5E6SB

Structures of leukocyte integrin alb2: the ai domain, the headpiece, and the pocket for the internal ligand
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
459
structure length
455
Chain Sequence
b'QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRKVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-L
publication title Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 127
structure length 455
sequence length 459
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5e6sB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5e6sB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5e6sB03
2QTVA 4IGIA 2VDLB 2VDMB 4JX0A 4K3JB 2P28A 1U0NA 4G1MA 3K72A 3IJEB 2NUPB 3NIDB 5E6UB 3ZDYB 4IHKA 1XDGA 4CN8A 1M2OA 1Q0PA 3EOAI 3F78A 2WINI 4BJ3A 4CN9A 1RRKA 4G1MB 2NVOA 1FE8A 3M6FA 3BN3A 5KYNA 1YVPA 1MQ9A 1MQAA 5HGJA 2VDNB 5ES4B 1OLZA 2ODPA 3RAGA 2P26A 4UM9D 1IDN1 1LFAA 1M1UA 3TXAA 1QCYA 3Q3GE 1MF7A 1M1XB 2WW8A 3EFOA 1U8CA 3QA3E 4XW2A 3ZQKA 2I91A 1AUQA 2UZYB 3AL9A 3ZDXB 4MMYB 1RS0A 3EH2A 2VDRB 4F1JA 1L5GA 3EFOB 4WJKB 1IDOA 1U8CB 4Z7NB 2ADFA 4O3TB 1XUOA 3E2MA 1MJNA 4NENA 3PPVA 5HDBB 1RTKA 3T3MB 4M76B 1JEYA 3HI6A 1UEXC 1L5GB 1ZOPA 4HQOA 4WFQA 4O02A 3BQNB 3GXBA 4WK4B 3FCUB 3K72B 1JEYB 4DMUB 3OKYB 1FNSA 2VC2B 4O02B 4WK2B 3AL8A 4F1KA 4O3UB 3ZE2B 3EH1A 3PPYA 1DZIA 5E6SA 1JV2A 4FWWA 3FCSA 3V4VB 3AL8B 2O7NA 3EG9A 1SHTX 1CK4A 2XWJI 5E6RA 5KYUA 1M10A 3EGDA 3VI4B 1PD0A 1XDDA 4FX5A 5KYXA 5E6SB 1IJBA 4UM9B 1JV2B 4IXDA 3ZE1B 3EOBI 4A0QA 3EG9B 5KYUB 5E6RB 4C2AA 3EGDB 1AO3A 1NA5A 2I6SA 2X5NA 5KYXB 1SHYB 4MMXA 3OL2A 1T6BY 1U0OC 4UM8B 1ZOOA 4HQNA 4JDUA 1DGQA 1RD4A 3PPXA 1N9ZA 3TW0A 1ATZA 5LN1A 2I6QA 4NENB 4G1EA 2VDPB 3HXOA 4Z7QB 3OL2B 4MMXB 4GZ8A 2XWBF 5KYWA 3ZDZB 1AOXA 4HQKA 2VDOB 3TCXB 3TVYA 4C2BA 4PN7A 1JEQA 2VDQB 1M2VA 1OAKA 3BQMB 4HQFA 3F74A 4HQLA 1T0PA 5HJ2A 5KYWB 1SQ0A 2NUTA 1JEQB 1M2VB 3EGXA 3K71A 3NIFB 2VDKB 3OKWA 1BHO1 4CNBA 2ODQA 3T3PB 1BHQ1 4MMZA 3N2NA 3VI3B 2NUTB 3EGXB 3FCSB 3K71B 3HXQA 1ZONA 5BV8A 1MQ8B 4WK0B 4MMZB 4C29A 3V4PB 1M1XA 1V7PC 2ICAA 1PT6A 1YUKA 1SHUX 1YVRA 3ZE0B 4Z7OB 2B2XA 5KYYA 1PCXA 3K6SA 3AFCA 3NIGB 4MMYA 1TYEB 3NVQA 3IBSA 1JLMA 1QC5A 5KYYB 3PPWA 1PD1A 2M32A 4G1EB 3K6SB 4NEHB 1IJKA 1MHPA 2IUEA 1SSLA 1N3YA 3IJEA 2NUPA 1CQPA 5E6UA 2XGGA 1QC5B
chains in the Genus database with same CATH superfamily
3EQ2A 3AK4A 4MA4A 5JXEC 1W581 1HT0A 5LQBH 1UP6A 3ZO9A 1TA0A 4DAGH 3TYFA 4XIGS 4K4KA 4S1VA 4UU8A 4UEJA 4Y7OC 2V7HB 1A9EB 3EUAA 5TVKA 1YXMA 1I36A 1T04B 4JQIH 2OQIA 1U4EA 2O8VA 4N68A 5FULA 3EAKA 4G8BA 5AW7A 1E8YA 1XIWC 1IEXA 5ELLA 4O4JA 4OQ1A 1GW6A 1GGFA 1OYWA 2VHQA 3O6LH 3IGAB 3SE0A 2PNFA 3BZ4A 4JFDB 2XV0A 4O3UB 2CLFB 2VJYA 5C5CA 2D7OA 3BHNA 3GCGA 4JFFB 1MCJA 3FHCB 3EGSB 4F8JA 4OMCA 1LXMA 2RAVA 5IPFA 4QFMA 4C3OB 4DG9A 3IP1A 3E7FA 3A36A 3TLBA 1VA9A 1COWD 4DDTA 4AJYV 3R7NA 5IDWA 1D2OA 2EQAA 3T95A 2ETXA 4Q3LA 3LBYA 2DMGA 2OJZH 5KSBB 3W8RA 4EBBA 4FJZA 1K5NB 2VUKA 2GJZB 4IK7A 4WFIA 3VX4A 3MWGA 4C4TA 1ZNZA 5D3QA 4RDBA 2VBFA 4E2YA 3P4NA 5AXDA 2FUG6 5AI4A 3JTEA 3SFZA 2FPPB 1DBJL 1CUAA 1KEWA 4WXPA 2R23B 1INEL 4IHAA 1NLYA 5CFHA 2QTVB 1BFKA 3MBEA 1TUGA 3DDZX 3EOAA 2MSPA 2AW2A 1GXSB 1QUEA 3MWKA 1QBMH 3C3KA 3CXHJ 2YD3A 1KAEA 4A2LA 1C0IA 1WP6A 3VW3H 1DQTA 5L6YL 5EXPA 3HKZA 2F59A 3UWMA 1N6UA 1XUOA 2IW1A 3LUKA 5CLFA 4XCCL 2GFHA 3VR3D 3DZDA 2D7DA 2G80A 1DVFA 6AT1A 1QFWM 2Q6TA 3IHKA 2GHIA 4G3XA 4S3MA 1MCSA 1SGKA 4IWYA 1CLZH 4QUKA 3GEGA 1X9HA 3WLBB 1VFNA 1OV4A 1E7RA 5G41A 4R2GD 4CNIB 3O3EA 1VP9A 1TEZA 2D7JA 2AJVH 3GTTA 3G8BA 1Z0MA 4LKXA 3L5WA 5E9WA 5T4EA 3G23A 2ZQYA 5JHDD 4LEXL 1U0LA 4MUXA 4TLSA 1W85B 4C0LA 5BR4A 2ZWNA 3QKSA 3OIUA 1E89A 1UH4A 4ML3A 1AMOA 4GKNB 3D6GA 4DM3A 2P9HA 2VSKB 3M33A 1JR2A 3PI6A 3B5IA 5ISZA 1G7SA 3P32A 3HZKB 5GZOD 1KSGA 1F3OA 1JZ8A 1GZQB 3SSNA 5EMMA 2VNJA 1XCWA 4Y1SA 2BFOA 2XXMB 2I24N 4U2YA 1CFNB 4OZIF 3NANA 3QZBA 4LHWA 2RFLA 2WLTA 5GHWH 3BP5B 3VMPA 1WF6A 4CN8A 2O26U 4HIHB 4KKNA 1FIUA 3WMEA 3NCYP 4O4IB 3DIFB 3MBXL 4JJ5A 3UCXA 4S1QL 2PSJA 2IXAA 3HCPA 4FFWD 4ZI3A 3P2BA 5DZ9A 3WNJA 1AY1L 2PS0A 3PABA 3UTQB 3MLVH 3DO5A 1R9NA 1TTBA 2HJHA 3QFJE 2XXGA 1N3IA 1VDZA 3KQYA 5GV8A 1G8HA 4XMXA 1MOSA 1TJGH 4JV5B 1LNSA 2OHHA 1SXNA 1Y1SA 1RJGA 2P4HX 4IDEA 3AF0A 5FUZL 4ENSA 1CQZA 4KLZA 4DEXA 2B3RA 4D8PA 3LH2L 4E31A 4BYHA 1JPEA 2P2GA 5HKAA 3T3OA 2JVUA 4PGBA 1RZKC 2PLRA 4KVZA 4Q9LA 3OICA 2W8BB 1AF7A 4OCRH 1GYUA 2G1UA 4GMSH 2MTBA 1FSKC 5EZYB 1OAKA 3R9XB 1SOVA 3BP6A 3LGAA 2VR8A 4YMPA 4C7JA 4C4BA 5CNKA 1BFOA 2F8MA 4LPKA 4M7OA 4DXHA 5LZ2A 1TZHA 2Z31B 3N1UA 1IFHH 1Q90A 2FSDA 2GT9A 1IVSA 3HE7C 2GUOB 1EXVA 2OJEB 1T1GA 1YZFA 2WWMC 4Q93A 1CE6A 1S8DB 4BFNA 1SJHA 1HE8B 3L7AA 2PKQO 2AK4D 1UASA 1DL7H 1RHMA 4L8CA 2J5KA 4DNPA 4L9WA 2O3QA 1HEZA 2HVBA 5BVGA 4WSJA 1JHQA 1SC1A 2YQ5A 1T9HA 5DZSA 5ECGC 4P2QD 2UV3A 5J13B 3I02A 5E99H 3LGSA 4DDUA 3W0WA 5FOTA 3WXVH 3RVXC 2Q8AH 4H8PA 2B8TA 3ITDA 3IK2A 3EFOA 2WM8A 4L75A 4XP4H 1D0IA 1EBAA 4HX9A 2DWPA 1UENA 1RP8A 2E7DA 1S9KC 3B70A 4OF6A 5HIMA 3OMXA 4TV8F 2H9GB 4HEPG 3BK2A 3C16C 3AIOA 3GQBB 5HIJA 3ROOA 4YMSA 1F02I 3B2MA 3NPAA 4XPAH 1RAIA 4BRSA 3OR6A 2AJUL 3VHXA 1E2QA 1MVFA 5LA6B 2O30A 4NAQA 1AIZA 5HQJA 1Z8NA 3NRCA 4LJSA 1CDCA 3LCYA 4RLHA 4Y0VA 3VJRA 3PGVA 1KYZA 3TUIC 1PX3A 2ZT5A 8MHTA 4QEZA 4A2PA 4NV1A 2KPWA 3O3DB 2QUZA 4B82A 3EVAA 2XITA 2ZOWA 4WHTB 2ERXA 2VKXA 5D96C 3BIJA 2FEDD 1LU9A 4BYMA 2G3YA 3O1JC 4JFQA 2ARJB 1A4BA 4NYIQ 3Q2CA 3DMRA 4KFSA 1NWHA 4IHKA 1XZHA 1EPFA 1IGCL 2HX8A 1VKXB 3KWFA 3WXWH 2DWEB 2VE6A 2BOBB 3BD4A 1KT2A 4RVOA 3A6ZA 4G0MA 2X41A 1DLIA 4OH1A 2IIQA 2NSXA 4AZ8A 4BH7A 1PY4A 4QGHA 8PAZA 3K0WA 1DAMA 4KDRA 1Q77A 3A26A 3ARYA 2NY6B 2QL7A 3PWZA 1W1IA 2L82A 1G5HA 5MI0C 3BVUA 3SB3A 4UF7C 5C07D 1KB9J 5CYGA 2F6RA 2WZDA 4IIGA 3PGA1 5IOPA 4YSRA 4DUPA 4EB8A 3FOZA 3WKCA 4XCYB 2XVZA 5BMVB 1FFSA 5CN1A 5JC8A 1KGSA 4KV7A 2VT0A 1B2WL 2RG7A 2YWEA 2VW6A 1A3QA 3NVMB 1IHDA 5KNDH 2FT8A 3P0YL 1AO0A 2FO8A 4GW5B 3Q7TA 2E56A 4IVQA 3SDXE 4X0KA 1JFQH 3N0VA 3MRBB 3P7MA 4OB5L 1VF5C 2BR3A 3W2DL 4C2TA 5D2LA 4YWGL 2P4SA 3RIEA 1T1JA 5A3IC 4YLCA 2J3HA 2XZAH 2CNOA 5L2JB 5ERXA 1KB5A 2DGDA 2PRIA 3A06A 4UTBA 3L4JA 3TLMA 4ZOAA 1XDGA 1Q7EA 4B5LA 4YIQB 2VQTA 2KHAA 3WEAA 2DRIA 1U58A 4HBCH 1KYTA 2FQYA 3TLYA 5ALJA 3VR6A 5D7LA 3X1FA 4QHTA 1KTDB 3CN3A 4WESB 5AVKA 1O4VA 4LASH 4ZVVA 2F2HA 2XZOA 1E42A 5EOTA 3BHMA 3WHPA 2EABA 1T2JA 4WLFA 1P5UA 1ZOPA 3QP3A 4F2MB 3PG2A 1K6QL 2H2FA 1Q44A 4JKWA 4F8EA 1LEKA 4YT2A 3WY3A 2QQ5A 3CC8A 2XE8A 4IK6A 2O19A 5KUKA 4XGZA 3TI9A 1KJ2B 3IPLA 4ONEA 4PRAB 5HHPA 3WTBA 5LBTA 2FGWH 2FPGA 1IN4A 4G09A 5CG1A 4B0MB 3RWDB 4UZGA 3UC2A 5EU6B 4PF1A 3O4LE 5DHVH 3W5IA 4HXBH 2F1HA 4EUPH 1BHGA 1UACL 4LVCA 3K31A 4TSBL 3GMLA 4HXEB 3A8TA 4K94H 1Z25A 4HC4A 4ZYLA 2ZWPA 2R5NA 1IUKA 4YHLL 5AQ1A 1W72B 3ADPA 1JGVL 3Q3VA 2BSTA 2NYYD 4P57A 4RMIA 3QDMD 3SYPA 1OAYH 3RKDD 1NVFA 3GJ4A 3VFVA 2BVOB 4S2SB 3M6DA 4R7VA 1QGZA 1U1DA 4TMYA 4I2VA 3W4IA 5DT2A 3N2IA 3KPOA 4XWOC 2GHQA 2PZFA 3U2JA 4JZJC 4J0IA 2J20A 2Y0BA 2ODEA 5DURB 3WUWB 1R00A 2I2FA 3DXZA 3QWAA 2W07A 5CJ8A 4R8WL 4U5QA 5HE8A 2B16A 1JG7A 4PYOA 5EJGA 2Y1AA 1XCLA 5FHBL 2VUSA 2P8LB 3T9CA 1Q5PA 5DHFA 1GZ4A 1MCRA 5KQRA 2H0FA 5DHEA 3FYCA 3B37A 3CX5J 3DVGB 1Y0LA 1RQ7A 2FR1A 4MWEA 5FOQA 5DJDB 5JSHA 1HURA 3TFKC 4MVJM 3NJ4A 4FMBB 3CCHA 1SZCA 2CCGA 1KQ3A 3DJTA 3VFSB 5FCDA 4MXWH 3S5JA 4LMBA 2XN9D 1TO2E 3BIKB 2OPCA 5HTOA 3FPCA 3JD2A 3ER9A 2WJWA 1T8TA 5LO7A 5IEKA 2D2FA 1VC2A 4KW7A 4Y6PA 3NZUA 2JPDA 1JS1X 5DGIA 1W80A 2HLEB 5AZEH 3IFSA 2CL6X 4ZHQF 4YL4A 4JGIA 3PPXA 2ZCUA 1MVYA 4HIEB 1FPTL 1XJCA 4KPYA 1M6UA 1SXSA 5L8LB 3QELB 4ACAA 3ZCRA 4Z4HA 5K6AC 4YHNB 3U2IA 3IFLH 3V9FA 3VXTB 1X3SA 4FNPA 3AOGA 1KMHB 1BE8A 2OR8A 2VXSH 3C3MA 1XB8A 2P9JA 3P96A 3QM1A 5BOSA 5J2UA 3ZS9A 3N3EA 2OFWA 4N5HX 1ZSVA 5IMOB 2XN1A 4X5QA 2HFGL 5CB8A 4XO4A 1CQKA 2OSLB 2O5ZL 1JIVA 4D6YA 3GQFA 4ZOLB 3QH4A 3IJSB 2VUIB 1EXUA 4I55A 4YRAA 1GD1O 3MVSA 1TZJA 5KBYA 4BQPA 1QSFB 1XQWA 3ZH2A 4Q9QH 5IREA 1CXIA 1EINA 4E9LA 3VYTB 4EXPX 4JI4B 4K73A 4QF1A 4W9JC 4EEZA 4I4LA 4EJSA 2V6FA 4I9WE 2E7CA 1U2PA 2Z91B 2NXEA 5FJIA 5JOPE 3ZNQA 4D9EA 4XXWC 2D7NA 5ALTA 3P27A 3E0QA 3GRAA 2O7QA 3N0PB 4L2YA 5F1KA 3OVMA 5T1MA 5JRDS 1I9RH 1ZU4A 1VE3A 2P30A 2QGDA 5EUOF 1Q2UA 1DAKA 4M7KH 1HTWA 3CFDB 5IBUB 4KOCA 3E6AA 4GOKA 4JJIA 4RL4A 5D5MB 4MK4A 5AB2A 4AY6A 1T0HB 3BPCA 2FX7L 2XRMA 3FYUA 4YASA 4RIIA 2AJ3B 3OC6A 4KUGA 1Y6MR 4DGQA 1GA6A 5LGJB 4YMWA 5CFLA 5DLYA 3MS4A 1JGIA 2AJSH 4EE2A 2ZRAA 3OAYK 4KKPA 4KO1S 3L3JA 2NSJA 5K5EA 2QRVB 3FUJA 1X1CA 2CO3A 4NAVA 1X15A 1VYTA 4KMQA 1KA9H 3P9RA 3VSEA 3G2JA 3E1F1 1R3KB 2QJFA 1E5XA 3TAHA 4X7FC 5ACZA 5B1YA 2OXGB 5JCOC 4OCWL 2OS7A 2AMGA 4B2IA 5CD3A 3C87A 4RW0A 4B2LA 1EX7A 5HFJA 5H1YA 4LQFL 3NYRA 1F4LA 4DWOA 3IE4A 1P7VA 3D4CA 3N91A 3UHOA 3KU1A 5A5DA 3HVIA 1H3PL 5ALKA 2OLEA 3FOBA 1ES0B 4OKIA 1A3RL 3EADA 1BJMA 3D5EA 4UAUA 2WHVA 1IIRA 4I50B 1N0WA 3GEPA 3GV0A 1R0KA 2DAPA 3SC2B 5KTRA 1E5ZA 1JCVA 1KCWA 3FH8A 4HOXA 1A72A 1F5SA 1FP6A 4RHUA 4Y5VB 2QVFB 1U4SA 3V7YA 2OMKA 1D5ZB 4GY4A 1O96A 2I65A 4KHXL 3DDOA 1QAOA 1NBYA 2XB6A 2GCYB 3LRXA 4FABL 1JNNH 5FDWB 3K4PA 1DG3A 2PD4A 3D18B 4PI2A 4ZVOA 3RLIA 1PMYA 2IEPA 3BEVB 3MV7A 3WS3B 2YVAA 3LKNA 2HFFB 3CSPA 2VQSA 3OJDA 3K0AB 3OTTA 4OAWA 5CLZA 3JVFC 4R6WA 5IQOA 3K7UA 3HHMA 1OX5A 2OG1A 2ZYRA 3H86A 2VAJA 5FO7A 1T7WA 2OV0A 4MHHG 1M2VA 1SPBS 5G3ZA 5HF9A 1OWRM 5FUBA 1O6GA 2OBXA 2QVZX 4AG3A 1WCBA 2VZ3A 4X8LA 1KCBA 1FNFA 3FKQA 1XMIA 4F9TA 3QT2A 4MB1A 4QRUA 4LJRA 5L8JB 1A4AA 4E2XA 2QDWA 1YPZE 5F97E 2HJVA 3HBPA 5GS1A 2VPQA 3UIEA 4DGWC 1HK6A 3TA3C 1OB2A 4WCFB 2O14A 3K94A 4WTWA 3T0AA 3AUJB 4PCYA 4IOKA 3ZD6A 5BXFB 1G6VK 3B6EA 1GMIA 2FEEL 2AIRA 2CD0A 3L95B 3B7PA 5KJ1A 2RHOA 2IOIA 2IIVA 3REVA 4MQ7B 1U2RA 3IT8D 1SDDB 1YQTA 1INLA 1K7FB 3CLTC 2CXUA 4WA7A 2NW3B 4J0CA 5TQVA 4JMLA 2CZGA 1W76A 2QGBA 2ETVA 3O0TA 1T8RA 4PRLA 1XTPA 2ZRQA 3EBAA 1WPXA 3Q5OA 4DGYL 2ITDA 4OAOA 5E3HA 3NG5A 5HW0A 4ZAFA 4LGMA 4YCBA 3PZBA 4GSRA 3U37A 1TIBA 1X5HA 4RBNA 3K1AB 1LO0L 3BQNB 3W34A 2OHIA 4IJMA 4ARVA 4RV4A 3LRSB 3MLBA 1LK3L 2J3KA 5D4JA 3LDFA 3I2FA 4F8TA 3SSOA 2Q86B 1NVTA 5GGSB 3QDGA 4UKDA 3EG9A 4L5FH 2WZCA 1Z73A 4PJBA 3CSFA 1DINA 2DLGA 1EDOA 1B9KA 2MH4A 3B2VL 1DBML 3ONDA 1DBIA 3BWUF 2BNQB 4BP8A 3K1DA 1X9RA 2ALAA 3C5VA 4NZTH 1QSGA 3MUOA 4FYKA 1SNRA 2H51A 4HISA 5DHYA 1PFCA 4LCWA 2X4PA 4FXLA 1RLIA 2VCOA 1X5LA 2ZGVA 4LRIC 3MGOB 4IBYA 4LGSB 4BZ2L 2PPAA 4GZMA 2Q5HA 3NJLA 1AY0A 2AR7A 2YQ4A 2ZJZA 5AVYB 2DPHA 5E2VL 1BYUA 1UKCA 3GT7A 2W6QA 2QZJA 3V33A 4ZFFB 3PY9A 3ETTA 3WJLA 3CPJB 5SX4I 1NUFA 2HPTA 3AJ7A 1RKXA 3CLUC 4CQMA 2YRXA 5BR8B 4EYGA 4V39A 1ETZB 2ZVJA 4JY7A 1O5TA 1GGVA 4NKMB 1C5BH 4EGQA 4GJTB 1DCMA 3FQ4A 3KFXA 2ZG2A 1OIVA 3E2HC 5BWLA 3C2QA 3KPQB 5F96H 5IKCA 5KYNA 2QT9A 2BY1A 4K86A 4N3CA 3R9KA 3VFMB 1JNXX 2HDWA 3A1UA 1OFIA 5JDCC 1QUNB 4G43B 1V45E 3WTWA 4DJ5X 3KPRA 1D8AA 3T77A 2P5WD 3M1YA 4MA3B 3AFGA 3DF9A 4TULH 2GZSA 1R9MA 1EE2A 2FIKB 2Z92B 2VNHA 4AZ0B 2YWJA 1WVIA 4JJFA 3BCDA 4OZ4B 3TOCA 3GRGA 1XGTB 3KL5A 3LRTA 4H7PA 4TWRA 4TLEA 5LGHL 3ZJTA 4MUIA 3STWA 4LKCB 5K3AA 3G13A 5JPNB 4MYDA 4X6EA 4FNQA 4QYSA 3OPUA 3OCXA 4HGPA 3QIUD 1YB6A 3GRWH 3CDGB 4D2IA 4RZUA 3U5TA 2GZRA 1NU8A 4PS1A 2R1TB 3EXHB 4Y4FC 1FO0L 1K2WA 3N2NA 4YCJA 3PLNA 1U2GA 2FRGP 1RZPA 1S5IH 5CVEA 3F7RA 2VHTA 3CINA 5CH5A 3AJAA 2WSIA 2OL4A 1ORVA 2FQEA 3JAWA 4H25B 4QHLB 3BORA 4RAUA 1X7QB 4N0YL 4O2FA 3AR8A 1YHZA 4UTXA 1Z9MA 1OSZB 3HB1A 2FRVA 2IOHA 1XCOA 4YAIA 4U9IS 3BCRA 5B53A 2GYVA 2QL5A 3R4VA 1OFHA 3H2JA 4K94C 4FKKA 3CVDA 5IQ7L 1K08A 1ZLUH 3CONA 4OD0A 3PGMA 5JS6A 1LW6E 3VU2A 2JLRA 1E0JA 5A2GA 1NAMH 1ODLA 3MJ9H 3LO5A 5T41A 2Z9CA 2E4WA 4KUEA 1R3HA 1SURA 2PLAA 2ZWSA 4CMKA 3ET5A 1ZXKA 3GJZA 6ABPA 5BUQA 4Y8VA 2CBXA 5D70L 2Y0CA 1JPST 4NE2A 5JFOA 4F9LA 1KK3A 3OIFA 5JNYB 3BJMA 4RD4A 4XWWA 2ZICA 4PWJA 2O2DA 4IRSA 4BKSC 1NX9A 1F18A 1W4AA 1BMWA 4LBYA 4UCWA 1T9BA 1JZJA 3CG8A 3ZZTA 1ORTA 2XECA 1UEYA 1JYFA 1M4KA 2E4UA 4YSAA 2ID5A 4PP1D 1NNSA 1MNUH 4AJWA 4JANA 3HRIA 2DWYA 3BQMB 1Z2PX 3EDCA 5KJRL 4H26B 4O33A 1OH7A 3LLVA 3GGPA 5FK9B 4XN1A 2VHZA 5FA4A 4JVOA 5BVHB 2WNIA 1Z7WA 4J4BA 2DFTA 4V2UA 1A8JH 4LSPH 4TUYF 2I54A 1S01A 3DT8A 5UKDA 3BAKA 5KCMA 4IQHA 5IF3A 5L3VA 2V1UA 3OAZH 3LRPA 1PDKB 1N2SA 3TJZA 4BC0A 1T3LA 5JAUA 3UPTA 3NCJH 2IC5A 2CHGA 4G7RB 1ZCJA 3THWA 4MCYA 5SWZB 4BQEA 3HI6H 4MJLA 2N59A 3ARGD 4MJ3A 3IRUA 5HGJA 4LSUH 5F7FA 4A2QA 1H19A 1T8UA 2F53B 3C3WA 2VJBA 5FI0B 4EHKA 4NQRA 3DV0A 2GIMA 1CJKC 1ZUHA 1VL0A 1KBPA 3X1NA 4HAFA 4DV7B 5EJ8A 3QHZL 5LL6P 3BHBA 2ZCKL 2IWGA 2WJJA 4FOTA 3HNTH 4ZU3A 3TF4A 4IV8A 2HA7A 2X4RB 3MGCA 1IBHA 4RWZA 3FPBA 1WIUA 1Z3CA 4BUQA 3L79A 2H32H 4PUBH 3CURA 1UCTA 3KDPB 2ZATA 4ELDA 1FWXA 1Q1BA 2B69A 1DEEB 1CGYA 4WCYH 4AMKL 4P5PA 1JERA 4YUZA 4HAIA 3WSVA 5EP4A 2IIJA 2IAMA 2PEYA 3PF8A 3BSGA 5HHQA 3US0A 5JVDF 4B6GA 1A7KA 2TAAA 2CMRL 1I1AA 5FHAH 1CUSA 2BMEA 1AC0A 4OI7A 2XX0A 4GXTA 2HOQA 2VSDA 4CW1B 1CS0A 2HLDA 2QHXA 3TYXA 2YPLA 1IBYA 4LLMA 3L1FA 4JO1L 4C57C 3R9WA 4ESVA 2E6JA 1TUBA 1ZITA 3AY3A 4E42B 5IY5B 3LY7A 1A7RL 4GRDA 5CHEA 4MGYR 2GDJA 1MF2L 1G7RA 2D0IA 2VF5X 3HDYA 5JYDA 4KQIA 1E99A 1II0A 3GSOA 3KB8A 3W90A 4DMMA 3PC8A 1A4KA 2RHHA 5I23A 4QRRE 1VMDA 1PLKA 2EWMA 4YRTA 1ZK1A 1UZNA 4M8UA 3U6BA 3F64A 4O8ZA 2FG5A 4OCXL 1MLBA 1R33A 1T2CA 3DLIA 4JIGA 4DIFA 1XN1A 2DXIA 1MR3F 3F7QA 4IU2A 4GXFA 5I7OA 4FZRA 3AT8A 2Y0EA 1PYDA 1IQDB 5D1XD 4I1NB 2G6TA 2DM7A 4KXVA 4JN6B 4DUVA 3O5AA 1ZKMA 4Y4HB 3GUZA 2DEWX 3IJ5A 3BGFC 4ZMBA 2XB2A 3MMXA 2J3JA 1E6OH 2YXEA 1PT5A 4EN2A 1UKVY 3H4FA 1E4VA 1SHZA 3MQ4A 3ISYA 3LV3B 4L3EE 1FLRH 4YP9A 3GUTA 2WQUA 4FJ1A 2PW2B 1TCAA 1ETA1 3O8XB 1A1SA 3RB8A 3U9LA 3I6GB 4IDJH 3F58H 2NV6A 1TCVA 1OP4A 4HXGA 2ED8A 5EA0H 3FXIC 3X1MA 5JXGA 3VC1A 4AGPA 1V71A 3BWMA 1USWA 2AOWA 1ISIA 3MRFB 4IW4C 1CR0A 1J9GA 4MAUL 3QISA 1F7VA 1YUKA 5DHVB 4KR2A 2ZOOA 1N4AA 1ORIA 4EUPB 3FG9A 1KXVC 1U6KA 1QC5A 1H2AS 1A8IA 5C0AE 4D9LH 4FFZH 3U61B 4MHHI 3VXKA 2Z4SA 2APSA 1S7RB 2UX7A 2W1NA 1E6MA 4Y7DA 2Q0HA 2JKWA 2UU9B 3UFIA 2GETA 4HXAL 4RAHA 4UFPA 3OQMA 4TVOA 4G81A 3OZFA 2VM3A 5CP3A 2Z3FA 4Z76B 1UK8A 5M7QA 3UUWA 3K9NA 1NDGB 4MS1A 1U3HC 1RULL 2JFXA 4HUQB 4PGMA 4JD5A 1S78D 4TL7A 4MR9A 2XFXA 4ZCLA 1AZNA 1XKLA 4IDLA 5KVFE 4XJXA 3WBFA 2L18A 3WFBH 2B9AA 5PGMA 1MX1A 2LPMA 5ALWA 4MRRA 5I1JL 1UK7A 2NSDA 4D7AA 1G9MC 1IC4H 4EUNA 3COJA 3TX4A 1QPPA 1VTKA 3O7WA 4EN3A 1B8UA 1H6BA 1L7XA 3WOHA 5D84A 5FL3A 3S5UA 4QY8A 1OI4A 4GOLD 1OA0A 4MUNA 3VKUA 2AFRA 3MLZL 1NURA 5DN6A 5BRZD 2EDJA 3E8MA 2IS1A 1NDMA 4L0QA 4L0PB 3JQAB 4DG5A 3T8XB 2CJFA 1Z2KA 2C7UB 3PNVA 5CVJA 4WHDA 1KBQA 4LCCA 1OVMA 3T4YB 1EAQA 4AJEA 1MCOL 4CEJB 4PGCA 4GIOA 1BJTA 5B3KA 4B3GA 5BUSA 2N47A 2SCUA 4KR7A 5G4KB 5IVZB 2DQJL 5ID1A 2V0NA 4RLDA 5L4IA 1XGKA 4BDTA 2R69H 1BZYA 4CT5A 1PG7X 2EDKA 4AQEB 1KCSL 1IEWA 3L40A 2J3SA 4MVJF 5JZ7D 4YNYA 2OMBA 3HKCB 1KDPA 4X6CB 4KMMA 1E3TA 4BNKA 3RF6A 2HFEB 1TW2A 1ARZA 4C1NA 4ZTOH 5I8EB 3RZCA 2ZONA 1M1NB 4RENA 3L3OA 4MD5A 4JRXB 3RGVC 3ZR4B 3EYVB 1COBA 4BCYA 3OHPA 3C9NB 4BZ2A 4NQCB 4P23A 3RVOA 4PPGA 2W11A 1I2BA 2FCRA 1GUZA 4Z0HO 1PGQA 5CT9A 2FR4A 4RVHA 2DX7A 3FQWA 3VPSA 2JAHA 4E0BA 2DY0A 5T3YA 3ZUCA 5HOEA 5J1TB 2XU9A 2CUTA 5D7KD 1HLDA 3E27A 1MJUH 4ZO4A 5HHOA 4OREX 1NVEA 2J6EH 2VP0A 4NYLA 4XCXA 4JHXA 4AXBA 3JS5A 5EJ4A 1I3MA 1Y5RA 1TNMA 2F1BA 3E9CA 2FJFB 3T41A 5IROD 3L2MA 5GZND 1J1OL 1STOA 3WK9A 4FMFA 2TS1A 4GMHA 2HF9A 1BLNB 1O9ZA 3N43F 5HDLA 3E9EA 5FI3A 3KNBA 3LLCA 1DELA 1E4HA 1ZS8A 3PL6B 3BX1A 3BRCA 2XBDA 3QEBZ 1Q92A 2A94A 2VXTH 4LOJA 4TS1A 1QIDA 4D7PA 3U7EB 4QRTA 3W11D 1E9EA 4PPFA 4AVYA 1HHIA 2OXHA 5ER9A 3DHWC 3N74A 1KPRB 5B64A 3R8BB 2MCMA 4OLVL 4LOLA 1AS3A 1CB7A 1F97A 4HNAB 2VDPL 3CKMA 2HHLA 3DEKA 3FC8A 3MV01 3P2DA 1UJ3A 2F1JA 5LLIC 1PV4A 4R96B 3OECA 4J6EA 2ZI9A 3MTIA 3O9WA 1RLTA 1E0OB 1R15A 1JAIA 3FNRA 4FLEA 4X6FA 3FNEA 1FO0A 3VR0A 4L8SC 5GGSY 1T2UA 1WL8A 2QD1A 4O4LF 3MJEA 5FV2A 1SYVB 4DBZA 4P2YA 3T4AC 5E1MA 3KJ4B 1QHIA 5EF1A 1L5OA 4N8CL 3REWA 1MXHA 2ZSWA 3AVEA 3ZQ9A 2A6IA 5IESL 3GSUA 3LZCA 3V0WH 3RFRA 1OIOA 1QRRA 1V5JA 2FLMA 3SN6N 1U80A 5AM1A 4QQRA 1U8JA 5TGBA 5C53B 1Q1PA 4W4OA 4IIXA 3O2DH 5GGQH 4CKQA 5C9KA 5AHXA 1SMOA 1T0BA 3PFGA 1NLBH 4LEOA 4Z0TA 1MJGM 3HKEA 4E33A 2YEVB 1TJHH 3RVTD 2XGJA 1EX9A 4GBXD 3WNVA 1N7MH 2CEKA 1E1MA 2GYYA 1RW4A 1N70A 4M48H 4UHKA 2HT2C 3UKDA 4C0WA 2OL3H 1MFEL 1ODIA 5I6LA 3C3AA 3QPCA 1HE3A 1L5HA 4PG2C 3M7IA 4I1YA 3VI3B 2BIOA 1QGED 1J8HA 3BYZA 4M0KA 4WOKA 1LYQA 4ZS7L 5KVDE 3JTTB 3ZU5A 2YUXA 3ZS8A 3RHWK 4PYMA 1CULC 5BRQA 1K0FA 4DETA 4X91A 5H81A 5B30A 2QX6A 5T4BA 5I6MA 4LF5B 3IEPA 4GNKB 5EFIB 1X14A 3U36B 1ZGLA 2ZBUA 2IPNA 2UWEE 3GIVA 4AIZB 1QYWA 4M5TA 1E9FA 4M7LH 1QSED 1LP9E 1WW8A 1UXLA 4ZREA 1WB5A 3DI3B 1QVOA 4RKYA 3SSMA 4HCIA 1YF3A 2G1PA 4U1NA 2WIIB 1Q11A 3RBSA 5IKPA 1GL6A 2YSSB 5CPFA 1Z6GA 1E2JA 4EA7A 2E9JA 1MI5E 1MVLA 3O9VA 4HGYA 2BSQA 1TFUA 2ZRGA 4GF5A 1WG8A 4W63A 2EHJA 4N8VB 3GP3A 2K3TA 4DQDA 2HRCA 1TJ3A 2AD1A 1YR1A 1HKFA 1M76A 1AO7B 3PJLA 1WBBA 4X8JA 3BQUC 4BMXA 1ZM7A 4IKPA 4GH7B 1LA2A 3D2AA 3MLAA 3DX7B 5CGTA 3BGVA 4G0NA 4HZIA 3MXWL 2FTKE 4TQUS 5DTRA 4V02A 5A02A 2SEBA 4IHJA 1NM4A 1OR8A 2XOTA 3NAAL 1Y7HA 3I6YA 1DOHA 1LEGA 5I1CL 1I7NA 1CC3A 4GIAA 5B1CA 4HLZG 4BGUA 2VR9A 5F9AC 2XT6A 1AH1A 4ITVA 4G1MA 5A4IS 1HNNA 3KW8A 2C8LA 1K1EA 2C9AA 4B6PA 4YMVA 1HTTA 1II4E 3HRZA 4U1IA 4LKOA 1Y9DA 3HUFA 1E1KA 2FE4A 3HO1A 2WJYA 3ZW7A 3ZHVA 4UQEA 5DRXA 1JHDA 4PJFB 3RU3A 1T34A 4M8LA 3RV3A 4LCYB 2C2MA 4R1SA 3U4HA 4MJ6B 1LKZA 1O9GA 5CX4A 1YJCA 5KKCA 4I6JA 4Z7VB 1SGWA 2OMEA 4GKOA 4CV2A 3H1EA 1B76A 1U9IC 3RJ5A 5TS3A 2Y7OA 1ZEAL 3EIFA 3QH3A 1Z83A 5A5FA 5BV7A 4PJHF 1XMEB 3SE4C 2VH1A 4GR9A 5F77A 4NFSA 2K7FA 5MENE 4X8CA 3WNKA 5F7UA 3KE0A 1M2NA 1PL8A 1A4CA 3GDFA 1LBSA 2JJVA 1U81A 4D0GA 2RGRA 2VXOA 3HS3A 2R751 2XPGB 4MA1B 3IMBA 4QFBA 4U8GA 1JLKA 3PXJA 4OZHE 3L8FA 2ZDQA 1QFPA 4JGGA 2JVKA 3CVXA 4J6RL 4JUAA 4NQSB 1V1RA 1YL7A 1NJ8A 2AS0A 3LPFA 1QF9A 5CO1A 4BMVA 5E9DE 3VCLA 1A4UA 4O4HA 2W70A 3A1NA 3THXB 5CJQL 3MUNA 2HB0A 2IEDA 4XWAA 4PS4L 4BRWA 5T3ZH 3ZT7A 4JZKA 2ZXWB 1Z4OA 2BGIA 2JKVA 2BP0B 2HJLA 1G38A 1A0QH 5EC2B 2FCAA 2ZWZA 4APQA 2O93L 3EXIB 4XBGA 1UWGH 4I18B 1ZR4A 2DBVO 1AZTA 3IB6A 3DECA 4WW1B 1RC8A 3PGCA 5CU9A 4G6KH 1JSCA 3STYA 2WYHA 4BO9A 2FHPA 2ADIA 1P6UA 5EC8A 2H9IA 1MRZA 5HY9B 1RUPL 3L3DA 3WEOA 4ZK8A 2WXOA 4LDQA 4MFHA 2YASA 3EYQC 3PQ5A 2OCPA 3DSNB 5H0IA 2NZWA 1NAMB 5BR7A 2VTBB 1YEKL 4P9ML 3HLYA 1X9GA 2XZTA 2EYUA 3DKIA 1OAUL 3S8YA 5D2NE 2L19A 5TQ0L 3AFHA 4XVQA 1TF5A 3U30C 3AW9A 2BSED 5KDLA 4P0QB 4ODWB 5SY4A 1D5CA 4QOJA 3ONEA 2WE8A 4OTXH 3KQUA 1JTFA 2W6MA 1CWVA 3FVRA 1BVHA 2HA3A 1AMUA 4K5NA 3MCUA 2EAEA 3TCTA 2O1AA 1ZY2A 5AOJA 3MCAA 3W37A 4ME6A 2FGZA 1QYXA 1KJVB 4M1DH 3ULUL 1RCFA 2W9EH 4RPJA 4ZC8A 4UAOC 5ILTH 1KYWA 4X64B 2JKYA 3ASYA 4JRYB 3BSFA 3C6SB 5GGVL 1WXEA 3UCFA 4RK6A 2PGXA 1UB5B 4B7UA 5AKGA 3A6CL 2ZYUX 3SZKC 2NLOA 2GCNA 1U1CA 1GZHC 3QU9A 5DRWB 1ITCA 3OWOA 4PJ9D 3I6MA 2K9FB 3C09C 2OA0A 1UOQA 3FYSA 5JOQA 1KQGA 3RIYA 2OR9H 4WLCA 1K85A 4MXQD 1P84K 1QH0A 1MO3A 3D51A 5I71B 2QELA 1OWOA 3LWDA 4OF3A 4HFMA 2ROQA 1LLQA 2Y3IA 3OUZA 4AM0B 1UXWB 1UZ8A 2DWDA 1I1FA 1G6RH 5F2KA 5L2KD 2ZR9A 1N4XH 3D6HA 4BTEA 2O7NA 4JXZA 2HIGA 2N01B 3L5OA 1SUDA 4Q9AA 1BMQA 2Y36L 1L7PA 3L3HB 4YDHB 4QREA 3H9JA 3LDBB 2YL2A 3FOCA 2ADJA 3JQ9A 2Y3AA 4HG4K 1SCKA 5TFSL 1EWYA 2R0ZH 2QLBA 1XZ0B 3FCOA 2XSZA 2AEFA 2NSHA 3QBJA 1CFSA 2ZAGA 1BCIA 2EZ9A 2PUVA 4NSKB 4U4BA 1MCPH 5E6ID 3NH6A 1HT6A 3IDGA 3BMOB 5JCXA 5C0DA 1C4XA 2H32B 2EBWA 3W9SA 2DTML 4JN1L 1JDBB 4TTDC 4CKBA 3GGGA 2P5ED 3ARXA 5CLWA 2OZVA 4QAQA 2P46B 1XFAA 3VRLE 2ZIVB 1S7QA 3ESOA 2OCBA 1QI4A 1FV1A 1I1OA 1TVCA 2M6LA 2C4KA 1KNOB 4JFYA 4ERXA 4GI1A 3RUGF 2EVIA 1YC7A 4NP4L 4KNVA 4ND1A 4AE0A 3VPXA 3P4LA 2BLNA 4YVFA 4YHIA 4RIRA 3TT3L 2QL6A 5F89A 2N56A 3S35L 3EH2A 2X4NA 1YVEI 5B6IA 1YWGO 2IZ7A 2ZQZA 3V79C 4L27A 1AFVL 4FQ1L 1MHPL 4R16A 2ZAIA 4QXMA 4P46C 4XP9L 3WO4B 1C8LA 3K5PA 3K9WA 1B8PA 4P2AA 2ZOLB 1P74A 1U8HA 3QPBA 1VLLA 5IB4A 5FR3A 4HJEA 4P3XA 1DRUA 4KAQL 3T8YA 1DANU 4GQIA 3ICQB 2GKSA 2ZWIA 2ACWA 3E8SA 2WUCL 3HB4X 1PL3A 3Q9QA 2G1AA 3WJMA 1NFIA 2GLUA 1BMGA 3ZOZA 1SLWA 4K7PL 3FN0H 2ZJYA 1QHXA 2Z0UA 3T3PB 4PU2A 3MUHL 1X80A 1RAMA 2CL0X 2RQEA 1CIPA 1DXYA 5JXJA 1G9NC 4Q52A 1EWKA 3R0ZA 1KIRA 1S6YA 4G85A 1EP2B 2C4FT 1SFRA 3QFCA 1EEYA 1ISMA 4B3DA 3LCMA 1VLMA 3ZDFA 5LP6F 4QATA 3NB0A 1OZ0A 4ALKA 4HZ1A 4LNHA 3RC8A 1R5BA 4G8JA 1T83A 1QZXA 2DLCX 2CGYA 4PCKA 4WNAB 4MNQA 4POZD 5BSFA 4Y2OB 2IH1A 1DJYA 3PQYA 3T6ZA 5DEIA 4Y9GA 3V4ZA 5CP7A 1KIAA 3ADBA 3BIFA 4DO6A 1DAGA 4B79A 4HL6A 1UEXC 3F7NA 3G2MA 4I9FA 4NDNE 2R0QC 3QUYD 1FDWA 1SCUB 3SEQA 4QOFA 3T5WA 2BR4A 3UYKA 4HPOL 3ZDEA 1E1QA 3PFCA 4M6WB 3K2QA 3RPEA 1MA0A 3NTXA 1YDPB 1JJVA 1MPXA 1Q2XA 1MV5A 2A57A 5I5GA 3WIHH 4BFJA 1VSQA 2NY0C 4UDOA 4FX5A 2PZJA 5CBKA 2PWYA 4UQ2B 4KQ0A 3LAFA 2XOKD 1T5XA 3U4EA 1A95A 5EU5A 5CEJA 2ZJBA 5EMYA 1UFOA 3TBYB 1GC1H 1CERA 5M34A 2CJTA 2YWYA 1BCRB 3LS2A 2R9HD 1LDEA 3IODA 2FBRA 4O2RA 3W0WE 2JSFA 1YR2A 2EO1A 1U5CA 3BD5A 3FGPA 3N8NA 3D2TA 1OLXA 1JHKL 3V8RA 1GARA 3KBOA 2DUMA 4LV5B 2YMXL 8GPBA 2LQRA 7YASA 3I37X 4ZSOA 2P28A 4L8FA 1O95D 4X4ME 3W5UA 3ROQA 4EY6A 3IV7A 4WKOA 3KMDA 1JT2A 4DPLA 2W2LA 2QTBA 5L9AA 3IBEA 4FDTA 3TD9A 4QTHB 1SUEA 1DT3A 5JWHA 4A2CA 3NSJA 2ICWI 1EM6A 4EB3A 1HF3A 3V9EA 5FFLA 4F97A 2IOOA 3NCXA 2AQKA 3RWEB 3B83A 1JQ3A 1FU7A 3PKZA 2Z0BA 3RHFA 5TDPB 2OX5A 2WWXA 1JFVA 3OPXA 5AWFC 2PWHA 5T7BA 4G1FA 1VIVA 4BO1A 5HQTA 1QKZL 2DLFL 2WWFA 1YI0A 3SHOA 2W2OA 3B20A 4QRSA 3NRJA 3DVIA 2R4TA 3WCYA 2XMBA 2KPOA 3BMVA 2PH3A 2P5UA 4IEIA 4UQ9A 2XXCB 3QJVB 2R6AA 2WM2A 3O75A 3BBLA 1C9NA 3ZKXC 2DQFB 3JV4B 1JPTL 2PX6A 3OKPA 3ZHOA 2QQGA 2C54A 3QOFA 2WWKO 3H0TA 1JDPA 4N0CC 1DBVO 1RZUA 3X1XA 4HAGA 1E27B 4MYRA 1A97A 4K9KA 2AYYA 1JK9B 3E9RA 4LVHB 1J8VA 1IK6A 3N05A 3K0CC 1H2EA 3VXRD 4GSKA 4DCJA 4DIUA 3KSUA 4DUXA 1YQEA 2YBRA 4QOHA 3SDBA 3FR8A 3BWAB 3ROKA 4EPSA 3EH5B 4FFVD 4PYQA 4WI9A 4ODUA 3N2GA 4BV8A 1UDWA 2G04A 1I3RB 5E8OB 2C9BA 2FG7C 5DB4A 5KNCD 2OPBA 4MW1A 3CK0H 4I1UA 1P6QA 4GMKA 4XD7D 1NJGA 3UC0H 4PCTA 2HMVA 3HCOA 3HN5A 2XQJA 4P5TB 3GRBA 3RTQA 4HX2A 4ZGBA 1MREH 4ZI5A 4LJAA 4WKCA 1D03A 3H53A 4V2IA 4X7EC 1KI6A 5THXA 1M71A 1D5XB 5ABPA 2ONCA 4AITA 5K20A 1SB8A 2QLMA 4FFNA 4PO9A 1WMBA 3E3QC 3CZQA 5DRTA 1ZINA 3SQNA 2CA4A 4YDJB 1I33A 2H6EA 2AQRA 3PVZA 4INZA 4HPXB 2I7CA 1MCFA 2R00A 2W2TA 2VZVA 3O45A 3BE5A 3OLWA 2I71A 4ERNA 5CUQA 2ET6A 4NM8L 4WD3A 4LCUA 1DJIA 2ATKA 4KI7A 4M5ZH 3THRA 2GVDC 4EWLA 3DG9A 1CD8A 2O05A 3GGWA 2Z6VA 1U4FA 4OYRA 3ANXA 4U2BA 5KJ6A 5TD4A 4J3UA 2IEIA 3DVRX 1CBVH 2FLWA 4RBPK 3CZNA 4YDQA 4LLVA 3Q06A 4KX5A 3ZY2A 5LB2A 3TDMA 2DKUA 1TUPA 3I83A 4MMYA 2X6RA 4LDEB 1AC5A 3FF1A 3WFJA 4N24A 2CB0A 3B3AA 1JGLH 5FA8A 3PENA 3BIWA 2OL3B 5TQ0A 5B55A 1J8MF 2BVPB 3H65A 2HX1A 2V7TA 2FR8A 4AK2A 2ZKHH 2IEZA 3Q10A 4M8SA 4YZFF 3T15A 1UF9A 2XADA 2X15A 4TTIA 3OZ9L 4NRYA 1H6UA 3C5JA 2FMIA 2HCJB 2Z2XA 2NXJA 2G9NA 5TJWK 1SCNE 1SF3A 1OB1B 1NIJA 5DHUA 3U56A 1D0VA 3L77A 2Q4BA 3WAJA 4WI0A 4P32A 2DPYA 4EELA 4PYGA 2ITCA 3B9QA 5HGHB 5DYOB 1PS3A 4D97A 4BGIA 4JHUA 2X9LA 1OCWH 4ELMB 4NRDA 5G0TA 1HR0B 4HFUL 2WUVA 5ESQA 5EG5A 3MOAH 2QQKH 1D1TA 5DJ2B 1SHLA 1ZTXH 1HQ4A 1R9FA 3G5LA 1U6AL 3FR7A 2NY7H 4HKXA 4ZYZA 1O7DE 5ICZB 2GBUA 1YCDA 2XWSA 3ICOA 3W4JA 1QW8A 3EEQA 6FABH 2P5TB 5FQOA 2XB8A 2H5UA 2NT0A 1MHHA 1ZHOA 5DI3B 1OE1A 1B4JL 3GA0A 2BINA 1NBHA 4JE0A 3RWHA 2R1XB 3ZK0A 3CZMA 1D4AA 2XRAL 2EUZA 1L7RA 1XLTA 3GJ6A 1TTHA 4KE7A 4J9VA 5C35A 1ZBQA 1WVZA 1YC2A 4F7TB 4LJ5A 5H80A 5FFMA 4QJBA 5TDOB 5DASA 3JQFC 1T1EA 4Z7NE 4F1SA 1S7GA 4ZMQA 2J9YB 5J40A 4EI6A 2IADA 1IC1A 4JUTA 5GMOA 3MGAA 1IBCA 3IE1A 3IJEB 3WJ7A 1H3GA 3K91A 3MOBH 4NM4H 2WK1A 3SCMA 3NFPA 5CGBA 4H60A 5D9SA 5LQUA 5E2UL 1ZSYA 3VH8A 3GSRB 4UMSA 2ZB7A 4EOGA 4V2CB 2NM0A 4AFNA 2GHRA 3IDXL 1D9KB 5CA1B 2QQFA 4LWZA 1J1XL 1M0EA 1FN4A 1V37A 5I0XA 4XASA 1EMTL 1BWQA 3CXHK 3OUTA 4I9GA 2D2XA 2I76A 4FQ2H 3ZX4A 1J7JA 3WDHA 5LNK1 2M98A 3DVLA 3HB5X 3VHQA 1CICD 2O2CA 4LOHA 1M6VA 3WADA 1XTUA 2H2WA 1NCAL 2ENQA 3II2A 1NVMB 3AERB 3AVXA 3UBXI 3EQ8A 4N8PA 2YMPA 4PANA 5IN4A 4JM4H 2ZG1A 5DRYA 4X8MA 1XSJA 3IHTA 1NI4A 4UBLA 3SEPA 3L5XH 2AXPA 2UYGA 5D1ZI 3FJYA 3B6ZA 2D0HA 5HA5A 4WW2A 2J5RA 3F7YA 1FX1A 4PY7B 5J13C 4WOJA 1EGQA 2FWAA 3E9NA 3GSVA 4YFLI 4OCYL 3JTBA 4YX9A 4P2OD 4Q39A 4DQAA 4KO6A 1JWMB 1M7HA 4GXVH 3NLLA 1YJQA 1K4YA 1Z5OA 2FN9A 1JWSA 1VPDA 1XV8A 1ZDMA 4B47A 1CYWA 2AS5M 1OQXA 3OZIA 3VJ6B 1TL7C 1F7UA 1RH8A 2AXGA 4X4KA 4L8BA 3G59A 3TPCA 1E7YA 3TQRA 1S46A 3T2NH 2VWEE 5AW6A 1IM3D 1NKVA 4QHNA 3SSGA 2OLDA 4R7LA 4J1TC 5DPMA 1SJEA 4ASUA 3CU5A 3L4XA 3BKCH 1HH4A 1B26A 1XMWA 4HLZH 4GZ5A 3FNQA 2ZUDA 3SIXA 4OD3H 1FS4A 1XZLA 3JQ7B 1DE4B 4HGRA 2YD6A 3DV4B 5HX7A 2XD4A 4JCMA 1EA7A 4YP0A 4NAJA 4FD2A 3S29A 4ENUA 4ENZA 5CDHA 4YQXL 3S8WA 1ULSA 4YRKA 1NR5A 4MV3A 2H3HA 4FTVA 1QRNA 3KDSE 1Q1QA 1EWTA 4Y2PA 3W3ZB 1TCRB 2CK0L 4EI5A 3NZHL 4C2BA 4EKYA 1ECCA 2AN4A 5C4IA 1NGXA 4AU1A 4XP6H 5HJ2A 2GH1A 4FQQA 1Y1LA 2FKAA 2XYCA 2OECA 1H65A 5FBQB 2JE8A 4YHMH 1HHJA 1VG0B 4GXUM 2PWPA 5FBKA 1PJZA 2O9JA 4X6BB 5I5MA 1WLSA 4R54A 3ZEAA 4DIOA 3MT9A 4JBIA 4MRMA 3ORJA 4G3YL 4TXLA 4NEHB 5A06A 1E58A 4HDRA 3DLAA 3B6SB 3FSJX 1YLBB 1MH5A 2Z3VA 1RYFA 2EKQA 2P42B 2HFJA 1BVKB 1AK9A 4RKFA 3KJNA 4MWBA 2AJZB 1UBUS 3GIZH 3G6JB 1KFEB 4R8MA 1RJLB 2ZRCA 3ZMRA 2GX6A 2F8TA 4OHBA 3EF3A 4X4YB 1AUOA 4QBHA 2NY6C 3O90A 5C5EA 2EVHA 4TUOB 3F7TA 2CO7A 3WLFA 1YQXA 3C5ZD 3MV7E 2L0XA 3CFBA 4HRVA 4WCDA 1NC2B 1KPUA 1V3TA 3STBA 4L4UA 3TFWA 1FDOA 3DEHA 3CW8X 3QZWA 1NW7A 5A2CA 4NPKA 4PC7A 2YZMA 2VLKB 3FT1A 3JZFA 5F88A 5AHWA 3OKYB 4XDYA 1BZ8A 3B5TA 4NUPA 4D3XA 5EL0A 4Q6WA 4W1SA 1MG5A 4L15A 1ULAA 4PY2A 3EDDA 5AI0A 1IJNA 1G9XA 3I50L 5KYUB 4EDHA 4YRGA 4LLWA 3DTVB 5T64A 1ROWA 3SPVB 4GSUA 2E46A 1JDTA 1L9SA 1JRHI 1YEIH 4XNXL 1A6PA 1OYVA 2JCSA 1J21A 4GS5A 2J8UA 4OZFA 1REQB 1G6RB 4RA9A 2C9MA 4M1TA 4EQ6A 3JWNG 1CDDA 2DI9A 3NHPA 1IKFH 4CADB 4I4NA 4MW6A 3MXVL 3ULVL 1NR7A 3WLHA 5DGCA 1QFSA 4F4HA 1QGOA 3MPCA 4JB9L 1TCBA 2NO9A 4Z78B 5FNVA 2C2BA 1MIML 4XCVA 3NYQA 1N64H 2ZKYA 3UMGA 2YJ3A 3ZNOA 3WIVA 1XEWY 3D3EA 3O3MB 3DULA 3HA5A 1Q6YA 5E8NB 4RZIA 3VQTA 5DTJA 5J1SB 3LQAC 2QUKA 5JXEA 3QDGE 3W3AA 5DYNA 1SBQA 4Q2ZB 5ECWA 1XD8A 4PJBE 2UXTA 3QYJA 1MX3A 4FFOA 1VBFA 4KR3A 3A23A 4H1WA 1TTFA 4M4RA 5FDYA 3TIEA 1QIEA 2FJGB 2I8LA 4O2CB 1SOKA 2XYRA 1I1YB 1XEXA 4LCWE 3QHQA 2HCFA 1XIWA 3WLSA 3PWUB 2YD7A 3HDTA 1TO4A 3ZHKA 1POWA 3VDCA 1QF7A 1X77A 5IBTH 5BRAA 2IANB 2W65B 1YDEA 2XTZA 2P9BA 3F85A 5AB9A 3FD8A 1S7XB 3ROMA 3VE0B 1X87A 4L9LB 5AVOA 5C7YA 4OBSA 4F1WA 1KB9K 1GW0A 2B8NA 5K0SA 5L53A 2OVFA 3E3LA 1VEPA 4L1BA 1J5OL 2OMVB 3HXKA 3MCTA 5FA5A 2VN3A 2AXJA 3ZKSD 5DMGC 4O5LH 4JEHA 5JO5B 2EDNA 1OHHA 1TJXA 4YH1A 2VSNA 1B1AA 5J11B 4DVRH 3D7SA 3V6MA 1I2DA 2FF5A 5DYWA 2J9XB 3L4TA 4JDTL 2I4NA 3ABQB 2PHZA 1GIGH 4YS6A 3CHYA 4HJIA 3KPRE 1ZT7A 1VM6A 3ZKNC 4JQVC 4J4PC 5JHAA 4R1QA 3QI2A 1ZLWH 4DR4B 3NUKA 5A4JA 2DUWA 2WIGA 5F0PB 4HDIB 1DZ0A 1G42A 4LLQB 5ICXB 3U48A 1BX3A 1OWMA 2QFPA 4OB7A 1UDCA 4NQDE 3EF1A 4EG4A 2RKOA 1WSWA 2CUKA 1BPVA 4W7SA 2UZ0A 2K7QA 4KNTA 1KGYE 2B78A 3AIMA 2GVZC 1OT1A 3LE8A 4HHGA 3BH8A 1LQUA 4KN8A 2WE7A 2F19L 4QHMB 1Y82A 4XGIA 4O2AF 3WYFA 4Z1MD 5FBVB 1AIFB 3BE6A 4MR8A 3CQ9A 3WLJA 4P3WA 3ZWAA 3QA3A 4MTLA 1GQRA 1SVSA 1E6KA 3Q5DA 1RIHH 1PEAA 5AXBA 4YR6B 5D1ZD 1XCPA 4RK1A 2YEZB 4K6OA 2IYWA 3EJYC 3N40F 3X1JA 1GAXA 3F90A 4HS3A 5EMNA 1I7TA 3M4NA 3WE6A 4BOYA 4CBZA 1JHTA 4LZNA 1UZAA 1NW6A 3MXOA 4B3FX 5HYVA 5LIRA 1XB2A 3K4QA 4G01B 4JAMA 4NZFA 1E4YA 2JEOA 4Q19A 4PJDB 4CSSA 1M33A 2X7JA 3SYNA 1TZBA 3K70B 2EZ8A 3EXFB 4PXYA 3C6EA 4GRMA 3TOPA 4WKXA 4CLHA 4KMLB 4D4IA 2ZE0A 1ACJA 4D4HA 4HEHA 2H8PA 5F2EA 2K6YA 4HNUA 4GQ9L 4CFYA 2QADD 3C08H 3IS0X 2HG0A 3OUUA 1C50A 5IDVA 5KYKA 1ZN9A 4YAKA 1NFDF 4LRXA 4AGQA 5C3TA 1EXMA 3ETDA 3KQVA 3H6KA 4CL0A 3GAAA 2XBZA 4CVZB 1JB1A 1T3FA 3GSNH 5HPMA 1TPZA 3IE9A 4ZBJA 1CF8H 4UU9B 1ET7A 5IJAA 3EDKA 5DISB 5IAEA 1Y18A 1EJ0A 4XLZA 2YIVX 3QIVA 3ZUNC 1N5RA 5EIIB 1ZI8A 1ZZGA 1GQOA 3CX5K 4FZEL 2W8ZA 3REQB 3D3WB 4LK2A 4MW0A 1DQJA 4HWBH 5AALA 3TUZC 1X5GA 5HYJB 3CVHA 2ZM6B 1PEKE 3E1KA 4B97A 3L8YA 1M0TA 5AK5A 5GISL 1QHYA 3IOYA 1IAOB 5JY1A 3I6KA 1T8SA 3RY6C 3QIBD 1KV3A 3MRCA 4E6EA 2NY4D 3SBRA 3IAEA 2VAAB 4FS3A 2ZJ1A 3EDEA 2G9HA 2HAEA 3PVCA 1LZLA 1NCWL 4MUKA 2R7LA 3VKWA 4FE3A 2RGNA 4HF5L 4ENEC 1C41A 2HM7A 4KYUA 1CZUA 4B43A 3HE7A 3MMSA 4K7FA 1EVYA 4C6HA 1GQFA 3NDZE 5I3CA 5JUEL 1IMJA 2XDAA 3DKPA 2Q76B 3DE1X 4MVCA 3SHWA 4XBMA 5ETUA 1Q0ZA 5AOKA 4O0LA 4RK5A 1BVNP 5JOFB 1BF5A 3ULAB 4Y5VC 2DQDH 1X4ZA 4LYHA 1T2EA 4GSYA 4CR8A 2COUA 4M00A 2RJ3A 1QO0D 1FNNA 1BMDA 1CTMA 3M1BB 5LNDA 4BQCA 2O4UX 4Q82A 2BJWA 1M6OB 3APCA 3BUIA 5AVXA 3ZUPA 3V5HA 2R6DA 2BGGA 3UTTA 4XN7A 2R8XA 4PYKA 3HPJA 3F6JA 3QU2A 2B82A 1JGUL 3CEPB 4KJYB 1CEXA 2ODHA 2ZJFA 5C3IA 3RAJA 3AVVA 4DXAA 4GMFA 1I3GL 5FPKA 4FMVA 2ZBRA 2EH7L 5TPWH 2QT6A 5DJ5A 1EO8H 2QQ0A 3V1YA 1LWJA 1SVMA 4MKZA 3BSZL 2CXQA 5EPEA 1KVQA 2VYNA 5BN4B 4PRBB 3D7RA 2WQAA 4ALAH 3TJHD 3EJRA 2X2UA 4WCFC 4XIFA 1E50A 2R1VA 5FM5O 2Y07L 3EGXB 4EMTA 2H57A 1QO3B 5IFAL 3D6JA 3D4PA 4YCSA 3D3VB 2IXFA 3QWNA 4PTUA 4D8XA 2Y6SD 2R4QA 2IDTA 3D3KA 2YY7A 5EG6C 4HUTA 1MIEL 1EU1A 5A3VA 4LCJA 4ACBA 3ADKA 3BAJA 5ESDA 3NIDF 1B0PA 3UICA 3H8NA 3UMMA 4X7PA 2OC9A 4ZPJA 4YO8A 1G94A 1RSFA 5JW3H 2X88A 4UTAA 2O61A 3EW9A 3FCCA 1L9MA 2CYBA 3LZDA 3Q3HA 4GRWF 2CDFB 4BS9A 4J39A 1PUJA 3AYXB 2C3VA 1L3IA 4KK4A 3DI2B 5IAGA 4KKCD 3HCAA 1S7CA 3KE8A 1G6KA 2JHAA 4FCHA 3THMH 1GPMA 2C9QA 3K9BA 4GEIA 1CJBA 2P8JA 4L02A 5CP8A 4GI9A 2FZ5A 1AKJA 5I30L 4LSRL 4BB5A 5FWAA 2X1VA 3KPVA 1XZNA 3AI1A 1GS8A 3T9EA 5DBFA 3GPDG 4LHXA 1HYHA 4ZQEA 1BVLA 3ZDXE 5FBRB 4MRNA 1HGXA 3H54A 2QJRA 3JBG7 3UK0A 1B42A 4HZLB 4DVBA 3ZOKA 3EO0B 5IQ9A 5CR8A 1KGJA 2IDJA 4LRQA 5FHRA 1RUML 3DJFA 1D5IL 4KVNH 2PCYA 4Y2YA 5DA4A 3SPHA 1M34E 4U6HB 1RMQA 5K03A 1CFVL 1E5TA 3AG3B 4LSQH 1B2YA 4X8GA 3SGKC 1TZOA 3BXZA 4RVFA 1W88B 5AFAA 1K68A 4GINA 3BH4A 4FNMA 2GSWA 5AVWA 1VE9A 3BDYH 3GMPB 2EDAA 3HB7A 4L50A 3C4QA 1QGUA 2YC4C 4UDTB 1JPGB 5AWNH 3WOVA 3DRTB 2E49A 4YRFA 2IDMA 1FA9A 1S9YB 2RIRA 3OKAA 3WWDA 4DIKA 1Q0EA 2Y7SA 2DRUA 1UC4B 5TMBA 3WFEL 2CEAA 4AUYA 3U1TA 2E89A 3GK8L 2VR6A 3IV6A 3CCBA 1EO7A 4MCJA 3CDZB 3KGRA 4NJEB 2I7VA 3LCRA 2A5UA 3M2TA 3VZSA 1I9IH 3DBLA 4JR0A 3U44B 2W2QA 3OQOA 5CB4A 3LFUA 3CSYA 4DH2A 3QJXA 4KPFC 1A3LL 3KKLA 4DEPB 5JPNC 4PJ8B 3BWSA 3HADA 4F21A 4C03A 5TE6L 3ED5A 3SX4A 2HKHH 4HZUA 4QXOA 2X9YA 4RNDB 2ZKIA 4K3UA 3HMWH 4Z95L 4LP4A 4XFKA 4PWHA 3EXHC 5FT9A 3B7UX 1F86A 4L29A 1JVNA 2W80C 4HX1A 1ZJAA 1I3NA 1QSVA 1VPLA 2Y5TB 1X6VA 2HK7A 2WJ4A 2CWRA 3ORQA 3U4MA 3KQPA 3Q13A 1XTJA 3KALA 1GTSA 1SCBA 1ZJJA 3PCXA 3U31A 1R24B 4XNYH 2ETWA 2YOHA 3T5TA 4ZAXA 1KACB 3PUIA 3UXFA 5JDJA 4PNZA 1DBBL 4QZVA 3TL3A 3ZDCA 3PA8A 2PG3A 3C3PA 5K0GA 5F7NC 1RK0A 2Z4QA 1CXLA 4XWOA 3DYMA 1OQAA 2EIZA 3ZDWA 4JYZA 2R7EB 3W2EA 1NMEA 4I3FA 2Z34A 1YRWA 2GCOA 3A1CA 4JJAA 3GVHA 5ACLA 1DIOB 2ZS8A 2BPOA 1XROA 2PGIA 4BATA 4IGBB 4Z7UE 3H2GA 1GUDA 5E4IA 4KVGA 2WYZA 3QDAA 3UAZA 2HF7A 1AZUA 4HIQA 1ZCAA 4U02A 3QYMA 2INGX 1Q9WA 1DUIA 4NRXB 5CBAB 2D3TA 3FB7B 4KK5D 3QY9A 1OZAA 2WXKA 1MUJA 1G0NA 4A6EA 1F45A 1OVZA 4QWWD 2PK3A 4A0QA 1ACYH 3DX2A 5FUVA 2Y7LA 2ICWB 1T6VN 1QHHA 4PD4J 4ETQA 1S7VB 2H2GA 3AM5A 3A67L 4F71A 2BS71 3OQRA 5AJUA 3MT7A 3EF0A 3QVGA 1GAWA 3JYHA 5DLML 5JIKA 2PR2A 3B6IA 4D3YA 3PGXA 3MLTB 4BFVA 4TOYL 3DOJA 4GYWA 2VLRB 2QLLA 2B98A 2EIEA 4FHBD 2GB2A 1FFWA 3OMAB 5K6AA 3IQDB 3C48A 3KAKA 2FW1A 4IUYA 1E5QA 3AR6A 3JZMA 5FYJL 2WXHA 3ICEA 3Q48A 4PRDB 3M45A 1V96A 4FNSA 3JVGC 3WIDA 3OD5A 3R3HA 3RWBA 3FPSA 1CT9A 4LHEA 3FPFA 3I9GL 4YSUA 3OFJA 5BVPH 4UXJA 2OAP1 4WEQA 5CR1A 3Q5YA 3TS8A 2BGTA 1GTRA 3ELQA 5TF4A 2NO6A 1T20B 3LXBA 1CT8A 1VLXA 2XXAB 3VWKD 4A5SA 3ER8A 4L0MA 2ZJ2A 3BW9A 5DW3A 3C0KA 1I30A 3CGTA 2H16A 2HC9A 1IAIL 1V41E 3H6HA 4TV9A 1YEHH 1DARA 1YMHA 1JVSA 2E9GA 3QWRD 2MSCB 3QF7A 3RVRA 2P1RA 5ALNA 1NGQH 5NULA 2XNCA 2X1MA 4DOMA 5FA6A 3TGWA 4R1TA 3BF8A 3FQTA 4UT6A 5ITFB 2O06A 5IJ9B 2BIPA 4IXNA 3Q2NA 1I7LA 2C9XA 3VU3A 1NT2A 2IZOA 4GMDA 1GSMA 3UB3A 5C08D 4H7EA 1QP7A 5CBEB 5IF0A 1F12A 1AGCA 3P4YA 1ES9A 1HILB 1U8PB 4RGVA 1TKBA 1MO5A 1UZGA 3OIYA 3WQHA 4ND7A 1VGKB 3A3KA 3PUYA 5SX5K 3UV7A 4CJ0A 2V59A 4AP6A 3UATA 1N8SA 3VXSB 2NVWA 1Y1KE 2QUAA 2W91A 1RAEA 4JUCA 4Q9IA 4J03A 1N67A 3I58A 1PBYA 5KAQG 1RKQA 2M32A 1UZ6E 3KWTA 1SSLA 3A4MA 2AXEA 3LLSA 4AG5A 2XFGB 1E9DA 4FR5A 2DL2A 2E4ZA 2GF2A 3D9AH 1XNQB 1KJZA 2M9MA 1ICIA 4Y4HC 3BA6A 5INDB 2BKXA 1C9SA 4HMOA 3CX8A 5CMLA 3KB2A 4WF7A 3LTEA 4XZUB 3KKMA 2GUGA 3A4EA 2AOUA 2QL1A 1FSGA 1R4NB 1U8CB 2V3CC 4K40A 3V2AR 2ECQA 2J4CA 3LDUA 4XR9A 3UMBA 2EDFA 2K8QA 1D6MA 3G1TA 3B7WA 1AGBB 3TEJA 4AGLA 4NP6A 4BQFA 2FHCA 3RX9A 3E38A 3O8XC 3HR5A 5A9RA 5I1IH 5B7MA 1FVFA 3AYZB 2O3UA 2OOSA 1JFHA 2I7OA 4S1TA 4JLOA 4N7BA 3GBLA 4QUEA 3ESBA 1NA5A 1UMCB 4BZPA 1KI2A 4FHEA 3L82B 2W2VA 1R3DA 2F5BL 1WZMA 3KKOA 5L4FA 4JUSA 1O77A 2X4SB 4GPTA 5GRVK 3O3NB 3FJ1A 2WJAA 1F6LL 3IF1B 1SBCA 2AP2A 2V4LA 2TMDA 4KDCA 2YVKA 4OJTA 4OUDA 4CU6A 1ZEMA 2W37A 1KPVB 1V3UA 5JD3A 5CHNA 3MRNB 2GUWA 5HP5A 1QXSA 2QPOA 3MN8A 1EQAA 3K6IA 1KVRA 3TA3A 3FJTA 4WY7H 3BSZA 4O4YH 5BNXD 4DTGL 4UDUA 1Z0KA 4NO0B 4IS6B 3HZMA 4BDSA 2OKMA 3JWNH 3E1GA 2NO4A 3BKWA 4WIAA 5D51S 3DVSX 1ZD3A 2ESVD 1MTOA 1T24A 3QUMH 1TNDA 2HH0L 3NEEA 5DWPA 4JS0A 1ZMOA 4RD2A 2RGBA 1HZHL 1HV8A 3PPSA 2ZLBA 3FFBA 4IO1A 1OSNA 2G4LA 1ZN7A 4BKQA 1D5MA 2AK4B 4BEIA 2ZSKA 3TRHA 4KZDL 4GUDA 5DO8A 5FAAA 2N42A 1VEMA 4N1AA 3SDXF 4ZXFA 5ITBH 1GYAA 3CZPA 5DYTA 5JWOA 2FA9A 4AS1A 3GBDA 1NBQA 4KPHH 4XNQB 4QWMA 1JQDA 2VTDA 1A4JA 3S99A 3B53X 2DMHA 3P0VL 1U99A 2HMIC 2NU9B 1T6BY 1THGA 8OHMA 4DR1B 1ZOXA 1SBBA 1P8JA 3WL4A 3ZK9A 4RWEA 4OHOA 4U9UA 1FNLA 2WUBH 3CN1A 5FOSA 1B9ZA 3D6AA 4PSUA 5JHBA 1CYDA 3GRCA 5KVEL 3NABL 2YNMC 1S5HA 1E9QB 4RQQA 1W5AA 2GKIA 1N2GA 2J9FA 5J1AB 3E48A 4AJPA 2PP9A 1EX1A 3OHXA 1VDMA 3T1HB 5CHYA 2HY7A 1SBHA 3V6BR 2O5YH 2HRDA 4RHCA 4OQTH 4NQED 2ZYDA 5E2AA 2A0XA 3UJNA 4XEUA 3KB6A 1FZMB 3VX1A 2E9BA 1TU2A 3VRIB 3K6SB 2R7KA 5E6UA 1ODSA 5DOZA 3R4RA 1QO7A 4PP2A 4ZRNA 3B2PA 4NICA 4L2IB 3N2KB 4JFRA 3AF1A 1M7GA 2GCEA 1UJNA 1QAQA 5J1TC 1NPUA 3DDGA 1EXHA 2Q07A 1HOEA 3MJ7B 1Z06A 2D1RA 4I0PD 5GIOE 3MHPA 1IPFA 4D0NA 3GS4A 2AT1A 2G75B 5DD3H 5DQDL 2NAPA 4LOKA 4ADIA 3E2MA 2VHUA 3MRIA 2R62A 3EYAA 4OXXA 2VHYA 5JDCA 1LDNA 5DNYB 4ZX4A 5JMTA 1ECFA 4QUOA 1L4FA 4BY9E 4HH3C 4QU8A 3V4FA 4OBXA 2R2EA 1EH9A 1ZTMA 3PL6C 1AQYA 1G4MA 1ZKDA 4DVGA 5EMKA 3GSNB 5ALZA 5E6RB 4KITB 4N2NA 3D39B 1URLA 3UX9B 1WMFA 4MKXA 5E56A 2VSMB 4EKGA 2FDBP 2H0EA 4LDJA 4TQIA 3QUKA 4PRPD 3VUFA 3TLGB 3TVYA 2JKXA 4BO0A 3H2IA 3CPEA 5C9ZA 4NKDA 1P9RA 2AGJL 3B60A 2X86A 1JR3A 2ZPAA 4G7VL 1K5GA 3MO1A 1AGDA 5C51B 2ZIDA 5BV7L 3ZTDC 1NVVQ 1MRFL 3TNMA 3EGEA 3BTUA 3CFEA 3FU7B 1L9QA 2V2XB 4OFDA 1UL1X 3HG4A 3RS5A 4Y4FA 2K2WA 5C3UA 3QEQD 2ODIA 4Z77A 5SWSD 3K6RA 2BSSA 2I4TA 2OHVA 4NBYB 3HJTA 4KMTL 4OI0A 4HYTA 3AQIA 4FUTA 3U2SA 4ZMXA 4UUJA 5BY2A 3KJ4C 1PGNA 3NA9H 4UBJA 1UPAA 4YEEA 3O8OB 3W7AA 4JFZL 4NIMA 3NPSB 3UUFA 3IDAA 5HM6A 4PONA 1AUQA 2NXYD 3NSCA 4OI4A 3HRPA 3WV5A 1SXPA 1MTZA 2WIDA 3ZI0A 3UAJA 3RTCA 3VSAA 1H4TA 3OAAA 4QRHA 5I8WA 3B1VA 3GM8A 4QLRA 1FFAA 1HYSC 3GLIB 2GC7C 1KZ7B 2IS6A 5AVRB 4F3NA 1I4EB 4HMPA 2F15A 5JQGF 1RZ7L 1ZY9A 3AZUA 8ATCA 2FNWA 3D02A 4HWSA 3SS9X 3TV3L 2AN5A 4RMBA 3A9VA 4S1RH 3W77A 3PUWA 2WWNA 2B2NA 1HZZA 4YDZA 5HK8A 3SIWA 3KYDA 1NC4D 1RUAH 2FWBA 2QSJA 1QLFB 4G5QA 4HB0A 5L40A 4K15A 1YQUA 4K5QA 2OSYA 3AXIA 2BNRA 3SVTA 5SX4H 3SF8A 3KUCA 2BOCA 3DFIA 3TONA 2ZXAA 4WBSA 3HKDA 4OD2B 1RQRA 1R5VB 5LMNB 4BLTA 2MSEB 5ESXA 4FQ8A 4WVLA 3S36X 1L7AA 3NESA 1KO8A 4YLEA 1M8FA 5TPWB 3EZNA 2ZIXB 1ZA1A 3F71A 3LZFL 5AOVA 4KO2S 3TTTA 4KIFA 5LKAA 1QQBA 3B3IA 4MRAA 3OEHA 1F9AA 4DP4X 3K1TA 3WGHA 1HEYA 1U0NA 4X62B 2WZ5A 3DVAB 1J88A 4N47A 2NUBA 1T2XA 4B6FA 5TE7H 4O02H 2QYOA 2FWUA 3MINA 4GM4A 2GN6A 3I3OA 2B0SH 1KTLB 3L54A 3CHOA 5KTMA 1OGPA 1G4RA 3QDJD 4NWUL 4QUBA 4UM9A 1H8EA 5J8OA 5CT5A 2I69A 3V80A 5DVPA 4CU5A 5F1NA 2X10A 3VD0A 1U3TA 2OV6A 5DJ0B 3S5LA 1F60A 4IDFA 1NV8A 4M9QA 1WV0A 1DJOA 1FK8A 1BJ1H 1IWBB 2VMFA 4HUUB 2VJLA 2XMDA 4U3SA 1OGAE 1KZHA 3U3ZA 5D87A 3FT3A 4B9ZA 1OAOC 4EEXA 3HNSH 3D59A 4DW8A 3GXDA 2PD6A 4J1QA 3ZE6A 2RB5A 2AZUA 2HF8A 4UD6A 3G3LA 4CCSA 4MWFA 3JSXA 4D8VA 1LUAA 2ZBFA 3WLNA 2P9ZA 1KI1A 1SAYA 5IC5A 3IOEA 4MYSA 1CUXA 4NOBA 4RULA 5BWCA 1YS4A 3EO9L 3EVTA 3EKCA 4UHDA 4Z0XA 2V8BA 1DHKA 1OSPH 5E7FA 4PXAA 1GGHA 4F6RB 4CEIB 5EE5B 4XPBL 2NX5A 2Z1NA 4JKOA 1TM4E 2RGGA 4MNQE 3CSGA 1KWGA 3PQYE 3K96A 3MGBA 1Z6QA 1GAEO 4NAMA 3VD7A 3S48A 1V5GA 2YHGA 1T5HX 4G9FA 3HS8A 1W9XA 1L9RA 3ANSA 3P3RA 1H3WM 1T4CA 1FEZA 5G4LA 2CO1A 3WIUA 4R84A 4S0HA 3BMNA 2J31A 4NBLA 2MSWA 3BKML 4YJ2F 1BMFA 1W9MA 4YPOA 1F4WH 4KQ1A 1H6FA 4E5MA 4L85A 1NA8A 2E27L 4EO7A 1QNIA 4RRPA 4RVGA 3BRSA 1KI3A 4Z9FA 4K2UL 1DN2A 1TB4A 3MV8A 5L7TA 3G6DH 4G6MH 1E4EB 2YIMA 1ODJA 1Z0JA 3D07A 1KDYA 1YPZF 4MA1C 3DTYA 3F6PA 3IXQA 1L5QA 5DSTA 1U3UA 2YFOA 5IHLB 4KOEC 2AEMA 2IHTA 2N0KA 1A9XA 5IVDA 3UAOA 4PJEB 4HIIB 1D4FA 4TYYA 2FATL 5E95B 2M26A 1JS4A 1FFNA 1HOXA 1CE1L 4ZTZB 4YTEA 4Q01A 4GG1A 2I6FA 1S8FA 3ESPA 1N0IA 3FFCA 3UWOA 5D72L 1RJZA 3MIIA 3IBGA 3SY0A 3V8VA 4GKSA 5I16B 2MINB 4ZSOE 1MY5A 3CVBA 2F00A 4F7PA 4LKRA 5EWIH 5E5LA 1J1PH 1A6AB 1YQDA 1IOVA 2AKRA 1T9AA 4I18C 2PIDA 2ZS9A 5E7MA 2F18A 2XZCH 1JG4A 4IG4A 4LXHA 3MBOA 1FQOA 2PAFA 1PJAA 4GBGA 1DVUA 1GPNA 4XPFH 2ID8A 3QJGA 1ORQB 3ENKA 1K5DA 1W35A 1KXVA 4KSBA 1AA9A 1LK2B 3B89A 1UQUA 2R7AA 3FYHA 5DLEA 4CCWA 4KAXA 1F1GA 4ZP1A 4GX1A 4OG2A 1KBKA 4UHFA 5DSCA 2DD8H 4DO5A 5IUNC 3PAUA 1U3HA 5DHAA 5IEBA 5B1SA 1P1ZA 2IWHA 3KJFA 4MSUA 2MQ3A 3WSQL 3WYEA 2QZ5A 4I2XB 1BC5A 1P4LA 4F4CA 5IUJC 5DCUA 1HC1A 4IIQA 4N0RA 3HUTA 5LB4A 2OGUA 1EDHA 5B5SA 5KPJA 1NUHA 4WN9A 2J73A 1BZEA 2ZSVA 5DS8B 4ZQTA 4D9RE 1PGRB 2VQDA 1BPLB 1C8PA 4AMYA 5FWYB 3ZY3A 5H02A 4LGYA 4QIHA 1N26A 4RPLA 2HKIA 2F4VB 3G08B 2ZUWA 1AE6H 3CVIH 3OKOA 1G41A 2BY3A 3SDCD 2R29A 3IAM6 3GEFA 4M54A 4P81A 3EZ6A 3MGTA 2IEYA 2VQ3A 821PA 4Y0GA 4YGXB 1HL7A 2OBBA 4YPGB 5BNZA 3ZV3A 1EBUA 4NZNA 1I7QB 4DT1B 1NN5A 3G5YB 3BUBA 5CJBA 1KOAA 4A7GF 3KSMA 1IHYA 5GJTL 4XVSH 3WN6A 3VFUB 3ZDYB 4HNSA 3QQ9D 4LOUC 5HVNA 4EGAA 4R9UC 3HZVA 5I71C 4YCDA 2IFFH 521PA 2VK1A 2VPXA 3RB7A 3IAUA 3NIFE 1PX0A 2OZNA 3RGVA 4XXDB 3VA6A 2OZLB 2RQ8A 2VW4A 5IZCA 1X70A 3SDAD 4YBQD 2GJ6B 4G8GB 2VHVA 3ZTNH 1JGDB 3TBTB 3IPCA 1NQWA 2GKOA 4E9YA 2EBFX 4JY5H 5FO8B 1THCA 3WY4A 3S96A 5DTEA 3LDBC 4XX1G 2Z64C 5A5EA 3AM1A 1CB4A 3CJTA 1Y1UA 5C52B 5DT1L 2BIFA 1BGWA 5AW2A 4XUGB 4X9IA 4DWHA 4EYOA 4AUJA 5BWBA 2X5NA 2NT3A 4N90D 3NRFA 3MB5A 4HA1A 5AR1A 5C8JA 1Y6RA 1EHNA 2DQEH 4IBVA 1JDBC 2NCEA 3LZPA 3N2LA 4YJFB 4GO6B 1XLWA 2HSGA 4YDVB 3NQIA 3U3MA 2H2IA 3V8OA 5FR2A 1HOCB 5KSPA 1A8HA 4IZ6A 2LZ0A 4BUZA 1LDPL 3IT0A 1AQJA 4KKBD 5JYLA 1T91A 5FECB 4PC6A 2HSDA 3LJ3A 2QR0A 2CFCA 3HJRA 1XD0A 1T7VA 1IN5A 2Q6WA 2FZ3B 4DFDA 2HVJA 2WTRA 1Y3HA 4PVMA 5K39A 3ULUE 4FNRA 2HA6A 4FYJA 4Z3OA 3M81A 3UJ7A 4G4GA 4MV8A 2ZE6A 2O1EA 4TSFD 1XVAA 2X2YA 2DM2A 3UZVA 1N6QH 4LLYA 2QTNA 2GPWA 3WO4C 1GL3A 3MYRA 1Q38A 3LQZA 2QUHA 4EMZA 4TYWA 3K0BA 3IE2A 3TRIA 2PN5A 2PN1A 2QN7A 4E0RB 1U8KB 1U9CA 2W6NA 4L8SA 2HT6A 1ZV9A 1LPBB 4KTYA 3H2SA 3NORA 4PR3A 1WFUA 4OFPA 4K2AA 1TRKA 4YDSA 3FUFA 5JCJA 3T4AA 5JG7A 4H4CA 5IK2A 4HCFA 4WWKB 4R05A 5I8CA 5C81A 3FCAA 1TYRA 3FNGA 2X6CA 5AW1A 4ODSH 4F2WA 3DC0A 1HLFA 1FYTA 2VMCA 4HV8B 2LTQB 2QYTA 4JJ4A 2FX8L 1VBNA 1LBEA 1ZPDA 3X11A 4U6XB 3D7NA 3DO7B 3PJNA 3JAKB 5K93A 5H83A 1TEVA 4KXNA 1G9NL 2B7LA 1BWWA 2Y1WA 1UIMA 4OZGA 2K4WA 2N1TE 4I0CC 4ZFGH 4XC3H 4U1GB 5KTPA 4TOIA 1QOKA 2WFLA 1X5AA 1J5XA 2M1KA 5AKSA 1PAUA 2A83A 1E7WA 4A5OA 1BHQ1 3Q3GB 2JIPA 1RZIB 3ULSB 5E2TH 1C5DB 3GIWA 3DEIA 4RSGA 3VYNA 1FUUA 1KENH 1KLGB 3TQFA 2ECPA 3O2WL 1JP5A 3LAWA 1CYXA 2Q2VA 3VO1A 5GRXG 1RK7A 4LO9A 1UA7A 4B4DA 4QTYA 4WY5A 1T8YA 1ZC3A 2VS1A 4KI5D 3F73A 3R6TA 4ZFQA 3VSBA 4DGIL 3QIUB 1F41A 4DPRA 2CHXA 2SKEA 2XW6A 2ZYGA 4ZMZA 5EV7A 4LBAA 4B96A 2PCPB 3NT2A 4N18A 1LILA 4P5KB 5C0BB 4PHCA 3CLSD 3E9QA 3GJ3A 4UHCA 4G5YA 4NE7A 2WGXA 2JJWA 5JNTA 5DMJB 2BW0A 4B27A 1UH5A 1P5ZB 1NW5A 4TQHA 1E8NA 3H11B 1GNRA 1TQUA 4RKQA 2OO7A 2HXSA 3S2EA 1ZRNA 1UFGA 3DDNA 4KVCL 2AMYA 3V0VA 3CBGA 2WBJB 4I89A 3X12A 3QUMB 3KVYA 1S3SA 4IOMA 4BVAA 2CJWB 5IVOA 1H2ZA 3MTAA 4U1HB 5C92A 5F7EH 2VDLL 4NECA 4ZRGA 5K9OB 1HE4A 3S2IA 1SKMA 1PVDA 1Y9EA 4WHMA 5DD6B 5L4JA 1F2UA 2Q5EA 4UQPA 2YC1A 2H1SA 1T9ZA 5A4DA 2ZUVA 4L9SA 5EEYA 5FPQA 5EO0A 2IYNA 3DJYA 1W8NA 2NUTA 3DE6X 4EY8A 2GYWA 3OMWA 5FPIA 5K7SA 2A2QT 2PO6D 1YYML 1TETL 5L3QB 1CY0A 3BQUA 2GCGA 3QNZA 3IWVA 3W5MA 2YPVL 4XGRA 4CKWA 2ZUQB 3DP9A 2JKNA 4RXMA 2WVUA 1RXCA 1I1RA 3U3OA 1JZ2A 4BVGA 3MTGA 5B4MC 3R76A 3L01A 1TKWA 5EHGA 4HZGA 3AJDA 5E24E 3FMGH 4RWHA 2JFZA 5TTRA 1OE3A 3F1LA 2AQ2A 5IAKA 2D0DA 3QPVA 2VZ9A 4NOFA 4H88H 3EJZD 4E5VA 4RVCA 5IU6A 3DX8A 5ALLA 3KKZA 1UPUA 4FHCA 3QTBA 3VMOA 1NBWB 3CLKA 3P9MB 3D4LA 4COKA 4QGYA 3K1YA 1E5LA 4AEIL 3BRFA 4RA3A 1S9VB 1T22B 3DTXA 1RXLA 1RFLA 4FONA 5JO9A 4XP5L 4LGPB 5I17B 3V1LA 1WBXA 4C21A 2Q5QA 1Z5LA 1HDIA 4FTVE 2I4RA 1QRNE 5C9JB 5DMKA 1D5WA 4FTDA 1OGTB