3NIGB

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alpha-IIb
total genus 127
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nigB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nigB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nigB03
4JX0A 3HI6A 4FWWA 3PPXA 1RD4A 2WINI 3K72A 4UM9B 3NIDB 5ES4B 2NUPB 4M76B 3ZQKA 2VDPB 5E6SB 3AL9A 1BHQ1 2P26A 4DMUB 2VDQB 3PPYA 1OLZA 2VDRB 4WFQA 1MJNA 3AFCA 3EG9B 1SHYB 1LFAA 5KYUA 1CQPA 1PD0A 1ATZA 1Q0PA 3K71A 3EGXA 5HJ2A 4CN9A 3BQNB 5KYXA 1M2VA 2ODQA 1MQ8B 3M6FA 1CK4A 4HQNA 4NENB 1SHUX 1L5GA 2IUEA 2XWJI 1JV2B 1N3YA 1M1XA 1JEQA 4G1EB 3TVYA 4MMXB 1U0OC 1XUOA 5HDBB 3HXOA 3K71B 3VI4B 1QC5B 4GZ8A 1U0NA 2I6SA 3IJEB 1M1UA 1V7PC 1XDGA 1MQAA 3EGDA 1PT6A 4MMZB 3PPVA 3ZDXB 2WW8A 4MMZA 3V4VB 5E6UB 1DZIA 4F1KA 1XDDA 1ZONA 3OL2B 2VDMB 1JEYB 5E6RA 1QC5A 4IXDA 1IJKA 5HGJA 2QTVA 3K6SB 3NVQA 4HQOA 3ZE2B 2P28A 5KYWB 5LN1A 1YVPA 4IGIA 4O02A 4FX5A 3Q3GE 2NUTB 3BQMB 2NVOA 2UZYB 3ZE1B 3QA3E 3EOBI 3BN3A 1ZOPA 2B2XA 5KYYB 4G1MB 4O3UB 1RS0A 1MQ9A 3EG9A 5KYUB 4C29A 1YVRA 1SHTX 3F74A 4Z7QB 1M2OA 1OAKA 4PN7A 1SSLA 1RRKA 4HQLA 4HQKA 5E6UA 2ODPA 3OKWA 3AL8B 3T3MB 5KYNA 3EGDB 1QCYA 2VDLB 3IJEA 1TYEB 4G1MA 1PCXA 3ZDZB 5KYYA 3ZE0B 3EH2A 1IDN1 4JDUA 4MMXA 3EFOB 3TXAA 2I91A 1U8CB 2I6QA 1IJBA 2VC2B 3EOAI 1JV2A 4O02B 2ADFA 1L5GB 2VDKB 4NENA 4IHKA 1M10A 3TW0A 1U8CA 3IBSA 3ZDYB 3FCUB 3V4PB 4CNBA 4UM9D 3EGXB 4Z7OB 5E6RB 1RTKA 3GXBA 1JEYA 3OL2A 4NEHB 5BV8A 4WK4B 3EH1A 4XW2A 3PPWA 1MF7A 2X5NA 4F1JA 4O3TB 4BJ3A 1FNSA 1MHPA 1T6BY 3AL8A 3T3PB 1AUQA 1N9ZA 5E6SA 2NUPA 1UEXC 1T0PA 3K72B 3F78A 4WJKB 4Z7NB 4C2AA 4C2BA 4K3JB 2M32A 3HXQA 1AO3A 3NIFB 3NIGB 3OKYB 2XGGA 3TCXB 1JLMA 4G1EA 2O7NA 1ZOOA 1M1XB 1JEQB 4MMYA 3RAGA 3E2MA 3FCSA 1DGQA 4A0QA 2ICAA 3VI3B 1IDOA 1M2VB 2VDOB 1SQ0A 2NUTA 4CN8A 5KYXB 1YUKA 4UM8B 3EFOA 4HQFA 3FCSB 1AOXA 4WK2B 2VDNB 4MMYB 5KYWA 3N2NA 4WK0B 3K6SA 1FE8A 1PD1A 1BHO1 2XWBF 1NA5A
chains in the Genus database with same CATH superfamily
4LMPA 3RGGA 1RJLB 1N6LA 35C8H 4F7TB 1Y8QA 2CYCA 4MV4A 2ENSA 2EKBA 1LFDB 1C7ZA 2I4RA 2HJSA 2JGKA 3E1GA 4X24A 4F45A 4FSDA 4TKLA 4GUPB 3CF4A 1IHPA 5AIAA 4TMWA 1BEYL 2J9FA 3EXEB 4NQXA 4GI7A 2EDTA 4EW1A 5EMYA 1R4NA 1XTUA 2QQQA 4MV1A 2PZLA 3TAHA 4DLVA 1RHQA 1Q20A 4OXYA 2NY1D 2VLBA 3KKEA 5DXAA 4YSEA 4FNLH 3OOEA 1A6AA 4C78A 1DVFA 2FEDC 1DJWA 3ILXA 4KKLD 4ODVL 1ZK4A 4HSGA 2RK4A 1C16B 1FNHA 4XCQA 1EM8A 5K0JA 3K1JA 1LHZA 1MKYA 5FECB 5T4HA 5I8WA 1PZMA 2ZWZA 2EKPA 3M1IA 4M9ZA 1H5BA 4FFZA 2YC2C 5JS6A 3RWBA 3LRSA 4NQXB 3VDMA 4S1DC 4ZFZA 2CVFA 3HXTA 3VPBA 3T0EC 2WUWE 4D96A 4JXJA 5EZOH 2OSLA 3IU3B 1J56A 1PEAA 3CONA 3CEPB 3O11A 4KR2A 3V95A 2WKOA 1THGA 3CFNA 1N9GB 3QCVL 3B1WA 3WNDA 1ZD1A 1B4LA 1JWMA 3S34H 2I22A 3QPQD 1W0WA 2XVAA 4ZALA 2J5XA 3BJ91 5AW9A 1CDJA 821PA 5DTRA 3UQYS 1XN1A 3A9UA 3EFFB 4PCLA 2D3NA 2QMYA 3LD9A 1O6ZA 4K15A 3UV6A 1X4XA 1WPQA 2JVIA 3IFLH 3S37H 4HHWA 3M8OL 1YQUA 3QQ4B 5JROA 1AZCA 1CY1A 3MACL 5L4FA 2X8JB 3HO6A 4LCWB 1QFZA 4AIXA 3DSFL 1D1PA 4F9PC 1GKLA 2QJFA 3IB6A 4YX2L 4WZAE 2J3KA 3U3KA 2JRCA 4HIHB 4A0GA 1HQRB 1G7QB 5KZCB 1PUXA 4IJVA 5AAMC 3PA8A 2DF3A 2AHRA 3GUHA 4OLZL 1QLJA 2VOJA 3MINB 2XB4A 2WUBL 1NBQA 1PGJA 3TO4C 3S96B 4NZUH 4GL2A 4WJG3 1MFAL 1Z2CA 3NC1C 3NGBC 3NZSA 2O7VA 4UZGA 3GSWA 4M1SA 5JW5A 4HNQA 3ZE1E 3UT6A 2WSBA 2HTEA 3K0AB 1E69A 1WNFA 3KLAA 4G11A 4O02B 5B2EA 2D31B 3L46A 2YS7A 1TZ8A 3FBTA 3CFCL 5IT2L 4GE0A 2AAVA 3BFVA 2I87A 2EQBA 3HU3A 2CHWA 3ZY5A 3N59A 1JK8B 2BIMA 2O5NA 2BC4A 5TH2A 1Z5HA 4CKXA 5CDHA 4BZ2A 5LVAA 2PZMA 2PMEA 4KTYA 2GHZA 2AMYA 3E9MA 5KTTA 2D5CA 9CGTA 1IWPB 4XASA 4BKQA 4KNVA 1NBWB 4PEVA 4KI7A 2FH8A 1LJUA 3HZMB 4M4RA 2FR4A 3U48A 4FG6C 1TYAE 1LTQA 2PG3A 2OHHA 2B1AL 2J9XB 2OL3H 3H9HA 3LV3A 4PJBF 5FYJD 5FOTA 3A1TA 5HHMD 3GMMA 4IOFD 4LL4A 1G5AA 1YMME 4ABQA 3R8XA 3ND5A 1QIEA 2ZJ4A 4BRJA 2R1YB 4NQTA 3EFDH 2DYPB 2VRWA 1ZLXA 4RX4D 3BSYA 1EQAA 1PZBA 5BOJA 5DD5H 2ALWA 1B15A 1G3MA 1L7QA 3X2EA 4V38A 4TMTA 4P38A 5E6RA 4HJUA 2QAGC 4ZX3A 4P8RA 1AI1L 1N1MA 2EQDA 2XTMA 1OFHA 1W4BA 5HI5D 2Y27A 1J7VR 1I4DD 2VO1A 3LNFA 4XP6L 3UEQA 5BS0E 1T36A 3E0GA 5KTOA 4OLYH 5F96H 2P2ZA 3TVTA 4C5CA 3RTQD 2H45A 4WA8A 1XKTA 1YK0A 5JIKA 4L0YA 2FSVA 1KOGA 3UTZB 4JM2D 1ZEMA 4G5SA 5D2LF 1KXHA 2I66A 4TT3D 1GKIA 2OTWA 4PD4J 1DN2A 1QLRB 4GZLA 2IPUG 4O8CA 3MRHA 4ANVA 3GLIB 1KY3A 1RUKL 4UV4L 5D6DA 4MAUL 4QNNA 1AGPA 4E7OA 4DOHE 1CDZA 1BLNA 1HHIB 4KK8C 2FR1A 1XTVA 3LY9A 5FL3A 4R0LA 3FO9A 3DX3A 2IANA 2KJQA 3L7FA 3BSZH 1GPMA 4PZDA 2AR9A 4BFXA 2EW8A 1SIBE 2Y1YA 3A2NA 5ELIA 3GPLA 4BNHA 4HX9A 1T5LA 4ZW3A 2X19A 1RI8A 2BKXA 3WU1A 1MZPA 1ZAGA 4PVLA 3RU3A 1EE2A 3IVGA 1KGSA 1JBQA 5TF1L 1JAIA 1L3IA 2QHXA 3CK0H 3KQSA 1E94E 4D9IA 4UF7C 3IXTB 5TDNA 4K3JH 2D7PA 2H4JA 1WUZA 1VIAA 4S0XA 4LPSA 1PAUA 1CS6A 3H9SD 4XPAL 4BRZA 5CEXA 2WWNA 5E8OA 4G41A 2HBRA 2HCZX 4WIAA 1PJLA 4P2QB 2VWEC 1GNSA 3OTHA 5DDHB 4UREA 3PFNA 4CEJA 4JP1A 2BUBA 1F7UA 2OMYB 2MH4A 3JV5A 1E3TA 2QFRA 1FA4A 1U4OA 1Z5ZA 2OCDA 4BFCA 4P23A 5BRZB 4BLQA 4KAQL 3AR9A 3IERA 4RJ2A 4FXTA 1XH2A 3LKSB 4F4UA 3FUXA 3IEIA 4CGYA 5IROC 3SM3A 3DUSB 3B6SA 1Z6GA 2HJGA 2Q1XA 1EGMB 5BN5B 1RWPA 4OUKX 5E2WL 3EO9H 3G0CA 2R1VB 3O6VA 3SDYH 2WQ7A 2V7UA 3EGSB 4JJAA 1R16A 1FAIL 2WNWA 3BIBX 2NXZD 4Y1RA 4AMYA 4X6FB 2GCIA 2OSLB 5EEXA 3BVWA 2BDTA 4JY5L 4QPDA 5FCDA 4OLVL 4MB0A 3D2AA 3NWPA 1GDTA 3VKUA 1NBYA 5B12A 4HU8A 4G8AC 3CR3C 1YPZB 1QFMA 3BXZA 4NT6A 5CZVL 3R19A 1R6DA 4DSNA 4AGQA 1E0JA 2EVFA 3PHIA 4IRUB 3HKCB 2IYQA 2QEQA 1DBPA 3QYNA 4DLUA 2AF3C 4QPZA 3IDGB 4G97A 5DHQA 1IAVA 2F1RA 3SK0A 2AJXL 2ZRHA 4D3SA 1WXIA 2G3XA 3BE4A 3GXDA 1T0JB 2F59A 1Q6ZA 2O5XL 2CZQA 4MCHA 3T6VA 5ITBH 4F21A 1KB9J 3A10A 3DG9A 3G6AA 2NX2A 3U60B 3HBMA 4A03A 1TTHA 1A5ZA 3PI6A 4BNUA 3GEEA 1S7RA 5CCXA 3FSJX 1DINA 1ZVYA 4Q6IC 2HSGA 1K98A 5KWSA 5FTJA 2YKKA 3IUJA 4KVPA 3BERA 4E5XA 2DICA 2D1SA 4M0LA 1HFWA 4WHDA 4NCBA 1ZJ4A 4DLTA 2B8WA 4ZW7A 4IRSC 1Q2XA 2EU8A 1L0BA 1KC5H 5LXGH 1M9NA 3VPDA 4O4IF 4M0PA 4MA4A 3RBXA 1ZLEA 5A1AA 4KQ3L 5EDXA 1JQDA 3DO4A 1QX1A 1EFVB 4ALNA 2PUAA 4JUTA 4ONFH 3UCEA 3DTUB 2CYBA 3AM3A 1OPGL 4H8HA 3MRFB 3CPEA 1Z56C 4GBED 4MW1A 1P74A 3F7LA 2Y67A 3GEMA 2FWJA 3ZD6A 1XA3A 1V3UA 3OMLA 3L5XL 1T5IA 2DJ4A 3AR8A 2A3RA 3ARGB 3CDZA 5KAQF 2C95A 3V5HB 3LI2A 3MWYW 5JARA 3O9ZA 1ZD8A 1C0KA 2E7MA 3JQ8A 3PDHA 2EDYA 3LDHA 5JAUA 1X39A 2P68A 3JALA 1GNQA 1NKSA 5IM7B 2QAIA 4ATTA 1UXKA 2DY2A 4K88A 4I0KA 1THTA 3SZRA 1JI0A 3V42A 5AW0B 3CRRA 3G88A 1SWWA 4AN1A 1JLRA 1S7WA 3C7KA 1FQOA 5LIRA 3OF6D 1LO5A 3SG0A 4QPCA 1J23A 1ZYUA 1OGAB 5F6IC 1M2OA 3I1JA 3UJPA 3AYZB 3KXDA 3VXMD 1OBCA 3K8LA 3C9NA 4NQQA 2QMZA 1Q0TA 1I1CA 3WAJA 1C9SA 4J3XA 1AC0A 3W1ZA 2MOQA 1DLFL 4PNPA 4MGKR 4LYGA 3TMYA 2REXB 1KRXA 2X0RA 2BSED 4L8BA 3KDMB 4FFZH 4YDLC 4P4KC 4FKKA 5BNXD 4KKXB 2F53B 2EQAA 1EJFA 4RWZA 1KJWA 3RB8A 2FLVA 2NY7L 3MUNA 1Q3HA 1H3VA 5AW6A 1JEJA 5DZLA 4OLYL 1TVKA 1IMJA 3F67A 1I7UA 3AITA 2RAUA 4WAUA 3MUOA 3IAPA 1OWOA 4ZJYA 2Z98A 3FB6A 3H9YA 3J81k 3CFMA 2W2KA 5TPWB 1KNOA 4MKFA 1GA6A 1F8FA 3HI4A 3P9IA 3ZO9A 2EJWA 3FY4A 3ZCPA 5D5MA 5EA2A 5IW6A 5FCUH 1CKEA 1VG1A 5CT9A 2IYNA 5BPFA 1FQWA 1SXJC 1GR0A 2GIYA 1REQB 4JP5A 2Y4OA 4YAFA 2G75A 4G5RA 4GE3A 4OFYD 3VDBA 2W95A 2JCCA 1PJ2A 4CFYA 3L92A 2V9ZA 3PHHA 3ZH2A 4P5TA 3FQUB 3U31A 4ZZ0A 2V7XA 3PD1A 6TAAA 2YS4A 3T9DA 1JS4A 3IJ7A 1G8SA 2EYTA 2NXYC 5TEVA 3T0EA 1NM9A 5BO0D 2YAQA 3SN6N 2R11A 1H3XA 3VXMA 3PQ6A 5J4MA 1BVOA 4NJAL 3HFJA 3US9A 3MX0B 2XZQL 1JQJC 4TL8A 3CFYA 3MVEA 4OQ4A 4WWNA 2QT1A 1N4AA 4MQXD 3PP8A 3CHSA 4RSRA 4K3GA 5ABPA 2AE2A 3ZU3A 2O7NA 4W9FC 2J67A 3CK0L 1WOYA 2GZRA 2W0LA 2NUTA 3BIKB 2CUZA 2FMHA 1S9WB 4OB7A 4DZBB 2LE9A 5K8LA 4R6XA 1IVSA 2O6PA 1Y4UA 2XX1A 3H85A 1BRMA 5IJZA 4ZO9A 2X8AA 3S88L 3W2EA 5GAJA 5K0CA 5ESWA 2EC9U 5F88A 4Z8FH 1R6TA 4UV7L 3RIMA 1QGED 4NTZA 1L7MA 2QVXX 3JVDA 2WKOF 4K03A 1NL3A 2XLCA 2ZVPX 3FT4B 2FPOA 1Q90A 4ABUA 3H56A 3OX8A 1VL1A 2G1PA 1MVFA 3IMFA 4JKPL 1SHSA 3FN4A 5DURD 4R26L 2OFQA 3E2PA 3RODA 4G6ML 3G2MA 3A31A 3LZFL 4WBXC 2H2DA 3OJEA 1UATA 4MPRA 4WNAB 1AGDB 1P9MC 4RQBA 3UW1A 1GTZA 2YQ3A 2X9XA 4TTTS 4OLVH 1TO6A 2PMBA 3G9TA 2H0RA 1T83A 2RIRA 4MR9A 2YOFA 1L9TA 2ED7A 1DKQA 1CIUA 4I5EA 2BUAA 4IPTA 2CDFB 2G71A 3HHMA 3AIMA 1MRSA 3KPVA 1B0RA 1AKTA 2DTML 5EF0A 1W75A 1BJRE 3BISA 4L1LA 5PCYA 5I6XC 2JLVA 3SBXA 3WFDL 1PL8A 3KGTA 4JPIA 2ZRKA 5G4LA 4JFXB 5F7AA 4JJFA 4UPEA 2KPWA 4MMYA 3N6VA 1X94A 1SKYB 2HN9A 4IBTA 4TWJA 1EDHA 1UC9A 3CXDH 1RIFA 2AXFB 5EWJA 4HX5A 4FCTA 3ROTA 3FCYA 3RNQB 2Y1OA 1QRSA 1KMHA 5EJ5A 3VNZA 3D3QA 4HA1A 2FR4B 1RZUA 5GONF 2OL3L 5AW7B 5I7RA 5E2IA 4YMTA 1KFAL 3JVVA 1MG0A 2ZI5A 4YJ3F 2WNIA 3CUYA 1P1JA 3HCCA 3HW7A 1H1DA 4HIIA 2R8YA 5DTFA 2XNJA 4PYKA 4HLDA 4HPYH 1E2MA 1QNLA 4M6WB 3QULB 2Z93A 4RTNA 3MO1B 4YPJA 3D9AL 3IDXL 1BPLB 1HA3A 4GMDA 4PAOA 2C9RA 4GKZA 3ATFA 2O1XA 5EO0A 2JD0A 3Q8LA 1T43A 3GO1H 3BRSA 2GTPA 2C9XA 2CHVA 4DJAA 1OREA 3RK1A 2MNJB 4YXKH 2PZKA 1IQPA 3GLIA 2FVYA 5I74B 4KYIB 1W8NA 5L8JB 2A1IA 4Q82A 1AN9A 1YE8A 4FMPA 4EA8A 1N0UA 2FUKA 4J0HA 5LZ8A 4B5ZA 5I1IL 2IF0A 1ZVHA 4GSRA 4NAMA 2PMZA 5BV7A 2C59A 4OKDA 2JEZA 4O51A 2I3DA 2P6NA 4Q9HA 5GGUA 1Y7TA 3U2IA 3ASZA 2VDLL 4Y4KC 2UUDK 5AVYB 4WCFB 5E1GA 5IEHA 2HJFB 4B9ZA 3DAYA 3W3AH 3W78A 5LGHH 5KTSA 3ARTA 4M61A 2ZR0A 4UM8A 1ZUIA 1JZ6A 3IKTA 1NDTA 1CK4A 2JWGA 4WJZA 2P3YA 1T9DA 4L85A 2XEXA 3GIDA 4NBRA 15C8H 2YD2A 1EJOH 5D6NA 1WUYA 3SHOA 5GJSL 4F3KA 3OF3A 2DKFA 3BKMH 5H3LA 2G6TA 3CZRA 1KCVH 3NVQA 4I0CC 3TM5A 1RRGA 3BWZA 5GZ1A 2QSYA 4Y19B 1FX0B 3F8TA 4OHFA 2PKWA 2C7QA 4Q3DA 5JLAA 2PS1A 1EP3B 3NRPA 4GPEA 4KNYA 2Q5QA 2AQSA 1G7HB 2YDYA 1EZ4A 3U0PB 2A1TS 3V7MA 4C03A 3TLKA 3DTYA 5KVEL 4KMLB 1UD8A 2G17A 3WIBA 3TT3L 1A9PA 4J49A 5F4BA 3CSYA 4I2NA 2RAPA 3DOOA 3TUIC 4IHKA 1DDGA 2LR0A 2OS7A 1FEZA 2YXLA 3GROA 3PFQA 4AGMA 3GJ0A 3P9PA 4L72A 2IBZY 2C26A 4XO9A 3DWTA 5BW4A 5IT2H 4G9FA 3F64A 2B98A 3G08A 3QWNA 4M7RA 4M1GL 4CT4B 2D8MA 3VSEA 1ODUA 3IUQA 3O4OB 4F5CA 3VVLA 2OHFA 3BAJA 4GRLA 2P0AA 2V58A 5CX1A 1XPUA 2BBTA 1Q7TA 2XOXA 3SR4A 4CKBB 3Q6IA 1IC7L 2TMGA 5IXYA 4GJTB 1N32B 3K71A 4KKCD 5MF6A 4OZFG 3TX4A 2EVGA 1KYOK 4JO1L 2OPCA 3EC7A 3AADB 2UWEA 4HG2A 4HNGA 4W7SA 6CHYA 1O5OA 4TYQA 2EC8A 1H3UA 4UHFA 2GN2A 1WT5C 5EJ9A 4FHEA 4Y2DC 4N6RA 1SBHA 1MY5A 2XDYA 3EYOA 1BHSA 4XJXA 3BGSA 1X0XA 1VFAB 1MO6A 1EFXB 4P46B 4PV8A 5ALBL 1QFWL 5E7MA 1XRNA 1N12A 4LTNA 2WM9B 4UHHA 1WETA 2YFHA 5HDQA 1PFUA 4GKSA 1I9CA 4AVKA 4ADIA 3BL8A 1BFSA 4JHAH 2PJZA 4MQUA 4XIFA 4OF4A 1TYEB 5DBEX 4LDPA 1BOYA 1AB6A 4YMHA 1XTKA 2QQNL 2G40A 4B8YA 1E1RA 1EHNA 3F9IA 4S1NA 1QRKA 2FHBA 4A2DA 2JK5B 3PPEA 5T6MA 3K9NA 4GLBA 4G8DA 2QSZA 1UH2A 1MW8X 5BNFA 2YRBA 5BPPA 2DWDA 4FFPA 5CU5A 4H77A 3HY3A 2NLJB 1Q19A 3F78A 1SNRA 2XRMA 4N8DA 3PABB 2W6PA 2DQGL 4YBHA 5EEYA 4I4LA 1JEQB 3HR7A 1M83A 1RZJL 3PP3K 1JTPA 1AANA 5IEBA 2TAAA 2XBMA 3MNZA 2D1QA 2VXSL 2AMJA 2DWTA 5KC9A 1IZYA 4D6PA 5ADPH 1PNVA 3ISTA 5BJTB 3OOHA 5B7MA 4JE4B 1K5NB 2GB2A 2CO7B 1K89A 1LW7A 1BA2A 2ODQA 2OCAA 4K7PL 1MAJA 1Q5PA 1Y1QA 4N28A 3GGDA 1O2DA 2Z35A 3RFZB 2X9NA 5GV8A 2H6PB 3KXLA 1K8IA 1M7IB 2BCJQ 1YC7A 3PXUA 1YMUA 2OMBA 1M2OB 4E42B 1NKGA 2E59A 1RPUA 4IH1A 2I7TA 3CN7A 3MUZ1 2W4QA 4O1MA 3AEUB 1EFRA 1ISGA 4J4BA 3ZWNA 4U33A 3PUCA 3U4EA 2XIDA 2IGFH 3LN5A 1MCKA 4W63A 1WYJA 1E1YA 5DZAA 4EAEA 2A9FA 3N0RA 1TM5E 5DK0B 3BE6A 1MHTA 1WCYA 2QTRA 3G5XB 1QBAA 3LNEA 1XCXA 4WK4B 4ESVA 4X99A 1UACH 3SYNA 1WD7A 4Y1TA 1P3Y1 1YZNA 2HKHH 1TFPA 2BEWA 2JZOA 2O9JA 5E2WH 1U90A 2UXFA 5HGBB 3G8YA 2AFRA 3VOBA 1E30A 4N2EA 3MJRA 3VU0A 4BE9A 3P9XA 1NNUA 3HJEA 4ED9A 1P0FA 4FQQA 4KHTL 3HUUA 4AZUA 1PGNA 1IM3D 1QRAA 1T4BA 2EF1A 1TJNA 2XWDA 3DE6X 4H4DA 4LF3B 1OX4A 2ZUBA 3QE0A 5A06A 1UOPA 1P5VA 1A9XA 3MO1A 1L2TA 3GJFA 4AEFA 4C47A 1DC7A 2PCPB 2JLCA 2PCFA 5CBEA 5TQ2B 4Y4KB 1DQQB 4DPCX 3ZL4L 2F1IA 3Q2OA 4EJFA 3E0XA 1OANA 1OK0A 3UTSA 1OSZB 2WWRA 3KAQA 1XH3B 2ZXEA 3MLVL 5C0IA 2IANB 3S34L 3T61A 4LNUB 1KDYA 3B78A 1A8JH 4G9EA 2P5WA 5ITZB 4PB9H 4KDFA 3P9QA 3EG9A 4H2DA 4MGEA 2AMVA 3GH1A 3MOBH 2VCYA 3GB9A 4TLLB 3ZWPA 3DOEA 1RJDA 3RABA 1K4DA 2MHAB 2QVYX 3WN5C 4ODBD 4H7HA 3P1VA 1P9NA 5C31A 1WBJB 3E9EA 4MGXA 3EFOB 3F5FA 3S5LB 2GI0A 2FRXA 5TJHA 1W581 2XRZA 1OZFA 4KNTA 3BD3A 3TZKA 4LHYA 2EDJA 2VSFA 4Z1OA 2F5AH 4BQ8A 4M98A 3TCTA 4LLMA 4C6RA 3RBAA 1DZ3A 1L4BA 4KDRA 1LEHA 1JA0A 2PRYA 3OLXA 3ZKMD 1UP4A 4PM1A 4ZEOA 4FKEA 5G55A 4EEXA 3W11C 1SXBA 1ZBQA 2EKSA 3QH4A 2VJ8A 4MCYA 3FB5A 1JKXA 5JXEA 3KLOA 5K3AA 1YUNA 1ST2A 4RGMB 1GC1H 1O7SA 4RMUA 2D6FA 3EGCA 4P4KB 5DE3A 3D5QA 4JX9A 3UIYA 5KSBB 4DNQA 5I17A 3C3PA 4NZZA 1QRNE 2FR0A 2Q8PA 4V0OA 5B64A 1NBCA 1YYLH 4KH2A 2C92A 3S3JA 3EZLA 5CZXC 3OPZL 2RGNA 1VZ2A 5FYLL 1YR8A 5F21A 1T1RA 3LIIA 4QC2A 5KSVA 3VAYA 4TSBL 3FD8A 3RFTA 3DZDA 1ICIA 2WXKA 5FM5O 2ENWA 1XNQB 2OQVA 1G7LB 4B6FA 2F7RA 4BY9E 4URXR 1WY7A 4G6MH 3ZDYE 5HI5C 4JPVH 2GYWA 4MWTA 3PHBE 2VE6A 2BC4B 2APSA 4JY5H 2C83A 5KVCA 3D2LA 3IYLW 2Z7ZA 4WUUA 4KJXA 3GIVA 1U8XX 3X1FA 4LYFA 4MTMA 5AVUB 2CGZA 4DIFA 4OUDB 1U91B 1L0XA 3M17B 1U3ZA 5HYFA 3MRCA 3IXLA 1MFDH 5E5UB 1D5IH 5FUZH 2DQTH 2VSYA 3N8DA 4QEZA 4U7WA 4WDIB 2ZIZA 4I0PD 2ZEJA 3VFUB 1RZGA 4HFMA 3HZOA 3SX2A 3MRQA 3HO8A 4HN9A 2C98A 4LP5A 3A9SA 1WDTA 1C4WA 1EUUA 3IFSA 3NGMA 1ADQL 1WHSA 1GARA 2VDOL 3KXKA 4ZO8A 3KQTA 1E7MA 4INAA 1RWVA 3L0ZA 1L0QA 5DHEA 3I0MA 2CCKA 1N2OA 4M93C 4Q6KA 1KBGL 2GTZA 2B5WA 2D5BA 2O6LA 4MHHG 1AD0A 1Q21A 3RFFA 5KOJB 3ZCSA 2CGEA 3GYRA 5CMAA 4HAZA 1FZMA 1UWFA 4J3OD 4TSCL 4AGLA 4UCQA 5D86A 3OHSX 2O8DB 4GVLA 4C30A 3RBVA 4H27A 3DMNA 4JZNB 4P3PA 5IW6B 3AXLA 2OYRA 1KGUA 5F7EL 4FZ8L 2CBZA 1EXUB 3KZCA 3RVBA 1JB1A 4KX9A 4PJEB 1WU8A 3FDJA 1NOAA 3FCBA 3SCMB 1GAJA 4BV3A 1Z17A 5AOCA 3U7WL 3PEUA 1JXGA 3A22A 5IJKA 2PVSA 4A23A 1IAIH 2YN0A 4U02A 1BFOA 3IU3A 1NGXB 2PMCA 2P11A 1T03H 2I2DA 2ZT6A 3FHEA 1YI0A 2WXRA 3EYFB 4RSGA 2P24B 1JXFA 2P7TA 2R85A 1Z2DA 4WNIA 4I3SL 1ADGA 3SDCA 4OCRH 3EXFA 4OIAA 3QIBC 5JYMA 3HDTA 3V33A 2XN0A 3NQ41 2C9UA 1J0JA 2YQBA 1QR2A 1RK1A 3IU4L 3WKEA 2FV8A 2VA9A 3CUUA 4CMCA 1IE3A 1M6YA 1JJIA 3UCQA 3V32A 2X0FA 2LIPA 3MV9D 1J9ZA 4L1DA 3DL7A 1EFHA 1TCAA 3QMVA 2R4SH 4GUPA 1V1RA 1GZ4A 1P7ZA 1ITBB 2QRVA 1YD7A 3ARSA 1YR6A 3ARPA 1UWGL 5T3XH 1DQRA 3DVLA 1G42A 1Q15A 1KY4A 2FFJA 1I3OA 2CF6A 5FNZA 4JQVA 3HV0A 2PRJA 5BV2P 1WXWA 3PGLA 4HF5H 5A0FA 4COKA 1EV2E 4JREB 1YQWA 1YOBA 4EI6B 3FPBA 3PNWA 1A4UA 3BOSA 3KKPA 4TQ9A 2E47A 1COWD 4DSYA 2SEBA 5DLYA 4ZZFA 4RH4A 3O38A 3S35L 2XDQA 4PJ8C 3MB5A 4EPRA 3NZUA 3TNMB 4Q01A 2OR9L 3EDYA 3QU5A 4OOFA 2Q99A 2GSDA 1MR3F 3W5CA 5LD2B 3AREA 3WGMA 1M9WA 4UT9L 3I61A 2CMFA 1HOTA 3ZSTA 1XTIA 3AVPA 1QWHA 4FNUA 1T2QL 1JR3E 4A5OA 3DDUA 3B2EA 2R0LL 1OT3A 1O3YA 1UBTS 1NC4B 2GJ8A 5IMLA 3QDMB 4I89A 4P5TC 2XH8A 1FPTL 2JGDB 4JFRA 1EO7A 1C30B 4ANFA 3VFSB 2WD8A 1XQ4A 3GXFA 2NYVA 1R8SA 3NHSA 1UFQA 4OLJA 3QEGH 2H9IA 3CISA 2EG5A 5HF6A 2ZIAA 1XDWA 3ENNA 1X77A 5EU7C 6GPBA 4NLHA 5H5JA 4QHPA 4GO8A 4E9TA 3FAZA 1EX6A 3H1PA 3I64A 2EDNA 4I1UA 1IBLB 2XUQA 5CLXA 1X7XA 4H1LH 1O5IA 1FTYA 3TO2A 2F58L 2LZ0A 2BDNL 2PKYX 3HZYB 4GR9A 5E2AA 2AZTA 3UB2A 2CHGA 5EPOA 1L6RA 1KFBB 3DDWA 2F2HA 1Q1JH 4R7NA 3UERA 1E79A 3PY9A 2B8TA 4H5SA 3PLNA 1TTPB 2EP5A 3V2GA 4FP8L 2J07A 2DMHA 3ZKQD 3W5JA 4P36A 4YHOL 6CGTA 3C3KA 4NNOA 4AM0Q 3AZUA 3GTTA 1OAOC 3JTTB 2DQIH 2CD7A 2E0IA 4JPWH 3T6QC 4CETA 5D7LE 4ELDA 4ROSA 1U4SA 5TDPB 3CSYB 4DPLA 5EPMA 4P93A 2ZXAA 5DRXB 2ZAIA 2QN9A 2NPOA 2IRWA 3NDZE 2N42A 1DBWA 1W0KD 4AGNA 3KS0H 3E5MA 4JBXA 1KEVA 1YEIH 4UTAL 4O5AA 3QIBD 5CUSH 2EWWA 4JR2A 1IZJA 2V7NA 5C0FB 2FX7H 1CVRA 2GEBA 2XNSA 1D5WA 1SB8A 4DL9A 1YTUA 3LOQA 2IIVA 3AC0A 1IAIL 1GGBL 5IVXA 2JKNA 1RAIA 5E95A 5LCVL 2V7QA 1XQXA 3KLMX 4PJEA 2NP7A 4RMNA 1LWNA 3JQ8B 2QL6A 1UM9B 4Q34A 3K8MA 3O90A 2DBVO 1Q0EA 1A65A 5F98A 2Z83A 3RHTA 1F2XK 5FLKA 5FUWA 4R40A 2HQ1A 3BVXA 3TOVA 3A1NA 3T09A 2VJDA 1D8TA 2FUQA 3QRGL 2VZVA 1X4ZA 2GEDA 1Q0XH 4AMWA 4Y9SA 3G6DH 5FLUA 2EZUA 3L0IB 3NWBA 5LZ7A 1CK0H 2XJKA 1WBYB 5AOZA 2E9SA 3G7NA 3FVTA 4M62L 4YSSA 4CTNA 3FB8B 3TT1H 1YEJH 1DQML 3BP4B 5K3SA 1XALA 1CFSB 4AP5A 2LE0A 1Y34E 4C57C 1E60A 1MRCH 5JBQA 1XGUB 3H9CA 3LDUA 5ICYB 2X0JA 4HPJB 3K92A 4TL9A 1ZT4B 1G8AA 3VKHA 3WY2A 5C1IA 1DLFH 2WHXA 1JTFA 1SMOA 1U41A 5DS8A 2IY7A 1ZWKA 1D5XA 5SY4A 5A4AA 1L4EA 1VA4A 1JHOA 4KFUA 3EJZC 1JHKH 2H32H 5J9FA 5KINB 3EVCA 1GAWA 5JRJA 1I9IH 3STBA 2WMPA 1IXZA 5DSCB 5M5BA 4GYJA 4LRXA 4AITA 2VN4A 5MN4A 3FGOA 1WV1A 1CC1S 4RVGA 4KQJA 3BPLC 5I8PA 1G7LA 2G4GA 3ULVF 3TEWA 4D8WA 3N1QC 5CDGA 5HZGA 1FGVH 4WFHE 4I36A 2PETA 1IY8A 3PV0A 2XTJE 1VKXB 1EXHA 5EIIG 5BZDA 3OMAB 2RB4A 1G98A 1D9KA 4W9EC 4YXLL 3UCRA 2UYQA 2ITCA 4HS8H 4BNKA 4OW6A 4ZD6A 4MBRA 4B81A 4EE2A 4EI5A 3CIOA 1CDIA 4G8GD 2EKJA 4DADA 3PL1A 2VPWA 2PQMA 4WQMA 1BW9A 4B5KA 4JJKA 1I9EA 4NZFA 5I75C 3LXAA 4UHCA 2I6SA 7FABH 3QI9D 2YBRB 5I15H 1NVBA 2RE8A 3OZIA 3DMDA 3GEBA 1ZIYA 3AFHA 3H0EA 4ZI3A 3CLSD 5EUOB 2R1YA 3DE4X 1FGNL 2AEIT 3SXJA 4DCQA 4LLMB 1K7YA 5JZOA 4IKPA 1NV8A 2OSXA 5CEEA 2CWWA 4KO2S 4PJGB 3CUKA 4BCBA 3MRRA 3OLIA 3EUDA 4FIZA 5MHSE 3L1EA 1CTMA 4G71B 2K8QA 2R65A 2XUAA 5CBAB 4M0EA 5DRZA 4Q37A 2VXVH 1BMFD 3GZTB 2PABA 5DD0L 1T5XB 5JIIA 4U1MB 1T4MA 1CGTA 4NLAA 1B3BA 1TPZA 4LZKA 3ARWA 4P2OC 2Y0PA 4CIYA 2IYPA 4ND3A 2AH5A 4KFTA 1UUNA 4J3WA 4L0MA 5T3ZL 2HF8A 4DUVA 3LPWA 1YB6A 2EBWA 1YKSA 2ZKIA 3M70A 3K3PA 4TMKA 1G6RH 2CD0A 1WZKA 3KWJA 2NT3A 1Q3KA 4PO9A 4FKZA 4RV4A 4BZ2L 2BNUB 5MFZA 1CLYH 5ADPL 2R79A 4LCEA 2ONJA 3ILPB 3I01M 5AVRB 1L4KA 3B9RA 3E3AA 5THQA 1RWBA 3OKNB 4LSQL 1E64A 3FJYA 2RJOA 2B0SL 3WB2A 1BG6A 4I46A 3NYIA 1EFCA 1ADYA 4Y7DA 1A3ZA 2QRKA 2CSXA 1P69B 3IP1A 2ITEA 3F58L 1X8LA 2XE4A 4EA9A 4M1YA 3AHGA 4QJBA 1HI6A 4IGIA 4CMKA 1YUHB 3VKWA 1VB9A 3L5OA 2XTZA 4LNHA 1O94D 3HRIA 3SGEI 2FB4L 4YQEA 4OGQC 1BKDR 2NTYC 1UD3A 3BE1H 3JQ6A 2QTCA 1JRHL 1AE1A 3QFHA 4GFDA 4DR5B 2Z2XA 1ZT1B 4X7TB 1CFQA 2NV2B 3ZOKA 1JIKA 5GRYA 5ANHA 1WBBA 1DPGA 1IAOB 4E51A 5IBUB 5BW5A 1R5BA 2C7PA 3KQMA 1DUYB 5FKPA 1N6HA 1JHKL 1U8OB 3LJ3A 2O07A 4GB9A 1WX1A 5IVKA 2CO3A 2ZUSA 2O5ZH 2Q20A 1VI5A 4XYLA 3NCYS 5IT0A 1CUOA 5G0UA 4G8GA 4A91A 3T9BA 1NW3A 4MVJF 4BH8A 5J4YA 3WTVA 3I9OA 3EH5B 1PFOA 5FR1A 3DGCR 4Y4FC 2GFBA 2ZP9A 1E1MA 3OO1A 3PDIA 5CRIA 4ZCTA 4OCNC 1BMDA 4S05A 4RQQA 4P3YA 2HEGA 5A62A 1NFIB 3DSNA 4AJLA 3RVWD 2EDXA 3P1JA 1I3KA 4OK5A 3KJHA 2J9RA 3CC5A 4GS5A 4YEFA 3HFRA 4ZVMA 4PJDA 3S7TA 4IFTA 2FXIA 1ONQB 4OJDH 2WV9A 1XMVA 2DLIA 1NUFA 3DLBA 1IBSA 3L1JA 3CFDB 1X70A 3E8UH 2W91A 3QEQA 1THZA 3EWSA 2SNIE 5EJEA 1CUYA 1UZLA 5T1KA 2HUPA 3MRIA 5CGYC 5ELLA 3RS2A 5CG1A 2VL4A 1H6CA 4G5QA 4RVUA 1LRLA 4U31A 2FN7A 3WJAA 3GJFB 1PJTA 2LP4Y 4W93A 1KCRL 4EL0A 2Y2WA 4BZQA 4JO2L 3LCJA 2HCTA 2E2WA 1LEKA 1PJ3A 1QG0A 2GNPA 4IQ0A 4LHSA 1FHGA 5JVDF 4JKMA 5B1HA 2ADFL 2BFFB 3LDAA 4JFDA 1K6IA 2R2BB 2EINB 2YASA 3R9WA 3T71A 2Q9CA 1IDOA 2GKSA 4QT0A 3D48R 3PA6A 1DTWB 2JKRM 2ZULA 4INOA 2WOYA 2IALA 3PCYA 5JS8A 4TMPA 3TC9A 1SJEB 4NRYB 5IVOA 4GFXA 3O9MA 2ID8A 2GF9A 3MRFA 3S4YA 3SS7X 3QELA 4RU1A 3V8EA 5IOKA 4MQ7B 3GQBA 3J2PA 4UTZA 5F5XA 4OLHA 1TMOA 3FFTA 3F5SA 4G8GE 2B6HA 2HDHA 2JIRA 5IMKB 4YRDA 4KAQH 4KXZI 1DE4B 4KR9A 4PJ6A 5ALIA 1ORSA 3PRYA 3SBEA 3U1VA 3G2PA 3S8EA 4XHQA 1ZONA 1JGLL 3VR0A 2ORBL 1RZFH 3C3DA 4DV2B 2PAFA 3RVUC 1KLUB 3CSDA 5HHOA 5IVPA 4Q6IB 5DD1H 2OQ2A 4EDWH 3ZTNH 3VKFA 4FFWA 3QIWB 3RYHA 1FYEA 3G6KA 1R12A 1SYVB 4HFUH 3L5WB 2WU4A 1PAMA 4GAJL 1HZJA 2HX8A 5I1GH 1EH5A 1M2FA 1T7XA 3U0WL 3R0IA 5F3HA 1MZYA 2VDWA 5JNRA 1IEQA 5CLZA 1T66D 3DEKA 3C5JA 2NUAA 4TWIA 3ETBJ 3VFVA 4KQ9A 1KCSH 4HJ1A 2WMOB 3A4AA 3ZDXF 4YDSA 1HEHC 1AQJA 1Q7GA 3H9SA 1K75A 2MSLA 3KU1A 3K0WA 5I18L 2XKNB 2LAGB 3N2NA 3JPYA 2HZHA 3QDJE 5DZSA 4F7TA 1J8SA 3GNML 5F9HA 1RD4A 3LYLA 1QFWH 4JSYA 4OXXA 4M89A 3ZZLA 2QXTA 1Z63A 1NCAL 4P49A 4F84A 3N7AA 2OXGA 4KUZH 4MS3A 3V8MA 4QRTA 3MV7A 2VZUA 2FKNA 1P4IL 2IANE 3R06A 4DP1X 2CO1A 2YMQA 3DBHA 3BZ4A 3TEXA 4PG5A 2WG2A 2XMBA 4QDZA 3WK4A 4MSUA 1RUQH 3ZDXB 4MNQD 2Q5OA 2EYTB 3C5EA 4FC7A 3KR0A 2REQB 1OFUX 4KYVA 4RMBA 1YYMH 2W93A 2J59A 3O2SB 1J8QA 5CSZB 1ZINA 3ZDFA 1NC4D 1Z8DA 3GT0A 3FVQA 3VWKB 5CK4A 1NE7A 1AC5A 1ZE3H 3FE2A 3BVNB 3OQNA 1UJNA 4QOGA 1MABA 3O6KH 1Y18A 5LG1A 3UHJA 4XGNA 4LHUA 1A72A 3EDKA 1OB5A 2R69A 3DMRA 3WLPA 4M53A 4K6OA 3PC8C 4XP5H 5C4IA 3OAAD 4FQCL 1N64H 3OURA 5D7LA 3HP1A 1AC6A 4GI1A 3ISRA 4Z7VA 1T03L 1A8SA 4UT9A 4I3HA 3MLUH 3MWDA 3U4HA 3HJ0A 3LKBA 3QPUA 1A1NA 2FQ1A 3QR1A 1ZW1A 3BKCL 3V6MA 4E1VA 1DKMA 5F6HI 1ZHNA 4RD3A 4JZOB 1V8HA 2JA2A 3EIUA 4HWBA 3DO7B 2QM8A 4XXWC 3NEXA 4WWOA 1AO7D 1JGUH 4AV5A 4YMWA 4AICA 2D4DA 4ONGL 3SDAC 3C12A 4CN1A 3RS9A 2B5VA 4OATA 2R15A 2H4HA 1J0XO 1KYXA 4D4GA 2HT3C 4X93A 5H35A 3EJRA 2BFWA 2J8UA 4S1PA 4DMRA 3LHFA 3H87A 2Y7QB 2P7TB 5K6TA 4C4UA 1ZICA 2EX0A 3D2CA 2WXPA 3JATB 4M8VA 1HRKA 4U6HB 2ZX5A 4OBBA 5FJIA 2XMZA 3KNBA 1ND5A 1L7VC 2ZAYA 3FLMA 4JOQA 1DKRA 4OT1L 4HN4B 1Y1LA 1ZUHA 2BV3A 1F11B 3WIIH 4US2R 5J13B 3HUEA 4IVPA 2YWCA 4GOSA 4V3CA 3COPA 4QCIB 4Y2PA 4RK0A 4C07A 1RZ8B 1DUIA 1ZV5A 3DCIA 2F7PA 5B7FA 3DHJA 3R3ZA 4DAEA 4OZGA 4TRNA 4W8HA 5M94B 4WZBE 1UPCA 1JHRA 4YDRA 3RRZA 3Q3GB 4QRRA 3O26A 4F1JA 4FYMA 2MMCA 4BXOB 1ESMA 5CHEA 3CPLA 2AG5A 1ZAKA 5AOKA 4PV7A 1BAFH 1L1FA 2ADIB 5K69A 2RGDA 5SY6A 1R7RA 1PL0A 3QHQA 4AAYA 2NR6C 3CLTC 3MLBA 3SE3A 3C8UA 2FMTA 3TFOA 2WP8J 1RHKA 1LSJA 1P4HA 2C1ZA 3NH7L 1MP0A 4QQNA 4JFED 2X4GA 5THXA 3ZU4A 2GSIB 4X9GA 4YRBA 4MXQD 1U7ZA 2PBRA 3B9AA 3PHQB 4R9NA 3C1AA 5C3LD 4FE3A 3ESDA 2X5KO 5KSOA 4QWWD 3PL6B 2OSVA 1F8YA 1GT6A 4R7DB 1YAHA 4I3RH 2XWSA 1MTZA 5CLHA 5K2OA 2A35A 5T1KB 1J09A 3LB6C 4KJYA 2I3BA 5C08E 3OJ2C 3TSYA 3GSNA 2BVNA 1SMAA 4L51A 1URLA 3EAQA 5CFZA 2VR5A 3AP2A 3F12A 4PJFA 5CFHA 1UD5A 3A67H 1T8YA 2YWEA 4Y2XA 3BDYH 2VDPH 1CQXA 3E6FA 4JB9L 3WYAA 1JIVA 4LEIA 4B46A 4N8VA 1XKLA 2FEPA 4P4TA 1YRHA 4HQ0A 2DPKA 3F8WA 4YSTA 3I6MA 3NHFA 1RHMA 1XZHA 1G87A 1K9SA 2XQBL 3LIUA 2OQJA 4LIQL 2UV8A 5IJ0A 1KJ3H 2AC0A 3TNYA 3RX5A 4JKNA 4AGPA 1LDPL 2C2BA 4LPCA 3V0EA 1C5BH 3T5BA 2PD6A 4B5EA 4A0QA 5IB5A 1A2YB 3MREA 3C85A 3KJEA 4TTVA 4OGXL 5D7BA 2IX3A 2DQJL 3APFA 4EXPX 1KBZA 1UBNA 3LKRB 3BKCH 1MCCA 1B0RB 4WMLA 4GAJH 3QDJD 5FK9A 1L7IH 3L7NA 1BVLA 3M6FA 1OKKD 3LO8A 4A8JA 4JXKA 1DJMA 4JYMA 2WIDA 5DC4B 3FHLA 1J5PA 3HXKA 3OBIA 2X8BA 1EEHA 2B2CA 3R9KA 1OLLA 2ZJFA 4UV7H 4L4VA 1MCFA 1VDZA 3RADC 4JQSA 4Q05A 1V16A 3BP5A 1N1EA 2XYGA 3R6DA 2RAMA 4MVBD 5J7CC 5H9WA 3WLWD 5ILTH 5CKGA 1MFBL 3KT3A 1AA6A 1RC1A 1EVEA 3KRTA 4QOKD 4MA1C 3BULA 2L17A 4F1SA 3K5HA 5HF8A 3I9AA 1JIJA 1B6RA 1WM1A 2QTNA 1CTQA 1PW5A 4C54A 2AQKA 2CPUA 2JCCE 3VQLA 5BR8B 4MW0A 4ZK2A 1C16A 4BFUA 2RJ3A 2FW0A 4AJNA 4HV8B 1Q9KB 5D1HA 4RD1A 3AU0A 1F4HA 1XBRA 4UKDA 2ADGB 2XMGA 1Z4OA 2EDOA 3KR1A 2XUHA 3RI5K 2VXQA 1KFGA 3IEXA 4Q3OA 3E6HB 3MT7A 3TKAA 3MCG1 3ECAA 1NULA 2WWKO 3TX6A 4EHDA 3Q5DA 1MJ5A 2VVTA 3AUYA 1DAIA 5A1TA 1FXSA 1UA3A 1RM5A 1E96A 1I1FA 3I9IA 5HBGA 4H1TA 4BX8A 2Y93A 1DZBA 2JIXA 3NCBB 5CVEA 1W73A 3WRYC 1B8PA 1RXEA 4DABA 3TG2A 1U3GA 4F93B 4PG7A 3FXAA 1QFSA 4O5LH 3JV6A 4P5KA 3AL9A 1L7PA 1N7MH 1ZD6A 3KMDA 3Q87B 5ALJA 1TT5B 3AQZA 1T9ZA 4TSFA 2ZYHA 2J3DA 3TECE 5KBDA 4OJTA 2ZJZA 5AVTA 4AY0A 3ZI7A 1ENOA 1FW8A 4AZ8A 1I4WA 1K3UB 1JTVA 4OY9A 1PJ8A 2O2SA 1GSHA 1YBAA 1JG3A 2WTAA 5JNWA 2DWQA 4ON9A 1MHHA 2J0EA 3T06B 1Y8AA 1ED3B 1UUFA 2PD3A 1G0YR 4L23A 4L1SA 1IH8A 1WZUA 2JKSA 1JDTA 5LCVH 3U4KA 2O72A 4M7ZC 1LK3L 2AW2A 4Q15A 1NCDH 1EGVB 4N5ED 1Z3GH 5AHXA 4IGEA 3U4EB 3RIEA 1DFXA 3IUNA 4IQGA 1MRDH 5AI0A 2BL4A 1NOLA 4I1PA 3IXQA 1DJHA 4AL4A 4ZHQF 3ZIAA 2V5UA 1XTRA 4X8LA 5COBA 1XCLA 4KE9A 4LY6A 2BSSB 2R0ZL 4Q4AB 3KPQA 2AKEA 2AXGA 1ZLVH 4EHFA 5J3JA 4NNPH 4D94A 3ORFA 2GFQA 3DGDA 2I71A 3S5ZA 3S5UA 4O4LF 4R8KA 3MFGB 2G25A 1QHNA 1GZDA 4QRSA 2JB5L 4Y2HA 5I0DA 3EMDA 4O29A 1XRSB 4N2KA 3ZDWA 4GLJA 3WTYA 1B00A 1TOAA 5FNVF 2ORED 2WTNA 4AC2A 1PV1A 2IPTL 4XHJC 3DO6A 4DTGL 4YDIH 4U6NA 5AAWC 4OY3A 3HN5A 3U5TA 3GBNL 4DQUA 3HVUA 2VZOA 4B6PA 4HT3B 1VKJA 4R1LA 4TL6A 2YJZA 4EJSA 3GK3A 4B17A 4OMCA 2DB8A 4UAHA 5LG6A 3M1OA 2ZSAA 1XQ6A 1TMQA 3CU7A 1N2ZA 4PJ8B 3AVEA 1QI5A 5CFLA 3R3VA 4KJPC 3F7QA 2Z30A 3F9CA 3P69A 4JI1B 2X4SA 4GP8B 2MQGA 1IN4A 2MR6A 4B9PA 4Z1MD 3M9WA 4CLXA 4MA3B 2WHPA 3QE4A 4B50A 1WT5A 1TZHB 3ZTNL 5I6KA 3WD5L 1N6OA 2HXYA 2BERA 2CHXA 3LNHA 3VSQA 1IHXA 1E2BA 3QM1A 1WNTA 4WENB 1QP7A 1LBIA 4CUJA 2G9NA 3QH3B 2H3KA 4WKOA 3L3GB 2JJTA 3AG4B 3LO5A 5L6LB 3HP7A 4HSCX 3OX2A 4KJPD 2WU3A 2UXVA 3N2EA 3BGFC 2J5RA 2H3NA 1OGJA 1QEWB 3FBGA 4RL4A 5EQJB 4OD1H 1INEL 1KUMA 1NZDA 2B8EA 5EWMA 3QWIA 1LILA 3DX1A 2CFTA 3K96A 3TLAA 1L5KA 4DW2L 2PR9A 3Q6FB 4EI6A 4XNQA 2FX2A 5TTRA 1GY8A 4B82A 1POXA 3MV01 5HDQL 4M87A 1IPHA 4J7XA 4X3PA 2CVZA 1WS6A 3GWGA 4KCGA 4REQA 2XTSA 4Q9CA 3BEVB 3SFZA 1N68A 2XUZA 2I7CA 4PJ8D 4N7MA 4F2WA 2F3UA 2YRXA 2B1AH 3D43A 1SAYA 1EWHA 3NEEA 2H52A 3SLKA 3O11B 4BO0A 4NP4L 1P31A 1B41A 5GGYA 1MX1A 5B1JA 1KT2B 2IL1A 2YPLD 3UYOD 3L1OH 4A68A 1CZKA 3SFTA 1P0MA 4MJXA 3SZGA 4F91B 2YFQA 2PCPA 5JNYA 3CB4A 2FE0A 2QLFA 5COAA 1IEXA 3GDBA 4EI8A 4FTVE 1U1DA 1YEIL 3Q43A 2VE6B 1XSJA 4UOJA 3JR3A 1QLEB 3CC5B 3L7KA 2BIHA 4LAFA 4HBCH 3RSGA 1OTSC 3LBIA 2DJMA 1PLKA 1SKAA 4EQ2A 4DQOL 1FFSA 2IAAC 1U8CB 2H1FA 4N0YH 4G25A 4QQKA 2C2WA 2UUAB 4J0CA 3PFIA 1J8KA 4DEYA 4PSUA 1BD2E 3IH5A 4HS4A 2OCPA 3ITNA 3G2QA 3PDJA 3IKVA 3T0XA 1TEVA 4LESA 3IJYA 4JLDA 1W59A 5D51S 2QTLA 3DVSX 4C7JA 5IX8A 3TBTB 5EY5B 2B25A 4KTDH 3K1KC 4ZARA 4WHYH 1AK2A 3PT5A 3FMGL 1I4EB 2VT2A 3CG4A 3JQEA 2GY7B 3KTAA 2R1VA 5NLLA 2IY9A 5TIIA 4XARA 4LRIA 2Z91A 4Y2DA 3E0QA 4NFDA 1IGFH 2AK1H 4HLUA 3A1UA 3B9BA 3LKSA 3KNBB 4DGVL 4I19A 4JDEA 4U6HA 1YCSA 4RPIA 4B79A 2P9QA 2ZIXA 4WFIA 1VKNA 4R8VA 4MMZB 2A6KB 2H1WA 1FC1A 2DFLA 3U6RA 3P9CA 1VBFA 3TZVA 4D3YA 4W5HA 1L5HA 2H6PA 2I1VB 3WGLA 2C04A 4PY8I 3AGVA 2QY9A 2VJNA 1DADA 3CG0A 1WKBA 1XTLA 1OAUL 3WLBA 2DECA 1C7RA 4WBNA 2EDCA 3ZZMA 3P0VL 8PAZA 4J39A 1BIIA 3P2KA 4RBNA 3HNSL 3IDQA 3OX1A 4JVNA 4ZAFA 1YDWA 3MQIA 2VUOA 3DRTA 5IHUH 1WBZA 2Y7LA 3MA7A 4LSTL 3CFKA 1CDUA 4D99A 4ZS7L 1GL7A 4R8WL 4BGEA 2DLFH 4H26B 4FM9A 5C0IB 3R0VA 3UJAA 2H5UA 1EFKA 3FHQA 1U1GA 3T2QA 3OT4A 3KYNB 4KKAC 4MVJA 3RWIB 1D2GA 4R3SA 1SBYA 3T1VA 4OCYH 4WGGA 3N87A 4G4JA 3EA0A 1ENPA 2VNAA 2P65A 2JGMA 3PCTA 4MJ5B 5D1ZD 4O08A 4NESA 3DM9B 4UQLA 2VM3A 3RFUA 4KYUA 1JF1B 3EE6A 3RTGA 1VE1A 3BTOA 5C80A 5F9OH 1SY7A 3VXNB 1LE9B 3GRBA 2OHOA 3KETA 2HA1A 2P9ZA 5C1MB 1B2RA 5JFTA 1GZHA 2QDXA 3D7RA 4TWRA 4P83A 3LH5A 4NQCA 4LOJA 4X4YB 1H4QA 5JASA 3VTZA 4RORA 2Z91B 5IDVA 4JDPA 4YUYA 5E9JA 5DGRA 5LU9A 3LK6A 1TSRA 3WRXC 4CIVA 2HZ7A 1R3LB 3HJFA 4HDAA 3U1TA 3OL2B 3GPCA 1OKKA 3PX3A 3G3LA 4W9JC 2DETA 4XI5D 1E66A 4X5LA 3NKVA 1ZE3C 4OQDA 4DHLA 4ZYKA 5DGTA 3AIKA 2IBGA 5G5DA 3KXIA 3K6RA 2FNBA 5EN2A 5DI8A 1E28B 3AHJA 4JFZH 1K2VN 2YBRA 1GUYA 3EZYA 4B47A 2BK8A 1NCCL 4G1CA 1R3UA 1VE7A 3QJTB 3WFHB 2QTZA 1O97D 1OBVA 4PFQA 4CNBA 2W70A 3IURA 2R6R1 2FW8A 1EWRA 2YCBA 2HN7A 4TZ0A 3B2QA 4FEGA 3P4MA 1NKTA 1KY5A 4IDFA 3VNQA 5HGHA 4Y16B 1DCLA 2VDLH 2R7KA 3EWNA 2HYMA 3ZS9A 5DHVB 1RI1A 2AGVA 2JBAA 1P6AB 4L9LB 5FXCH 5I51A 3US0A 4YRIA 1CL7H 1I85C 3WBDA 4M9QA 1FO0L 3HB3C 1Q0PA 2HLPA 4NZYA 3P9RA 4L7QA 1TQUA 1Z32X 1CB7A 2CLDX 2JG3A 2ETWA 3FCTA 3SAJA 1ITCA 1YEHH 3WB1A 4MVJM 1BCSA 1MIOB 3IP6A 2YC1B 4X6CF 1S8FA 4F37K 5CIQA 2WCSA 2XAUA 5E4EB 4BWFB 4PTTB 3RPIA 3S4SA 4BPBA 2FYVA 1F8XA 4YLBA 4DH2A 2UZ3A 3K05A 4LMRA 2Q7XA 3U4GA 1RAFA 4DUZB 3QA3E 3N5AA 1XZEA 4BDVA 3H1BA 1RM3A 4H0NA 3CH4B 2M6KA 1R9JA 5G0TA 2VWPA 3PNSA 3F6YA 4XBGB 2FZWA 4YNYB 3BYYA 1CP3A 3OKPA 3WXVL 3PXLA 3MW8A 4DS3A 1F8UA 1ZM9A 1TO5A 1YZLA 5CS7A 1QLWA 3WOVA 2DQ4A 1OY3B 3TVMA 4MUEA 1K7FB 3OSVA 4I6EA 1XO1A 5KJ4A 3EXJA 1G2PA 2YVKA 1QO0D 4J94A 2CXTA 1JPGA 32C2A 2CK3D 1V5JA 1REQA 1OAZH 4MCYB 3VXTB 1K9VF 3E48A 4XOUA 2GXUA 3Q06A 2VYND 1YMVA 5I8CA 1IK4A 4YCNA 4YREA 1WMSA 1Q0ZA 3C3MA 2QD4A 3LQYA 2R6AA 1BEEA 1E1QD 3AL3A 4JNKA 3L7AA 1HL8A 3OEYA 1JDCA 2GCPA 5FOJA 5K4GA 3ZWQA 1B23P 1M7DA 3A7DA 3WC4A 2DUUA 4BZ1L 5MENA 1FG9C 1Z06A 3VRJA 3RHWK 4JI8B 5FADA 3WDIA 1AVTA 4ODTH 1EB9A 5AKTA 5CB4B 3U3OA 3TFKC 2DKSA 3RX9A 5JQGA 1KDTA 2ALAA 3P2YA 4BD4A 3CYFA 1IC5L 2BGJA 1K5NA 4YHNA 3R8QA 4X98A 3DTTA 2EFCB 4LZAA 4TNGA 3NHPA 4WO4D 4FA8A 1BXAA 3DX7A 1OPXA 6ABPA 4LLWA 2O52A 1C12A 4HH9A 3RC3A 4UIKL 4MNGB 3K8QA 2MU1A 1MFCL 4RZSA 4XVSL 4YHYC 3DHPA 5AW7A 1RAMA 3F2VA 1AKPA 6LDHA 1YPZA 2YD0A 3WXMA 1KB5L 3N3EA 2QQNH 5DK2A 4XXHA 2X1PA 5FPIA 3BP6B 2ESVD 1MFMA 5ACMA 2LGJA 3JD0A 5HXAA 4HR7A 4P3DA 3QCUL 3SKMA 1WDWB 3O6FC 5ESAB 3LYUA 5F1SA 2H2IA 3S3SA 1YMMB 3ZNNA 3A24A 1NIFA 3PSHA 3OWEA 2I9KA 5ESVB 3ZW3A 4Z3GA 3TQRA 2XKUA 4GRDA 1KC5L 2YJGA 1MCHA 4TMYA 1F7VA 1WMDA 3UENA 4U9HS 4QYWA 3SYTA 4QX6A 2BSDA 4L5IA 3D39D 1WUTA 9MHTA 3UTTB 4FEAA 2OP1A 4U2EA 5AI8A 3M1BB 2Q3BA 2EEDA 1R0CA 3O0RH 4NH0A 1E5YA 3DJ9A 5IB1A 2HJ9A 3HE7C 3IDJB 5T1DL 4FYPA 2IDTA 3A05A 5KOJA 3N9GL 1S7SA 1J8FA 3HYCA 1I2AA 3TW6A 2WIBA 1A2YA 5BSVA 1A9BA 4Y5VB 2I7OA 1R9MA 2CJUL 2LVBA 2WPGA 5LP6F 2ESVB 5HCIA 3CE6A 4XPGH 5C0GA 3TSWA 1NLBL 4EDXA 2G4LA 5I19H 5IDYA 2QUZA 3TUJC 3ZOAA 3FKUS 3L95A 4BUCA 5A6MA 1R6AA 1U7WA 2FJFB 4DCMA 3UYRL 4ZRDA 4LPWA 1SHJA 4JPSA 4DJEC 4IGFA 5EKXA 5H8DA 1RJFA 4ALLA 3K0HA 1YDPA 3A6LA 3L8MA 5CK5A 3D52A 3LHAA 5AQ0A 5ID0B 2BY3A 1D2AA 3D39B 3UTTD 3S35H 2C8VA 1VHJA 4L4YA 3VXPA 3NBUA 2JIQA 2R0LH 3M83A 1PFVA 4UT7L 4N3UA 4WXYB 5ISZE 4PLHA 4QUHA 5EHZA 4N6NA 1IVYA 2V54A 1RQ5A 5MFPA 4D41A 4FOPA 1T1YA 2X5NA 3QIVA 2AZMA 3SP1A 2R1ZA 4J6EA 3NVMB 4D98A 1JMKC 2YUIA 3HCBA 4Q3EA 1EKXA 3V0JA 5JSQA 1MVUA 5DOZA 4H2CA 4HPWA 3I9PA 3WKYA 4HRVA 1Y18B 1F3LA 1J22A 4HMPA 1IG3A 1LI5A 3OT1B 1VP3A 3K20A 4L4SA 4J76A 1YBMA 1JMYA 1ET5A 5T3YA 2Z31D 1O9VA 2HK7A 1ZFNA 5L88L 1Y8RA 3JARA 2E4XA 1BP3B 3TCLB 4AZSA 2B20A 3D2TA 1ACCA 2VHXA 1JSRA 2JCCB 1RLBA 5BRZE 3TEMA 1RC8A 1Z62A 5AWNH 1DIBA 2B2NA 3REWA 4YJ3A 2VSCA 4YV0A 4H0LC 4F1WA 2YDXA 4HGRA 1W1WA 5ERWB 4P2AA 5HQTA 5JA8B 4QRQA 1VKOA 4GZ3A 4V0KA 5FYKH 2OMNA 1FN4B 5DZPA 3KC2A 1VFAA 4B3JA 5CLGA 1UG9A 4Q19A 2XCRB 5F97E 2NX5E 4KXXA 4FJ0A 5EQDA 4JBWA 4L4ZA 1W4AA 1VA9A 4DIDA 2YX1A 4EI5D 5CT5A 4OH1A 4KG7A 2QOEA 4RE5A 4UOEA 2WJVA 5KANI 4Q93A 3S48A 1U4FA 2A67A 4IBSA 5LQSA 1NRXA 1JZ4A 1EDEA 2RHGB 2B3RA 5CCDA 4P48A 4HWOA 5CO1A 1ZSDB 1E2UA 3QXSA 4XX1G 5I8KH 4A38A 2KM1A 2QG4A 2IC5A 4ODUA 3JQAA 5IFAL 3NLLA 1YJDL 2O5CA 3WVNA 2CEKA 4M7WA 5D9SA 2ATKA 3JVFC 3D3WB 1YQVL 5HJEA 3LOPA 3UAZA 4MHOA 4O58L 1J0YA 2AZXA 2HHJA 4IMRA 1AKJD 4DG5A 1P33A 2VH5H 1U3JA 1LPBB 1INQB 3HS9A 2X2OA 4XHJD 4UQ3B 4HUMB 1LFAA 4YYZA 1G9TA 1E0DA 3BMNB 3SJ7A 2LQRA 2ZIUB 1T5DX 3E4CA 3FOWA 3N9GH 4D4JA 3WGTA 1CJVC 3GM8A 3AFMA 3T3NA 3I6GA 3A3KA 1IRAY 3GD5A 5CNKA 5AKXA 1KTCA 3TQTA 5JW3H 2X4DA 4N2NA 6REQA 5C34B 1MXDA 5FHAL 5JWRA 1E2FA 2ECPA 3UGUA 4FFYL 2C03A 1T2FA 5TNXA 3NA4A 1J24A 1NNSA 1XFPA 2E9BA 4IHAA 1XLUA 1XCBA 1J25A 2J0UA 2VAXA 4WEQA 4CDNA 3E18A 4IQ4A 4CKWA 2VSKB 2G3MA 2XSZD 3AESB 4A2MA 1I7RA 4ZJUA 1RE1A 5FOSA 3IE0A 4CV1A 4F15C 5C0BE 2ZVQX 4WASA 3FSEA 2AE1A 3DP9A 1CUUA 2W07B 3DIDA 2AJ3B 1OARL 1O8BA 3VGPA 1H4TA 1Y6MR 2VLLB 3T4XA 1S8AA 1VKHA 2BY1A 4KKQA 4XEUA 2ZW9A 2WXQA 4ZRMA 2VYFA 1M05B 4HEPG 5ESAA 1Z9BA 4PJEF 3SGKC 5AK0A 1KO7A 4E5XB 3MGTA 3EBLA 2I8LA 4MPJA 1DTEA 4UTAH 4LVUA 1UR5A 1WFIA 3EJYC 1NQXA 1AQLA 2EW1A 1QDLB 4IDOA 5IGXH 1D7FA 2V6JA 2EIZA 3HA5A 2P3QA 4S12A 4Z7UE 4ZSOA 2NY2B 1CEXA 5D55A 1YEFL 2ATAA 2QJOA 4OBSA 4H3KB 2NTVA 4PYOA 3KPSA 5E1BA 4WCYL 5DSCA 2AABL 4XP4L 1PLAA 4ZMTA 1T1ZB 1E4JA 5B7NA 2ZXGA 4LYAA 3DRQA 1GGTA 3L13A 3MOQA 3SEZA 3FDZA 4CKEB 3CNBA 5HQJA 1ZS8B 2G2RB 2QV0A 1H2BA 4DCCA 2G1JA 5SZJA 4JGJA 4RK4A 3CVHB 1FNEB 3OCUA 4Q56A 1Y1TA 4Y4KA 2B4YA 1NXPA 3KLNA 1QLEL 4RENA 3TWYA 1WXDA 2GBCA 3NBMA 1AF4A 4YQXL 2J31A 4G8IB 2UZPA 2BOBB 1FXUA 3O3MB 4JHLA 4C0KA 3FYTA 3QP9A 1V3KA 4U2BA 3EH1A 5FBZA 3D7MA 5KDOA 4KHZA 2VDJA 3D6UA 1M6OB 1W19A 4BQPA 1VZHA 2UY7B 3U30B 3BCHA 1DJZA 5K8JB 2ATVA 3PFWO 4KRXA 3ECVA 2XYCA 3T0EE 2P5YA 3DJFA 4N5LA 2VOTA 4L0ZA 1Z9PA 1EERB 1I8IB 2H3HA 4J4TA 2N01B 1CY6A 3A14A 2C9YA 4YJ2A 1HWYA 5CXUA 1SG6A 1UZ6E 1FSKC 2OMWA 1QFXA 3N43B 1MX9A 2I24N 4NK4A 5I9NA 2WJ7A 3RS5A 4K71C 3U3JA 4JPQA 1J05A 3CW8X 3QFSA 1S7UA 2ACEA 2X4RB 1YRYE 3ZR5A 1KG0B 1V27A 1UKEA 2G6BA 2EKQA 1QKZH 5KVFE 1W72L 3LUPA 2BM0A 3MLAA 2WSKA 3A6CH 4W5WA 4L73A 4X61A 1X1CA 1MC4A 5LMNB 4FQ1L 4HWZB 2V8BA 4WVLA 3CM0A 1AXRA 1AGDA 5I6PA 3I8OA 5GVRA 1EO8L 2VP2A 4XP1L 3A0UA 3IETB 5L8KB 3GC6A 1V1RB 1P2GA 3OTIA 1ISHA 3TYFA 1QH8B 4YMSA 4N2CA 5KNDH 2GK2A 4OV6B 4KFRA 1HE3A 3REVA 4QYAA 3O1LA 3GMIA 1JEAA 3IE2A 1E7VA 1LPOA 1TLLA 4R84A 3PITA 5B30A 3D2UB 2O1EA 1OF2B 2O8NA 4YBLC 4WI8A 4ZMYA 4CSZA 3GDFA 2PO6C 3RYFA 1IAQA 1Z74A 1AQYA 5D93B 5LQBL 4DY4A 2Q6OA 4IO1A 3I6KB 2IEGA 3GYBA 4DC9A 1IEVA 3KHKA 2X9QA 1EDBA 4ZT2A 3BWUF 4O8ZA 5FKJA 2N7SA 4JDZB 4CN4A 2ZUXA 1OB1B 3ETDA 3ZJ5A 4TSFD 4Q9LA 2YIVX 3VDAA 3LUBA 221PA 1EHAA 3G6JE 3BP5B 4YGAB 3A4VA 2Z8YA 4Z7VB 2XRAL 4EIWA 3P32A 2I33A 3WSQH 4R01A 1W9XA 2Y1WA 1QS0A 3TPUA 1U8JB 4L8CA 4YR7A 5BYAA 1H93A 2X1LA 4KQHA 5DB4A 3MBWA 2ZAMA 1QPXA 4EYKA 2GRUA 4DQDA 2XZTA 4MRNA 4BFFA 5F3BA 3PQ7A 4QXMA 3KYBA 1QFWM 3OZWA 2C88A 3Q01A 2VUSA 2QSCL 2AJVH 3E3QE 2IHBA 2NU8B 4DC1A 3W9EA 2DM4A 5DD5L 2Q3XA 1DC4A 4F5WA 4P3XA 2X6BA 1NOKA 1NQVA 4JLKA 1PTJC 2QLVB 1AO7E 3RUCA 2PWZA 3A8TA 4QDKA 1X6VA 4WTWA 4YBQD 5C0ND 3C6MA 1RZJH 4GRWH 3MELA 3M2TA 5CSBA 1L4IA 4WFGE 3QUXD 5TK4A 2RHEA 2HU7A 2I9PA 2R9HD 4PJIF 3L2OB 1YEGL 3V0WL 3PB3A 4G2AA 1AN0A 1DANU 2YXNA 1DUZB 2YTZA 3JTEA 2ZX7A 5BWMA 4K3DH 3PC6A 4KOAA 1GGJA 4LRWA 2JJ8A 2VPTA 1PLGH 3A3YB 3D6JA 3QTBA 4H88H 3UXFA 2FUNB 4M46A 4IOIB 4RVFA 5AJWA 5B38G 4PAGA 1BBJB 2F54A 2V1XA 3CFDA 5DYYA 1BM7A 2AC2A 1KSFX 1MLBA 4Z3IA 3G68A 1LP9E 3VMNA 3CNLA 3SY6A 3TLCA 2WO2B 2V4LA 4Q7DA 4YRPA 2HLNA 4C43A 1QCZA 4F5EA 4V1DD 3E81A 3STVA 1R33A 1J99A 1T1ZA 2HH0H 5DYFA 3U7IA 4B4VA 5EBLB 1FDIA 2QTHA 2QJWA 2J43A 3DPDA 3P02A 4ZVPA 3MT8A 4CLRB 4F7MA 4OJFL 1XJQA 3Q15C 1L3CA 3WN6A 2QJRA 3W5NA 4DY6A 5ANMB 1A1OA 2Z4QB 1FDSA 1D9XA 4U2ZA 1HYEA 3AIIA 3L3DB 3QUXB 4LOUD 2LBPA 4O2BF 2ZUDA 1L9QA 2BP5M 3RDJA 4QELA 1YU6A 3E82A 1UPAA 3H6GA 1DWUA 2IDZA 4Q7EA 3CLEH 1RMFH 5J11B 2Y76A 3DVQX 2L7JA 1NW4A 1ZTXH 1NHGA 2B2XL 1R5JA 5DASA 2QRZA 1XAGA 3BD5A 4JAMA 3M34A 4QJ5B 5D6OA 1FH5L 4NQDB 1UINA 3WN5B 5C0CA 2O06A 3UG3A 5DSZA 1R9GA 3BGFB 1KCUH 4DV0B 5SY9A 4UHEA 3SKJH 3QJHA 4EKDA 1Z5GA 4IG9A 1C4OA 3IELA 4JP8A 3I37X 4LA4A 1KCVL 3WJ1A 4YRZA 1J1PL 4FXGA 4PB0L 3EW3B 1SVZA 3KJFA 4MKIA 4QM7A 3HE6B 4FABL 5EHFA 1E9BA 3MJSA 4JFUA 2KYIA 4NUMA 3DL4A 5LGJB 2NNCA 2DAPA 4D0NA 3NP3A 2CFCA 5CEXB 1BBDH 2D8KA 1NBHA 1RHFA 1W5FA 1NT4A 3ZV7A 1L9NA 3H6KA 1Q8MA 5F7HA 3KKNA 3MJVA 1R0RE 4IDLA 3OZAA 4G8CA 2ZWVA 4ZAGA 3OTTA 4AJIA 4LBEA 5GGRY 1KB9K 4N1HB 4PCYA 3K5IA 2IBBA 2I07B 3P0YH 5K4AA 4YYEA 2I03A 3FCEA 5KO2A 5DD6A 4G8BA 4BLRA 3OKDB 3R1IA 1XH3A 5L6MB 5A16A 5AXCA 1L5RA 4BGDA 4D45A 4ODTL 2XBZA 2RHLA 5FKAB 3JUYA 3LQAC 2JQMA 3QWRA 5ADUS 4HGMA 1V0JA 1U93A 4M7JH 1XAIA 1LK2B 1YQGA 2YJNA 2OMXA 1P18A 1DXYA 3GUVA 3CGGA 1XCPA 3QWAA 4PJBB 5H59A 1EFRD 2GC7C 5I6MA 4HGKC 4UU9A 3SE8L 4PZLA 4J3JA 4LO9A 3ZC3A 4DA7A 1C50A 4JFTA 3SZMA 2FUG1 1Z83A 4IOSA 2W2LD 4TPKA 2FLMA 1I9RL 2IXDA 3NQKA 1GTFA 2XU9A 1SXJE 4NBXB 3CBRA 1D2MA 1J5OL 1ODAA 2UZXB 1O95C 3SDXE 3UT5B 3P9KA 2QRGA 1KL7A 3EXHA 2XKKA 4LHUB 3DAGA 3L8HA 1UBUS 3PCRB 1B4JH 3WX0A 3ORSA 5HVHB 2ODHA 1N33B 2C9AA 4WX2B 4Q1BA 1YHZA 4PY2A 2UZYA 2R8SL 2C2HA 4BAUA 4OJEH 4WK0B 5INTA 3LTVA 4HPXB 1SLVA 3HU1A 4DIOA 2VLME 4BBPA 1VPTA 3PKJA 4ZOCA 1MWOA 3EADA 4MIKA 2A0LC 4J4PA 3Q9NA 2PVPA 3EN0A 1MC8A 3Q3GA 4QRRB 1OD6A 3RPEA 4N0UA 4ZNEE 2RHTA 1S7CA 3UTTA 3W0WE 3IT0A 1EJ6A 1E1RD 5AXBA 5JOEA 1CC3A 5FPSA 3DEAA 2QQLH 4CEHB 3ARZA 3HR4A 2CNDA 1R6VA 3SJVB 3PDOA 2DCMA 3RFZA 2WC7A 4EY6A 3IVMA 3P4YA 4XR9A 2EDQA 4LHUD 1C1XB 4PLVA 3QE5A 1MCEA 1CFTA 2IEBA 2A38A 1XR8B 3VNRA 2IGTA 4APQB 3QF4A 4Q2ZB 3GN1A 1PEKE 2Q29A 3C5VA 1GUDA 1U2DC 1URZA 1B0ZA 4FAAB 5DRXA 3EXIB 1XEFA 2EERA 1HLGA 4H6XA 1AKJB 4XUDA 3JWIA 1Z0UA 5EEHA 2Q4RA 4HDQB 2IUTA 1WD5A 2K6YA 4PSVA 5CEZH 1LY1A 1V55B 2QB5A 2RHRA 4D42A 1KYZA 3F5WB 1H1TA 5IUSA 4Z7VF 1BG9A 2XT1B 4GP5B 2FATH 3IFNL 4WI0A 2JFPA 3R5HA 3I04A 2HH9A 3FYUB 2IFTA 3STWA 3D7KA 3ZS8A 3ZXSA 3AR7A 1N7ML 4B3VA 3LEXA 3RC9A 1NY6A 3BQUC 1GUAA 5A6SA 4Z0BL 4BX3A 3MINA 4QOHA 1V7QA 2ENQA 3NA9L 2N59A 4LNRA 3W82A 3WLIA 1TJHH 3Q40A 4YO0A 4QNMA 3D8HA 5GSRB 3OXSB 2PS0A 4NYIR 3AT8A 5F1KA 1CZ8L 1ESNA 1TNNA 2PBFA 1AE6H 2KL6A 3BMWA 1DBKL 4L78A 3AHDA 1NAML 2O0LA 1ZLYA 4RAUA 1A7PL 5I1JL 3TQIA 2DV6A 2JH2A 5IJVA 5F3WB 5FOWA 3VFPB 4GBMA 4C4PA 3HYRA 1Z4IA 3Q7RA 3S2UA 1C7TA 1MQ8A 3CMOL 3R0NA 4B35A 4UBDD 5K3FA 1GZHB 1X87A 3IILA 1VCOA 2HV8A 2G4EA 3QISA 4NX2A 3O2VH 3E8UL 1A1MB 1V47A 1F4XH 3P3TA 3BQVA 5IK2D 2WV3A 3PEYA 3TCLA 1PBNA 2FGWL 5LB1A 2Q27A 3CZFA 3VA6A 1UBFA 4XNYH 2XZQH 2CLSA 1Z7JA 4P9HC 3DXFA 3P97A 2PLFA 1S2NA 2QGCA 2YIHA 2Q4BA 3UA3A 1P62B 5FW8A 4Z7NB 1R9FA 1YC2A 4HUJA 4ZEMA 3EOBB 4R83A 4WN9A 2ZG1A 5LLSA 4Z2AA 4BL5A 4L3ED 1S1CA 1I01A 4PGBB 1KU6A 4HIEA 3VACA 2GY5A 1NGYA 3QBEA 3ZGYA 2PPCA 3U0PA 3AS3A 2CLMB 4IDEA 5ACLA 1WAAA 5ICCA 2WFZA 3MJTA 5AESA 3DX0A 1Z22A 2B30A 1KR5A 5BWNA 4N8CL 4KGZA 1C9NA 1JHXA 1FO0H 3GT3A 1H6BA 4U6QA 4LF8B 2C2ZA 1QP8A 2F43A 4O9HL 2Q9OA 4J1TC 3DZFA 1QUNA 3T5WA 1OYOA 2P2CA 4MMZA 5BZWB 5F5LA 3HL0A 4RA9A 1Z38A 2XYPA 2VWEE 1K0UA 4C4SA 4BQEA 4HEME 4JK3A 1NAMB 3DEJA 1WPGA 4WIQA 2QR0B 1UBLS 4CHTA 2G9HB 5LYJA 2X0KA 3UK6A 2ZWMA 4UUBA 1ACYH 3UHOA 2WLNA 4OLWH 2YXEA 3K9CA 3TXYA 2UYOA 4NJEB 2JE8A 3UJ3X 1TO2E 2EL7A 2XF8A 4TV9B 4M1DH 4DT1A 1UDAA 4YHZH 4K9EL 1IDN1 4R5VA 2B4RO 1OTHA 3WMEA 2R0KH 4JZJB 3VD4A 4PBVC 2VDRL 1L5GB 1XV5A 5BZXA 1E9AA 5E56A 4M29A 1JT2A 4IS2A 2VLKB 3ZK0A 4DDVA 5GGQH 2BVTA 1Z3IX 1JGIA 1NUNB 4HISA 1L4GA 1A9EB 3KXPA 2DQZA 4WESA 3FVRA 4JOBA 1NLDL 3T08A 5F72S 5G4OA 5ELMA 4DWVA 4LDJA 1WTAA 2BXYA 3R5FA 1ZHBB 5J13C 1W25A 3I1YA 5F89A 4HT1H 4U6XA 3BPNB 2QPLA 4FFLA 1X1TA 3L7IA 3CIQA 3BSWA 3OEWA 3WIOA 3QX9A 1JGVH 3NHJA 3T5TA 5IHXA 4MQ6A 2O6HA 2WXFA 2F58H 4CMIA 2L8AA 3Q8WA 4P9NA 4PFEA 2XWCA 4II2A 2CXHA 3BUDA 4TULH 1TF4A 3EJQA 2UDPA 2GYSA 2R23B 4LVNC 3LRSB 4GR5A 3UBXB 3BG5A 2PL1A 4N0FB 2JKLA 4PR3A 2Z0UA 5EGSA 4WY7H 3KHSA 4F8QA 2E9IA 5AKSA 3E7JA 1QC5A 1CUXA 2NNXA 2H4WA 2ZT9C 4QAWA 3P8ZA 3VD5A 3MSXA 1IGYA 4Y67A 2ED9A 2I7DA 2NZVG 1U0BB 1ANUA 3D4CA 2H1LA 3BWCA 2QT0A 3PD7A 4B9YA 3O2DL 4Q1FA 3G1UA 2XFXA 2FOLA 4POAA 4FR5A 4AMUA 2GJPA 3KDAA 3M6IA 2BOLA 1T1XB 1OE2A 2JK1A 3I5XA 3IN0A 5GGTA 1EPUA 3O9WD 4UM9D 1ACJA 3SDCC 3G8BA 5ALQA 5B1SA 1FMLA 2EP6A 4JFPB 1CR1A 2PRSA 4TUJB 2IS6A 1CLZL 1A2QA 4UOW0 3LU1A 2V5TA 4XMZA 1ZCZA 4OHPA 1SQ0A 3NC0C 4PLPA 2XOTA 4Y1AE 1Z8HA 4R8LA 3R3UA 5L3QA 1RQGA 3ZHRA 5GZOD 2ZSFA 2ZJAA 4XM0A 1AGRA 3OJVC 2WLKA 2QVIA 3ZE2F 1GM5A 3L49A 1UXLA 1XHHA 1L4YA 4IIGA 2C3WA 4DTGH 3IGLA 3CSGA 5FI1B 1G7CA 3L2MA 1UOOA 3JZDA 2HFGL 4TM7A 5F44A 4LQDA 4MINA 1TKWA 5DJ8B 2XRYA 1H2WA 4ORGB 2JRLA 4Q7LA 4HDMB 3TJHC 4NBZB 1X14A 5DVPA 4CL7A 2NGRA 1RKVA 4RTMA 3NFPA 3B53X 5DQJA 4BHUA 3BH7A 5TT1A 1G55A 4NO2A 4APQC 3S6JA 4BFEA 1GU7A 1OVMA 1Y3DE 1ZLVK 3HBPA 2PZBA 3BI9X 2ORYA 4X8OA 4K0RA 4M8KA 4J16C 1NC1A 2LUOA 4RDQF 1B8NA 4IWNA 1QP0A 5F7YC 5DM1A 4GQPH 1KJZA 4EI5C 3STHA 4GRIA 4GICA 1KYOJ 2A4MA 4AYGA 1AXSB 1RLJA 1JHTA 5DC2A 1EZZA 5CH8A 3SR0A 2V7GA 2AOXA 4YEEA 3GDHA 3B7RL 4AXWB 4ALKA 1N0XH 5EEZA 5IP5A 5C9JB 3P30L 4U0RC 2I85A 1Z3GL 2AI2A 2LR4A 3ASUA 1Z3RA 2VMJA 1FMTA 4MR8A 4NB7A 1YDGA 4FHFA 1B2WH 1XD1A 4W68A 3TGPA 2DULA 2Y6VA 5L4JA 5KJ1A 2MSEB 4BO5A 4KMOA 3RQSA 5KOHA 3D0VA 1DAMA 4N22A 4DUYB 2P4HX 5GRUH 2NAPA 2KMLA 1ZOLA 5AJYA 3KHTA 4JS7A 2ILTA 2WBXA 2D0GA 1A96A 4JG5A 4JY4B 4RRPA 5DR5H 4ZYYA 2NX5D 4QXGL 1Q44A 2DFDA 1OSPL 1W85A 3WUWB 4RF3A 1G4AE 1BV8A 3ME0A 1TK2A 2G5BB 4QBIA 4NHEA 5AUOB 2I6TA 5JC1A 3QUYB 3H5LA 2GCYB 4FQIH 1U3HB 5F9MA 1XIVA 5KVGH 1BWMA 1VIDA 3O3EB 1ZVMA 1C14A 4LCVA 1H8EA 3ACCA 1GRCA 3L4BC 3BT7A 1E3WB 1DQVA 2GUYA 2YN2A 4NE2A 1E2NA 1HDMA 4X8JB 3N1FC 4GYYA 4RABA 4XCNA 3WNPA 4AEIH 5E6UA 2XA1A 4LDNA 4YJ3B 1N5OX 4DLAA 2F7OA 3R2JA 5CEZE 4MI6A 5F1OA 4MAYB 2GBGA 4N2BA 4LTDA 1R0BA 2JIXB 4AP9A 4J3BA 2KQUA 1AG9A 3IEUA 1PZUB 4YASA 1YQTA 2X5XA 2CRYA 3HGMA 2OWDA 4EXKA 1FJGB 2Q5CA 1K4DB 5U9CA 1XWFA 5JAOA 4F7KA 3VH8B 5EIXA 1W8DA 1QZZA 2ADGA 5I6NA 1HZHH 5H4YA 5HRUA 1ZLSH 2MSDB 2XGSA 2W0FA 2X3AA 3M5WA 3REGA 3HMQA 4X62B 1NJFA 1ERNA 4WK2B 3TMKA 1YR9A 3KSMA 1HDRA 1S7VA 3AY2A 2AN3A 4N1CA 3UK2A 1GYCA 3CVHH 1US8A 2J20A 4IJ5A 3TR6A 3HWSA 1WFUA 4JMLA 4CF7A 1BMTA 2OMUA 5BSMA 2CJ3A 3IJSA 5JQGB 1D7BA 3WTUA 2GD2A 4PQXA 3INNA 2HIMA 1HT3A 1UFVA 2RKWA 3MHPA 3Q2WA 2CSUA 4E3WA 5E7QA 2OV0A 3RWJA 1WTLA 4DCGA 2Z31C 1F6LL 4KH9A 4FWIB 3IIJA 4FNRA 2WSMA 5LD2C 4Q0XL 4TUOB 5JR1H 1BFDA 1K2DB 1VRSA 1KG0A 1LV7A 1BE1A 3RVLA 4OUUA 1SYSB 5HKLA 2R00C 2HSDA 4NDNE 1T3TA 3DP7A 2GPAA 1XF3B 3WWYA 3SJAA 4QRUA 3GGWA 4G6KL 3FQ4A 1H2XA 4J1SA 4UHJA 2H1IA 3IRPX 3CSTA 3KQOA 3ROXA 4IFIA 3F62A 3ZK7A 2E9GA 3VXUB 3QJ5A 4C3OB 1GD1O 1AGBA 2WD9A 1A4K