3NIGB

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alpha-IIb
total genus 127
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nigB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nigB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nigB03
4WJKB 3ZDXB 3PPVA 3NIGB 4Z7OB 4FWWA 1L5GA 3QA3E 4HQLA 1U0OC 1JEQB 1RS0A 2QTVA 2WINI 3HXQA 1JEYB 3NIDB 3V4PB 4MMZB 4IGIA 1DGQA 3ZDYB 3AL8B 2ADFA 5HJ2A 5E6SB 1YVPA 1M1XA 1AOXA 2VDQB 3OL2A 1XDDA 5E6SA 1AUQA 2ODQA 1QC5B 3TXAA 3AFCA 1QCYA 2NUPB 4IHKA 1PD0A 4PN7A 1ZOOA 1FE8A 1RD4A 2IUEA 2NUPA 3M6FA 4NENA 5ES4B 4GZ8A 1QC5A 2VDNB 1N3YA 3EGXB 1Q0PA 3K72A 2VDMB 3NIFB 3FCUB 4BJ3A 4MMZA 2XWBF 3ZDZB 3EOBI 3ZE2B 2P28A 3F78A 1T0PA 2ODPA 3TVYA 4A0QA 3T3PB 1BHQ1 4C2AA 4WK2B 4WFQA 4C2BA 3AL9A 4JDUA 3VI4B 5KYYB 1RRKA 2WW8A 4HQOA 2M32A 3EOAI 3EGDA 3OKYB 2VDOB 3BN3A 3RAGA 4UM9D 2I6SA 3EG9A 1OLZA 3PPWA 1RTKA 3OKWA 1ZOPA 3IJEA 4O3UB 4IXDA 3IJEB 4C29A 2VC2B 3EG9B 3Q3GE 5KYUA 1U0NA 2ICAA 1NA5A 1MQAA 1M2VB 4JX0A 1PD1A 3EFOB 2O7NA 5HGJA 3AL8A 3EFOA 1DZIA 4MMXB 4O02A 4DMUB 4CN8A 1UEXC 1M1UA 4CNBA 4F1KA 2XGGA 2X5NA 1MQ8B 5KYXA 1TYEB 2NUTB 4MMYA 1IDOA 1V7PC 3NVQA 2NUTA 1JV2B 3HXOA 1XDGA 2B2XA 4HQKA 1BHO1 2VDLB 5KYXB 5E6RB 1LFAA 1U8CB 1OAKA 4G1MA 1U8CA 2NVOA 1AO3A 3EH2A 1M2VA 1YUKA 3PPXA 4HQFA 3ZE1B 3TW0A 2VDRB 3F74A 5KYNA 5HDBB 1SHUX 1SSLA 3K6SB 3T3MB 1SHTX 2VDKB 4MMXA 4MMYB 2XWJI 3K71A 3K71B 1M1XB 4UM9B 4Z7NB 4O02B 1PCXA 1YVRA 3BQNB 5LN1A 1PT6A 1MF7A 3FCSB 4FX5A 4NEHB 5KYWB 1CQPA 4NENB 1JV2A 1IJBA 1L5GB 1XUOA 4WK0B 4UM8B 3PPYA 3FCSA 1ZONA 4HQNA 3TCXB 5KYWA 3IBSA 3HI6A 3E2MA 3BQMB 4G1MB 3ZE0B 1M10A 3EGXA 1T6BY 4CN9A 4G1EB 1JEYA 1MHPA 4F1JA 4G1EA 3N2NA 5BV8A 1MQ9A 2I6QA 3K6SA 4M76B 3EH1A 1N9ZA 1SHYB 1SQ0A 4XW2A 5KYYA 5KYUB 2P26A 1IDN1 2VDPB 1MJNA 1CK4A 4WK4B 1M2OA 4K3JB 4O3TB 1FNSA 3OL2B 5E6UB 3EGDB 3GXBA 1JLMA 3V4VB 3VI3B 1IJKA 5E6UA 2I91A 3K72B 3ZQKA 2UZYB 1ATZA 1JEQA 4Z7QB 5E6RA
chains in the Genus database with same CATH superfamily
1EA7A 5ANRB 1BWQA 4Y19A 1I10A 1AHWA 4DDVA 3U7QA 2CHGA 3R3HA 5IT9A 2NNAB 1TKAA 2YKLL 1ZUD1 4IGBB 4JI2B 5A7GA 2J31A 4CBVA 4XKJA 5ESVB 1U8JA 1QRNE 1MXDA 3F85A 4AN1A 3N3AC 2P5TB 1A0QL 1NFIB 2XMDA 4H2DA 3ILXA 4MLDA 4KSCA 3SKXA 3WNCA 1PZ3A 5CH5A 4R26L 4G5ZH 4J94A 3NA4A 1Y0BA 1N9PA 4C6TA 1Q1ZA 4I6JA 5FR2A 2DV6A 5HGJA 4CU2A 3T34A 4C7OB 2BZ0A 4XBPB 1SBNE 3HCWA 4BKQA 3KE0A 1SBBA 1VJSA 1VLZA 5INDB 2G36A 5GM1A 5J2TF 3WY9A 2EC5A 4NZOA 4N54A 5SZKB 1CDJA 3PXDA 3LFTA 4I2VA 3C24A 3EMKA 4CTJA 1DX4A 5JOQA 4JQZA 1GZVA 4B60A 1DN2A 4B87A 4TUKH 1PG7W 1O0SA 1IQDB 1FRZA 1X2BA 4A7PA 4XTRC 4YFEA 2PRJA 3R4VA 4EN3C 4DPAX 1JECA 4CRPA 1WZCA 3P0IA 4L15A 2IAMC 3GDHA 3LIZL 5F7NC 4GI2A 2H1WA 1YB2A 2ZWPA 1QP1A 2HLNA 1IJKA 3PUHA 3HZMB 5GGRA 4JM2B 4OPMA 1DEDA 4RCVA 2XQYA 3PWPB 1A5AB 1AIPA 3IS0X 4KDVA 1LW7A 4EYQA 4F7EA 1E4VA 2I85A 2VLKE 1MW8X 4DMFA 3KLDA 4ORGA 3TF5A 5MP6H 3PL1A 3BPNC 1GKYA 1A50B 5F7DB 5EUMA 1KYZA 4ISVB 2DYRB 4KGZA 4EGSA 1A2QA 1BD2A 3G5YB 1Q9OA 2FD6L 2CLCX 3T1HB 3V79C 3D2TA 3MBEB 3OF6D 2H17A 2Q6OA 3LP5A 5I6DA 1I6LA 5AI4A 4P23B 2R4RL 3RBXA 1PQ4A 1V5IA 4PG2C 4C4YA 4AJWA 4O9HL 1SOAA 2VZSA 4JN2B 5E8OA 4PW4A 2OFWA 3PNWA 2JVIA 1GHTA 1E1YA 2B5IC 1JEJA 4LDCA 3MTXA 1F8UA 3MG9A 1DLJA 1E7VA 1TVBB 1YQUA 2PF6A 4P3KA 4ZQFA 2Y1FA 3O8OB 2B1JA 1D2EA 4MDEA 3VNUA 4FJZA 3MACH 4BNHA 3NM6B 1BZ7B 4MX7B 3EDRA 2OB2A 4UUJA 1Q74A 4KXYA 3H0TB 4QCIA 1W5FA 2HPOA 1X7ZB 1WMBA 4O2AA 2RCSL 3PNBA 3K8YA 3QEUB 5EN3A 4LK2A 1BIIA 4PJDF 1YUBA 2CUAA 2VN7A 4IH1A 3TZ6A 3C6ZA 4R8WH 4QNPE 4FZRA 4FQQA 3OIUA 1UKSA 1WBZB 3S44A 4IMPA 3B5HA 3LHPH 2FEAA 2LT9A 4GRAA 3TL3A 2YHSA 5GV7A 3QR0A 5IB4A 4AKOA 1U5AA 5AAMC 1Z3CA 4JFFE 5CVEA 4ENQA 1SH7A 3EVDA 1AZLA 3FQNA 2J0VA 4B3IA 3DCYA 4BAUA 1N5AB 5ANME 4H88L 2JK0A 1QIFA 1QKJA 1ZN2A 5E24E 4BNLA 4HCJA 4RL6A 2PJDA 4RAHA 1PJ2A 4R31A 5GXBB 3LTVA 4XNUL 3JT2A 3OE4A 2CK0L 2ZUSA 3FBTA 2VT7A 2HT3D 3MINA 3D50A 5LQCA 1UBJS 1N1MA 4RESB 1J1OH 2IH3A 1W6WA 4F4CA 1FG9C 4QAMB 5KOHB 4ODWA 4RGOL 3HZYA 4HBCL 3WEAA 1DBBL 5JIIA 1FTGA 5TT0A 3QHZH 2O5YL 4WXYB 1CT9A 5H3HA 3MM4A 2A9FA 2A5JA 1I51A 4ALIA 3NGXA 4PS4L 1Q3TA 1MHCB 2A0FA 4IZHA 1I1CA 5E6YA 4FLQA 1M3IA 1BAPA 3QDGD 5E2TH 3D4NA 1HCFX 4M6WA 2ZYVX 3G0BA 1Z0FA 1SXAA 3WL8A 5SY9A 3ZHOA 3EQ8A 3C09B 4JDVA 1QTPA 1ZAGA 3ROZA 3P3SA 1CS6A 4IOMA 1JNLH 3Q9LA 3I0MA 5IEHB 1QHSA 5TF1L 1JF6A 4CNIA 5TQVA 1ID8A 5FWXA 3IKVA 4LP4A 2QDKA 5DW0A 3QOXA 3CFCL 1AR1B 5REQB 1N32B 1GRQA 3VQ1C 2V5YA 4NESA 4LLDA 1K4MA 2QQLL 4LLMB 5GM2A 3MTRA 4F0JA 4ENRA 1OTTD 1FP7A 4TN1A 5CUSL 2ZIXA 1XSJA 5DC2A 3ARED 1NVFA 1VLLA 3B37A 1F4LA 2DDQL 1T0IA 2OENG 2GT9A 2JKTM 4J3WA 4JJFA 3G6AA 1XVVA 4GAGL 5E8PB 1I6MA 1B41A 3ZKWB 4K9NA 3EQ6A 5CCJA 2QVCA 2A5FA 4OHCA 4GW3A 4ZVLA 1V1MA 1E3MA 1G4HA 2CFTA 5DM70 4RJLA 3ZWNA 4K3DL 5AM1A 4XPBL 3EEIA 1NM9A 5FA4A 2V2XA 3QUML 1HC7A 3PUZA 3BGWA 1R5WA 3BE5A 5HDBF 4L4VA 3MV9B 3ZV4A 3LEXA 5DO9A 1T4BA 4NPYB 1WP4A 3RX7A 2IBZX 4IDNA 5G2OA 5DZAA 4M7OA 4LZZA 3I61A 3QXSA 1CBVL 5BMVF 1G4UR 3GT4A 1PR3A 3HY3A 4UB0H 2UVEA 3BIFA 1TI7A 5CFZA 1KI6B 3EFEA 4L5FE 1UACL 4XN8A 3A6DA 2P5SA 1AY1L 1SOMA 3OMLA 4FI3F 4JM0A 3CFIC 1GD1O 2OXCA 1QO3B 2VUUA 1C9EA 3UJ7A 3Q88A 4JSYA 2O1SA 1SXGA 3D6JA 2CMHA 2ZJ6A 4PRIA 4N0UE 2ZXDA 1F0PA 1PVDA 3RFFA 4JFFD 4EX7A 1KTCA 4XNMA 2H06A 4RFNC 5I6XB 2YMXL 1TCUA 3BUYB 2J3EA 4B0MM 2MMCA 2NUAA 1EFXD 3VFVB 4WJKB 2BVQB 1TNNA 1YN6B 3M6IA 3M83A 2DEXX 2HT2D 2R6JA 4FUTA 4NL4H 4U3JA 1U5BB 5FR3A 5B2FA 2E47A 5JIKA 2I4RA 5J2UB 2FO4B 1P91A 3HC7A 1IB5A 4UE6A 1T3FA 3A28A 2PO5A 1RQGA 3QNFA 5FTMA 5B6PA 1UWXK 4Y2PA 1T21A 2FZWA 4G1UC 4F86A 1P0MA 4XWYA 2HFJA 4UOEA 1X74A 5G0VA 1XIWD 4XCEA 3HFJA 3JAKA 4RAVB 1G42A 4G6FD 2G7ZA 1ZTXE 2QN1A 2FPIA 4Q3OA 3MCKA 1QHHA 3CN9A 1IHDA 2BI4A 3USZA 1NLBL 3J7HA 5BN1A 1L5WA 4M02A 4YP7A 4D6XA 4N3TA 1T3TA 4RX1A 3QZMA 1G7JA 3B8HA 3D64A 4B75A 4PR3A 3ATAA 2PH1A 5F6HI 1BIIB 1T2DA 1G9TA 4Y2TA 5TE4H 1B15A 2O6PA 3ZVMA 2WVVA 3IAFA 2CNWD 1DJOA 3LIUA 3H19A 1H6FA 3K09A 3ZCUA 1B0GA 2Z6AA 1RUMH 2Y7QB 1PKXA 4FE9A 3ZKMC 3N0VA 1N7GA 2Z5LA 2K7FA 3B12A 1A5SB 2DG2A 4LCUB 1G63A 2AJSH 3N04A 1S8FA 2O7QA 3ZLVA 4ZYYA 12E8L 2G17A 5HGBB 1N0IA 4KH1A 1X5YA 1N2OA 3IGLA 5LOVA 3HVNA 4S1TA 3GXOA 1T43A 2FKNA 4AVKA 1NBZB 2GYWA 5AJZA 3FFCB 2VZ8A 1LLDA 1N7JA 1NI3A 2QZZA 3RIGA 4DM3A 1FL3B 1N2CA 1M56B 1ZOOA 5IHPA 2E9GA 4G09A 3CDGB 3RWGB 4Q9NA 2OG2A 3QCUL 3ZZLA 3AU0A 3NG5A 2GPYA 2UZIR 4PP2A 2VXOA 3OC6A 1PWYE 5IIEB 4BVKA 1RADA 4K8RB 4G9FD 3GJFK 4OQTL 1SOUA 4HWZB 1LEGA 4GT1A 4WMLA 2A4ZA 4UDXX 3MGGA 4NWUL 2CO4A 1WKCA 3IU3A 4Y16D 1C3VA 1T8YA 1PJZA 3QITA 1WJ3A 2JEYA 1QTQA 4F8NA 5CD1A 2G2NA 1Z75A 3T2NL 4JFDD 2P43B 4RF2A 2HJKB 2PBZA 4NONA 5I1EL 3UENA 1XZ8A 3FUEA 2ATKA 4Y0VA 3P9PA 1W9MA 4DOHE 3HE7C 3SSOA 3AWEA 2NU6A 4CQMA 1SVKA 4HWNA 2H26A 1XEWY 3V4VL 3KT3A 1SUSA 4YONB 3E3OA 5ELIA 3OXRA 1KLUB 4PJAB 4G4SO 1G18A 1J1PH 1X15A 3O92A 1E8MA 5FFMA 3AY4A 3GGWB 5B1IA 1FSPA 5JRJA 2OEPA 4LDAA 3ZZQA 3VPXA 4RX4D 1WCQA 4YC2B 4MXQC 4R7GA 1U8HB 3TM5A 3G9XA 4M8RA 2EKLA 3GBVA 3MRRB 2Z7ZA 1KEGL 1VL8A 2WNIA 5DD5L 1JWUB 2Z8RA 4NQEA 9LDBA 4DLWA 4MULA 1XZWA 3NIFE 1UATA 4L51A 3OP4A 3A2MA 4HIQA 3FSGA 3LTNC 2B94A 3DURA 1FW6A 4WTXA 3V4RA 5FUOL 2P80D 1E89A 2XFXA 1TM2A 4UQIM 3ZIUA 5C0OE 2PL9A 2BHSA 4PZ0A 3GMOA 1J10A 4EKXA 4D0CB 3JVGA 4E41D 2VLIA 3CHSA 4ZNEA 4YJ2F 4EI5A 5C09B 1MIMH 2F43A 1JKJA 4OSOA 3E9CA 1FIEA 3VXKA 3QE0A 3DMNA 4XNUH 2XKAA 4YGVB 4R8SA 4PV9B 4URTB 4L8YA 3V8CA 3PC8A 2C78A 4H4NA 4C56D 2YIMA 3CQQA 4LAQL 4U2GA 2CJUH 4KQEA 3ISVA 3VX1A 3EOAA 2DZEA 2VABB 1PI3A 2WKOA 1CUHA 3KYCB 1A4KA 1NINA 2IU0A 5KHOC 5DI3B 4DLZA 2JFUA 3S2GA 4RFLA 2G8NA 2D74A 2HJFB 2FPGA 1CP2A 3TEWA 4ZYXA 3ICEA 3EVCA 2KH2B 4KY1H 2BR4A 4OKDA 4UBNA 4E6PA 1CTMA 3AV0B 4GXFA 1NAIA 1O8CA 4Y19E 3LCCA 2B37A 4YECA 5JXWA 1YCFA 4IWXA 3B2XA 3DT9A 2KPNA 5E8DH 3QXDA 4KLRA 1HWHB 2FF7A 1XEWX 3NNSA 2QROA 2EOAA 1QJ4A 2EIXA 3WFBH 3P30H 1ZC4A 2ZNWA 1E3DA 1LD9B 5IFAH 4JDTL 2R65A 1SAYA 5JS2A 5ID0A 2H8KA 4KGVA 5DTRA 4E9WA 4B48A 4E51A 4WKPA 4AV0A 1RJFA 2XXMB 2PGLA 4FHBD 4OBEA 1LJMA 2NY5H 4RU1A 1TEGA 3S4YA 1QMPA 4DGIH 3K8LA 2OCGA 3P71T 2IXBA 3GSWA 1DS6A 4TVPH 3JD4A 3WBJA 5I1HH 1NGYA 4M5YH 5GZOA 5FYLD 3DC2A 2WIIA 1KPHA 5INDA 1QWNA 4BELD 1NIAA 3D6HA 4J0GA 3NACH 1YNKH 2HY7A 1LEKB 4H2AA 4N9OB 3DQPA 5DJXB 5I82A 1AD2A 4UAJA 4WAFA 5H70A 1T9ZA 4ZAVA 5DEGB 3A4NA 2A1WH 4RDQF 1LLFA 2VQSA 1R3HA 3BEWA 4RDQG 3LRSA 1R5IB 1CN4A 5CCXA 1LI4A 3N5KA 1L7EA 4PWHA 3F5DA 2HJRA 5FYLH 4D42A 1OXTA 1BXRB 1CE6B 5EIVA 5AKVA 1JSLA 1R34A 1US8A 1ZHNB 3ESOA 2BMVA 1HQRB 4R8KA 3WMGA 5AYQA 1ZCZA 4GS7C 1EAPB 3MHPA 4FFWA 4RLHA 4NS0A 1CX9B 1PQPA 2M98A 4AYFB 2I27N 4WO0A 3NPZB 4WEBL 3JV4B 5AOLA 2VXBA 1JQEA 3ZEIA 4QWWC 4KK6D 4V1DA 3RGHA 1KEMH 1O87A 4QRRD 1C16A 2PVSA 2PO6D 5BPFA 3ILYA 4J8PA 1A7BA 2FECI 5IWCA 5TDPA 2ZITA 4GKZA 4EG6A 1P4AA 4WUKL 3MXVL 1ONPA 5AXCA 3SHOA 3GJRA 5F1IA 3KUKA 3VI4F 5DNAA 3WQSB 5DNWA 3MMPA 3LUBA 1XYGA 3N2GB 2AUMA 2IXQA 3WMQA 4M5TA 1JDAA 5C5EA 3DROB 4E33A 1PFGA 3RKRA 3HHSB 3RWFB 2VXSL 3J80A 5FGCE 4GS7B 2WJ3A 2DQHL 3W56A 1P7KB 5B8CC 2WPDD 1Q72H 5JW6A 3L7EA 1H3EA 1PDOA 4F8JA 1NZDA 1OA1A 4DMKA 4YMIA 2YN4A 1RRPA 4J3OG 2AXGA 4F2HA 5BS0B 4H7DA 4EY3A 3C14C 1RK1A 1M9WA 4NZTH 4J4HA 3C3AA 5KBDA 4KE8A 3BCRA 5IVXB 3AR5A 5JS7A 2DLFH 4YSEA 4H7EA 5M7QA 3CSSA 5IEKA 3LN5B 3RWEB 4NQCA 3IEUA 1GHFH 4A7TA 2WSIA 3VGAB 3INRA 1HL3A 1JHVA 2BVYA 5HQ3B 3AUSA 2PCFB 3PXEA 1G9MH 5JNVA 3VXUA 1UYWH 2HA6A 1RVV1 4D82A 1JRHI 2X44D 4OUUB 4QYIB 2GHRA 3QVMA 3GZ4A 1XKQA 1QZUA 2ARJQ 4A2MA 1RWWA 5C09A 2EDXA 4TMZA 1Z6ZA 2CMGA 2I6GA 5J06A 4BMCA 2PTVA 2QZ9A 4N0YH 1ISFA 4EY4A 4R7DB 3OKNB 5LXVA 4XGRA 1ZGAA 1BM7A 3F3SA 1IBYA 2VS1A 2RIPA 1CS0A 2A9MH 3QVGA 3PWJA 3LN4B 2RR3A 1XTPA 4N4YB 4HN4B 2DT8A 2CY0A 3ESPA 5A62A 2JFBA 5HTKA 3C1TA 1KCRH 1HOCA 2C4FT 2HSWA 1KXTA 1VLJA 4DA4A 1AGNA 1NPJA 4TVPD 1RWQA 2L0XA 3IXTA 2WJYA 1UWVA 1QSEA 4ZTEA 3HR5A 3VRLF 4UJ5A 4NZTL 1PNRA 1CYEA 3K9WA 4IGBC 3BGIA 3OCXA 1N6IA 1INEL 4PJ7F 5FM5M 4Y2SA 4Z0PA 1E3WB 3V8OA 2OGSA 2IBTA 2Y92A 4R9HA 4I3HA 2YJZA 1J24A 3GZOA 2O3UA 3HC3H 1DLIA 1L4NA 3L84A 1YRYE 3BWZA 3LAWA 1QO7A 5EG6C 3X1FA 4ZS6D 3FTCA 4NEQA 3QH4A 4KXCA 4ZJZA 3WMXA 5I1GH 3IDSA 3BKXA 5IWAB 3LEYH 3N9GL 1GUFA 3H42L 3PU6A 4OEHA 1MNQA 3CU5A 4F2FA 1ZS9A 1PJSA 4KP7A 4NFBA 2C92A 2X70A 3MRDB 2O3JA 5EKXA 4EVNA 1J5OH 2E7BA 3BFXA 3ZE8A 1LBQA 1S2IA 4AMVA 2YK1H 1WSDA 3GS4A 3S2IA 3WWZA 1DGQA 3EGSA 4EZMA 1IN5A 3ARVA 4X6FA 3VZPA 2Q50A 4B17A 5FB8B 5P21A 2HTKC 3G1UA 2XADA 2I3DA 5AENA 2JIDA 1WFMA 2QL7A 4LHUD 5AVXA 1HZZA 2X7HA 5CSBA 3CZUB 4FQXD 4TNEA 3K2MC 1UPBA 4IQ8A 5C07E 1IRAY 3E9QA 5CURA 4L50A 3QDJD 2VF5X 2IXDA 4M8SA 4RTQA 3F3YA 4ZFZB 4BNZA 3AH8A 3PQYA 4WDIB 1BYOA 3G89A 1GQYA 2JBAB 1C7ZA 3GWZA 1A69A 1SVSA 1F8FA 1W2WB 4Z7VB 4JC4A 3P3TA 2FW1A 1W8EA 2WQ6A 4UPVA 4DSYA 4XWWA 2G9RA 4DKFL 4J1TC 4N0FB 1JPNA 3ADDA 2HC9A 1W93A 4EI6B 3PPXA 2E6JA 1VM6A 3C85A 3ESXA 1NAKH 2VLLB 5LZ4A 1FNSH 2WWOA 3FU3A 1AC5A 2ZM5A 3ZCXA 2HT4C 1RJLB 2WCGA 3SE6A 2ZAIA 3OMXA 3MLRL 2ONYA 1MQKH 4OZGF 3WHXA 5TXGA 8ABPA 3ETBJ 4PZLA 2P9FA 3KKQA 4RLSA 3QE4A 3ZU5A 4PJ9A 4QRQA 2A1IA 1VF5C 3G0CA 1U2DC 5JORB 3T5MA 3TPKA 5AK3A 3BQVA 2R6R1 3WLHA 3ADKA 1VL5A 3ZD9A 1IGCL 2W9DH 4WA7A 4P2OD 1D4AA 1KLFA 1WT5A 5KS2A 4CCYA 2VN4A 3B2DC 5JO5B 4KOBA 2WQZA 1AB5A 5LCVH 4JDEB 4NMXB 1XCTB 3UTSD 4UYPA 3EULA 4ZJUA 4S3MA 2AERT 1JPVA 5JH7F 5D6DA 3US0A 2OSLB 3N55A 1JAZA 3MRIB 4WW2F 4NKOA 1RP9A 5J2UA 3BVUA 4EBBA 4V0OA 5EIOA 4Y0GA 4OB7A 4DS3A 4EO9A 1SHKA 3F3HA 4PJEA 3TO4C 4S1RH 3ZKND 5HKAA 1HNYA 1CEEA 4IOFD 3SCMB 5ERWA 2J6HA 5C1BA 4OTXH 3MWYW 4YDIH 3WLOA 2ZIEA 1M6UA 1MQKL 2EDJA 4RAUB 4K8RL 2DMCA 2WOBA 2QZQA 2LCFA 4XJTA 5I48A 5ALBH 2Z08A 1Z5LB 4GR4A 1DXQA 1JIQA 4NWUH 5SWSB 4OJQA 3H0EA 2I9PA 4V0RA 1F8TL 4KHZA 1Y7IA 1CQXA 3U7JA 5DNUA 5AOKA 4HB4A 2WIBA 3K2KA 4G2NA 1I3VA 5EMYA 3L8CA 5BQ7B 2FO4A 2VRNA 4QY8B 1N6VA 1XK7A 5LCVL 5H81A 3QA9A 1VFMA 3GRKA 2A5UA 3K32A 2E4UA 5HPOA 4G83A 2ZI9A 2W59A 2Y7LA 3TFOA 4CF4A 1IX2A 4ENTA 4ITRC 4NUJB 1G0DA 3IB3A 2BNRD 4EZKA 1Y9AA 2PJRA 2GAJA 4V11A 4CQMB 3T9DA 4JW3A 3OJVC 1EUCB 1ZJ4A 3UMYA 3SDCA 5H37A 4AJVA 3PVZA 1DWUA 1KFEB 4PWGA 3SBEA 2XD4A 4JVNA 5ITVA 2P44B 1THGA 4N3BA 3QVXA 1HEHC 3DZHA 3G6KA 2ENJA 1LTXA 4PJHE 1FW8A 2YGNA 3GCXA 4GQAA 3I39X 2DHCA 1UJ3B 2ENUA 1E6JH 1EFTA 4QU8A 1NPYA 4M3HA 3AVQA 2D2IA 4GMXA 1TKWB 2RDMA 4HWZA 1UBGA 4YBQC 2O8DB 3VKGA 2ZBQA 4K8RH 3ARDB 2OZLA 2CDCA 2DQHH 4C4XA 1SJHA 1D5WA 5FTKA 5DVNA 4JBWA 3T7CA 1TA9A 2F9MA 2I1WA 5E1DA 1IGJA 4MO2A 4JJHA 1Z8FA 3ZO0A 1EFVB 4X7CC 1ZGLB 4HZGA 4G7RB 4RMVA 4AM0A 3E18A 4BO1A 4WCDA 1FYEA 4JO2H 2BERA 4LHUB 1VFBB 1HYQA 1MPXA 4FFDA 4RMTA 4GQ9H 2YJ5A 2XT9A 1F90H 2PLTA 1EMDA 3Q98A 4O33A 2ZF9A 3F5WB 4NXMB 4QRQB 5FA8A 2C83A 1BEYL 4IFTA 3IODA 3FHTA 1JWLA 3ZKXB 4HQLA 1FQ9C 4DO6A 4P3NA 2R66A 1M6WA 5KW9H 2OQRA 2WK1A 4G7VL 3LKPA 4N6OA 3PL5A 3RREA 1PV1A 3A6BH 4AKTA 5GGXA 4J1TA 4MGEA 4IBYA 4P4KC 4I99A 1NBWB 2VJLA 4Q1FA 1FQJA 4EMBA 3VTAA 2P1YA 4HWBH 4P46A 4WLCA 1KOGA 1OP3K 4B3TB 1I2AA 4RZHA 1P6QA 1J00A 1Y1LA 1PGRB 5DFVC 2B0SH 3PL6A 1E4KC 1ZRMA 1HYBA 3RDPA 1RUAL 5PCYA 2C9PA 3AQZA 1VG1A 3GJ8A 4NJOA 1OTSD 3REFA 4NPKA 1I7ZA 3FBGA 4GH7B 1Z0JA 3CFDA 1SEBA 2Q3DA 2BEVA 2QGDA 5EZJB 2VXVH 5T67A 2V7QA 4DN6A 1U9YA 3B7GA 1WW2A 2YXDA 2N3ZA 3UAJA 5A9SB 1RHUA 3CRMA 1CB7A 2HMIC 3THYA 1ORTA 1ECJA 5I6OA 1N2ZA 5HF6A 3OL2B 5DBIA 4FXGB 2QPFA 2FK8A 3IPFA 5BURA 1KGDA 5I4CA 3T2OA 4HDNA 4ACAA 5HIAA 3RIKA 4GAEA 4OLFA 1U8OA 2RB8A 4QY8A 4QBKA 1FUNA 1VDMA 3HA5A 3PC2A 1RV6X 4LRUA 1ZUNB 4F3FA 4NNXA 5BSUA 3NHJA 4UTAH 1XNGA 3CSGA 4XOIA 5KVFH 2H4JA 1JF8A 4OUOA 2YWRA 4FDVA 2G40A 1WR8A 1AX9A 3B3BA 2XVLA 1Y3AA 5CJOL 3VI4B 1HUQA 2H1XA 4JB0A 4RJKA 3BPLC 1JFSA 3CMGA 1Y4ZA 3KLKA 1Q38A 3GDWA 1KLFB 3ZWMA 3TN0B 3DHEA 5D8JH 5DQJA 3M88A 2CLRB 1QK5A 1H4VB 3BFVA 9ATCA 3LKOB 6PCYA 2RFLA 3QHZL 5AJHA 4XIGS 1IBSA 1QF9A 3KVPA 2HLHA 1POWA 3OFNA 2R62A 1JFFB 5CBEA 1DUZB 2CHDA 5J43A 2NU9B 4WKBA 4ZO7A 2X9XA 4R7TA 5LQSA 2DOCA 1SD5A 4MV5A 4XGZA 1CD1B 4KE7A 3A06A 2Q9BA 1ZLUH 1VPLA 4RVGA 1QF7A 4NENB 3IDUA 1MXHA 2QV7A 3FCTA 3CK0L 3EXIB 4BFYA 3QG7L 5G3ZA 2PE5A 4NARA 3I34X 3W11C 5BRPA 3EMDA 3R5SA 4XZUA 3AB7A 3TN0C 4DMCA 1D1SA 3PFCA 2WHRA 5BZZA 4MR7B 3ILSA 1QMUA 2NXZD 2XTJA 3Q7RA 1MH5B 5DK0A 4CSSA 3DDOA 5K9QI 1G7TA 2BJHA 1RRVA 3RVPA 2BGGA 4FS3A 3UAXA 2P48B 1GFIA 4TTAA 2BFEA 1O0CA 1CG9B 4FMVA 1RK1B 4PPNA 1MCEA 3M4NA 1AIFA 1K97A 3PLAE 1M7HA 1HHGB 2GJJA 4LOJA 3DXYA 3IVKA 3GSNH 1QHFA 1A6ZB 5AW0B 1OBFO 3QHFL 1XGYL 2GSWA 4PRKA 5DHYB 4HAUA 1CFQA 1RLTA 1NMBL 4JI0B 1WZ1H 5HZHA 3J2PA 3O94A 3UWPA 3SQOH 2IUSA 2WWFA 5FW7A 4OCZA 1PEZA 1XL6A 3TD2A 4J0KA 2IDZA 1P7BA 1OOWA 1T7VA 4TLUA 3PQYD 3KEGA 1OB1B 5DCCA 4XP1L 1F17A 1DZ0A 1V27A 1RWPA 4Z9FA 3HE3A 5C18A 3PL6B 1OFUX 2ZPAA 3FRIA 4MQFB 5B1JA 4ZREA 3OR7A 1SVLA 3TXYA 1DZ3A 3FMGH 1I0IA 3GJ5A 3TNLA 1XFPA 3O2WL 5D7LD 4ZP1A 4V1DB 5CSGA 3I5XA 2JNWA 1EHLH 4Y9SA 5CBAB 1D2HA 1CWVA 3KL0A 4LDZA 4KNSA 2L82A 4HF5L 1W44A 5EKUA 1ZW6A 3UTCA 3VWKA 5DMHA 2R2HA 1DTEA 1S7SB 2VO8A 2JI6A 4U7WA 4ZHQF 1HHIB 3DKVA 3UBTA 4E9LA 1NY5A 1B7GO 5HHTA 4PW9A 3C6LA 3VD2A 2KZKA 3MV8B 5F6IB 4YT8A 4AIOA 1T8WA 1MAJA 4AULA 4GVLA 1B90A 3SM9A 3P4MB 2OR9H 4P06A 3FSJX 4HKXB 5PGMA 3EEYA 1SKAA 1QR1B 4BXOA 2YY7A 1B23P 2W0FA 2EDKA 4Q21A 4GPZA 1SHXA 2AJZA 3OEHD 4BNYA 1N6PA 3MNVB 2ES4A 3LT0A 3FTPA 1OSPL 3SKVA 2YMPA 4A2DA 5A4IS 2QTCA 1YWGO 3EJYD 1MPAH 4X3PA 4WX2B 3PHGA 2R69L 1NGYB 1OBVA 2BC4B 5LQDA 2AXGB 5CIPA 3AL8A 1ZS8A 1P0FA 4P93A 1UBHS 2HMID 4HP8A 5I0XA 2NUTB 3Q5EA 3FMGL 4CDMA 3DDSA 3FTEA 4Q4DA 1FP6A 2H32A 4MR7A 4YAUA 1J11A 4W4OA 2WWWA 4DESA 1OWWA 5KVFE 4L3AA 2Q0QA 2IGLA 1G5FA 4UQ2B 4K2UH 5JMOA 1LA2A 2DS4A 1JPFB 1E9EA 3MLAA 1UUNA 2IHTA 2ICWI 1ZNWA 1ETJA 1KY3A 1NUPA 1MFAH 4CN9A 2N59A 4UT6H 2WGXA 4AY5A 3C4VA 4YSSA 3NNDA 4YRCA 5GZ1A 3A3YA 1B0ZA 1OAAA 4XVHA 3CNBA 2PUCA 3G7TA 1XPJA 3OOEA 5CFAA 12E8H 1ZHKA 1QSVA 3ZGVA 1AP2B 1N0UA 3A3PA 3U0WH 1ORSB 3K1JA 4NBYB 3HXQA 2UU9B 1JAIA 1RAIA 4ZJPA 2HDHA 5JHDD 4MA4A 3GMRA 1MRDH 3DD1A 2Q76B 3OJDB 2XWZA 3RZCC 1S3SA 1BVRA 4R2IA 5AKSA 3OHXC 2PGAA 3E0GA 3DUHA 3WKML 2ODBA 2VTDA 2ZUVA 3GXTA 3RAEC 1ZVVA 3IVKB 3RAGA 2XA1A 2CWDA 1PJ4A 1LE5B 4BUQA 2OR7A 2ICWB 3C43A 3HAEG 3ZT6A 1WX1A 1DZIA 1ZSVA 1TTRA 2YQBA 2O23A 2A1TR 3B1WA 3T1YB 2R2AA 3LD9A 1J7JA 3ZY7A 4XJSA 5F9MA 2L7EA 1VSCA 3DV6A 3KCPA 3NZSA 4BO7A 3ZGIA 1MSPA 3W2DL 3ASVA 3STZB 2NZJA 2W83A 3JWNH 1JMKC 2PZ8A 4QF1A 1KJZA 5JDIA 3N2LA 4HJJH 4WN9B 1MIOA 3DC0A 5TMPA 2NSMA 4RK1A 1FVOA 3NUZA 3OCZA 2X8JA 2EVJA 1GPKA 5FM5O 3DUUA 3ZIYA 3TBKA 5JSZB 1HX0A 3BJLA 1GQSA 1X7WA 2XXCB 2NZ1A 1G43A 5HHXH 5CLLA 3P1JA 1MTZA 3TXXA 4BP1A 3CTTA 1QO9A 3NSXA 4BGDA 2CDGB 5EVCA 3DL4A 4I1VA 4P22A 2UUDH 1GPWB 2WAQA 3BSHA 4FCCA 2PW2A 3WIVA 1Z08A 5FECA 1EK3A 4R4FL 2PX4A 3U16A 1WHTB 1JQKA 1WV0A 2OGWA 1BVKA 3A70A 3O2NA 5CEFA 5CXSA 3OWEA 1YJ5A 3W6NA 2BLNA 4CGTA 4HDOB 2GD6A 1Z6QA 3OJXA 1DBKL 2NSDA 4I14A 2IP1A 2J6CA 1FYFA 2X41A 1E0KA 1KULA 5AJTA 1RMFH 3VXME 1XAJA 1KIUA 5IFJB 2G88A 4U1RA 1ZESA 5I16B 1REQB 2IOOA 5LNK6 2HRGA 1KEEB 1P75A 4FMDB 1LEIB 5BXFB 3ORRA 2Z9DA 2GETA 4QLAA 4S0XA 4V0NA 1CDBA 4Y2VA 3H17A 3P0FA 5DLLA 3LDAA 3WIOA 3F6YA 2QHLA 3D2BA 5DEOA 3SZKC 3O0DA 3D0RA 1A9QA 5A9RA 1N0LA 4I0WB 3BMNA 1BD4A 4O08A 5H68A 3AHDA 2G82A 3EH2A 4J3OD 4QRIA 3QEUA 2YXFA 5EZSA 3SIKA 4WN3A 3O45B 4YZFF 3EC7A 3U44B 1IVSA 4PUBL 4Y16C 9PCYA 5C3TA 4G8EA 3ALPA 2WB7A 1K72A 3WLBB 4KQXA 1QIDA 3WOHA 1GKLA 1MJ5A 3GQVA 2W07B 4WI8A 3FQRB 4PYNA 2R8RA 4IV8A 3FSAA 4FKZA 3KPQB 1SVIA 3H2SA 3UFXB 4OZHA 1RWOA 4QRAA 4G5SA 2HRCA 4NE2A 3LPGA 3EWAA 3ZHLA 3DGGB 3HLTA 5EMJA 1VZGA 3SE9L 5ILTL 1MVUA 1JT2A 4YCNA 3QA3E 1K8QA 5EIBC 1CFTB 1Y9DA 1RCUA 3IFLH 1EEYA 3AVYA 2V0NA 4JHZA 3MNDA 1PZFA 4O58L 5CM2Z 2CA3A 2P91A 5BOSB 5ADUS 1D2CA 5LBTA 4YVFA 4QXQA 4H5SB 3NHAA 1AVAA 5FEBA 3WL9A 2G9NA 4QTHB 3H8JA 1HOEA 4MP3A 3PWLB 3R06B 3PV0A 4YUXA 3W78A 3JTMA 1EAQA 4ZYKB 2P62A 1OGPA 5D5MA 3R7BA 1RJYB 4BBPA 2RCSH 2VRWA 1OWMA 1H8OA 4P0QB 2VJYA 5FYLE 2XR1A 3B6IA 3X0DA 1GG5A 2WKQA 4RDHA 2I5YL 1F0LA 1OUMA 1WBZA 4YDKL 2OD9A 2EO7A 4LF3A 1C16B 4C76A 3F2IA 4B8WA 2VDNH 2ZX8A 1R4NA 1V39A 3WHE1 1CY1A 3A27A 3U62A 1JGUH 2VXTL 1FFNB 4YHLL 4HIXH 3FW6A 3ETJA 1GN8A 4MR8B 5AYUH 4WHYH 3CVBA 2AV7A 4QHUA 2QTAA 7AT1A 3CVXA 5SV3A 3U13A 2BZ1A 2VMFA 2XPZA 5K3AA 1YVDA 4MR9B 1OAKL 1R3KB 5IABA 1ECYA 2Q3HA 2ZYSA 2H63A 3SX2A 2OAEA 1N4AA 4Q9QL 3FZEA 2ADFA 4JY6A 5JS6A 3K6JA 4Y1GA 1M2JA 3MMXA 1HH6B 1GYQA 2HJWA 3X13A 1L7AA 4L72A 1HFJA 1HYGA 1I4OA 1A5BB 4W8OA 4CRWB 2C0QA 1VA4A 2HWZL 5HKLA 4QOGA 5H7XA 4IDLA 2C2WA 4CIYA 1L9PA 3GZPA 1L8XA 5MDHA 1G6RB 4GGPA 5M04A 3L8HA 4NECA 1AC6A 4QYAA 2OO3A 5HBRA 3HNTH 4HU8A 2QTGA 5CVTA 5JPDA 3WO0A 3FDWA 4O3UB 5CZVL 4QLWA 3G8DA 3FQWA 2AJTA 4CM3A 5KMGA 2A6KA 3DSFL 3HY4A 2I65A 2F8IA 1C3JA 4HA1A 3M1BB 4UEJA 2V7WA 4U2KA 3BRGC 4E13A 1DVFA 1DFIA 2FD6H 3Q6FB 4XN4A 3ZWXA 3SPXA 2GZ3A 4Z76A 1BGXT 2HEIA 3VSBA 1BLIA 4B7LA 5H5JA 3GDGA 5EZOH 3DDGA 1BCSA 4S1VA 1RIVL 1WUHS 3BAEH 1RH8A 4N40A 4ND7A 4AWBA 1MI5D 1M6HA 4A2LA 1IAIM 5E8PA 3EH3B 3NMEA 4ZAKA 2CGYA 5EEXA 3F12B 1DHKA 4I1PA 4LBYA 1E9FA 1QB8A 2O06A 4RXMA 3LIZH 4NQDE 1CR6A 4QOJA 4PYJA 5I7UA 4AYGA 1T04A 4DERA 2WLLB 2AVGA 2YJGA 3UT6A 4E5DA 4MVJI 3RO7A 1B93A 5EEZA 4KUCD 2BSSB 3VXOA 2NXNA 2RAPA 3A4TA 4CNIB 1GFSA 4Y2DD 2VTVA 4K07A 3NBZC 5D7NA 1EK6A 3P19A 1XSOA 1U3VA 3P2IA 3MSCA 4U7DA 4L4XA 3LXCA 1XZ0B 2MPAL 3UZEA 3QIUB 4Q3LA 2CNZA 1MHTA 1WFJA 2CE6A 6Q21A 4PJGF 4RSMA 2YRBA 1LC3A 3WN5A 2G9KA 1R74A 4C2BA 4QGSA 4D74A 4ZVKA 1VMEA 1CUGA 5EBLA 2OE2A 4ZVRA 4JR2A 3BWEA 3KHTA 2VLRA 1EQUA 2R4SH 4Q03A 2FX3A 3PXHA 4XI9A 4FKHA 4PTUB 1PD1A 2ZQZA 3HDYA 3ZE2F 2F55A 3NIFF 3N2EA 1RQ7A 1ZO8A 4RMUA 4UQPA 3M5CA 2E9BA 3OO1A 4LSDA 1DX9A 4H20H 4JOSA 3HHRB 4Q89A 4P2QE 2LIVA 3GL9A 2IDQA 4GUOA 3LP8A 3Q8EA 1ULZA 2H4WA 4TN5A 3WSVA 4YFLI 3UM9A 1ID2A 2BP0B 3PUCA 4OLBA 4G63A 3G23A 2BM8A 3KZ8A 4M9ZA 3WTBA 1DLHB 4MPRA 5K99A 3IUEA 3WWEA 2XB8A 4YO8A 5LQAA 4B6OA 4YR6B 1K7CA 3ZWVA 3GKZA 3KPRA 4J75A 3MV11 4KC3B 3LLSA 3VG0H 6NULA 5E2IA 3SBPA 5E2TL 3CF2A 3CVWA 4OAWB 5F9JA 1J5EB 1VCOA 2F08A 5E3JA 1FC2D 1L7IH 1SVBA 4J3TA 4EI6A 1BYNA 2GKOA 1L7MA 3HUJE 1UANA 1W0KD 4WKXA 2PQ2A 4I9UA 4TYMA 5AW5A 3WGVA 3MJ7A 2YQGA 3WXWH 4BQQA 2V8LA 2C7QA 3ZTTA 3LT4A 3ZW8A 1VFPA 3PF9A 2SEBB 4Y89A 3V0FA 3QMWA 4K87A 4WW2C 1ESDA 1SYSB 2BGLA 1SOWA 1UPTA 1RUML 3CHYA 1W15A 2F0CA 3TBCA 4URYR 2LR4A 2ZJFA 1IIIA 4KZEH 4WJLA 4EJ2A 3KYMB 2B39A 4GAGH 4GOSA 4ZVTA 2N56A 3NFYA 2Y2YA 1KPVB 4Y0NA 3JD3A 4KXQA 3A4AA 2WAHA 3PKZA 4IOIA 3WB0A 5FKAA 3KBPA 4KOEC 4E5NA 1BXVA 2A9VA 4EOWH 2ATCA 1YEGH 2Y67A 4HY3A 3NPSC 4YJ3F 4HFRA 4URZR 2FR8C 3VG0L 2FZGA 4EJSA 3GIVB 4RHYA 2AXPA 2R69H 3FS9A 5TQ0A 2ZI6A 4N5NA 3DEHA 2EKDA 3ZHSA 1EJOL 2ZG3A 5LPNA 3BN3B 2P8PB 4D0BA 4MMXC 1XR8B 2V3WA 4UDNA 5IB3B 1RR6A 3H9BA 4LAJH 3EYQC 3PUWA 4MB6A 1L4FA 2Z31A 3ARFC 2OBNA 4CVUA 4DIMA 3KGSA 3OG9A 2XG5A 2ZUFA 4K2HA 4JDEA 1NMCB 2AEWA 1G4MA 3H11A 4B7AA 4C4AA 2MSCB 2QTBA 4U7HA 3Q8FA 3HKCA 1WGOA 5E7QA 1DVYA 2F4VB 1F58H 3LGSA 4MHSA 2X4NA 2DKFA 3F71A 1S8OA 4H1LB 3RUGF 2VKTA 3ARFB 2G4EA 4PHTA 3IJ5A 1KLUA 2Y6SC 4K7PL 5EPEA 2FA9A 4C8XA 2XTJE 3HFFA 2J9XB 3I2CL 4HJTA 2UZYA 3RC1A 1UMKA 3QVWA 3QHTC 1UMDB 4QWWD 1QU3A 5CD9A 5BV7C 3WKDA 2ZPKH 2XJ4A 3RPIA 3C87A 1QDLB 1M6EX 4BSWA 3JYLA 4FZEH 3UJCA 4EN3D 4XWAA 5DUBB 1KAGA 2OMZB 2NZ2A 2TMYA 4FMCB 2G5CA 3ZY3A 4L8SB 2DFPA 1GZ4A 3JYCA 2EIEA 5KBLA 3QNXA 2VDRB 1SXJE 2Y0PA 4CV3A 3H8NA 2XA2A 1RXLA 2ZIAA 3LG2A 4URKA 5ALIA 5J1SB 5K20A 1XV5A 1UVQA 4DEPC 1IBKB 2HGSA 4NZYA 1A7NL 2B7BA 1JUFB 3RX9A 4OLZH 5HYJE 4ZZFA 2HAZA 1A3ZA 5K0EA 2GXSA 1PNVA 4P81A 5DBEX 1SIWA 3E3QE 1RAMA 4NV3A 1NC4B 2NSXA 4XMPH 1GNSA 3BE1L 3BVPA 1Q2XA 3KKLA 1UJBA 3EJSA 3I9PA 4EJ0A 3SDBA 3UJ3X 4RTOA 2BEUB 5JI3E 1ZRSA 1W72H 4DCJA 3D25B 4OQZA 4WO4A 2R6DA 3GPLA 2NY4C 2J25A 3FONA 4DW2L 5IF3A 1MHEB 1QCYA 3CH4B 2AF4C 4HG2A 4DIDA 2X1OA 1LBIA 1ACMA 3T0IA 2YW2A 3ESAA 3CXDL 1HDEA 4ZPVA 1H2YA 2ED9A 2PKRA 5GJSH 3FCUB 4NO3B 4GEKA 3V6OE 4OQ4A 3DMTA 5C70A 4CMHA 2R44A 4NQED 1J9GA 1CUVA 5BR1A 4RBNA 3HNTL 5LU9A 3WYDA 2BFFB 2WUFA 3JQEA 5DC4B 1Q90A 1AMYA 1UK9A 4UEOA 3I6GA 3IBEA 4YRSA 5EIWA 4OCMC 5IJ9A 1NXPA 1NFDA 3WTWA 3RYTC 5LAXA 5JHMA 1TCMA 3RF6A 4WW0A 3F7OA 3OZTA 5E8DL 3W1EA 3QI9B 1N9KA 2HO5A 4NBWA 2JCVA 1RMFL 3B9KB 3UC2A 3JQRA 2I71A 4D43A 1TJNA 4P7FA 1H0DB 3RJZA 3VRIA 5KYWB 4IOIB 5BV7L 5ICSA 1SA0A 1VLVA 4D4MA 1AFVL 1RZJC 1TTUA 4L0YA 5CEZD 2X5JO 5A3SA 4WU7A 2YXEA 4MCHA 2E6KA 1TT6A 2J5RA 1DUSA 2HF7A 4XXHA 1N12A 3EVEA 2O1EA 2JGEA 2G0NA 3DJFA 3E5RA 5TE9A 1DAIA 3X1GA 3A6OA 2Q9AA 4AZTA 2QOEA 3FVQA 2DQZA 5LZ2A 5CJ5A 3DQQA 1VIVA 2FDCA 1GY8A 2GBCA 1ZOIA 3TOSA 2FUG6 2VWQA 3OM0A 2EZ4A 1I31A 3CUUA 2D2FA 1TJ3A 3MRJB 2WKLA 1OX5A 4WLOA 4DIKA 5KHLB 3CIOA 1E9AA 3N8HA 2WHVA 2YA1A 4P2OA 4Y4KB 5TK4A 3S7ZA 1M2GA 2BSAA 3O1LA 3O38A 1NNLA 4G56A 2H6EA 4PJ8B 1WZEA 2OV3A 1KBWA 2XE7A 1V8ZA 1UJTA 3SYPA 2IW1A 4PVCA 3UCXA 4QDZA 1D5IH 5AW8A 4M7LH 3FZUD 2QMKA 2I60H 1XGZA 3PZRA 4TYYA 1V7PC 4UFNA 4LCCB 4DQOH 2AD1A 4BNTA 2QRMA 3RS7A 4XVSH 2ZI3A 3IV7A 2JLWA 4IRJC 2BNRA 3W4JA 3D7MA 4P9HC 1WTCA 3EXEA 3HYRA 5CT6A 4AG4L 1WAAE 2D0PB 2ZAHA 1PFWA 1DJHA 1CJCA 2IEDA 3H5OA 1AHWC 2ZIVB 1J1PL 3GB7A 4ANXA 5LLSA 3DAOA 1QWHA 3LQZB 1NPUA 3TPUB 3N75A 4EAAA 3M8KA 4G86A 2ZI7A 1XVIA 4FLOA 4ENED 3DNFA 5D7SH 5ENDA 3PGMA 3WDSA 3WXVH 2R11A 4G8IA 3IEMA 121PA 4U2DA 1RIIA 1FJXA 2GUYA 1CDUA 4GMHA 3SC3A 3ANMA 4JFQA 2H1HA 2R8EA 4GBED 1OX4A 1CE6A 3FO9B 1BW9A 2X2YA 5I7FA 1Q94A 3VGFA 1XDDA 3LQFA 4FJ6A 2WBJA 5AVUA 3IBYA 3QVGB 3AF6A 1HYSC 4D9EA 4C1NA 4E1AA 4BFIB 2HL6A 5DRXA 3ST7A 2XPGA 4PAGA 5BSEA 1TR7A 1IULA 4FBLA 2X0EA 4QQKA 4NG4A 3EIXA 2WLZA 5EKTA 4JDUA 3RSZA 3SG0A 3H5IA 3NUKA 1VZIA 4Z54A 2X89A 3LKSB 4QRSA 4Z5RB 3CDGA 4ALJA 1PL8A 2Y8EA 4MUFA 2DQSA 2H0QA 3ZE0E 3HEAA 2O72A 1NC4D 5GIPE 4DANA 3DLBA 4OAPA 1HE8B 3UNXA 4DKAA 5TMDA 1Q16A 1AURA 2XUFA 4WIQA 4X95A 1ZINA 4GKJB 4CU8A 2JSFA 4LCUA 4ZQKA 4X6BB 1FMJA 1YSOA 4XRRA 3WJJA 2AXQA 3O3MB 4Q6BA 5ESRA 4WWID 3WLWD 4JYMA 3IOMA 1FBNA 4H1VA 5D7JA 3ZSSA 4G0QA 2VH5L 3EDOA 4BMYA 5HHME 2RQ8A 2YIDA 5L2JB 4KUHA 4ZD3H 4C5CA 2YMMA 3GPBA 5B7QA 5C0AB 1JG4A 4MQUA 1A66A 3WS7A 1VBNA 1LDMA 2NXZB 1I5OA 4IMLA 1EA5A 3QVAA 4UAOC 4ZTBA 1IAOB 4GMKA 5K8IA 1IM9B 2VJKA 5U9CA 2HYMA 2XCRB 2PT9A 3VZCA 3S5YA 3PXXA 2WJPA 1HKLL 1HG0A 3CKMA 3LECA 3MBWB 5IJCC 3ZWKA 1HDMB 2FFJA 3FN9A 1WBYA 5BWMA 4BVLA 4DOHB 1KCWA 4X8GA 5LWHA 1PBNA 3MODL 1QFHA 4RQAA 3JQ9C 3VSAA 2DQCH 4HV4A 3APDA 2W2KB 2WLIB 3ARGC 1RTKA 3LFUA 2O0MA 2EDDA 4LIQL 4N3CA 2ZZKA 1FUEA 3K5RA 1DEKA 3EFOB 4AQEB 5AZ2H 2PSJA 1F11A 3QF7A 1NKVA 3TZVA 4OV6F 3DX9B 2RARA 4L3EA 3TKAA 3B5JA 4IS3A 1RZIA 1Y18B 4XX1A 4OHYA 1J5OL 1I7TA 4BU0A 3DSNB 3TIGA 3KHOA 3SDDB 1PJ3A 5JNSA 1QBML 4MS6A 5CT4A 2JEZA 4MQMA 3GCGA 2TS1A 1TVBA 4FDLA 3VYVA 2HU8A 5I7HA 1KK0A 4KHPB 3BJRA 3VB9A 4FFZH 1UT6A 4ALLA 3WO4C 1L1EA 4GP7A 1XF5B 1DV2A 1SBHA 4TLCA 3SHQA 3L5XH 5ANHA 5HVGB 3D34A 1UODA 5B3AA 3RV3A 1IG3A 2D0OB 1ZNXA 1NCCL 3IJ8A 1TQBB 5K0SA 4ODXB 3F90A 4LI3X 4A37A 3AKYA 3KQKA 1RBZA 5EMKA 3D0QA 1F4HA 1OH7A 2QM0A 3TZCA 5F7DA 3GXUB 2NPOA 5BPHA 1CS4C 5EJ6A 1M71B 2EE3A 2GGSA 4IHAA 2CMRL 3KYOB 4ADSG 5CGYC 5E7JA 2GCNA 3DOEA 1IVLA 4RIHA 1Q22A 4FSXA 5BSRA 4IZIA 2BUCA 4O4IA 1PG5A 5AHKA 1QTYT 2CO1A 1C1HA 4YMWA 2X3BA 4W6QA 2VATA 1ZAYA 3TBTB 5T5NF 2GN1A 5C4IA 2Q5CA 2AJVH 2PWDA 1M34B 1T6YA 1BA9A 2I3AA 4PZEA 3VHQA 5EUKA 4D9RD 2ZYWX 4Q3EA 2CKMA 3RYMA 2VBGA 4OCSH 1QU2A 1DCLA 3WYGA 3GTTA 1QHYA 4Z7OE 1T4CB 1TLLA 4XWTA 4RKFA 5E4OA 4MNGE 3S5LG 1J87A 1NA5A 1NGQH 1U9CA 5DZVA 1AQIA 3DRTB 2OK0H 3NS7A 2VBIA 5L9DL 1R66A 2DKMA 4NBNA 4FOSA 1E4YA 1PQYA 2V2WA 1M8KA 1CPUA 1G4RA 4Q1AA 3S7GA 3OV6A 4IQ0A 3G6JA 4BFCA 3RVXC 5HKKA 3K8KA 4HDAA 3N0TA 1ZA6A 1MCNA 1OH6A 4M8KA 5GISL 4PD4K 1RI2A 5CFNA 1MB0A 5T3ZL 2A7XA 1XYVA 3WGYA 3C8KA 1IQWH 5HYSA 3CVHH 4PJIB 1AS0A 1FZKB 1DRVA 3MFFB 1FFYA 2FP3A 2QJDA 5IP5A 4PJDA 4MXDA 4KV7A 3D85B 2RHLA 4HDCA 3ZY5A 4MAMA 3MILA 4RKYA 2Y77A 4OBBA 1I3RB 2HG0A 3HB9A 2G76A 3OR6A 1T4MA 3EYFB 5GGSY 1T5DX 2UZ4A 3GBMH 4EI7A 1W46A 4CLEA 2WIDA 3RWHA 1BG1A 3B1ZA 3PEFA 1EZUA 4U9UA 3HHMA 5C97A 4Y6PA 4S1DC 5E0KB 2VN6A 1J9TA 1Z5GA 4Q00A 2XDAA 1QZTA 3DYPA 1KE1A 2ENWA 3T0AA 1UT2A 1UCTA 3OTHA 1AKMA 4BGLA 4EP1A 2YFNA 4XB7A 1S7QB 3QG7H 3TVYA 3WEOA 1Y7TA 3B2UC 1L9SA 1JYWA 1ZLEA 1LDSA 3DNPA 3MB8A 4FEIA 3SFZA 3JVEA 1KC1A 1KR2A 3RVBA 3V46A 5TX7A 3HG1B 1DB3A 3BRSA 2C9CA 3KLSA 4NJMB 3U80A 1OP4A 3Q5DA 3F83A 2DFNA 4FQPA 5C0AD 4A6YB 4AXWB 3FUUA 3JQPA 5JIBA 3M4YA 4N8DA 1N2CE 4FTVE 1YR9A 3D54D 4IJ6A 1CERA 4MNQA 1BHSA 2G09A 3O74A 2P5EA 3WLRA 4W9HC 4P5KB 4U1JA 3STZA 1E92A 1MI5A 2QSVA 4PCLA 3C5CA 1WC7B 3NZHL 4PTTB 3IQZA 6REQB 2YUIA 5JZSA 5TK2A 3MV01 2QTLA 4ENUA 2BP3A 5IK3B 2PTTA 1Y9ZA 1TU0A 3S98A 1KZGB 1UBKS 1ORDA 1NXTA 1V54B 1IBBA 4JFUA 2FEPA 3RVTD 4TRMA 3SY8A 4DKTA 4GEIA 3QUTA 4JJ8A 3NGLA 5JQ6L 3WS3B 1CDGA 1FHGA 1HE8A 3CS3A 2H1LM 5ITBL 1E6JL 1JSRA 3KFLA 4TX1A 1SQ2N 3LL7A 4XVJL 1F9AA 3MLRH 5A9SA 3B3IB 1TLFA 2R4TA 2DBJA 5LDHA 4P38A 3DV0A 1RU9L 4IRXA 2FPPA 3BTVA 1A7NH 4F8QA 3P0YH 3RLIA 1F6AB 2XWDA 4N5EC 4KUZL 3HUUA 5E03A 4X63A 5JR3A 1DBKH 3H7BB 5FOWA 2IDUA 1EDOA 4YJKA 4CG3A 5C0CA 4Q74A 2EYRB 4ILEA 4XQ0A 2W9DL 3DHVA 1P44A 3SZGA 1FVCB 1LNSA 2B5OA 1MVLA 2VJ8A 4JHLA 5HE8A 5K6RA 1QOKA 1FLRL 4O02A 3NUQA 3DHMA 5BPPA 4KO8A 2QRNA 4M0KA 4Y1EA 4JGMA 3WSTA 3ARBD 4RIIA 5I9MA 3CBRA 1SU8A 1PQUA 4KQCA 4RXTA 3LHKA 4RY9A 3LCRA 5I4KA 1NMAL 2QT1A 3P2JA 3D4GA 3N1UA 5K4AA 3RGWS 3S35L 5LGJA 3ZV6A 3A9VA 1M7IB 2W5PA 1N8OE 2W6ID 4PQFA 3MGCA 1IM2A 4DDKA 3HZZA 4PLCA 4WXRA 2MKWA 3OE1A 1HI9A 1JPJA 1Z9NA 1IFHH 2R7EB 2FFBA 1DQIA 3TM6A 4FYWA 2IDFA 5D7JD 4ZVUA 5MF6A 3W9BA 3V52H 2VC2H 4E9RA 1KJ2H 5HY9B 5K8UA 2W6JD 4LEOA 4F9PC 1YQVH 4IOFC 1GFWA 4IFBA 5B39B 2C9ZA 2Q8AL 4C4UA 5DF1A 1USZA 1AQ8A 3QAQA 3CH1A 1NR5A 5JCPA 4CT4B 3GHEL 4XYBA 2BFGA 3OVUB 2R9HD 3MO1B 1UKTA 3JAWB 4NG5A 2HVJB 1Y6JA 2QRVA 4H8QA 2OHFA 3HVKA 1FF9A 1XZEA 2VA8A 2FQDA 1NC2A 3D1LA 1U3HB 2DKUA 4PP2B 4L48A 4P48A 3V5HB 3KGTA 4W8HA 3RDTD 5AHOA 3V1YA 2PYEA 1GRNA 5J8OA 2DQCL 3R3ZA 4D8XA 1T5OA 4S1RL 1HE3A 1KPUA 3D33A 1B43A 4CNBA 4FXGA 4FA7B 5KSAA 2ZBDA 5LN8A 1ULHA 4ICIA 3AM3A 4R3SA 2UZXB 3TEYA 3GCDA 1ENZA 3PQEA 4TPRH 4XLLA 3EPHA 4V1DD 3IDYB 3LZPA 1Y3DE 5I8ZA 4HXAH 4ZDHA 3L6EA 1XT6A 4Y4KD 2EDCA 4TMFA 1SOQA 3ZC3A 1NIFA 5LYYA 3ZW9A 2VPIA 5DLDA 4GBXC 3QF4B 2HRZA 3BIOA 2ZJAA 3G2LA 1ZHBB 1SK8A 3CLTC 4OIFA 1T2QL 5A3VA 4QTYA 2OK8A 4GP5B 1I7SB 2IYQA 4PWJA 3G2PA 1BAWA 3ZHZA 5J1TC 1OGTA 1TNMA 1SZPA 1MO3A 2J3QA 1NGZB 1QC5A 1DTWB 2EH8H 2A74A 3K72A 1VQ1A 3QJHA 3SE7A 3BG5A 1UDWA 2C9YA 3I9KA 4XFKA 3REGA 5EIXA 3GM0A 4U1IB 2V6GA 3IOCA 5CMLA 2C5FA 5C0CB 1TB4A 1O9VA 4Y9GA 4MYRA 2AC4A 3ET5A 5I9TA 4OM1L 4LQLA 2GS9A 2Z7WA 3W6PA 2ZWYA 5IBUB 5CJPA 4ZMTA 2J0SA 3NCJH 5B7EA 1U7HA 2ZRAA 1KJ9A 4AKSA 1CFSB 1ADCA 1X1BA 2NUAB 1L7TH 3PTZA 2Z95A 2QELA 2JAPA 3JALA 3LRHA 5HUHA 2BF4A 3C5WP 2OFXA 2XYBA 1NUQA 1D3CA 4BVGA 4DLNA 3D1MC 3K9FC 3I01M 1PZ5A 5DD6A 1Y48E 2AANA 2NN3C 5GS1A 3GLIB 3B9AA 5MI0B 3O2JA 3SO3C 1S7TA 2ED8A 2H54A 1HI6B 3N2KB 1FFEA 5IT4A 5ALYA 3S5UA 3UBMA 4NRZB 2JFHA 3USCS 1JGIA 1K8YB 4M86A 2A9PA 3GUTA 4CF7A 1MDBA 5JHDB 2AJUL 1F45A 4E2XA 2EJTA 2XRZA 4NKQB 3H2KA 1Z66A 3GBML 1NTRA 4AG5A 3NRJA 4MV7A 2GWRA 4QGTA 4RK0A 5BZDA 4BUZA 2WAAA 2QEQA 2IXFA 4E5SA 4UT6A 4Z3OA 1XP8A 1BV8A 4ACTA 4HEQA 3MT8A 4GG6A 2B9EA 4NY1A 5BSVA 3C5VA 1T20A 5MEPA 2YR3A 3AM1A 1U5CA 4C2AA 4BSJA 2QHRL 3E2HB 2QN3A 1M8PA 4H0HB 5DIZA 3JYNA 5FTLA 1P0PA 5J6SA 4UUOA 1NVUQ 3IO5A 2CLKB 3PY9A 4GKBA 5CLWA 4KRPD 5K3BA 4C7OA 3V6OC 3HQ4O 4TS6A 4KR6A 4K40A 3AWFA 4KE9A 4GO6B 3KBEA 1J09A 1CICA 4WBNB 1E6CA 2WLLA 3TAHA 2WQXA 2J4FA 3TBVB 3VWJA 3IT2A 4MTMA 1AXIB 5K8VA 1EE2A 4BVHA 3K1AA 1ZK0A 3LS5L 3VKWA 2Q8QA 1U11A 3GMQA 2VOTA 4G72B 4N20A 4C88A 5HHMD 3BD3A 1E6LA 2AUTA 1TJGH 1FO0A 1XQXA 5T57A 1R5BA 3P9LA 2HQSA 4OMDA 4GW1B 1P4LA 3TIVA 3W2IA 4YB8A 3TLZA 4IVRA 4HDMB 5I1CL 1RYMA 3L7MA 2HXSA 5B2EA 1HKUA 3HU2A 2CL6X 4PYQA 1ZLYA 4DC1A 4N0UA 3LE8A 3ULUE 2BM1A 4YROA 3BAKA 3TCKA 2ORVA 4OHMA 3APCA 1IC4L 5FT9A 2BONA 1G8JA 2AE1A 5ERYA 3TLCA 5BYBA 1DMSA 1ENOA 4A6YH 5JCOC 1MFBH 2JIZA 2GD2A 4TL4A 5C07B 3PWVA 1O5IA 4YS6A 5G0WA 3P11H 4FYQA 1L5KA 3PZBA 3FE2A 3TNNA 3WFCH 2ZSKA 3K1KC 2XE6A 1XB3A 2GN9A 3LWBA 5T1LD 2VZ3A 5BCAA 1OWRM 4G65A 3H2IA 3FGZA 4QOSA 4MS3A 3B89A 4LEOB 3BQUB 2UYLB 4L8VA 2GSIB 1VL6A 3LZLA 4D8PA 3CX4A 4E41A 2ENYA 4KQIA 4D25A 2PVCA 1DP4A 1TMKA 2YV1A 4KKBC 1RZPA 2XOKD 4D4LA 4LZJA 3GRFA 3U46A 3LS5H 4X93A 2W6IA 3EDCA 3M17B 4IIXA 4CKWB 4ENWA 2J8UF 4BP8A 4RMJA 2GZSA 5F9JB 3BTUA 1YC2A 3KL2A 4NS1A 1KEEA 2VI5A 1H5BA 4UPEA 1MCDA 4AQEA 2ZP9A 1FDVA 2BEWB 3L4ZA 3VZDA 4Q3BA 1A7RH 2G80A 4JK0D 1E18A 3FQTB 1JMYA 2A6JB 3U5ZB 3APFA 1RZRA 4BNWA 4NRYA 2HPTA 5AMXA 3VO0A 5DMYA 5THKA 2R6ZA 4RGVA 5CLQA 1OBHA 1HDMA 4XHJD 2GN0A 2ZDHA 1E9BA 4A8TA 2B5IB 4OHBA 1Z6TA 4IU2A 4K73A 1KGIA 3GNMH 4N0MA 1T5WB 3L1IA 3RVMA 2NZVG 4IRSA 2EX4A 4WESB 1A9EB 3KJHA 3ULVE 2YJ6A 4QPDA 3WAKA 4TVBA 4EL5A 1RZ8B 1ZG3A 2EIBA 4B9GA 1H5QA 3GJZA 4X6UA 1QE3A 1D7CA 4BM7A 1Z16A 2P2LA 4UV7L 4DVGA 3V6FB 1CG6A 2BR5A 4KR2A 4EQ3A 2ECQA 4O2CB 4L2IB 4EFDA 5LGYA 3ADPA 1ODJA 1TZHA 4ELMB 1AGBB 2GTIA 2X28A 4UHBA 4U1MB 3BLPX 4KVNL 5I19H 1Z2CA 3U1VA 1MWAH 4LJAA 5JROA 2YZ2A 2M32A 4JLPA 1OOEA 1QVOA 2X7LB 5EORH 3SQOL 5FO2A 2RGYA 4FI3C 2BEKA 2AMUA 3FCGA 4AF8A 2YRWA 3RUGA 1VPOL 4DLPA 2FWJA 5K51A 3GLZA 5I0VA 2X2UA 5KZMB 4D80A 2MHAA 1N34B 1I8UA 3T95A 4J5VA 2AJCA 1OSPH 25C8H 3KEQA 2YICA 3IDOA 4D94A 1NCWL 3TTVA 3CHQA 5FWNA 1G5RA 3FJTA 3AABA 1ZA6B 1BDYA 4XVOA 2BKUA 2VJQA 4FOTA 3Q7EA 1B1AA 2O5NA 4HF5H 3CRQA 4INJA 3P9LB 3QDMB 3O1HB 3I9FA 4HAKA 1L3IA 3I9GL 4OIMA 2QLLA 1UWYA 4QFDA 3ZJ4A 4RY2A 3ROFA 2VSYA 3RVLA 5LSAA 3TDKA 4YMPA 1VHJA 2BLFA 4Z3GA 3VNZA 2PCPB 5E1MA 1ODFA 4RRPG 1NRJB 3VC2A 1LILA 3AGPA 3CUPA 5E5UB 5T4EA 2VR1A 1MEJA 2I33A 4ATNA 4ZVSA 1G8SA 4K81B 1R4XA 3CH7A 4NXKA 3FQ4A 1YZYA 5HI4D 3M1YA 2ENSA 3PIRA 4C54A 4QUDA 3H9QA 2NV2B 2IWEA 1GMEA 1ADQA 1SBIA 4G8AC 1I6WA 4X80H 3V7UA 5CJXA 4PV7A 4E9TA 3BL5A 4MGKR 2A1UB 1OM3H 2DZDA 1NUTA 5ILOA 5BJTA 1FRQA 2XETA 2GEEA 3EW3B 4QQNA 1BREA 4YWHA 2AR0A 2JD0A 1WP9A 3G17A 1FZKA 4JZJB 3IJYB 4MRVA 4DO5A 2OMEA 1UZAA 2F8VA 2BZSA 4JN6B 1TPZA 3DZBA 4EMSA 4GPIB 1XZLA 5ESQA 3MREA 1YQDA 3MLWL 4I50A 2H2PC 4TGLA 1G17A 2Y0CA 3WELA 1U3ZA 4K28A 3RBAA 1P7VA 3BZUA 4ZMRA 1H8EA 3ULKA 4KKNA 1B6RA 2IHVA 4OVKA 1DVFB 3UTTE 4MVBD 4DKEH 1S8DA 3D4OA 3T35A 1U8YA 1TZBA 3ICVA 1VE5A 5KSUA 3WFDL 4G07A 4U02A 1EAJA 1XZHA 3QY0A 5BWLA 1IE4A 3ZU8A 4KUGA 1BFOA 2YEZA 5LD2B 2QG9A 2AYYA 2Q3BA 3KQHA 2C07A 5JXGA 4OM0H 3BZWA 3K92A 3UXFA 2IODA 1N4XL 4QNNA 3MR9A 3LUGA 1DXHA 1ZD8A 1NJ9A 2HT1A 1XGTA 3HSKA 5KQLA 1ZVSB 1B8NA 1N5MA 2EZ0D 4MKXA 2VHJA 4Q7EA 4MVJD 1L5QA 4FNQA 3CSUA 5IAOA 1B6GA 2WFAA 5LC1A 2X1PA 3EHBB 3H2BA 3PRZA 3MRDA 3WNDA 3OTTA 4OZIB 3RHZA 1N5OX 5B7MA 3FU6A 4JJZA 1KYDA 2BBWA 1OSZB 5L7WA 3IOEA 2GYYA 3NJGA 2QJOA 3H2ZA 1I4FB 4WOJA 3I9V6 3K70C 1FFWA 4PJEB 1P0IA 5L2KD 4WNAA 5SV2A 2UZ1A 3SS8A 4FHCA 2XBLA 3ZTWA 5I2IB 5KYXB 3Q8XB 1DJLA 4N2KA 2BSED 2EQAA 4WUUD 1AGDB 2E4VA 2IQIA 2HUEA 2VPYA 1QG6A 1PYWA 2ZR8A 4XMXA 3U36B 4L0MA 4KQ6A 3SMQA 3H0KA 3KT0A 4L18A 1ZJZA 1IVTA 3L1FA 4Q0XL 3DVNB 4MKZA 3ES6A 3BGVA 4ENSA 3ND8A 2Q3FA 2H32B 4JQIL 4AJ4A 2H1LA 4PP1C 1P7CA 3A5VA 2HTEA 2IOQA 3KSMA 2OXTA 7MHTA 3T5WA 4ABWA 4M9SA 3WIHA 5TTRA 1PR1A 3OZCA 2IEPA 4IBWA 3K9QO 4HG4J 3AM8A 3T0ED 3F46A 1QYRA 1ZAKA 1Q77A 1IY8A 4Y2LA 1DOAA 3F7RA 2EW2A 3GDBA 2DCMA 1F7VA 3EGCA 4EHNA 3W8DA 3IUQA 1RWXA 1NI4B 4CEIA 1P17A 1DAHA 3AFHA 1VOTA 2Y2TA 1QVWA 2Y0SA 4W1PA 5LBSL 4H0CA 3VKUA 1B9ZA 1PZCA 3J07A 4CV1A 2NTNA 1S2GA 4LFHG 1QYGH 1WIOA 3UKDA 4XO9A 2R0LH 4E22A 2PGNA 3O8XD 4AEHL 4P2AA 5KNBH 5I1JL 4LOLA 2XV2A 1ZK5A 6PAZA 3HCCA 1Z9SB 4U6XA 3V95A 4P8QA 2C9DA 1CXHA 1TYDE 3FDJA 2EUWA 1PQWA 3GLUA 4H6WA 5EBGA 1WAEA 4DQXA 2X4SB 2YS4A 4BZYA 3QDME 1K8ZB 2FWSA 3NNNA 2N3JA 3INOA 5A4AA 1OWLA 2WKWA 1D9KB 3O8XA 1AO3A 1GNTA 5C6TH 1FSFA 1X14A 3PFIA 1UGNA 2H00A 1R37A 2OWDA 1BW9B 5GRVK 5IGXH 1Z32X 2GEJA 4QO7A 3DMMA 2X3AA 1KEZA 3GGDA 3UWSA 5ICXB 2Q6IA 3UV7A 4GRWF 2RGCA 2R5NA 4ND3A 3VH2A 4C3OB 1J88A 4WZBB 1KTLA 2YHAA 5JALA 3FKSA 4S2UA 3TSWA 1XTVA 4CJ0A 1U7ZA 1KYOK 3N42B 2DQTL 1WIPA 4DWHA 4TL8A 1FNEB 4L6AA 5IZCA 4PQRA 3DT8A 4XBGB 4XOCA 5LN4A 3X1DA 4CMEC 5IW1B 2MYTA 2JQAA 1YULA 3LC1O 4AUKA 4N3AA 5DRNA 3NONA 1MH9A 4R4JA 5IJ0A 2DBLL 4KHXL 4UBMA 4ELDA 1MIML 5A3ID 3DOSB 3KPSE 1KFKB 3KAKA 1ED3B 4B43A 3QZNA 1MCPH 3N6VA 4OK6A 3L6RA 2CLZB 1VCNA 4C6HA 1C12A 3LN9A 3OZKA 1Z0SA 3IRVA 4E5XA 4L4SA 4K05A 1IGIH 2UUPA 3DYIA 4C4BA 1L5MA 2NY4B 5KAQG 4RTMA 2ONKA 3A1SA 5LXTA 2H2FA 2Y7NA 4Z7VE 4JDZA 5JXAL 4O4JF 3EZFA 4Z7NF 4POAA 1ISRA 1GKKA 4DJDC 3FFTA 3A1NA 3L3HB 1NWHA 4PTZA 4PIVA 2FB4H 1H9BA 2OXRA 2CZGA 1DELA 2DWQA 3T6QC 2ROQA 4K0KB 3D3VB 3E3LA 1AZTA 2X4NB 5F0LB 1NVEA 5IESH 3NSCA 1R0AH 4IOLA 1W6RA 4UNNA 3ZWWA 3IKLA 3TO4A 1FNFA 3FHEA 2MT9A 4EEKA 1ZKMA 3I6SA 5FOBB 1ZM4A 3NIDF 2PS9A 4GVXA 1MIEL 4NNPL 4BFGA 3EH1A 2DP4E 3EWNA 3QPUA 2CKBH 1JZFA 2Q6WA 1HHJB 4FZ8H 1GIGL 2WIJA 4WPGA 1G5TA 2P8PA 2FMHA 3SDZA 4KRGA 2CV1A 3IR5A 4Z7WA 1DCTA 1FYWA 4UARA 3TH5A 2C3MA 1HT1E 2ZSUA 2G3ZA 3SPGA 3WY3A 3IK2A 3BP7B 1N3LA 3IERA 1RPZA 4LMQE 4OFWA 4F8PA 3SOBH 1QNIA 3AV3A 2HT3C 3WJAA 3RVRA 1GYPA 4I4LA 3V0IA 1IUPA 4AM0B 1P7WA 2QZPA 3O9WD 2YMQA 5F3RA 2JTYA 1RCTE 4ZMBA 3HYCA 4ZX4A 4UNQA 2QUKA 2ZIXB 5EHNA 4OQLA 5KVQA 2QNRA 5IJXA 1I9JL 1G84A 5E7FA 1Z9MA 4LSSH 3M49A 3BIKA 1JZTA 1L5LA 4TMXA 5ALEA 4WKGA 2IPTL 4IMKA 4XODA 4N2AA 1RC0A 2C2ZA 2FPRA 5CM1A 5KNDA 4TKWA 2LRHA 3SDCC 3KWWA 1KAEA 4RGNB 1PNOA 3CFDB 4UVIA 4N87A 1RCYA 3KYBA 1WWBX 2CRMA 2XWTA 1G8FA 3BWUC 3M81A 4ODSH 5CFLA 5ALHA 3TPFA 5CDFE 4H8WH 4NUJA 1R64A 4E94A 3L1EA 4DJTA 1ISMA 4PG2A 2Y4OA 3PR1A 1RPUA 4GMSL 5C3UA 3SIRA 3CFYA 4A0GA 1NC4A 3HI4A 1Y8RA 1BZDA 2NSJA 2RJOA 2EQ5A 2J3SA 5I8KH 2WLTA 3I6GB 3FOZA 5D2CA 4Q9RH 1X9UA 1D1PA 5C1OA 1Y33E 4GRIA 5I8EA 1L0YA 3ILHA 3P20A 4LE0A 3QS2A 4F9GA 4LLDB 4OLUL 3GSVB 1LV7A 1XVSA 2UZYB 4RK4A 3RX8A 1DUYB 5CBPB 3VAYA 3BSSA 5FUYA 3ECVA 4KDTA 2JGRA 2A5GA 4OHKA 1SYVB 1A7RL 4IS6A 4ZKEA 1R9MA 2B4CH 3RFVA 5L8VA 1HYSD 3IH5A 3K0AA 1K6QL 3I6MA 2OMZA 4G8DA 4F2MB 1FE8A 2WBJD 2ZJ5A 4E12A 3TO5A 3CLKA 1C81A 3FTNA 5AB9A 2AKEA 5TF1H 1G6OA 1G9XA 4FK8A 1J0EA 4HJUA 5HGAB 1C1EH 3OAWA 1IUOA 3O21A 2BKXA 4FYXA 1BM3L 2O8NA 2XEXA 3TCLA 4G6MH 4ZI3A 2OBBA 5E0OA 4ZUVB 4CIXA 1TEZA 1WVMA 5CLIA 3DBXB 5KN5B 5ACLA 1CFSA 4QOEA 2QYOA 1QGDA 4LDNA 1LDBA 4BO2A 3NH7H 1Z26A 3HG2A 4QSHA 5ALKA 3ABQB 4BFNA 2FN3A 1NCDL 3QORD 5HGBA 1UT5A 1QOPB 1UM8A 4QRUB 3F2VA 3CINA 4WLVA 3RRJA 2C3YA 1OALA 2AH5A 5F1NA 5DUBA 1LZLA 3FB1A 1VGVA 3RZCB 2OCIA 1W2GA 1TUEA 3P9YA 1KBBA 3N1MC 3ARRA 4MXQD 1SCBA 4P7JA 1G8HA 3SF8B 3D8SA 4IK6A 1W88B 2FG6C 3H42B 4D8VA 4CAGA 1V5EA 3K6OA 4UM7A 1QKZH 3X1WA 1BE6A 3AEQB 4YE0A 4Y30A 1NR7A 3ND6A 1LK7A 4ZOEA 4ZI2A 3R7WA 1YNLH 1O2DA 4AQAA 2FMFA 1Z3IX 4CUCA 1OT4A 1Y6KR 1U7DA 4YEDA 5KEIA 4U3HA 3P73A 1R15A 2VDJA 2DJMA 4I0PC 3UYPB 1BG6A 4YDMA 4N4AA 2JC3A 1K4CA 1HBJA 1HTBA 1TECE 2J3LA 1KY2A 4K3UA 3I2HA 3DWEX 2F1JA 2J8ZA 4P83A 2VTKA 4YAFA 4M00A 4FYVA 2YMXH 3VU9A 5LLTA 2P11A 2WC1A 4TTTS 1X1DA 1KEWA 4QJ5A 3CWZA 1S3RA 3ROLB 3LKBA 2YIJA 2FWOA 4OLXH 4U3JB 1AQDB 2AQ2A 5JPNA 1QCDA 1QSFD 4M36A 4PX3A 5T1MB 3O6ML 4RETA 3FQUA 2VE6A 1XTIA 4KNYA 2AZXA 2ZTUA 4JQOA 5FUQA 2F53B 2O5XL 5CA0F 3DOHA 2H0AA 4ENEC 3H4VA 1ZMYA 4QUKA 4M7JL 5IBPA 3N40F 4QECA 1I1AA 1GH7A 4G41A 4BGUA 4NN7B 3UBXG 2BOBB 2E4YA 3LUJA 2Q7YB 2X6RA 2CDAA 3DTVD 4W63A 3TYXA 4DETA 2IZ0A 5IQ7L 4R5XA 1IFHL 4QHMA 3EA4A 1JPGB 5HKOA 2Y5TB 2PCYA 3ISWA 1SJEA 4U9IS 1JSXA 3W5MA 3PI6A 4YRFA 3BZ5A 2BGMA 3JZMA 3CF4A 5AVQB 2E6UX 5DN6D 3RR2A 4D0RA 4BXSV 1UA6H 2YAPA 4FQ5A 4PU2A 4DOMA 3AL0C 3RYFA 4ZMPA 2C94A 2CNKA 2ZVDA 1PP4A 4RZCB 3E61A 3D9AL 3WUWB 3BRQA 4M4RB 4EFNA 1WITA 3FOLB 3KPTA 4JM2D 1JZHA 3HZVA 3X12A 3I1YA 2F59A 2YFKA 3UBFA 4Y3UA 3CVHA 3MYJB 5FV7A 2DBLH 4KHXH 4D5EA 3CVHL 3L7AA 1ZLXA 2DM7A 5CH8A 4KZKA 5FHBL 2ODWA 3UZVB 4G80A 1BRMA 4X7TB 1XZPA 4I6GA 3VD5A 4FGJA 2ZUXA 4L1LA 3MRSA 3AVOA 4DP1X 4U3CA 3U9PH 3BUSA 4HDKB 3VGGA 2HA0A 4L0PB 2YKLH 5EQFA 4Q3CA 4DIUA 4LMPA 5HPYB 3K0SA 2VLMD 1J5XA 1T7ZA 4UMEA 2C97A 5LZ7A 3RIYA 1MJ8L 4QASA 3VJ6A 4QYSA 1F56A 4AY0A 3L93A 4KQ2A 4CL3A 1G7PB 2X0NA 1PS3A 2O3QA 1MJ7H 5D1XD 4RENA 1Z0NA 3ARGA 1V45E 1SFRA 3QXJA 3F7TA 1JIBA 4FNTA 1OD7A 1CD5A 3Q9NA 4PR0A 5LBIA 2ZOUA 4UANA 1AP2A 1PSWA 5K01A 2JJSA 4M7KH 3IDFA 3F8UB 1MW9X 3LHDA 3T4YA 3L5JA 4ZHQB 4KXBA 1NCAL 2GK0B 2X6CA 4L8DA 1JTOA 2R4UA 1FH5L 3WDJA 4MAZA 3OKMA 3C98A 1UM5H 4NDZA 1GZDA 1EKXA 3OVMA 5DHVB 4TL6A 4DV6B 4JKPH 1RS0A 4I50F 1OAQL 4KDFA 3QWQB 1DSWA 4EMUA 5CLYA 2GERA 3T0EC 2ESVD 1LTQA 4G8IB 1IZZA 1H3FA 4KKQA 1LQTA 5KJ4A 4JVSB 2NY2D 4B83A 4EDFA 4YT5A 1JZDC 2AQIA 1O6VA 5I9QB 1T1GA 3WIFB 5CD3B 2XKKA 5ALRA 1P1ZB 3C6LC 4ZV9A 4HLEA 4WV3A 4FE3A 5FK9A 2ESVE 4RISL 4Y19D 4AVIA 4TLKA 2AHRA 3QGMA 4URVR 2VBCA 1RLUA 4UDTA 5E2VH 1LO5B 4HAOA 4HYEA 4E0BA 1T3GA 4QU0A 1QEWB 4KX7A 2LBPA 1MEOA 1TM1E 3OCJA 5BSTA 5CX1B 1I8IA 5JEDA 1HU8A 5I66A 5C9ZA 4OZIA 5CKGA 4KK8D 2JKVA 5EULV 3OZ9H 1GPDG 1MH1A 4OA8A 2Q3ZA 1QZ3A 2IANE 3NIWA 4UD6A 3IV9A 4MB5A 4E42A 4BNVA 1ZVKA 2OLDA 1P9MC 5EO9A 2PUWA 3M07A 4YJGB 3VDNB 2F19L 5KO2A 3ATEA 1XROA 4QLRA 2HT2C 4I18A 2FJUB 2E9WA 1LDEA 4M43H 3T1QA 2KQNA 5I8KL 2LE9A 4MLIA 3UAVA 2DQEL 4ZT3A 5HDRA 2VM4A 3MRNB 1JHYA 4DUWA 4KO4S 1S5IH 4D45A 5NULA 2I26N 2VAWA 4KW7A 4M8NE 4PSUA 1HFEL 4JI8B 3K6RA 1G7HA 4AW7A 3O0TA 1BX0A 3WYEA 3ROXA 4KI7A 2OMTB 1D2MA 4PIPA 2I9TA 5LWYH 4AMGA 2JFCA 1UD2A 4IWNA 1E3LA 4RTRA 3EH4B 2F53D 3DRQA 4HOZA 2Q4EA 4AQ7A 2ZJSL 3ZZMA 2C95A 3WLKX 1XGQA 2GZAA 2FLKA 2PPVA 4FGLA 2P80A 4J07A 1HFUA 1XELA 4D0DB 1UZ6E 1NYTA 3FNGA 3DOCA 4IKOA 2XA9A 5JIQA 1MW2A 3QLVC 5I18L 3BWXA 3JQGA 2I78A 3K1ZA 1WB4A 2XG4A 3MVEA 1DEHA 3IKMB 3RUFA 4NQCB 1OPGL 4FCAA 3FQXA 1KFAL 4XN2A 2CLRA 1FCGA 2PU7A 4R2XA 5I75C 3WTUA 3TQIA 4ZW3A 3VFSA 1J9RA 4V2CB 4I4TF 2DOKA 5CYGA 2R6GA 2LR0A 4OD3H 3BDBA 2RMKA 3WY2A 2UVFA 2VHVA 4D9LL 4J4BA 3T2PA 4QVKA 2W9EL 4GW1A 3BWCA 2H11A 2WMNB 1HHKB 4IGEA 2NCEA 3OJOA 3HAEH 4PJBE 5KYUB 3HZOA 3WEMA 5M5BA 2BT4A 2WWTA 2RTTA 1DQLL 1ILUA 1T2UA 5DS1A 3ZHRA 3LN4A 4HK0B 1TU4A 4J49A 3MGKA 2ERCA 5IQMA 2OV4A 2FCBA 1P5UA 2UKDA 1KACB 4YXHL 4JFOA 3SBWC 1BE0A 1EA9C 3HE6B 1EH9A 4S1NA 2W2KA 2O8EB 1E7RA 4JA0A 1QXSA 1W0VA 2XMQA 2B1AL 2EQDA 3EO9L 4MGIR 5DBGA 2AFHB 3JV0A 4BFFA 2VDMB 1NCUA 2HPZA 4OUUA 4XP6L 1L7RA 5BRJA 3QI9D 3W0WE 2Y1LA 5CD3A 3N2GA 5HGDB 4S0HA 2K7ZA 3KOXA 2HGZA 4OV5A 5AG8A 1H3TA 3LCVB 1I3LA 1E98A 2QI9F 4DTGL 3VX0A 4XJVA 2V7GA 5DHTA 1X1TA 4MXWL 1GKIA 3L4EA 2CB9A 3GNLA 4UTOA 1Z4LA 4RD3A 4NQDB 4MMZC 4WW2B 2WMDA 2NTSP 5EU4A 4ZVQA 1TJ5A 3HNRA 3JQ8B 1E5VA 3N7TA 5FLEX 5T1KB 1UQTA 3PGCA 3T4YB 2OECA 5J7CC 4Q4EA 2VMCA 3AJEA 5DD0H 4OSUH 4FG6D 3ZYCA 1FNSL 5CDFA 5DMKB 2NQ8A 4BND