 2FPKA 4CIWA 4S1SH 2CNBA 1LJMA 2KBGA 3VXME 3VFSB 1F12A 1A4UA 4O08A 4OQPA 1MHEA 4G85A 2QRVB 1NU6A 5E2BA 4QR7A 1UJ5A 2ZRKA 1FYDA 3HNOA 4WK6A 2F5BL 4PN6A 1MCEA 5DNVA 5JW4N 1YKSA 4KYUA 4AWAA 2VLRB 2OKCA 5C3IA 3H1PA 4KR0A 4Q1EA 2BLLA 2Q3EA 1NVBA 4XHQA 3PP4L 3IU4L 3W2IA 4CCYA 5AOKA 2IXEA 1G5TA 1GZQA 3AWDA 5GJBA 1F14A 3WFBL 1A9XA 3WGLA 3P9LB 1A9YA 4IDAA 4FMCF 2YARA 3DX7A 5D8JH 2JK0A 1HYSD 3L49A 1ISJA 4L4XA 4TT8A 3NRBA 5C09B 1G1MA 1MHCB 1CE8A 4IS6B 1GAWA 2PPFA 3AS3A 4AY0A 4TTAA 1WV7T 1XXHA 1P2TA 1WEJL 1LI7A 4MRMB 3VD3A 3K6KA 2FEEI 3S7ZA 3DJ9A 4HC1A 4OVKA 3E38A 1OZHA 3PJSB 4Y5XC 4J3NA 4CVXB 4PBXA 4W9JC 4Z77B 1O54A 1VZ3A 3JR7A 5DEFB 4OMDA 3HCAA 2PNJA 2G60H 4YHZL 5BV7A 4PJ6A 4CMEC 2OHIA 3CO0S 1YN7B 5TB5A 1NBVL 3UJTH 3X3FH 4PLJC 5AHWA 1LMIA 2W60B 3CH4B 4LJ6A 4MKTA 3MC1A 5JVDF 4F3FA 4GAJH 3HXTA 4G9FA 1ZUWA 1OBHA 2PCXA 1EZSA 1S3RA 1DAMA 3QK7A 3MUNA 3EZ7A 1XTQA 3EZYA 1G0XA 2QR3A 4PX3A 4OGGA 4MQ5A 3B2DC 3QMWA 4ETQB 2VUOA 4PX9A 5EP3A 1M53A 2G5CA 4KXWA 1I9RH 1S2IA 2IV9A 1PWZA 4AT6A 2E47A 3KKPA 3MJDA 1KB3A 4DLWA 2WF7A 3VHLB 1LJLA 3LW8A 3MRVA 4XCNA 5E51A 1NWCA 2GJRA 3QAZC 4QAWA 3EDCA 3E8UH 2IXFA 2ZYUX 3QT2A 3VR2D 4ZD3H 1GGIH 1S9WA 3O4OB 4H60A 1AC6A 2VTBB 1ORVA 4FYHA 5L6YL 2Y1AA 4YBQC 1HYQA 2G6BA 3CH5A 2CB0A 4IHKA 2A57A 5IQ9B 3GJFH 4UARA 3EVEA 3P45A 2F08A 3VTKA 5DHUA 2P9FA 1QUEA 2PWAA 3B7RL 1U4EA 3E23A 3VUEA 1LE9A 3W5BA 2Y5TB 2C7PA 1NTRA 2ZR9A 2G6TA 5EH1A 2L42A 5I8WA 3ME5A 3VYWA 3M1OA 5I45A 2P3QA 3U83A 4FK8A 4RZKA 3VD2A 4N5LA 5JC8A 3ZLJA 5FAAA 2C3WA 3OZ9H 3GZPA 5C0OE 3K4PA 2XQ0A 2BRRL 1QRKA 4TS9A 5EA0L 4TVPH 3O90A 4BKLB 1OZ0A 2O5EA 4YXKL 3HQ4O 2VDPL 2NADA 5K1ZA 1YCHA 4MHSA 5F52A 1B2LA 1WUYA 4AKGA 4ZFZB 3DYMA 4MRCA 3HCPA 3KJIA 1VCBC 1ET7A 1D2HA 1QZXA 3P20A 1TCAA 4JL6A 4PBWD 1AH2A 1Q20A 3ILQD 3KXFE 1I1CA 1KO5A 3WQQA 3DDHA 4KNSA 4OTZA 4I1YA 5CA0A 2OCAA 3B53X 3MXTA 1HNYA 1IC1A 2WTPA 4MUFA 2NPOA 3UGJA 4NH4A 1YDEA 4U7MA 3PNKA 5FGCB 4J3VA 4BRZA 2HLAA 3QWBA 1V7ZA 1MJ8H 4PD4J 4OJMX 2JCYA 3MXVH 4WU7B 5JZ7C 4OLUH 2A1WH 1T7ZA 3LPAA 4IYRA 3VSAA 4GO8A 3O2SB 1VG9B 2EDCA 2XVGA 3Q3GB 3QEKA 5EPEA 2B92A 4XWGH 3BL6A 1J1OH 4ZAKD 5IXSA 3NMEA 4GLBA 3IJHA 2D13A 3M6DA 5DFVC 4F33A 2W0KA 3DVGB 4KQHA 2H3KA 2R8SH 3RKDD 4DDWA 1E77A 1S4QA 4GUPA 4G0QA 3I2KA 3R5KA 3GEWB 4W5NA 3QMPA 3O6KL 5C1OA 2NAFA 2H63A 1NE2A 2WA2A 1FVHA 2TMDA 4H8QA 1I9GA 5F7DA 1CQKA 3PKJA 2W71A 3II1A 4LK4A 3SKYA 3CFYA 3EFFA 5A7EA 4KO5A 4FMPA 3RWEA 4D57A 2OXHB 1E4EA 3ENWA 3N28A 2A73B 1XHEA 1H0DA 2BMEA 3RVRA 3CDGA 1K86A 1OM3H 3RHWF 4I8IA 3IN0A 1I9IL 1IGIH 3VFUB 3LKNB 4OU4A 3A6LA 3VNQA 3IE0A 2BONA 3BCHA 1F0LA 4OHCA 1FG2B 3BPLC 3FCOA 2BDNL 2K8MA 4K9OA 3VHRA 2CA3A 3VAAA 4LECA 2XPCA 3TDKA 3T15A 3QI7A 3MFYA 3CH7A 3TAXA 5CA0F 3I9FA 3LXUX 3C5VA 2O2SA 2NZ1A 3I37X 2W6OA 4PRHE 1JPSH 2PCFB 4CM7A 2HCZX 2W2LA 1OB1B 3RS4A 1EQWA 1T03L 1VYTA 3I9OA 4ESVA 2JFHA 4OZGB 4A5SA 3L7FA 3FYEB 2H31A 4PFSA 2M2IA 4JRYB 3Q7RA 2ZD0A 3C4VA 1TITA 5AJWA 2JE8A 3WVNA 1T8WA 4RLDA 1Y4SA 4FIDA 1BW9B 1CUCA 2AEEA 3HG1E 3DNMA 3ANNA 4Q7DA 5AJTA 5ADOH 1UF9A 1AB6A 1KYVA 3HNPA 1NKGA 4LZZA 3JVGA 1H4TA 1XTVA 5I5MA 1SG6A 2I03A 2OCFD 2ZF8A 2HMSA 1JEEA 1F2UA 5L7YA 3TBWB 5HBBA 1D04A 3ZCXA 1F11A 5EULV 5E6IA 1YPZE 3HSSA 1WCV1 2NGRA 4TVKA 3R1GH 1W1UA 1EO8L 5JPDA 4M8KA 4FNTA 3NT5A 2G2PA 4CEJB 1ASOA 2ZJ4A 1BVUA 3D0QA 1ZT7B 1BBDL 3KKLA 4LWZA 4UOZA 4CUJA 5IAJA 2E75C 1KJNA 4BRJA 4J94A 1RPTA 3QZPA 4D8VA 4ZK8A 4OKVB 3O3NB 4DDKA 1FDWA 1NONA 2ZNWA 4A2CA 3CVHA 4CNQA 1RIFA 3KOZA 2EIDA 3PK0A 1SLUA 4KQ2A 1NURA 2XA2A 3C6BA 3SEAA 1J12A 4X95A 2H1LM 1JHTA 1TJMA 2IEGA 3APDA 4GYKA 1D5RA 2E18A 4ASUD 4YSUA 1Y7LA 1PFYA 2AEQH 2TYSB 3T99A 4UT6L 1G1OA 3PWJA 4N12A 4J4PC 2DMCA 3ILPA 4PLNC 3ZXIA 3BWCA 3TMAA 3RKSA 1L4IA 2B9AA 4B9AA 5FUMA 4D99A 3MO1A 3I76A 1Y8RA 3OTGA 2VLLA 4XI9A 3LKSB 5D7LA 5JPMA 2H1SA 3CFJB 2HCFA 5TGBB 3L7LA 2ODNA 3WMRA 3BKYL 5EIXA 2VHUA 3PIIA 1WS7A 4GXFA 1FVCB 4D81A 3OKLB 2PR2A 4KO6A 3SX4A 3IBSA 1ADFA 3T5BA 4BKQA 3WOHA 3FQ2A 2AS5M 1QH9A 1R10A 1HILA 3DRTA 3CFCH 3HBQA 2OPBA 1XCXA 3A1VA 1UCBH 2J4CA 5EC1A 1X8XA 2ARKA 5D1XD 3UMRA 4PCTA 3RRNA 1AU9A 3EUWA 5J13C 3GHHA 2DH2A 1L4GA 3AEUB 3D7SA 4F3KA 5D4HA 2NNWB 2H1IA 3F71A 2P30A 3QDGA 1W1IA 5JPMB 1RWMA 4DUGA 1P2DA 2A4MA 5KVGE 1SBIA 1LBSA 5AR1A 3K70D 2JC3A 1L5QA 1LPAB 3IETB 2G88A 1P1IA 4OLWL 2BP7B 3P32A 1A8ZA 4JQVA 2JLBA 1LLCA 1JBKA 4K2HA 3H54A 4EUNA 3RRJA 3ETTA 4C4TA 1MH5B 4RVUA 3WTBA 4M9SA 3W3AA 1M74A 3I9KA 3ZBMA 3I9JA 3DHJA 5DJYB 3ARWA 3D69B 1PNTA 4AUEA 2BI8A 4O63O 3CS3A 3UFXB 4APXB 2AQHA 3UPUA 4UT7H 1T43A 2B14A 3A7EA 1HK6A 1GCAA 3BH6A 3SAJA 3QUXD 4B41A 1B0UA 2H1LA 2I5YL 2UXCB 3FUCA 3S37X 4DC0A 4JFHE 4Y2LA 3FCBA 3HUFA 3OFSA 4YRJA 4KY1H 1P29A 1SULA 3ZJVA 1ZN9A 5K51A 3L92A 5EBWA 1ECJA 1IVYA 2Q7YB 1NG1A 4KX9A 3FF4A 1E3QA 3ARGD 5BOJA 1HUQA 2C96A 2VPQA 3JR3A 1LO3L 3M8OH 3IJPA 2P4SA 4G3XA 3P54A 4BLRA 4FNUA 1BFOB 3EJPA 2GD6A 3OQHA 5P8WA 1RHMA 1KTKE 1A02N 4ZO4A 1YMMB 1YNOA 2ERCA 4E5PA 5I6MA 1U3CA 1H9BA 3IGLA 5AFSA 2FUQA 1IGMH 2A9VA 2IFGA 5AUOB 3VW3L 2QW0X 1KBOA 2HWZL 3PRYA 1CRLA 4PY2A 3ZD6A 4LA4A 4Q3AA 4PLWA 3QFCA 4JLUA 2P9RA 3IFOA 1FFDA 3FFWA 3MLSL 3KOWA 5FYQA 3UO1L 4WTQA 3R3JA 4X85A 4MJ3A 2BFOA 2QTLA 4JVWA 3QUZC 4QXTB 4QO7A 3I1JA 1EDBA 1RJ9B 2GZ2A 4MV0A 4ARAA 3RGVB 5ES3A 4WNQA 1O96B 4KOCA 1QIMA 4YJDA 5EJ7A 1HESA 1AMUA 4Y0VA 4W1SA 1OCOB 3LM8A 3NIGE 5FKAB 1Q8MA 2CD9A 4NNPH 1TETL 5H37G 4BQFA 1JBJA 3L6BA 3GUTA 4P04A 3FSOA 4HU2A 3LZFL 3EZ6A 3EVCA 1OGPA 3CBJB 4TSCH 1RFDH 1DAFA 3JX9A 1UWYA 1QHXA 3MA9L 4I8DA 1R0ZA 3JYQA 1L7BA 2XMPA 4HNAB 1BX2A 4LMQE 2C9ZA 5DGIA 1UK7A 3UTSD 1RZ3A 3DPBA 5CN3A 4ZI7A 2Z9TA 2YJNA 4UQ2A 2OI9C 4RX1A 4KE7A 2GTHA 2J6EL 1RPKA 1W5BA 3F3MA 2WLTA 5IH3A 1LPNA 2QPAA 3WLPA 2MHCA 2NZJA 1VFMA 2QZ5A 4OTXL 3LC1O 5HXAA 4ZZ0A 1ET8A 3SJCA 1TZCA 3V4PH 1MJGA 5JXAL 3HG5A 1S3FA 1AY1H 3QQ9C 4WHYH 3IDYC 3GD5A 5EFOA 4TLEA 3EGWA 5TEVA 4BNDB 5D3ZA 4PBRA 2PRKA 1LVUA 1TLTA 1RKUA 3VO9A 5D4IA 1Q0ZA 5B30A 4EKIA 5HHOB 1K7YA 5GS0C 3ESAA 4AJ2A 3BO8A 4P2RE 3EWAA 1VF5C 2AW3A 4DCQB 1KI7A 2AJDA 1L3NA 2V6BA 4DZZA 1KIPA 3E4CA 5F7YC 5JUEH 1X1TA 3OKOB 2MYTA 4DLAA 1AFVH 3FA2A 1NUAA 1QRNE 4Y4HD 2V7VA 2HWWA 3RVDA 2FP4A 2GEVA 2OV4A 4FS0A 3GARA 4FOLA 3S70A 3REQA 5AH0A 4XB7A 1MDBA 2JVIA 3D4CA 5C0EB 4HNTA 1E5VA 3QXXA 3GLRA 1UJ4A 5KSZA 4GMSL 2HX7A 3OU7A 2KZ1B 1ACYL 4BZ1H 1NMSA 3EYOA 1EFDN 1S6NA 3PUXA 1UFVA 4WFGE 4YREA 1OC4A 4HYYA 1XLWA 4UHHA 1QVWA 5AHXA 4CKYA 3HN6A 1NCIA 1U99A 2DDQH 5LU8A 2A7QA 4EEXA 2VLJE 5E2JA 1YYLH 4MWEA 3GB7A 1QI4A 3DNFA 3LXAA 3QORB 3V7AE 2E4WA 1J0ZA 2H2HA 3GD7A 3EA0A 2WT8A 3H2HA 2Q3ZA 4JFUA 4AG6A 2GXSA 2HHCA 4A6PA 4D7PA 2AGJL 2WT4A 3VI3F 4HQKA 4J4PA 1GKKA 2AWOA 3D05A 5CNKA 4OREX 4ODTH 3HKFA 3GQBB 2NG1A 5CSGA 4KKZA 1PEYA 3P0GB 4CBZA 4LC1A 4N0PA 1G18A 2I4IA 2CV2A 1ZSNA 1PX4A 2VJXA 2G82A 1GHTA 1YMHA 3H42L 5TDHA 2D4FA 1L5WA 4F4HA 3R6TA 3PVCA 3ESVF 4MJ6A 2ALJA 2BD0A 2HOQA 1LO2L 1R3LB 1AZUA 1E5QA 1QHGA 4Q6BA 3WRYA 3DMRA 1U9YA 3SBXA 3PENA 3FB6A 3O5AA 1BAWA 4Y30A 2ZYTX 2XTZA 4AZUA 4XODA 1QPGA 3L3GA 3EIFA 3R7RA 1II9A 1ZM7A 4JPKH 2W0LA 3E9TA 2CN1A 2DYKA 1BM3H 15C8L 3NYRA 4ON9A 2MH4A 2L18A 1TMOA 4DV6B 4DCQA 3F6SA 4O58H 2Z3VA 4I9HA 1UWXK 3JZDA 1T9DA 3QIAA 2Q1YA 3LEXA 4JBWA 3DAFA 4YDJB 1REIA 1O94A 3P11L 3LY7A 1NKRA 2L04A 3OXSA 4WWNA 1DKRA 3QZWG 1MQ9A 4X99A 3UO1H 2H1CA 5I4BA 5HTKA 3HFFA 4NS4A 2FR8C 1DAHA 2WM0A 3OP1A 3GNMH 3ZXSA 2ZJFA 4FXGC 3CVHB 2CF5A 3HZMB 2Q2WA 3FLMA 5KJRL 2L8AA 6FABL 1SJEA 2JQAA 4DOHE 4GSKA 1RZKH 3FYSA 5I75B 4PIPA 4HV8B 2QTNA 1Y18B 4K9SA 1PFUA 4C6TA 2QSQA 3MRCA 3QPQD 1NGYA 3IJ9A 4X6BA 1M1YE 1K5NA 4R2MA 3NVMB 1UATA 1RM5A 1EPFA 4TXMA 3AAZA 2VAVA 2YWXA 5JAUA 3VC7A 2W2MA 1V1RB 5AXCA 4WHMA 2YD3A 4XX5A 4JXXA 4IBOA 1IY9A 1U1EA 2AFHE 5E6RA 4XIFA 2JKIS 1WCIB 4AP9A 3PGDB 4F9TA 4B87A 5DUMH 3T41A 3PC8A 4DIOA 3DFFA 1CR9L 2CHQA 4OFWA 5MHTA 5HY9B 1RJLB 1ZJWA 4ZCPA 4O2BF 4J0HA 4DBLC 2AVGA 1EXWA 4HWGA 3EBIA 1JNYA 3ZLQC 4ZX3A 3EQ6A 2D1YA 2R69A 3ADCA 1US8A 1MAML 3CNHA 1WBYB 3PLAE 2AJVL 1MAVA 2PE5A 4N68A 1QLHA 2ECKA 3WAKA 4QRAA 1H22A 4EI6B 2CXGA 4R8WL 4UTPA 4L5FE 4RFEB 2HXAA 2LT9A 4L28A 4HK3J 4TTPA 4YSRA 5C8XA 3PFWO 4LQCA 4XI5C 2WD8A 5HJ5A 3I5YA 2W9XA 5E8PA 5IB2A 3KD4A 3IKKA 1P2CB 4FG4A 3MV8B 2AKAB 1KPVA 5DLPA 2V7EA 2JLVA 4OF3A 5HIIA 2J8UF 1JEQB 4UKDA 1JK8B 3FBQA 2XUJA 2BOCA 3DV4A 1D2CA 1S7WB 3LD9A 1HILB 3F5DA 4DP8X 2EQAA 1DRJA 5EJ8A 1YR6A 1UCBL 2QVYX 4X5XA 1NBCA 4IXNA 2HWXA 1NSNL 2PS3A 3OKKA 5JIPA 4UIKH 2VT3A 3MV7E 1K5PA 2Q8NA 3PFCA 1Y3HA 1A9BA 3PVZA 3CXHK 4HP5A 5HHOD 1RP7A 4BKMA 3AFMA 5ICYB 3EW9A 1HMPA 4FKKA 2XZAL 4I14A 3WWOA 2A1UA 4RFLA 4KE8A 4E9VA 4TOYH 2CIKB 3GBEA 3R18A 3UAOA 3CZKA 1NINA 4DRZA 3LIZL 1HHIB 1I9JL 3QE5A 2FMKA 1YRLA 1DTWA 4TLMB 1I1AC 4E12A 2EDYA 2GLUA 4OF4A 1CDIA 5GRUL 2C2MA 2WG0A 4XMWA 1R0CA 3D69A 4NRYB 2B8TA 2B78A 2ZWPA 4ONEA 5C32A 2WA1A 1U92A 2C4VA 2HU5A 4LOUD 2YD8A 4YV7A 1NCAH 1WH0A 1U3ZA 3ZIUA 3M6FA 1CUSA 3TE7A 5EG6C 4I89A 4GMSH 4MV4A 3SYAA 2Y6TE 2H07A 3CGWA 1YZTA 2R1YB 4BO4A 1OPGH 5IYZA 3UAGA 5B1DA 1M5TA 1VJ1A 4QBGB 4YMUA 5DHVH 1AZRA 3IEMA 3VHXA 4F3CA 2GPBA 5FWXA 2R51A 3OFKA 4X3CA 5LXTA 4GX0A 1SXSA 3S7GA 2DWCA 2OFOA 3HVDA 1GUDA 3CSGA 4DS3A 2B4YA 2W6JA 4Z0BH 2SKCA 4J90A 1GITA 1NRJB 4DSOA 4YAGA 3T0EE 1DQML 5FR3A 1UK6A 2PX0A 1FUIA 2NUTB 1L0QA 5FLVA 1MC8A 3T5PA 3T54A 1NLMA 3N75A 4WI0A 1P4GA 4MMZA 2O8NA 4LNRB 2EUZA 2V6JA 3WTSA 1JEJA 3Q9NA 1C14A 1HSZA 1C7FA 4MMZC 4TLCA 2JHGA 1Y48E 3QVGB 3HC0B 4PP2B 3G5XB 4GRDA 2AEWA 3CSUA 3AG4B 1ECLA 4LGYA 5J4HA 3OPYA 1E1RD 1IN6A 3CWQA 4E31A 1GVNB 2IIBA 3T1TA 5HY9A 2YBDA 5E99H 1I3LA 1P1BA 3LUBA 4FFWD 4TRNA 3FK3A 1UK8A 2E85A 2IHZA 2P5PA 1JDNA 2KDYA 2NSLA 2OQJA 1ZU5A 4Y9RA 4BZYA 5I4CA 5C51B 1ZLUK 1OQXA 3QG7L 2IEIA 1M71A 1YASA 3DLPX 4H2DA 4U9UA 2XWDA 5AG9A 2BSAA 1D9KC 4F3RA 4NKIH 1UAYA 1TQWA 4U1IA 5JBQA 2ENQA 2LR4A 5CN2A 4PR0A 3G1WA 1Y18A 4L8SB 2GN6A 2KQUA 4XNBA 4KVPA 2J5LC 1SMKA 3NT2A 4IHOB 3RX7A 4RD0A 3SGDH 1EEQA 1E3EA 2BY3A 5K9QI 1ZNQO 4D79A 4JG1H 5AESA 3JZFA 1AVTA 2DR2A 2NNCA 1FTYA 4P53A 4RTSA 4XQ9A 3IDGA 3A14A 3RVTC 3EJYD 2HWZH 2PNDA 3DBIA 1EK5A 2UZ1A 3J81A 5GSRA 2GBCA 2PO7A 5ALDA 4TRJA 1E3XA 5LQAA 4LXXA 1E62A 2IQ9L 2EIJB 5JYDA 5AB1A 1KELH 1ZJ5A 4LZKA 5IH7A 3AV3A 1ZMRA 1FE8H 2HCBA 1KF0A 3QEUB 2P7TB 2X77A 3LNIA 2C8LA 3UC5A 1J99A 3EIOA 2JL1A 1OOEA 2CBTA 5AHKA 1BVOA 3BVNA 4DREA 2VO5A 3RIGA 3U2SB 2CJSA 4NN5C 3PEYA 3WB0A 1DVFA 4GOJA 2VC2H 2I9KA 2Y2VA 2G5UA 2I8AA 2CLFB 5BQ7B 3D3QA 2VL7A 2G04A 5ABDE 1O97D 3Q3JB 3LIUA 4JO5A 2HBZA 2DWOA 3VDBA 3N05A 5KYXA 3NVQA 1JAYA 3ID6C 3BP7A 1YHNA 2E27H 2ESVB 3A36A 3E53A 1EI9A 3ZU5A 2EHJA 4M87A 1W35A 4DIUA 2NZIA 3VISA 5JZMA 1QU2A 1SIUA 2HWKA 1KJYA 5M04A 1LK2A 2BZGA 1XA3A 2Q1XA 2FZWA 4ZVTA 4GAAA 3D2UB 1SEPA 4G70B 3S3CB 1HDCA 5EZ6B 3QVXA 1WDMA 5BO1H 4ZW8A 4AYDC 1PKQA 5D84A 4DKAA 3EDEA 3D02A 3OL2B 3A6HA 4DA8A 1CO1A 5HP4A 3INUL 1P4JA 2YPVH 1D2GA 1HXKA 2BZ0A 3NIGF 4FQIH 3DMMD 3QR2A 3BD3A 3F12A 1I4TD 3RS7A 1NPYA 1F5WA 3LH5A 1NGSA 4AVJA 2IUYA 1RJYB 4UM9D 2JCCB 1T8UA 1NU8A 3A11A 1JPTL 3CC1A 3E2HB 4L8FA 2J88H 1FDRA 4F9LA 5AENA 1FJXA 2IDJA 1U30A 4YHOH 3GIVB 3MT7A 1NC4A 5DHMC 3ZXYA 4N6QA 3CIQA 2FZ4A 1T9HA 1GU0A 2DPHA 1BGVA 3B13B 1SZCA 4LAQH 1H05A 5JZ9A 2CKDA 1IPFA 2YNMA 3T4YB 4B35A 2P28A 1GAQA 3UYRL 4IKNA 1ROCA 1WK0A 3TBWA 1V71A 4UTZA 3IJ8A 5DGXA 3X1DA 1WT5A 1PWXA 3CO5A 1WAEA 1RJDA 2KPOA 4LRUA 1Y9EA 1W4BA 3KQTA 4EA8A 1E9BA 2BT4A 3ZXUB 3BC9A 4JREC 2IY9A 4IOKA 5BWCA 2AXQA 4LASL 5HD8C 3L3KA 3WKCA 3L6RA 5GQSA 3RJZA 1AGFB 2CEKA 1W75A 4Y7MA 3QPVA 4LXQA 1TTFA 3VU1A 3P9ZA 2X70A 2QL7A 4MVJP 3NHLA 3W5HA 2WNHA 4Z3JA 5EF0A 3ET5A 3JASB 4XSHA 3JWDC 5ICSA 5BUPA 4DGYH 3S6CA 1E3WB 2WEKA 3IT0A 3K8MA 4ZUWB 1BC5A 1QVRA 3CRVA 3LQ1A 3NPAA 4MQFB 4GXUM 2MJWA 1ZCAA 3SKJL 4QRIA 1EHYA 2D7TH 4Q56A 2NV0A 4EGAA 1DKOA 2VWHA 1I8LC 2B83A 5ALVA 2G2RA 3NYIA 4U8GA 4KMOA 1SXQA 3Q44A 3WY3A 4X94A 1PX2A 3UCFA 3L5XH 2IELA 3OSVA 2DPYA 3HJUA 4WTWA 3FMGH 1ZN2A 1S9VA 3HC3H 1OXTA 2WQ6A 5IC5A 1CF8H 5IB5A 4IJTA 4MW4A 3NYQA 2BGIA 2YINC 1A6ZB 3BWAA 3W1EA 4O8CA 1FNAA 1G2PA 2BFVL 4HIJA 2E3VA 3K72A 2XWBA 2ZWKA 5AB0A 1ZH2A 3HG2A 3ETLA 1YC7A 2HAZA 2OS7A 4MRPA 2QEQA 5TF1L 4ODXA 3VX0A 1NMYA 2CE2X 3U7RA 1IEBA 7YASA 1YL5A 3NH6A 2ZUQC 4DEWA 1Y98A 2RJMA 5C0CE 4P83A 2KI6A 4BCDA 1QBLH 4OM1H 5IKMA 1MGOA 4HIXL 1S7VA 4ZAGA 4R90L 1W9HA 4EHKA 3AR3A 1KG0A 5HGGS 1YS6A 1E1NA 4A2GA 4XXWA 1IUKA 4GXUN 4PGJA 1PZ2A 4QUDA 1H9CA 4YHNA 2H8PA 1QHQA 1IBDA 3ZTDC 4ICWA 4HC4A 5AKLA 3QEOA 3I5XA 1P2SA 5JIKA 2GVYA 5DEGB 3BTUA 3O0RH 2XA8H 4F2ME 4N5IX 2PUEA 3NZ8A 2ORYA 1VRCA 5KZMB 5D71H 2JH8A 1ZGAA 2J8UE 2XKJE 1ZA6A 4PB9H 4OGXH 4DJDC 1CI3M 3CSSA 2QTCA 3CPLA 1RI4A 1MIMH 4QKXB 1BBJA 1J1OL 4PJGB 2ZUYA 1MTOA 3AERB 1QYRA 4L1LA 3RO7A 1E7SA 1HE7A 2V9UA 5HHMD 2VKWA 1LM8V 3JWOC 2RD0A 1Z63A 2ZSBA 3WGTA 4TVOA 1JEOA 3F7VA 2H2AA 4QREA 4LL9A 2X3AA 4BFNA 2E7MA 5E8OA 4R1OA 3L7EA 3IAM6 2H54A 4UTBL 4C1NA 2W8BB 4KPHL 5BQXA 2XTJB 2OAQ1 4ZMRA 2ZIZA 1Q6ZA 1ZS2A 2QRVA 3DE1X 3TR0A 2KW5A 3IVAA 2GJAA 2VXYA 1JPNA 1YL7A 3QZBA 1OLSB 3WKDA 3SKNB 3IDIB 4Z7WA 1QLWA 4G5ZL 2OBLA 2VOEA 1KGYE 3FQ1A 1NBWB 4BJLA 2XWJA 3PEEA 2MINA 2QK4A 1NCBL 3QJTB 5K0CA 2DAPA 4X8XA 5D2NC 5HRAA 1R15A 5F9DC 3ZNPA 3I83A 5PAZA 2UZXB 3OCXA 2IGFH 5L2KA 3PA8A 3VXSA 1ZTXH 1NATA 3OE4A 5CAEB 1TEYA 2A99A 4AO8A 5I8OL 3NACH 2ZITA 3TXYA 1AO7A 5IKXA 3GPBA 4ENZA 5CUSH 1NRXA 1OAXH 2ZWYA 2XHNA 5CUSL 3HJRA 4KRGA 4N2LA 4QODA 3EISA 5J4VA 3TZQA 3C6SA 4QRPD 4HGQA 5CCKL 1BQ5A 2Y06L 3S3SA 4U6NA 4ZYZA 5IAOA 2FZGA 1S5IL 4EEZA 1IFHL 5IEHB 1TAUA 5K2OA 5HKBA 1H8HD 2GF2A 2YOGA 2Z0UA 3DVLA 5T1DL 3RIAF 2C42A 1MEJA 4BO2A 1G7PA 1BU8A 1VZHA 3KXLA 1DKPA 1E65A 2YBRA 3VFDA 4IQ0A 3AZPA 3LS5L 4UHDA 5IABA 5DGRA 3CFKA 1PO7A 5IQNA 5F1IA 1NQ5A 2GILA 3VQLA 4WWOA 1IEAB 1KQGA 4ND8A 1NVFA 3QFJA 2C7VA 1JXOA 1GGIL 3HKCA 2Y0BA 4G86A 1CQWA 1GTG1 2P9YA 3DMYA 3S5YA 5IAKA 2QI9F 1P9NA 4Z1OA 1IBYA 5H3HA 1U7DA 4C54A 5CLGA 3ABRB 4EPWA 3GVIA 3Q8KA 4RV9A 2NX5B 3NJXA 2XWTA 4RVDA 3OT1B 5J6HA 2YK1L 1KB5B 3QBEA 2A83A 3KYMA 2P4QA 3LIZA 2ID9A 1MQSA 2X4PB 4DO6A 2HSJA 2XWJB 2DIJA 3IPFA 2GITA 3R8XA 2XZCL 4JC5A 2XR1A 4QGAA 1TJ4A 4RTLA 4O2FA 2IH1A 3K71A 3NTOA 2CBMA 1XZEA 4DBLE 4RGBA 3GV0A 3CC8A 4XVUD 4TSAH 1F42A 5FFNA 1QTPA 3GM8A 3VXMB 1NCCL 3HFRA 3R76A 3DGEC 3HVJA 2WBJA 5JQHC 4KVFA 3BWSA 3FTZA 2YQBA 4OK6A 4UPVA 3X0DA 1K5NB 2XUFA 1V3KA 1FK8A 2R2GA 4GGOA 3HDJA 1DDHB 1JIQA 3MLXL 4KXVA 1PT6A 5CFPA 3ZUGA 4PRIE 2P75A 3RPKA 4IR7A 2FLKA 2X0IA 2GXAA 4ZI2A 2R62A 4D8PB 1R0LA 1SNYA 1E40A 1BAFH 1XL6A 1W4CA 2Q07A 2EUXA 2WNGA 3HKZA 1X6VA 1VKZA 4G0MA 2CLLB 2QRQA 3EUAA 3VI3E 1Z17A 3E1SA 1R0SA 5I48A 1RLBA 1PK8A 1FB5A 3Q48A 3QJZA 1C7SA 4D9QE 4ZZ2A 2XGMA 4W9DC 5AT1A 5D7SL 6YASA 3L3IB 5F7MC 4GKSB 4NRDA 5BCAA 1JNJA 1GPJA 1V3MA 4U3JA 4R90H 3KVVA 2F5AL 2VYRE 5I4IA 3N0PB 1KCUL 1FL6A 2NVUB 5HHNA 4DLLA 4PW3A 3BREA 3EF1A 2KWIA 5CBAA 4WENB 1M83A 1T8PA 1FFYA 4LP4A 5EOCH 4A15A 3PYMA 4RYLA 4DYHA 4AZWA 4LSTH 4L23A 3ZLUA 1G64A 1K85A 4UM8B 4KKRA 4KXXA 3FB6B 3WFEL 4TSBL 5UKDA 3BP4A 4JFOA 1V11B 3RKUA 4G81A 1QBMH 3HCVA 1E4XH 4Y5VA 1XCJA 1VFBA 2FQYA 1YAZA 2PKEA 1CGYA 3S1AB 3IJ5A 3RQ3A 1HG0A 5CILH 1EUZA 2QGCA 2RH9B 4A91A 4CVZA 1BE1A 1D1TA 2PXAA 5A40E 1T25A 1JR3A 5EHIA 1OYOA 2I34A 1P1FA 3FGPA 4KQFA 3ZDZF 5A4KA 4R4FH 3A3YA 3EXEA 2WXQA 3Q7SA 4F4FA 4G1FA 5EN3A 3L4CA 5KDOA 2X7HA 3SKJH 3G6KA 4LSUL 4NAJA 3K9GA 2BP8A 3P73B 2H17A 4XB6B 2F1RA 4M4SA 1S7UA 5EOCJ 5IFJA 4TKZA 3MBXL 5JROA 5ESVA 1Q1QA 4B4DA 4PE5B 1QC5A 1IN4A 3MA7A 1DIHA 4L4JA 3JV7A 3ZNQA 1UC6A 1DJQA 3H84A 2J30A 3HRPA 3DEZA 4AMYA 3G0HA 3RW9A 3UAXA 4Q39A 3WNQA 4R2GB 5ESDA 2QQLH 3EYUH 5JNWA 3MRKB 4MCJA 5D3MA 1AHMA 1B4TA 2VYCA 3V32A 3ND5A 1CX9B 3SC4A 1FNDA 3BGOS 2OYKA 3AF3A 4UB0H 4ONOA 2OFQA 1BXAA 2G0TA 4XXDB 2F8SA 1BQSA 2DY2A 1Z0ZA 1N0XL 5EC2A 2C7BA 2W2OA 4Y2RA 3ESZA 4OGAD 2QRUA 1HQ4B 2ACVA 4YJ2F 4I36A 4K15A 2H00A 2OOSA 5AW0A 1AS7A 2B08A 2XE8A 3OX3A 4QQ8A 1MKYA 2ITCB 3A9VA 5DNWA 1AKJA 5I71B 1YR7A 2XWQA 4BXSV 3IKLA 1RQNA 3T5WA 2G9VA 5ESWA 4YUVA 4M5ZL 1Y7IA 3QH3A 4MYDA 1SCQA 3SC2B 4LFHD 5FCUH 4F7TA 2C3XA 4DJTA 2Z7YA 3GSRA 3HLAA 5LQCA 5I1HL 1X6LA 2DHEA 3CYFA 721PA 4V1DA 3LYLA 1T9ZA 4GI8A 4KMLB 3H5IA 1QGED 1DBAL 1OW3B 3O6LH 3OF6D 2CDGA 5D9SB 2OP1A 3ULUC 4K9NA 3QNYA 3EO1B 3JRNA 5B3AA 4YEFA 3SU8A 1HYRC 1BDBA 1E8XA 3ML1A 4Q7EA 4BCYA 4KG7A 4MXVE 4OIBA 4HRVA 4Q3DA 4JL1A 2B1HL 1J4AA 1DBKH 2V2WB 4K1LA 4MTLA 3RWHA 1FPTH 2BO0A 1WE5A 5B7MA 5H5JA 1MFCL 3HG1D 2WIDA 2OYCA 1Z0AA 2QTVB 4XNZC 3BJMA 2ZXUA 4X9FA 4HVTA 4A04A 2CXPA 1VEMA 4OGQC 5CU7A 4ZUSA 1F17A 2VK8A 4MWCA 4F06A 2VSKB 1BVNT 1J09A 1N2HA 5B2ZA 3EO9H 3GMQA 3UAJA 2ZUSA 2HYDA 1DMSA 3EQ7A 2Q28A 3H86A 4GOXA 5D1XC 5SICE 1HXMB 1T3SA 3Q3VA 1DINA 5E2IA 3PFBA 5MDHA 2AG5A 3CW9A 1G7SA 2VDWB 2FWUA 1MCHA 4LOFA 4NO2B 2WWVD 2WO4A 1I4FB 3ZMRA 1CNEA 3K2UH 3BE4A 4FYIA 1G98A 3GJ7A 5K39A 3X11A 1CGTA 4LHZA 2ZRLA 2VTBA 4FJZA 3WKEA 4DDUA 1UJNA 1AXIB 3SZKC 2CXOA 1RKQA 2XGOA 4H7VA 3RREA 1MW1A 2ODHA 5A04A 1UKQA 1AXGA 1QEWA 3MREB 1VZIA 3RL2A 1R2QA 1ODKA 3LPGA 2WIJA 2CLZB 4CL0A 5K0EA 2KSQA 3LXBA 2WJYA 3GG9A 4ZMBA 1Y07A 1O7SA 5BQPA 1YZVA 5FV1L 2E86A 4L8YA 4KJZA 2QNBA 4P4SA 5CT6A 4EG5A 3LC2O 3QAZB 4TQIA 1JKXA 4M9RA 4F1SA 5EBMA 3R3VA 5DI3B 1HSAA 4KHTH 1HRDA 1H0RA 4C7VA 3P30L 4GPVA 3K1ZA 3K80A 1HYGA 6Q21A 1D4ZA 4XQGA 1RHJA 2EGGA 1MVUA 1LRJA 2IEAA 1BWMA 4JO3H 3WL6A 1KR5A 3GC6A 2XYBA 5IWAB 3VXUA 3F73A 2VHCA 3C8DA 2YZNA 1OZTG 1QTYT 4OA5A 3OD3A 3T6XA 1OP4A 1U4OA 5K03A 1DEDA 5EUCA 1UM4H 4HJRA 1I6WA 1GTL1 2R0ZL 1LGVA 4JHAH 3DPUA 2VLKD 4F5CA 4JLRB 4MS4B 4EPYA 4OZFG 3BERA 3F7OA 2XN9E 4DFDA 4PU2A 3I2JA 1VFBB 1F5SA 3E58A 3QTBA 1T3TA 1KI4A 4QFCA 2VLKA 1I36A 3GCZA 1J1ZA 1FQ9C 5EZYB 5DLML 3RURA 4XBEL 3L1FA 2E5FA 4CADA 1VSVA 3VTMA 2XUOA 1EAMA 1O6SB 2F8LA 4EO4A 3R7FA 2ECOA 3N43F 2UZAA 1GKUB 1IJ9A 3F5MA 2WP0A 2KBFA 3TEXA 4IK7A 4GOOD 4PJAF 2C9VA 1IVLA 1CTOA 3MLBA 1JPVA 2OBGA 1CT8B 1G8HA 4U1IB 4FS3A 1DQJB 1IFRA 5FORA 3D7RA 5IW6B 4TL8A 1ZIPA 2OHGA 2HDWA 5H35B 4U2FA 4EA6A 2HFGH 1CF9A 2EP5A 1N36B 1C1EH 5KQSA 5ANMB 1X7ZB 1JR6A 1TQVA 1Y34E 4LFCB 3QA3A 3OWHA 2QQKL 3ROQA 1M2VA 4E46A 4X6XA 4TN9A 3D85B 3MGBA 1G66A 4NTZA 1KAGA 3MV9B 3NZUA 5DBIA 3GHBH 5AVYB 3H04A 2A0FA 3ICWA 3ZWVA 1I2MA 4YASA 2IGBA 3CEAA 4NQXA 1C3OA 2K0RA 5FWAA 1F7UA 1T04B 1V54B 5E5LA 4TYQA 3U6KA 5I16A 3Q5YA 4PGFA 3AEZA 1UCTA 1L7QA 3R8QA 1V0JA 2XSKA 1UJMA 3PHSA 1ZJJA 3K71B 3KVRA 4P3XA 5K8VA 4M6NL 3DV0B 4ZPTB 4AQ8A 5HHME 4EJ2A 2PPDA 5D72L 2ZRJA 4URXR 2R5WA 5I6DA 3WK6A 2XKSA 4NZRH