3NIGB

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 127
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nigB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nigB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nigB03
1JV2B 1SHYB 4MMZB 3ZE2B 2NUPA 3EFOA 3IBSA 3K72A 4WK2B 2NUTA 1SHUX 1QC5B 3NIFB 1OLZA 1M1XA 1U8CB 4G1MA 3AL8A 1PD0A 3PPXA 2ODQA 2I6QA 3TXAA 2QTVA 3HXQA 1T6BY 4HQKA 1U0OC 4NENA 3K6SA 4IXDA 2VC2B 1L5GA 1MF7A 4FWWA 1N9ZA 3Q3GE 4C29A 4MMXA 1XUOA 2IUEA 5KYYB 4UM8B 4CNBA 3EGXB 3NIDB 3HXOA 4IGIA 3FCSA 3M6FA 1M2VB 3E2MA 1JV2A 4MMZA 1MQAA 4JX0A 1QC5A 4Z7QB 3AFCA 1U8CA 4NEHB 4O3UB 2WINI 1MJNA 2VDMB 2VDLB 2ICAA 1ZONA 3BN3A 2I6SA 1QCYA 1IJKA 2P28A 1M1UA 5KYXA 2O7NA 1RRKA 1FE8A 5KYYA 5KYXB 1SQ0A 3EGXA 1TYEB 2X5NA 4IHKA 5HJ2A 3EG9B 3EOAI 4DMUB 4CN8A 1M2VA 1JEQB 3TW0A 1PT6A 1CQPA 3BQMB 3ZQKA 4O02B 2UZYB 2ADFA 1MHPA 5E6SB 3OL2B 4C2BA 1RD4A 1SHTX 1ZOPA 5BV8A 4MMYB 1MQ8B 2VDQB 2VDRB 3OKYB 1M2OA 3ZDYB 1RTKA 2M32A 2ODPA 3VI4B 2XWBF 1YUKA 2XWJI 4PN7A 1JEYB 4M76B 5KYUA 3ZE1B 4FX5A 5HGJA 1YVRA 1AUQA 1XDDA 4HQLA 1Q0PA 4F1JA 3F74A 4G1EB 1OAKA 3EG9A 1U0NA 5E6UB 1NA5A 3ZE0B 1XDGA 3N2NA 3TVYA 2VDKB 1JEQA 4WJKB 2XGGA 3EOBI 4XW2A 4C2AA 3EGDB 1DZIA 1PD1A 4O02A 4CN9A 1IDN1 1V7PC 5E6SA 3OL2A 4A0QA 5KYNA 5LN1A 2P26A 3T3PB 3OKWA 1UEXC 4MMYA 3ZDXB 1AOXA 1FNSA 3EH1A 3NVQA 4WK0B 2WW8A 3RAGA 1DGQA 5KYWB 3PPWA 4UM9B 4WFQA 4Z7OB 1JEYA 4UM9D 4HQOA 3K71B 3IJEB 4GZ8A 1ATZA 3GXBA 3BQNB 4HQFA 4WK4B 4G1EA 3NIGB 4O3TB 1LFAA 3FCUB 1IDOA 1RS0A 5E6UA 3EH2A 4Z7NB 2I91A 2NVOA 3EGDA 1ZOOA 1AO3A 1MQ9A 1JLMA 3HI6A 5E6RB 1PCXA 5KYUB 3V4VB 4K3JB 2VDNB 1BHO1 2NUPB 3EFOB 4HQNA 3K72B 1M10A 1YVPA 2NUTB 1M1XB 1BHQ1 4G1MB 3AL8B 5KYWA 3T3MB 1IJBA 1SSLA 3K71A 3IJEA 1CK4A 1T0PA 3TCXB 1N3YA 3F78A 4BJ3A 4NENB 3K6SB 3AL9A 3PPVA 1L5GB 4MMXB 3PPYA 4JDUA 4F1KA 3ZDZB 3QA3E 2VDOB 3VI3B 5HDBB 3V4PB 3FCSB 5ES4B 2B2XA 2VDPB 5E6RA
chains in the Genus database with same CATH superfamily
3IKVA 4UYPA 1UBJS 2J43A 3MMEB 1A6PA 1M66A 5AEAA 1HY3A 4M38A 2P8PB 3VXME 3RVQA 3OZTA 1N9ZA 1BD3A 2WWRA 4AZSA 2ZUBA 4M5YL 3MN1A 1JPTL 1CQJB 1MRNA 1J8RA 2QRMA 1ZK0A 2PO6D 3I4LA 5IEBA 1QZXA 4XMUA 1DRUA 1OK8A 2YVQA 1L4MA 3QJRB 5E8EA 3ZS9A 4N6OA 1L6XA 4C14A 2ERYA 3P0VL 3N8HA 3CNBA 5G0VA 4ECEA 3MGTB 4TRPL 3OVUB 3LH9A 4EVSA 4YQEA 1VERA 3TV8A 5ALXA 5BW5A 2PV7A 3N42F 2G1JA 1Q0XL 4A2MA 4DUGA 1SOUA 5K8JB 2YV1A 1E1MA 4JEHA 5KQRA 1SEBB 2CLZB 2F43A 1HXYB 1OAJA 2VDKB 5I9QC 2GSIB 1S7SB 1LO5B 3INOA 3ASYA 3HBFA 3DXAE 4DGWC 2OLJA 2W93A 5KBYA 2BW0A 3LN5B 2BGNA 4ZEOA 4IDFA 3RTGA 2J3KA 5KWYC 4J8QA 4OGAD 1NIJA 1D9KB 1BMDA 1V1MA 1CDCA 4NBXB 3D0KA 1PJAA 4HJ1A 1KC3A 2GRAA 3F46A 4PICA 2FWIA 4X0KA 2FT6A 4NE2A 2CHDA 5JXIA 3IXAA 4LTMA 4D8XA 3GHBH 2ID9A 4QQRA 1Z39A 1H94A 3QORA 4XB8A 5JLZB 5L0QC 1YR7A 3WGJA 1CJMA 2KX7A 4E6PA 4KX9A 3VMOA 3MACH 2BTEA 4YPGB 2NY1D 1OB1B 4H18A 4I5GA 3HFML 3U61B 2V0NA 1KI2A 2CLHB 4YONB 1JSLA 3SDYH 2V03A 3UP6A 3DA8A 1L7AA 2GBTA 3BVDB 4ZT2A 4EPWA 1BFVH 1CXFA 5J89A 2M98A 3L1VA 2F8IA 4N3UA 2NO4A 5AW7A 1R8QA 1DC6A 4XXDA 1N6QL 2ZAHA 3GBNL 5EHQA 1N59B 3CTTA 3QQ4A 1X1AA 4GZ5A 2OPBA 5BWLA 2R2AA 4F3TA 4YHOH 2Z7ZA 3BP7B 3N6XA 3P2YA 2KH2B 4GSLA 4E11A 1NW6A 5FYKH 3TA3C 2V7TA 3BTUA 3MMPA 1PVVA 3PT9A 1XHFA 1HH4A 1V7PC 3AYZB 3O0RH 3MQIA 5ICFA 4HN2A 4ZW7A 3HV2A 3MOBH 1N2OA 1AK1A 3MZGB 3FOBA 3D30A 4WW2F 5DU7A 1VGEL 4D44A 3SYOA 3GJSA 1QRND 1IWBB 4EJ0A 4NY1A 5AW6B 3I1JA 3KJEA 2GN8A 1JR2A 2GBPA 3QBTA 2FB9A 4J4BA 3WZMA 3I9NA 1LSUA 4A73A 2VGLM 4FFZH 4OG2A 5I3ZA 2JWGA 1NIPA 1UF9A 1MI5B 4Q93A 4HFUH 4HFWA 3IJHB 1RPQA 2CR0A 4PZAA 1XXHA 1EXHA 3F7VA 5K9JH 4NM8L 5L88H 2X0DA 4K3EH 3VFVA 2QE7A 1U0FA 2EYRA 4EG8A 4Y6RA 4B4DA 3LFUA 4DLZA 3Q3GE 1XUOA 1E1YA 3OEHA 4XRCB 1CYGA 3BWAB 1NGZB 3SBEA 4Z0TA 4S2UA 2WZQA 3N07A 3T0EE 3NZUA 1U9JA 4Z7UA 5HIAA 2X76A 1XXFC 1G3IA 1YY9C 2J8HA 1YB6A 3F00A 2QTCA 3TPFA 2X4TA 1NVTA 1C1DB 4H4NA 2GDJA 1CS6A 4KE6A 1XTQA 5BMFH 5C86A 4GUCA 3S0PA 3ZK7A 4UKDA 1KO1A 1KIUB 1M54A 2BGRA 1NBZB 5B3AA 4U6XB 4PLGA 3AMKA 3WUWB 4PYMA 1YI0A 1A4IA 4X61A 3W8DA 1UKSA 3IJ7A 1DC5A 4MWCA 3PG5A 2CHGA 3RTQC 3IFPA 2BP7B 2VLIA 4G5FA 5DUML 3U7IA 3G6DH 4DLUA 3OT5A 5HUJA 3CBGA 3G68A 5BYJA 1DO8A 4MV3A 3BIFA 3VAAA 3C6LC 5E4FA 2YC1B 1R0LA 3BD7A 3U4IA 1QACA 2BZDA 3AXHA 4YSTA 5FFGA 3CVYA 3D9AL 2JCYA 4B6ZA 1T4MA 5B7EA 3R9IA 3ZW8A 3E3AA 2P0YA 3J7HA 2PCYA 2H45A 5LDSA 1Q5PA 3M8OL 1Y98A 2P6NA 3LN4B 5COAA 3UAZA 5D2LB 2CXQA 1UB6A 2HGSA 1P77A 5KAPA 2ZBQA 2VDMH 3DK2A 3I3SR 3F3KA 1ZJBA 2AJCA 3ULVL 1EFRA 4OOFA 4E5DA 1F58H 3AY6A 3VJMA 5J40A 3M17A 3HDJA 1E2NA 2G7ZA 1QYCA 2DWOA 4LRQA 3AY0A 1U7XA 4HGYA 2Y2VA 3O4OC 4XGRA 4GKZB 4HYYA 1XZPA 1FE8A 4Q4AA 3RX5A 1SUPA 2OENG 1GL4B 5DBEX 4UTBA 2E47A 3VMFA 4CILA 5EJAA 5FR2A 3L1FA 5EIIA 2VAAB 1BREA 2VWEC 2H0FA 1UWKA 1F00I 4YGXB 5CUSH 2XRAL 5J6GA 5IJXA 1C12A 4GLJA 1W25A 3VXMD 1YLBB 4OFYA 5EEVA 5IOPA 1OXVA 2EKLA 2RC5A 4DJTA 4HEMA 3ND6A 3W05A 3MGBA 3V8VA 2WBWB 3PHSA 2FG5A 2I67A 2O1SA 5B6PA 12E8L 5IDXA 4IY1A 4WY7L 4LLAA 3F0TA 1F4PA 3OPXA 4E5KA 3FNIA 1Z88A 4W4NA 2OI9B 3BVUA 3WGIA 2ZLBA 1GAWA 1OI2A 3C1AA 1NURA 4D9LH 2DQTH 1JVBA 3SBXA 4BNVA 5GS0C 2CR3A 1U8OB 3ZHLA 1BZ7B 4DA9A 1J10A 4DY4A 2NY0B 3V0WH 3ORQA 3V1UA 4BASA 3DXAD 1NVXQ 1J0IA 3GJ3A 4FS0A 4YSQA 5IEKB 1TZHA 3CE1A 1JKXA 4I46A 4JL6A 3HJ0A 3MRGB 3G0DA 2PSEA 4PAMA 4L29A 2OMBA 3HPJB 1RLBA 2ERJB 4OAQA 3E2HB 3EEQA 3MLPA 1A9YA 2QQLL 2BGUA 2EDKA 2OOSA 1O1YA 2X13A 3OT4A 1XAJA 1D0VA 2B37A 5D7IE 2W2MA 3EQ7A 3MT0A 2K7ZA 4N12A 3S28A 1UZ8A 2VN7A 1E7VA 1H3XA 4IKPA 4F3KA 4BTVA 2EXWD 3NM6B 4JT9A 1KE1A 1T2NA 1M3SA 2ZWNA 3OPMA 1KEGH 3RGHA 2ZQZA 5E08H 4TMKA 5HVHB 2W2VA 1JZSA 4FKBA 3WLNA 1UM4L 1ID1A 4G4JA 4XPTL 3WHKA 4N03A 3MBWB 1ZVNA 2WT8A 2H11A 4PSDA 2QGEA 5DJYA 4M43H 2BHYA 1R8JA 3ZC3A 4OZHB 2WWXA 4Q34A 4KRNA 2JGDB 3BULA 2DFLA 2XBUA 4KXBA 4EHIA 5JSYA 3JPWA 4KRYA 5K3DA 4BC1A 4F21A 1QEXA 3FFWA 3II6X 5KYUB 4CF7A 1QFWL 3VWKD 1XZQA 4F7EA 4JJZA 4LNRA 1JHQA 1Y63A 2OL3L 4DUXA 4DLTA 1PZBA 4PQFA 4UDXX 3WB9A 3OZRA 4JUTA 3T4EA 1CDDA 2FUEA 4PLVA 3VV3A 2VHJA 3QEUB 1IXKA 3N8KA 3Q2IA 2OG2A 2QTHA 1JLHA 1JVKA 5AW5B 2SKDA 4QDTA 1U0OC 5BV7H 5F12A 3S8FB 1UQSA 1OBFO 4IM7A 4XAQA 3F04A 5CGBA 1OMOA 4DZRA 1DJXA 1KJ8A 4O51B 4PXSA 2ED7A 3VR5A 4LQFL 1ROCA 1WR8A 1UOOA 4D6PA 4RAQA 1ZS8A 1WXWA 2WZ6A 1NMCC 4DJ5X 5C0GA 3P69A 3C8UA 3TGLA 2FI1A 4QRPE 2VZ1A 3RKUA 1E79D 4BEIA 1OB0A 1JMKC 3ETGA 4FL4C 1KI9A 5I7EA 4MKRA 1OT2A 3GX1A 3ZY7A 4PVDA 2V3CC 2VXTL 4WNYA 4C7VA 3OJDB 2F48A 3F6EX 5HI5D 1EUZA 4LCWE 4XNXL 4KH1A 1JEQA 4UNNA 3EIXA 2PF6A 4DDUA 2IXQA 3LIZA 3T0ED 4GMTL 2JAWA 4DESA 5KVQA 1GARA 4JEMA 4ZMXA 2OCAA 2D73A 2WTPA 4W4TA 5BQOA 3MD9A 4YJ3A 1VDMA 1GILA 3NA9L 5EF1A 2BFAA 1V0JA 5E38A 4RVUA 3EXG2 2QKIC 4NZUL 5AOAA 5M7EA 4H44C 3LX6A 3KYCA 5ULLA 5D4QA 1U8ZA 2OZLB 5EBLB 1Z8NA 3EMDA 2K7FA 2FSVA 2P30A 4WZAA 2EFJA 3G5YA 4JFZL 2QW1A 2GK0A 1W9MA 1ZVSA 2F8MA 1ZTXE 2ATCA 3UTCA 4X3CA 1PGPA 3DBXA 5JCXA 1QYRA 1MF7A 1YN6B 1UT5A 1TFRA 3I0ZA 2QRLA 5D7KE 3OPZL 4TL4A 2BM9A 3GSNH 1SZDA 2PYEB 4JGIA 5D2CA 4TUUA 5IP4A 2W4MA 5EJIA 3BO8B 2ACVA 1AAJA 4M7OA 4FR0A 4NI3A 3SHFA 1VBFA 2YD7A 3FUCA 4HZUA 3ARBC 3ZE8A 2OSLA 2HT1A 2ICEA 5HGDA 4FFVA 2ZEJA 5EWIH 1U8FO 1QATA 3KLQA 4O02B 4ZPVA 2OL4A 3GJYA 5JMWA 1GPOH 1VGRA 3T95A 1MQ8B 2WPDA 3QWNA 3MREA 3RLSA 4NRXB 3FETA 3RL1A 2Y1EA 5LMCA 3WMQA 2EIBA 2EX1A 4HADA 3MHPA 5ALCL 2LDXA 3TQIA 1PFWA 3ADDA 3LTNC 4HTFA 3QG7H 1O8CA 3ODPA 4LHSA 3KZOA 4Z54A 1NAIA 1Z0SA 3FO9B 3EWIA 2ZXBA 3D3VA 3EVCA 4U6YB 1QUFA 1QSEB 2C97A 4ESEA 2WJZB 5BURA 4HWKA 3SDZA 1RAMA 5K39B 3WNIA 4QRQB 4JKIA 5KVFE 3IT3A 5I6XC 5C7ZA 4XXCC 4HNAA 5CLQA 3KDMA 3EZ6A 1AG6A 4NAQA 2J07A 4BMPB 1ZR4A 4HD9A 3DO3A 3SQOA 1NVFA 1OV6A 3EPKA 2WLLB 4B8YA 1L4LA 4GMKA 4Q7KA 3V5KB 4PGHA 3QVSA 3EAGA 1MOEA 1Z2KA 1N0LA 1MIOB 2IYZA 1AO7A 2Q2QA 4R3SB 3R06A 4MP8A 1N3IA 2ZANA 4MJIA 2R6R1 5I1GH 1FAIL 4P3DB 4HKZB 4GB9A 3KKPA 2I99A 1XU7A 1ODFA 2AFNA 3WN5C 2P2NA 4F9TA 4GEJA 1RWQA 1KJ2H 4PPFA 3ZDZF 3JTSA 1JG7A 3QR2A 1LW7A 1RY7B 4QBFA 5JO9A 3AUXA 3FR7A 3AESB 3UJ9A 4X20A 3OX1A 3U7QA 4R4BA 3T9WA 4HIHB 2R0KH 2QX8A 2AOUB 5D6CA 5DD1L 2BW4A 2CO2A 2ZJOA 1J56A 3I9OA 3RA7H 3D2AA 5A1TA 1EGJA 4L9LC 2H1IA 3QOWA 2HV9A 3MYJA 3K09C 2B8JA 2GI7A 3BZWA 5AD1A 4FKKA 1F6LL 4PBTA 1D7FA 4QYOB 2VHQA 3GYRA 5T67A 2P2YA 4F9GA 5CEFA 3NRPA 4W1RA 4CETA 3VA7A 4XOIA 1F4VA 3LZNA 2Y2WA 3DO6A 4N0UB 4IS2A 3BX1A 1KN4L 2BWQA 4D43A 5DUPL 1U80A 3GJTA 2I91A 3ARYA 4KLNA 5DMKA 5JPMA 1P6UA 4ZAKC 3LBFA 4J91A 3B9AA 2UY6A 5IFJA 1AFVL 1UENA 4V1DB 3UMBA 5BMVB 1CJCA 4XWWA 2AJYL 4IRSA 1N2CA 4ZTOL 2GIYA 4JVNA 1XD9A 5E94A 1NRXA 5K8UA 3LS4L 3AKYA 5G41A 2FB4L 3AG3B 3TBVB 1A7RH 5F98A 3P0HA 3IXTA 5BYKA 1WLYA 4FGJA 5JIBA 1Y8AA 4KSYA 2HT3D 3NJIA 2YFNA 1QG6A 4LYGA 3L7EA 4DM7A 1E4JA 3JVVA 2I1WA 1PJZA 3QXUA 1X1EA 5C0AB 4QDUA 1OD7A 3TNMB 2VLKE 5CVEA 1NONA 3OBBA 1Y42X 4YHNA 2FPWA 4BFNA 1N7ML 4ARIA 2FSDA 2ZRCA 3H2IA 1MF2H 3QXAA 4PANA 1RK1B 4K6CA 2EDEA 1CTQA 1T34A 1YEWA 2PO6A 3GLGA 3AKCA 1TMYA 3DHNA 4D4JA 5ITZB 4TNVK 4RTSA 2H26B 2GKSA 1XTJA 2XDYA 2QXYA 1BWSA 4NZDA 1GQOA 3RU7A 2ZP1A 4YP9A 3B2PA 3ZV7A 5J9PA 1U0NA 2RHJA 4CRWB 4YA6A 1L3WA 4RVOA 2V6BA 2ZWPA 1BTOA 4YDLB 4G8FA 3FPAA 3FQYA 5C9KA 1D5ZB 5DQ9B 1UKZA 1MW3A 4ZVPA 3A6FA 4LE0A 4MB2A 1E40A 5EO0A 4QRPD 1ND0B 1L7XA 4QXUL 3BEDA 4WTZA 1BX2A 3Q1EA 3GNQA 3IV9A 4IIQB 7REQA 2R85A 3P3YA 10MHA 1DFBL 4KKAD 4YP1A 2O48X 3FVTA 4LCWD 3WGOA 5CG2A 3EGCA 3EJWA 2ZP9A 1KZYC 1DQRA 3BJRA 4JPIB 2WOOA 2C29D 3B8YA 3N0RA 3Q85A 1I7UB 3S40A 3ER6A 1UC4B 3DEFA 4QHNB 4JFXB 5IYZB 3LAWA 5K0EA 1N1GA 4NCBA 3QWBA 4R7ZA 4KWHA 5KVSA 4UV7L 4MKGA 2HC9A 4FCVA 3AM8A 1ACZA 1ABBA 4IHAA 1KCRL 4AFNA 1E1CB 1T8PA 4MVJH 5EC2A 2FJFA 1M2NA 3PJGA 2FPKA 1U6AL 4TN5A 3EMVA 2F4NA 3DO4A 3HKCA 4E5SA 1T9CA 1RZIB 5EPMB 1O9ZA 2CN1A 3DHUA 1NGYA 3H4IA 3T9DA 3R7DA 2W0KA 4YAOA 3RPEA 1OOAA 4NN5C 1J8VA 1TLFA 4PJ5E 3LHPH 1URPA 2UZIL 4PN7A 3PEVA 3T3ME 4M02A 3M2TA 1RLWA 1NBYA 5D7KD 4OU4A 3KQVA 3EOBI 1U8LB 4GYKA 2C4TA 2XQJA 4I3GA 5IB5A 2GZ3A 3WWPA 3AQXA 2YHUA 3KBPA 3ZT7A 3E3QC 3FUKA 3TIVA 4PG8A 3G2HA 2D7NA 2ZIAA 2E85A 1QOPB 4YLCA 3KBEA 2VPPA 4XQ0A 2PPCA 3SDXF 3D1LA 2AQ3A 3NPSB 1O6SB 4H8UA 1E0SA 4K9NA 5D5MB 5LBSL 3LBYA 2PWHA 4UHEA 4OI0A 4P46C 4N3TA 1SG0A 1UOQA 4G3YL 4DIXA 3QUSA 1QRNA 2AI3A 3D9QX 2O8FA 1ACYL 3V0EA 5DJXB 3RSHA 2F61A 1E8WA 4MMZB 4IHJB 4I50F 1CR9H 5KTEH 1GL3A 5IVKA 4PJBB 4RJLA 4KTYA 2QKYA 1ISJA 2PKQO 1WB4A 4LSMA 1JKIA 5KJ4A 5LP6F 2CKBL 4TTSA 3GSVA 3H8SA 5AVQA 5IB4A 3PG2A 4LW8A 1ZUNA 3E0GA 3BP6B 1T22B 1ESZA 5ABDE 3BE1L 1CJUC 2A6KB 3DVRX 4GRWE 1I8MA 4HIXH 2V7BA 4X4MA 3D4OA 4J27A 2OW7A 3UADA 2QTAA 5K0TA 3AC0A 3W9EA 1C0IA 4C7KA 4EARA 5KSBB 4EZBA 2BFWA 4IFEA 3VU9A 2QAGC 3EDEA 2WIBA 3R5XA 3PQYB 2DLFH 5C0ND 1YA4A 3PEWA 2VDLL 4Q6IC 1P6XA 2C2HA 3GEIA 2G82A 1S7XB 4G5HA 2CBXA 4HCRA 2AJ3B 2GVZC 5TE7L 2OA9A 2X1PA 1SRQA 2P79A 4HMDA 2JASA 2V8BA 3K5IA 5BV2P 5EBGA 3ARSA 2BVTA 1WOYA 5FWRA 4RXTA 4ZMOA 5JS8A 1W36B 1BFKA 5FWYA 4N2OA 2ZTVA 1HNZB 1FMTA 5CKAA 3RX8A 4D4IA 2J6CA 4HEA6 4H1LA 3JQCA 4UQOA 5F3RA 4TVSA 4JHAL 4MRVA 5JDSB 5HMLA 4ABVA 5A2AA 1KY5A 4BZ2H 1WCWA 2MTAA 3DZKA 1ITCA 1JEOA 3UO1H 3K6IA 3FDZB 5BW4A 2NP6A 1BMGA 5IQOA 4GDFA 4XZUA 3NHMA 4WI1A 2I7OA 1V2GA 16PKA 4LSQH 1AXRA 3L5XL 3DV9A 4CADA 4BUQA 2ANBA 5GGRA 4KPYA 2DBYA 4N2HA 3T54A 4FULA 3BYTA 3JXEA 3DGDA 5J6HA 2KT6A 4YVFA 3TVMC 5F9OL 2W2PA 2ATAA 3TLKA 4YRQA 4KVGA 4MD4B 3HS0B 3ZLUA 3APCA 2GASA 3LY8A 1NUQA 4OLHA 5AVVA 1UWFA 3A11A 1IH8A 3P3UA 2PUWA 3CUEF 1SULA 2W5PA 4UBKA 3QELA 2DE0X 2PW1B 1XTZA 5K3OA 2ZNWA 4V0QA 3WICA 5AYVA 2WWHA 4G9EA 5I47A 4XYMA 2I2WA 5CIQA 3ZVRA 2GERA 1GGNA 2FX8H 3M1BA 3FWPA 1NQXA 1OE1A 4JFYB 1ULTA 4M6NL 2EARA 3MMXA 4YI5A 2NSDA 1QVVA 2VLKD 3ZYZA 3LAFA 1MEJA 4LPCA 2ZE5A 1KDOA 3JRWA 1NJ8A 3VXMA 5K2OA 3WE7A 1L8XA 4HPJB 4QREA 4ZT5A 1X7DA 2ZX7A 2V97A 3LQAL 3QPCA 4EHDA 2ADFH 1D4AA 2A9MH 1C1EL 5D1XC 3BDIA 5IFAL 1XTPA 2XDHA 2ICES 2RARA 3WS7A 3A6PC 4CI0B 3AF0A 2ZUWA 4IPTA 5D9SB 3O3BA 1JHOA 1KY2A 3WNJA 3UWMA 4YLBA 1QQ5A 4AG4H 3O3MB 1GG2A 4V33A 2EVIA 3V6ZB 4JUIA 3CRMA 1FSSA 5DLQC 1ZCAA 3H1AA 1WMAA 2RGYA 3C4VA 5FA4A 1WGVA 2PKWA 3V4UH 3WLWD 3D6TB 2QDWA 3KPSE 2AFIB 4HDNA 3DXAA 4FQLL 2A59A 1VCOA 1Z33A 3K0FB 4R26H 1NF9A 2WK1A 5AVTB 1VJDA 1H05A 4K2AA 2HHLA 4ZEXA 1SKMA 5EXTA 2HA6A 1YEEL 3IDJB 3TQFA 4J5VA 3HWX1 4L51A 4IXWA 4J3SA 5DJAB 5IVZB 3G5WA 5CCEA 1L4EA 4F7TB 4WNJA 1J8HE 4A04A 4RESA 3TWOA 3ILSA 1AGYA 3D6FA 1AF7A 4U6HA 2M6SA 4W8OA 1ZN8A 2GFQA 2XGOA 3GJFK 4NLHA 1QBMH 3BGMA 5ADPH 2JAQA 3HE6A 3UZUA 3BT2H 1F38A 4D74A 1E3FA 5T3ZL 1G7RA 2OLEA 2IS1A 2BNQB 4P06A 3GTNA 3LPPA 3M4JA 4U1MA 1RLJA 5BMOA 2XI9A 2HY7A 4AK1A 4NIMA 4G0PA 5CDHA 1QFWM 3R7WA 1CXIA 3LEVH 2YWRA 1JDBC 3WJAA 5E2TL 4PJ5D 4LRIA 4ORGA 2HG5A 1CRWG 4RU1A 2EW2A 1G7QB 5CSBA 4IXNA 2APJA 1WETA 2ZD0A 4WESB 4KJPC 3L5IA 1SCJA 2YQ2A 2HYMA 2AERT 4NCDA 3ZNQA 5D7LE 2PGLA 2OBLA 1DQKA 4UTAL 3PRHA 4JN6B 3Q5OA 5F2KA 2OMZA 2E7ZA 1NICA 2EEAA 3AB0B 4EJ1C 1ZGLP 3OZAA 2NZJA 4UUOA 5E5MB 5FLKA 4NXSA 3MRHA 5HJ5A 2DM2A 2NDGA 4LLDB 3QE4A 1CYWA 4NNXA 5KOJA 1K66A 3FSGA 5K3EA 1I3GL 4FYKA 1F11A 3Q8EA 3L84A 4XN7A 1T1XB 2BM3A 5EOCH 3S3BB 4AP6A 4C4PA 4IBLT 1NCUA 4PJGB 3TAUA 4L16A 2NXZD 2ZS9A 5F3WB 3UIEA 3C12A 5LWYH 1HXMA 4P86A 1S9VB 3H3FA 4HS8H 3CLVA 1WF6A 2DQGL 5F6HI 2NYRA 3ZMRA 3Q3GA 1L5LA 4PJ8D 3D2UA 2F1EA 3I74A 3VGDA 4ESOA 1SBSH 1E4EA 2D0PB 5FUXA 4JJOA 3RWCB 1CBVL 3MRMA 3B36A 4RK1A 3PF8A 4HDAA 2YSSA 1MFZA 1IIRA 4FVTA 1JXJA 4YI3A 4UINH 1E6EA 4BKOA 2KLBA 1UXSA 1OFUX 4L4RA 1O2DA 1LS1A 4PJHE 3CFEA 4JO8A 4QGSA 3B37A 5DZ9A 3ANLA 1F8XA 4XD7D 1WA5A 4Z7OE 2C3HA 1P5VA 4WGWB 1VSUA 3PUHA 5DBIA 3S36L 2EJWA 1PZFA 3OWOA 1HI6A 3AFCA 2A86A 3P9LB 1PW7A 5IHWA 4ZOQI 1MZPA 3P9CA 4I3RL 1R6AA 2FUG6 4HQQL 2RHDA 3GARA 1NIAA 2A9BA 3VH8B 1OBCA 2P62A 4YCJA 1TU2A 4AL4A 1MAMH 1U4SA 1YRAA 3GDBA 3SN6A 1MAUA 2ITDB 3C7DB 4AKSA 2P26A 1N7JA 1Q19A 3R3VA 5JUEH 2XA3A 3GMPA 4GAFB 1P2FA 1LX6A 1KPGA 4WWNA 4XI5D 3WFJA 2UVPB 1UFKA 3TR5A 3V4FA 5H2BA 4AQAA 3FCUB 4B3DA 1WXIA 3GRYA 4NWUH 2X4PA 1B8VA 3VU2A 4KR9A 4EYOA 1JZ8A 2PRKA 4WHTB 4OBXA 3Q9PA 4EN3C 4O2EB 1W35A 2P91A 3ZKMD 2VAWA 5DJ8B 1PFCA 3OKMB 2VN8A 2XYGA 4YGVA 3SGLA 4GI9A 2CQVA 4NU5A 4ZWNA 2XJ4A 4ZK6A 4F3RA 1EVQA 4JC8A 3AL8A 4N2BA 3X3FL 4I4CA 1SWWA 3N9GL 2Y7SA 1UJCA 5C5IA 1XZFA 4ZHQF 5HGAB 4HBGA 1DC4A 1USIA 1ULHA 1RXYA 4CIYA 4AL8C 2NXCA 2QTEA 1EQAA 3SDAA 2PM8A 3QQDA 4RNCA 2ATPA 1Z9SA 4OB5H 2KQNA 4I18B 3A0RB 2PAAA 1NJ6A 4GC9A 4Y0NA 1ZIBA 2V2XB 3QK0A 2MNJB 1ORHA 2FPGB 3W37A 2PX2A 5EZYB 3S37X 5CFPA 2B0SH 4W5QA 1FWXA 5ALYA 4FQXC 1JTVA 1N3NA 4B9KC 1DQLH 3NJRA 4DTIA 4KH0A 5A3QA 2P48B 4B3HA 5B22A 3SBPA 5AOLA 4RETB 1T3ZA 1RZ3A 2YDYA 1O5IA 5K93A 2GXUA 4XB6B 3OCUA 1VHQA 1Y18B 1KELH 2C5LA 7YASA 3HAEA 4FNQA 1TT6A 4HKXA 1X9LA 4FGSA 1RWOA 2W0PA 4LVOC 1DAHA 3DYIA 4Y5YB 1J8HD 4YXLH 4ZQEA 3DONA 5D7IA 5KYWA 1GPLA 2NZYA 4YC2B 1F14A 3G89A 3DEIA 1MMFB 4HUXA 4PGBA 5DMXA 3AT0A 3IO3A 1A6ZB 5JNLA 2W11A 3BUYA 2D5AA 2J8UB 4HU8A 4PBXA 1EXNA 2JIRA 4YJ2B 1M33A 3A6HA 2JI3A 4Z0XA 3RGGA 5LB2A 1RULL 5DTQA 1W49A 3IVGA 3TLAA 5KVEL 3I02B 4QUIA 1GZVA 5KYYB 4FZEL 2DWQA 3ZKXB 4J7AA 3VFRA 5KNDH 2BRQA 4EQZA 4QOKE 2AJTA 3L7LA 4G1BA 2A6IA 4I4IA 3T3PE 4U6SA 1RUMH 2FCRA 1GYQA 5JYEA 3QEGL 2ZRBA 1JWSB 1AS3A 2CLVA 1TMOA 4BUCA 1DELA 2CB0A 3DDCA 3FOWA 1BXGB 3ARXA 2HEGA 4D8UA 3VR3A 3T12A 5D7LD 4DT1B 1SVSA 3VJ6B 5B8CB 1R8XA 2RHBA 1U2DA 1LKZA 1TVDA 2LIPA 5EKSA 3I84A 5I1LB 5DRWA 2GCIA 1FJXA 3CC5A 5AHOA 5I9LA 4OLUL 5K0BA 4ZQKA 5EU7C 4FCHA 1X8LA 4WE3A 4MUNA 2KPOA 4MW7A 1C3OB 4QHUB 3VFOB 5CFQA 4EFNA 1JGVL 5F5XA 4TLBA 5SWZE 3QUMH 1CICD 3L7FA 4JY6A 5HXMA 2ZE8A 3A67H 2VRCA 3KPUA 1E9VA 1C3JA 3TG2A 1G291 2H16A 2ZM6B 1XZLA 1ZDSA 2R5NA 1F5WA 4S1RL 3WK9A 1JFFB 3VYRB 2FWPA 1J9ZA 4YAFA 5CJ5A 1PR6A 2EYTA 3Q3CA 4LIQH 1L7EA 3LUFA 1TO2E 9ABPA 1JAYA 4L9SA 1A8PA 2BOVA 3EJYC 1T5XB 4TLTA 1X5AA 5EG5A 3ENZA 5FOBB 3NUKA 1JIIA 4ZDIA 4LCWA 1UH2A 4LP5A 2YAQA 3DS8A 3DT9A 4NYJR 3B2UD 3MD0A 4G23A 1XXHE 2IMMA 1UXWB 3PVSA 2XIBA 1PR4A 4FYPA 4RL6A 3Q9UA 3V9CA 1KIRB 1TEXA 3G02A 1L3CA 1KYYA 5B7GA 3GPLA 5KNBD 4HZGA 3Q8LA 5BWBA 2VJMA 3NP4A 2D1RA 1WUIS 4CL0A 2Y7MA 2ONYA 2BMKB 3LDAA 3ARDD 1XZ0B 5F7DA 2BY3A 3VG0H 4TS1A 3L5OA 4KWCA 3POHA 3G3EA 1W88B 3W1WA 3W11C 1B2LA 3ZUGA 3K4PA 4N39A 2XGMA 3K4QA 4Z7UE 4LZWA 3T3HA 2H29A 3R9KA 4ITVA 3WNOA 3AYXB 2NW3B 2EDFA 3WLHA 4HXAL 1L9QA 4BWUA 2FWRA 3SBRA 3ZHUA 1ZHKA 3MRKB 1UH4A 4G8IB 1A0OA 4TYPA 3LHKA 3COOA 1B0GB 3UT5A 4R4FH 3LCYA 3HUFA 3L6OO 1P84J 3EPHA 2C5BA 4IRXA 1TJMA 3D02A 1S3FA 2AEJA 4Z2YA 4MS3B 3FO0H 2C7UA 2ZUQC 1P7QA 5ESDA 1Z3GH 5CCKH 4N49A 2I6XA 2ZI4A 4OGYH 1OLUA 1CU4L 2ZU6A 3MRRA 4NI6A 1T6VN 3CZLA 2D3NA 5T4HA 4TLAA 4S1QL 3JQ8A 1JQJC 1TXKA 4EDFA 4OVUA 5J06A 5KOYA 4WNQA 2WSSD 4S2SA 2ITCB 3A70A 3BGOS 2ABWA 3ZKWB 3X1GA 3FCYA 2CEAA 4HMQA 2WNGA 4BX2A 4RIGA 4Y7OC 3N2KA 1M2KA 1P2UA 4WOCA 3AY4C 3AERA 3HM9A 2PO7A 4LVEA 1JS4A 5DRTA 1YRYE 1ULZA 1UXOA 5FFNA 4MSWA 3BWXA 3LT2A 3IDAA 4OZGF 2G0KA 1UBRS 1GL6A 2WQVA 4L3VA 1IZJA 2RC6A 1DQDL 2AJXL 4KNQA 2XDQA 5EIHA 3SJZA 2OJZH 5LVEA 4H17A 5CNIA 5LCVL 3NVQA 4PR0A 1D7BA 2H9AA 4QUJA 3NASA 3DX1A 1FNLA 3LCUA 4JK3A 2XXAB 5D6DA 3OIVA 3L8FA 4TMVA 2GJ6B 4ODSH 1ZESA 2CDFB 1U02A 2CZQA 3N85L 5CHNA 3QDAA 4U31A 5TH2B 5DD5L 5FFLA 3GLVA 2E7CA 4ALAL 1I2MA 2L2QA 5J4MA 3VFUB 1GSKA 4RA0C 2IBZX 3UGJA 3QBJA 3TQQA 4GRMB 4V2CB 3K4ZA 4NOKA 3GGWB 3ICQB 4GQ9L 4FW9A 1V16A 3R5FA 4PS8A 2JCCE 3DO7A 5K0NA 5A0FA 5L8LB 2YD3A 1QRAA 2Y9PB 3ESDA 4KQ3L 4ZPTB 2XMBA 3LWDA 4LRWA 2OZNA 2AG6A 1JDNA 2OSXA 1IJNA 1II0A 1I7TA 3BAKA 3DD1A 3QJOA 3OETA 2YRPA 4IU3B 4X80H 1FUUA 3G1TA 3OKFA 1YOBA 2W6ZA 3T5BA 3FW1A 4CDGA 5JU6A 4JSTA 3C5ZB 2IOMA 1N0UA 4NKDB 5HYSG 3MV11 1L8QA 2ZRIA 3N2JA 4R05A 1TCRB 5KS9E 2PZFA 5D1NA 3W5JA 4LC9A 3OGOE 3R9XA 3Q48A 4YHYB 4O8ZA 1EVKA 2YIJA 2OP4L 4MZIA 5ITSA 4PLPA 4JPWH 1PSZA 2PYIA 4CMEC 4B60A 4OFDA 2GITB 1HT6A 2WO4A 1GGYA 1QLJA 3MROB 3KJGA 2PHZA 4RVSA 5AM3A 5EHIA 1SELA 3L5WA 1NY5A 5I5MA 5A6LA 1XMWA 2H2WA 3U4DA 1I5EA 1XU4A 2Q76A 3LQKA 2J5XA 4UWQB 2BCKA 1Z5WA 1T89A 3KM1A 1RZGB 2OXGB 3L40A 3L16A 3DJ9A 5SWZD 4MCYA 5DWPA 4H1TA 3QUAA 3SNHA 1GPNA 4J16C 4UEJA 2K4WA 3GZJA 4L76A 4NIKB 3I92A 1B2WH 1MFAH 4GRLB 3LX9A 3O8NA 4JUBA 1LLFA 3O2DL 5ESXA 3UHAA 1T6NA 1NHWA 4XFJA 5LNGA 1PR9A 2XUAA 2ZXEB 5HZMA 3P4OB 4P9HH 4N3GA 1R19A 2J6EA 1AIFA 5JDJA 2WIKA 1Z2PX 5DVMA 2XWPA 3ADOA 2XBDA 5F7YC 1HYSD 4L8BB 3A9CA 5E1IA 3WMPA 2NSHA 2J25A 2QE7D 2IYVA 4ZMNA 2VNJA 3E5NA 5F9JB 5I7UA 1JPST 5JBNA 3GIVB 4L4VB 1IGIL 3SLKA 3OEHD 1GAXA 5B3KA 4JP2A 1E4XL 1GL9B 3G7UA 1BHGA 3SGDH 4YEDA 1RZJL 1RADA 1MA3A 1JG6A 5C0JA 3COPA 5IW3A 5DZLA 4BK4A 2BZ1A 4BINA 4ZJPA 4M2LA 5KAQG 4M9RA 1DKPA 5AKZA 2GFHA 5CM2Z 3QKRB 5A03A 2Y6UA 1VJ1A 1YEGL 3NIGF 5CKGA 5AVWB 5ACZB 4JS0A 4IDAA 4CMHB 4WDIB 3RBGA 3V55A 2COEA 4CCSA 2C9UA 4K9LA 4PU0A 3M1CA 5F7LB 4R9NA 2Q21A 4U3HA 3VU0A 3SIRA 1L4NA 1YB5A 1TCVA 5LOVB 4ESVA 1F1JA 3HN7A 1LHZA 1J0EA 2D1TA 4WZAE 4GQAA 1PVOA 4UDUA 4DKDC 5IBUG 3OU2A 3GCZA 3GZNB 1TMKA 3NBNA 4LFCB 5LBGA 4QYIB 1AK2A 3R4CA 3SM3A 1H2EA 1SVBA 3SE9H 1MB4A 4DP8X 1KO4A 1MJHA 1NA8A 3CFCL 4HOZA 4XBPB 2SNIE 4Z3IA 4X0NA 2O6PA 4NFBA 5G4LA 2OP1A 4ZAYA 1Q72L 1NTOA 3VPAA 4Z4FA 5C35A 1RJYA 4KXQA 2R4SH 2VMCA 3D4NA 4ZMPA 3JR7A 5IT4A 2P5EA 1RXIA 1Q0UA 4P4NA 3SCMA 4LJ9A 3L3JB 3I6KA 2HGZA 3IOMA 1L4GA 2NYKA 3WIUA 3H2YA 3RSQA 3W2FA 2F19L 4PTTA 5I6PA 3KWFA 3KPMA 1MJ7L 3VXPB 3ZQ4A 1O0BA 5AI6A 4A0HA 4BCYA 4EAEA 3MFFB 1SBCA 2IUYA 4YSAA 1INQB 1X4YA 4CM4B 3VH1A 4Q7JB 2C1OB 5ALSA 4IEFB 3ANTA 2XIIA 2A30A 4RMVA 2OS7A 1X19A 3EQ8A 4PJ8A 5CDSA 4ODXB 1H9VA 4XB2A 1GZ5A 5HHVH 5F96H 4LNHA 4ATTA 2LOEA 2RACA 4B7AA 4QECA 3KL2A 4F1WA 3TS1A 3ZR6A 4KBFA 3D6AA 1YYML 3LB6C 4OFYD 2E27L 1XCJA 1CU1A 1H4QA 2W6PA 3KPQA 3ATAA 1G84A 3SKXA 4HUVB 1L0BA 3VRLF 4MJIE 1MFMA 2MYTA 4XD7A 1PBTA 1WCIB 5G1PA 1EA5A 2HWZH 5HTSA 2AG0A 3E7XA 3HBLA 5LGJA 3QNXA 4KR2A 2IXDA 3EBOA 3JWPA 1DWUA 4I1YA 4B81A 4LXUA 3QG5A 2QHRL 1QFSA 1HILB 1HDXA 5FEUA 4ZYUA 2VF4X 4IKNA 3ZBMA 4LLUB 4M8KA 5JCOA 1COWA 2QGFA 4PBWD 4J2HA 3E1ZA 1T0OA 3F3MA 1OAUL 1T5LA 2OBYA 3M81A 3GQFA 1QYVA 3T2NH 3BX7C 2P3QA 3JTMA 4Y4KA 4Y6GB 1PSDA 2WMPB 3QRLA 3WB2A 4G0YA 4HDRA 2HLAB 4LY9A 4DNQA 4HHEA 1FN4A 3O26A 5LUAA 1NRIA 2J57A 4GHWA 1HORA 1NI4B 3STBA 3N2ZB 1DMSA 1LDGA 2XMZA 4MYDA 1QPPA 2MSNA 1KAOA 1P4HA 5M04A 2CB9A 4GKLA 4GI7A 3N70A 3DMMC 4GXVL 4N68A 2DIBA 4CIXA 3RZCC 1IKFH 2QSVA 3TEUA 1H1DA 3BH9A 7CGTA 3KBOA 5K09A 1E1DA 1K0FA 3Q2WA 2B5IB 1WAAF 1BH2A 3U5ZB 2WNWA 3V97A 5EB9A 2F6AA 1QO3B 4M8VA 4EUSA 4C57C 4EA9A 3GCXA 3DVAA 4KXWA 4YO0A 1Q0YL 4CN4A 1SHZA 3BH0A 1QMGA 3IJ5A 2OXHB 4Z7NF 3AEQA 1MCPL 2IDFA 2BI8A 3EOTH 1URLA 2XZQL 4LO9A 3G49A 4DQUA 1OW0C 4EO4A 4MAFA 3BDBA 1KKUA 3WU1A 4NT6B 4R1SA 3GYBA 2W5UA 3WFBH 5FI0B 5B3SB 2CK0H 3GXUB 3IQIX 2MFNA 1R47A 3GZ4A 4BMOB 2QDVA 4KQCA 1UYWL 1C4XA 1KI7A 1TIKA 1QO9A 3GLGE 5BYAA 2X2FA 3OG6B 2JIDA 5EJ5A 2BWDA 2R1XA 2AXPA 4E42B 5J8OA 2DLGA 4ENRA 4QWMA 2O4CA 4YDNA 5KVDH 2E9WA 3CLTC 3KPSA 1K4YA 3PX7A 5BWNA 2ZJ7A 2C5SA 3PWNB 2J48A 4CV0A 3VR5D 2DPGA 3WNNA 1YGYA 2D54A 2YGNA 4DWOA 1ILUA 1P5FA 2GBLA 2E5FA 3K81A 3I4CA 4HF7A 5AUPB 1P80A 2LRHA 4LDPA 2ZR9A 4JFEB 3E22A 2XWBB 4G9FB 1R4AA 1J8HA 2NNAA 2J5BA 3WLPA 2B1HL 5BOPA 3NHBA 2HBRA 1KJQA 3BC1A 1YNKH 2V4LA 5AW2A 1J23A 3L5KA 5GINE 3I85A 2Q3ZA 2RKBA 4R2GC 2DH5A 1C9MA 1BG9A 4R7NA 1R00A 2AK1H 2J12B 5I24A 1R15A 1G18A 3AV0B 4KJYA 1S8FA 3G7NA 3W9UA 1T1WB 1DFHA 2RHEA 1SN5A 3T7TA 4L6AA 5AZ2L 4AY2A 3IL2A 5ENVA 1SQFA 4BATA 3PUKA 5FQNA 5B64A 2WYHA 5LQJA 4KJZA 1E9PB 3CVIH 2VR9A 4F3YA 2IH3B 1KTDB 2JA2A 3QJQB 1OSEA 3M1YA 4QL3A 5I1JL 4HH3C 5CZVL 3TZHA 4AMBA 4R2HA 4FINA 4TQEL 4GQPH 4QHLB 5D7LA 1JTPA 2H2AA 1HTTA 2AB0A 4WCYH 1ZC4A 3ZK0A 4OZIF 1BE6A 1SBYA 3UJJL 5DT1H 4L78A 2IYXA 4D02A 1ACXA 2IUFA 3F90A 3QVWA 4RNRB 2NVUA 1OCRB 3M5CA 2JB6B 2IDZA 4OGKA 3FAWA 4LNUB 2QM3A 1DJSA 1UXHA 1YAZA 4P2OA 2X8JA 2FJHB 1ZS9A 5C1BA 4MJ2A 2VITB 5CS7A 2P1ZA 4FABH 3GD5A 2W07A 1CICA 1Q44A 4JFVA 1N2RB 4ELKB 2V7GA 2YXPX 4MIKA 1P2GA 3DG9A 4MMXB 1KVRA 1QAMA 1D6VH 5HOEA 1RFLA 5INCB 3IDXH 3PYMA 1NFQA 2AZ4A 1TEVA 4ELMB 4NO3A 3M70A 1QFYA 2HFEA 5E0FA 1JYFA 3CFDB 2HYIC 2X7HA 2QR5A 4NO5B 2OD2A 2QSJA 3MINB 1G64A 4K05A 3H2HA 3MOAL 2O2HA 1AP2B 3TIEA 1ORIA 4XHJC 1W73A 1Y89A 4KH9A 3G2KA 3TBYA 5ALMA 4I4NA 1AH2A 1SA0B 1UPBA 3DFFA 2OECA 5I8KH 2C2MA 1F2TA 4P58A 3EZNA 1SHXA 4X4ME 2V3DA 4E32A 1QGUA 3HB5X 2VPYA 3PHQA 3IO5A 5ALUA 1JHLH 3UTTE 4PJHA 1IGJA 1KBGL 1NVMB 2FZ3B 1RSFA 1S9WA 2EATA 3KJZA 4MJID 1PLCA 1H0KA 1YF3A 5E1AA 1FVFA 3WYRA 4LUCA 1G7JA 4V24A 1WW8A 1AGRA 1EUCA 4ARUA 4HUKB 3BAIA 4MB1A 4UC0A 3LC0A 2I4LA 3QVUA 2WJ6A 4EDWL 3S96B 3DPUA 4TUKL 3LBAA 4WNCA 1X0VA 4J9VA 1XH0A 3E38A 2R3SA 4KK9C 4NCC2 5HGHB 4MVJI 4M0FA 1YEDA 1C5BH 4JHWL 3NQ41 4LSUH 1IY8A 1ODAA 2ED6A 1F51E 1P0IA 2XX1A 2CM6A 1MJ8H 2GWRA 1K72A 5C52B 2WLIA 3O84A 3CS3A 4NKIL 3U81A 3TINA 1JR4A 1KCVH 4D0SA 4UUQA 1NSTA 1FL5B 2CO7A 2M1XA 4TZ0A 4NOFA 3EUDA 4HAIA 4AUEA 3UHPA 4UUJA 1H9CA 3JWNE 4F2WA 2CNYA 1TZGL 4WTWA 5FA5A 3MTQA 3KH3A 2WSSA 1Z5LA 5FBHA 5I6LA 1U8EA 1DIRA 1VJ0A 1O5DT 5H94B 2VM3A 1EX9A 3WV4A 4PJEB 4NGHH 1BX1A 4P5RA 3P4NA 2RCYA 4CEJA 1TZIA 4PS1A 5KOMC 1NVVR 1VSQA 4ZP1A 1IM9B 4IRSD 4GNKA 1JWUA 1QORA 3X1JA 3CPSA 2BSCA 2FN4A 2ALJA 4NJAL 5B30A 4ZCPA 4BWYA 4PTZA 3FROA 3LDBC 1VC2A 1S7WB 3KKMA 2PANA 4QJ3A 3QI7A 1GTSA 3AT8A 1HWWA 1RWBA 2XQIA 3MRNB 1DGQA 5PNTA 4H59A 4ZOEA 2BVQB 4C55A 3LQYA 3SOZA 2WTBA 1TL7C 3QXXA 4A2WA 4KSCA 1UBOS 1QDUA 4KK8C 3ZQUA 2XF8A 3JZAA 3GMQB 1E3XA 3QPXH 3ZDYE 3OD5A 2SEBA 1OZGA 3W90A 2W98A 4R97B 2PXYD 1WNFA 4ODHL 1KSHA 1K6QL 2VQ3A 2QD3A 3H11B 4CJ0A 3DFUA 2EGHA 3S2EA 1U8YA 1VHLA 1KK0A 4N5IX 1R3HB 4BX9A 5BN1A 3FSVA 4FFWC 4H0NA 1ID2A 1HLFA 5LHDA 5FADA 4GRAA 3HC0A 1DIHA 1CNEA 4N87A 2ZI9A 5E9NA 1X1DA 1XRSB 5D7JB 3ICEA 1S5HB 4GUPB 1P2SA 2C4VA 4XQCA 2B7BA 2DF3A 4GT0A 3LKQA 2IPMA 3WXMA 3MV8B 3P73B 3IXMA 1E1KA 3L3DB 4OZFH 3E0XA 2VUHB 1K5WA 3ZWBA 3LRSA 5GZOC 4I0KA 5ID1B 3E6HB 1NVEA 3PQ5A 2R2BB 1C3XA 2VOJA 1UBSB 1E2LA 5HKLA 1RRCA 3V1NA 1PGOA 1ZNYA 1BJKA 3DV2A 1JB9A 1P2CA 4FHGA 3I39X 3IJ8A 2RIRA 5JQ6H 3VXUA 4GECA 3S8YA 1PJ4A 2O54A 5DD6A 1KGSA 2XVKA 2JH9A 4ZYYA 3F9RA 3TO2B 4EN2A 4QOKA 2QUZA 5NLLA 4MFHA 2HWUA 1G7LB 1QE5A 1NQOA 4LJ8A 3QH4A 2IOHA 1PL8A 4BDVA 2WN2A 1TO6A 3LQFA 2V59A 3AF3A 6CHYA 3SKOA 5FOXA 1OSNA 4QRHA 2F5BL 1QABA 3BE6A 1MIMH 4MDFA 1VYHA 1UM5L 1HKHA 1EFKA 5ALBL 4DP7X 4CIBA 4JITA 2NIPA 4KIJA 3LZOA 4M4SA 2B3DA 2IG2H 4BX8A 4X41A 2LU7A 3IELA 3MFQA 2HKAA 2IHNA 5SWZA 3LDHA 1SB9A 1N6HA 4BO3A 1DE4A 3CQPA 5ITBH 1ZOXA 4QODA 4JY4A 5KBPA 1JPJA 2JI6A 3ZEIA 3I6GA 5FECB 4PJFA 1JD7A 1J39A 3CTMA 5K9KB 2IQ9L 2RE8A 3ETTA 5HMMA 4J6RH 2DU8A 2H59A 1C9SA 2IGFH 2WQXA 3Q8MA 2FH8A 1NAHA 3D4PA 1DQVA 3JYCA 1NDTA 4GBJA 1JHKH 2IGTA 4UTVA 1DI0A 3LXAA 4LCVA 3NHSA 5HZKA 4QXWA 4TQIA 3W5UA 3ONWA 2XW6A 4JDZA 2WYTA 3CZFB 2ODWA 3VUEA 3T04D 2NQ3A 4AUYA 2J5KA 2IP1A 2BJHA 1E5CA 4O2BA 3U17A 4X65B 3IAFA 4HI0E 3NTXA 5LQBL 3UW3A 3WMRA 3LO5A 1KP2A 1VRWA 4R3UC 3TNFA 4UVDA 5KDDA 3G2OA 4REOA 1XCLA 4KDCA 1WAMA 3OC5A 1E7SA 3VKGA 3I8OA 2J3QA 2DQKA 2V54A 4PB9H 4PV1C 3QKUA 4U7TB 2JCGA 1V9SA 4AJWA 3G04B 1JIJA 5F7XA 5BO5A 1X14A 1KG0A 3T1NA 2FQYA 1KB5L 3C7AA 4RWHA 3ZIUA 4U8HA 2ILLA 3NHRA 3OKNA 3M7FB 4CV3A 1SN0A 4KRPD 4WI8A 3C5VA 3MTJA 2P27A 4K7JA 4WTQA 2VJCA 4BFJA 2CHZA 4HD8A 4QD2E 3LH2L 5AJVB 4G1FA 3IDNA 3Q3JB 4EVQA 3CXHK 1B0PA 1ZISA 5KCZA 1OP9A 3UAXA 2HBZA 4ZCRA 2C57A 3LX4A 3JV4B 5JSUA 4S0SD 4IDHA 3IUSA 3RODA 1Q3KA 3AVXA 1FO0H 4M61A 2V2TA 2AMVA 1LD9A 1ZITA 3I01M 2EOAA 4CDNA 3ZHCA 3Q7TA 4XNQA 1MCOH 2DHDA 3HEBA 1N6PA 3D18B 3BUPA 1Z2DA 1MABB 1FNSL 2KBEA 2X3BA 3U7RA 3L05A 2J09A 1QRRA 3I04A 5JXEA 3T9FA 3QULB 3GNLA 3BIAX 2IXBA 4O2FB 3ZWVA 3IUYA 4MNQE 3GIZH 1YDPB 3QQNA 3BD6A 4TTPA 1NM9A 1QWHA 1T5WA 2JI4A 1EAOA 3H7BB 2Q28A 1BOYA 2J21A 1U42A 3SPIA 3PTAA 3BRSA 1D2GA 3UAJC 1FB5A 4IIZA 3T71A 1FFGA 4NYMQ 1ABEA 3RTCA 3ZWKA 3B1YA 4DIDA 4JZOB 3JD1A 3TA4D 2PUHA 1NVKA 1M1SA 3U1SL 3RAPR 4Y7CA 3TLGA 1TJXA 4P4SA 1G59A 5C37A 5A06A 1X5LA 5AD0A 1HZKA 2L0XA 3H4FA 5TJ9A 2WQZA 4D9IA 4TZTA 1ZJWA 2PKQP 3PCXA 3GSUB 4BWWA 2WSBA 1QH1B 5ALJA 1F6DA 5HUQA 1TQBB 3A1FA 1QONA 5A71A 2EKBA 2DIJA 4I85A 4LKCA 4IHKA 5T5NF 4EJFA 3DHJA 3NN8B 3B1FA 1CG9A 4DFHA 2VJYA 5TARA 5LMZA 1BLIA 1OXUA 2Q0HA 2OSYA 4Z7VA 1E28A 3KB2A 4Y2DC 2JHCA 4JRYB 5GGUB 1OIVA 2GXAA 4XPAH 4C1NA 1WXEA 2Y4OA 2EH8H 1EEUA 3RUEA 1UJ3C 4B84A 4NUJB 1RU9L 3D3QA 2VC2H 4ZYKB 2JCCA 2VXQH 3IJEB 1DANT 1QQDB 1PZAA 3BJ91 2FJUB 1T1YB 4C54A 1RUKL 1NSFA 1BJTA 4WSKA 4Z3TA 3FUTA 1Y3DE 5FDWA 1ZM2A 3TCKA 2ICEC 3SD5A 4B3TB 5DZJA 4FFVC 5FO9B 1LO3H 1GH7A 3GT0A 4PYGA 4Z78A 2FP4B 4H0FA 3WLBA 4XWTA 2EXYC 1CDJA 3IDMA 2VUSA 2BOCA 2IU6A 2CGYA 2ZYSA 5H8DA 4HEJA 1J1XH 3P3TA 2G4VA 3BB4A 5KS9A 4YUAA 4FFBB 3KHUA 3GNTA 3HE6D 1BKSB 4L74A 2G0LA 3DAHA 3ZCXA 2P9YA 4WJZA 5AUMB 1BMTA 2X6TA 3O4RA 1P9LA 1XGQA 2Q5HA 4GXTA 1QB8A 4PX5A 3INGA 2J9RA 1E6KA 2VBGA 4AW4A 1LSSA 4FMKA 4J6FA 2PWFA 3FI9A 1H0HA 3P8ZA 1H9DA 3DEZA 1LPSA 4IGKA 5GIRB 4JC5A 1WKBA 4U2FA 3ZKSD 5JR1H 3IEUA 3VKWA 4DYVA 2GM4A 1UK7A 2O5XL 5DEOA 1CD0A 1NXTA 5JOFA 2GUOB 1M71A 2I24N 4KDFA 4KK4A 5H9VA 3L2NA 3DVSX 2V0CA 4CWAA 5DYOA 4MOWA 3E2IA 3CWCA 1OSPL 4HSEA 2Y72A 2UZAA 1X9UA 5K9ZA 4YBZA 4ORZC 5C8JB 3UXHA 3H1EA 5BQ7B 2HNKA 4MUKA 1A1MA 1CE1L 1ZLSL 1RPJA 1ZINA 5AG8A 1UDBA 4OJFL 1YVPA 3H5VA 1OLSA 3F6RA 2YXFA 4P8QA 1TQWA 4LSWA 3GRRA 4TTGA 3W5SA 2QS9A 1OAOA 3FSGD 3FYHA 4L2IB 4FMCB 4TSAH 4J0HA 4ZT1A 3FB6A 3GFSA 4O1IA 2NAFA 3T99A 3EFOA 4I55B 2VXSH 2GN2A 4WVLA 3RI5K 4BLOA 1UD8A 3PE6A 4ACPA 3V9PA 4DZBA 3ONEA 3SJVB 3BAFA 3D6UA 4P5TC 3O21A 3Q8AA 3IBFA 1O0SA 3T9AA 4C4SA 3S8GB 2ARJQ 3D2UD 1W1UA 3BMOA 3QU2A 5CT8A 2VR8A 2YTZA 1M7DA 2JJ8A 4R90H 3A1VA 1BXZA 1V1JA 2FPPB 3D5EA 4R3WA 5K33A 1G4AE 2XJLA 2FOXA 1ZHBA 5JPMC 4E9TA 3OKEA 1PO7A 5I8ZA 1KFGA 1GVHA 1TVBB 5MP6H 2H51A 3DXXA 5C1DA 1MW9X 3DYOA 4OZ4B 3T5MA 3ASWA 1KHTA 5E1QA 4G4GA 3PNRB 2WGNB 4YK4B 3OLIA 3HM2A 3B38A 1F1GA 2GMWA 1P5ZB 5BOSB 5LIPA 3U6RA 1OAZL 2Y5QA 1WHSB 4GEIA 1M5UA 3HG1B 3D7MA 1NGXB 3L6FB 1WTLA 4NQSB 5D70L 2AMJA 4DVRH 1ZIYA 4B3EA 4TT8A 4BQBA 5JH7B 5KKCA 3N8DA 2OL3B 5IKMA 3NSJA 2VHWA 3D0AA 2FEJA 5JD6A 4XN1A 4HVAA 2J3LA 5IF0B 2AQTA 1G9HA 3NHAA 1D8TA 4XMZA 5C34B 5BZWA 4Y4FD 3OPVA 4E9YA 2GPBA 4RZCB 3N5CA 2PO6C 1FL3A 3KSRA 2PMWB 2AXHA 4PQYA 2ZKHL 3FF4A 5EPOA 2WUWE 3SB3A 5F2NA 4AXXA 2BKEA 4JG0L 3ENEA 4MNQD 1ZK5A 3DURB 3AZPA 2CXSA 1DBRA 4E4YA 1U0TA 2ZR0A 2C4WA 3GGJA 4XVTL 1YNSA 2YMXH 4MV4A 2OCFD 1HSAB 3N2LA 2GW5A 1WQ3A 4NABA 2ZKWA 1G8JA 3MNVB 1NJGA 3RC1A 5BZXA 1LV7A 2NTEA 3PEFA 1P7WA 3SHWA 4NCHA 4I1NB 2A5JA 2PMBA 3B6JA 3HB1A 5BSVA 4M4RA 3MV9E 6FABH 2JA1A 5T64A 1GFWA 2R0WH 1PKQE 3S2UA 3CVBA 4OGAC 5P8WA 5BUQA 4ZU1X 4ATNA 3OHMA 4QZVA 4OJYA 5BO1H 3QMPA 3SX0A 3QKIA 4B9AA 3GMOB 4DFIA 1L1FA 3OTHA 4EY8A 3G5LA 4F15B 3B2VL 4BEBA 4QC2A 3L3KA 3X14B 3UMMA 4FKMA 4Q3BA 5GGTH 3NPZB 3JQOB 4DC9A 4JM2F 4MQSB 2TECE 4L07A 2AYYA 1QVRA 2Y1LA 5I0WA 3SDAD 4FE4A 5FPKA 4HWZB 5C0EA 1IQUA 4CLOB 2NY1C 1DJLA 3L95A 1WPXA 5DZNA 3GG2A 4Y1TA 4ENVA 2BFBA 2AK4B 1X5KA 2I9LB 3N6YA 1OT5A 1ZN7A 3TX6A 1KFAL 5EC1B 3AHCA 3B1ZA 3DDWA 5FV2A 3I5MA 3AS3A 5EU5A 2EKJA 2X8WA 1X70A 1WZLA 3LY7A 4B6SA 1WCYA 1P9MA 4EI2A 5ALOA 5EZJA 2PRYA 5CB6A 5CCXA 2PRZA 1UWYA 4WKPA 4P9ML 3LP5A 4NCIA 4KX3A 3A9UA 5JAMA 3HPLA 3BWZA 3L93A 3FU7B 3BRGC 2GGSA 2E5WA 3GJEA 3L3GA 5I1DB 2WT4A 3FCSA 1Q8MA 4LGRB 2I07A 4HGKC 1PL3A 4M1KA 3TX4A 2YN5A 3X2QB 3MUOA 2EBHX 2WLSA 4C21A 3GJFA 4BMVA 4FTWA 5TQ2H 2XY4A 4KBGA 1NW7A 4DEUA 4L18A 2JFVA 1SMAA 4E5XA 5F73A 1P44A 3OZGA 3CUSA 2VLBA 3C6KA 4K7FB 3J81k 4OYLA 4CYMA 1DQSA 2O1AA 5IQMA 4XIFA 1NDHA 5I9IA 2FRDA 4NEQA 2F8VA 1DN0A 3LE8A 4J4HA 2P43B 2IBBA 4JWTA 2QVCA 2Y3IA 3WNDA 4NNYA 1NSNL 3ZE0B 3EOBA 1K98A 3Q5DA 4A0SA 3IKCA 1I7NA 1A6UH 4ZREA 1J2EA 1GDHA 4AXBA 1V8ZA 3NFPB 3GRBA 4JJEA 5LZ5A 5C5EA 3S1SA 2XHZA 4E68A 4UT9A 1A6WL 1HWYA 1T43A 1IL1B 3FK3A 3TBHA 4PI0A 3OM9A 1Y1RA 2QRGA 3K2EA 3KL4A 5TMEA 4D9FA 3DW3X 4ODTL 1PFYA 1TYBE 2DD8H 1N5IA 3D0LB 2WF5A 4GI2A 1WM1A 2PBFA 1QJCA 1KH1A 4AEHH 3VR3D 5BXQC 3PXJA 4F1ZA 5T8KA 3BL6A 3U48A 3DTXA 2EDDA 1K85A 2LD4A 1JXMA 5J4HA 5I7SA 1MDAA 2NY7L 1YDHA 2XVBA 1WF5A 2PXYA 3IAGC 3S37L 3QUXB 4JEGB 1KB9J 2QVBA 5H3LA 3K1AB 5CVTA 1SOQA 2DEXX 2V9PA 5CA0B 1G1MA 3MGKA 1ODSA 4XP6L 1UGKA 1CDUA 4KUCD 1AZVA 3AXIA 4H7PA 2VRCD 5CZXD 5KYXA 1VHWA 3EGIA 4B2YA 5EUOF 4ND8B 3TIDB 5HJDA 2NSYA 4L3OA 4ADSG 1VE7A 3OE5A 5LXTA 3TYGH 3V34A 1KVTA 3N5KA 2VJPA 1YZFA 3X1YA 1UD2A 2BJWA 3VZDA 3A32A 1GCUA 1Z28A 4UMEA 1G7IB 5FAXA 4KO5A 3K53A 1GPWB 1FGVH 5IQ7L 4FD0A 1P2BA 1RQGA 2I7CA 4IGBB 2CIIA 3S5LB 1H42A 4OLAA 3EJJX 2HPHA 4MJ6A 3PT5A 3GI9L 3BKMH 2X86A 3Q3EA 4BNLA 3CZEA 1GQSA 1PZHA 1FEZA 4DSUA 1ES0B 1QD0A 5B1BB 4NCXA 1G7HB 1HX0A 1Q7EA 2AEIT 4MLZA 2GYSA 1HH9A 5AVSB 2G3YA 3U7GA 4TQPA 4M37A 1S7TA 4ZIRA 3TSWA 4CKXA 1SXJA 1XXLA 4AT1A 3QJSB 3FRIA 1UADC 5IM5A 1VGVA 1NU8A 5EYPA 2E4FA 2VSXA 4K9MA 5AK4A 3NCEB 4RS4A 5FKAB 3KPPB 5I6OA 3TNNA 4QRIA 3GLFB 3MCLL 2E2WA 5IJKC 3AUAA 1PEKE 5JWRA 4JLMA 5C7YA 2P4EA 2K70A 4AQZA 5FO7A 4M0EA 3V1TC 3SZMA 2F1BA 2H2FA 4CAGA 1ZA6B 4AENB 5LNK6 3LY6A 1N0XH 3QZWG 3SYMA 4PHCA 3HDVA 4IKOA 4OJDH 5KTMA 4X8JA 3PE9A 2X4SB 1U2CA 1ZK9A 1K88A 4M1GH 4EY4A 3VRIB 4IIHA 2E6KA 1ZSVA 4DDWA 5B4VA 3QPKA 1AUOA 1Q17A 5F1NA 1A04A 1DFGA 1P7QD 2C0QA 3P30H 3PWTA 1BWPA 2QX9A 3WZLA 1NCOA 3C3PA 2GCEA 5B58C 3JAWB 4CEIA 2FJGA 5E9WA 3DPSA 4OXXA 3FKUS 4RDBA 2BXYA 3AAZB 1D6MA 2Z92A 4XKJA 1DTEA 5CLLA 3MUUA 3K2UH 1TJPB 1D1PA 1X38A 1E6CA 2P5EE 3OLWA 4J0KA 3S1AB 3IU4H 4DJDC 1PZ5A 3UHOA 3NK3A 1P0PA 1SM3H 4RIRB 3MV9D 2P3SA 1M5RA 1W4RA 3D4YA 4AYID 3RUDA 3GQBB 4WXPA 3U2SA 3SJBA 2WUFA 4WLFA 3GB7B 4EBBA 3RAJH 3RABA 5D51S 2Z5FA 4OCXH 4BMSA 5I2IB 4KTDH 1TITA 2FPSA 4WTOA 3PFGA 5J3JA 3QQ3B 3UTTA 1N5RA 3SR0A 4HS6A 1YVLA 3SOPA 3PS9A 1CJVC 4NP6A 2GH1A 4AK9A 2EXWC 2YS6A 2VTBB 4PVBA 3VD0A 1X7XA 3QR1A 1G98A 2EIZB 2PR4L 3HABA 2JJQA 5JW3L 3T34A 3O3NB 1ORRA 1FJ1B 2NY4D 2FIKB 5HF5A 2NSMA 1HT1E 5TNXA 1H0DA 3BRWD 4F9FA 3ZU5A 4G0VA 3SGDI 1M3JA 3ZXSA 1PFQA 3IFOA 3ESUF 3NRCA 4QUBA 4UHHA 1ASPA 2NU6B 1ZOIA 2KKQA 2PPEA 1QUPA 4N0EA 5FP0A 5JY1A 4H8HA 3TD6A 2ATIA 3VWKC 1Y1UA 1JZDC 3LBNA 4TQGA 1KTKE 3DOJA 1JGDB 3W9YA 1P74A 1XF5B 1V37A 4GUAA 1EAPB 5E8RA 3JWEA 2VL5B 2EAUA 3WK7A 4PJIA 5DQJA 4ALKA 5CF3A 4V1CI 4LHQB 1JXQA 4DWVA 2L3BA 3KNBB 2OC9A 3BBPA 3KXPA 1V05A 3BSZH 1DJGA 5HD8D 4NMLA 4ZYLA 1D2NA 3SGKA 5JW4R 4YIQB 4M6ML 4C7OB 4YR6B 1G7MA 5JAZA 4AW7A 2CKBB 3CFTA 4PS4H 5T1JA 1J20A 4OF8A 4MXVF 4H8WH 1U2YA 1O0CA 3DMDA 5KJRL 3VDCA 4A92A 1L1RA 1EP2B 3F7NA 3QHZH 2YASA 1ESNA 2ASEA 5C08A 2H00A 3H1BA 2WM0A 5JYMA 4R7DB 2REOA 3V4PA 1PFKA 4MA7L 4I4TA 1TYRA 1CG6A 3K1YA 5FUZL 3M1LA 4FE9A 4MS8D 3L54A 3UMJA 3W8FA 1OZ0A 2R1YB 1AOHA 1SUDA 4WN3A 2VDLB 6GPBA 2BHFA 3GW8A 5HI5C 2K87A 2XBMA 2OAGA 2AJVH 2ZJAA 3LYLA 4YT4A 4RTQA 4M4PA 4K9OA 3BSHA 4OV6B 3RYTC 1F4LA 1TUGA 3T0EC 4KAQH 2APFA 4PRNB 2FJ0A 3Q6NA 3UQYS 4J0DA 1T26A 2XLBA 5K0JA 4ALJA 1NDUA 1E42A 1XZNA 4DA7A 5CXQA 5U4XA 3QDHA 2B4CH 4AO7A 4TMZA 1AHPA 4QNPF 3REVB 3S8WA 2BSSB 2P9BA 1JWBB 1V96A 4YZFF 4PJXA 1T2QH 4I77L 1WV7T 3T3EA 4YMIA 2PCPA 5DD0H 3SO3C 2YPLE 3HCEA 3U09A 4BGUA 5ADUS 2ZJ6A 3DWGA 3LXBA 4LJSA 4NZOA 2VXCA 5A04A 3TG8A 2WZDA 3D1VA 2I27N 1V5JA 4HDMB 3JASB 1JLLB 4JWKA 2VWPA 4L08A 4M1DL 4DA8A 3BH7A 5D8DA 2YPVH 3FHQA 1Q74A 2CMDA 3H3PH 4FFYL 2AQIA 1T21A 1I2DA 4BHTA 4D3CH 1TETL 1NFDA 3UTSA 3DEYX 4WH0A 3O4LB 3DGGA 4LOLA 2WINB 4QELA 3JBG7 2B1JA 3CEHA 3K6SA 3EYWA 1ASQA 4CMIA 3NABH 4N0RA 3BQUA 1IHDA 2ZSDA 1AANA 5H80A 3IE2A 1ZV5A 5JNUA 1N2GA 1QZ3A 3KXDA 1BGWA 4I5DA 2VBFA 4ARVA 1BVOA 1J7KA 4QM6A 3TTVA 1WZ1L 4U3SB 2YEVB 3GN2A 3EDRA 4R7LA 4GG1A 3LRLA 1XCWA 4DQ0A 4W1QA 1EBFA 4PUBL 4JSRA 1FX0B 4R96A 3NZ8A 4PJDF 4MVJE 1ECCA 2EADA 1XGKA 2NP7A 1DRVA 4WSJA 4CA4A 3TFKD 4YQXL 1YBVA 1PT8A 2VL7A 5DRXB 2B36A 4J4PD 4PY7A 1PRYA 2HUHA 2BTQB 5MEOA 3ECAA 3OO1A 3GRWH 2GN9A 3UPCA 4XDGA 4XPFH 4XN5A 4O2AA 5IV2A 5K9OB 2H4FA 4MRBA 2PZKA 4MD0A 2YV4A 4XCFL 5L7WA 4FLQA 4KFZC 3OX4A 3QG6A 2QP4A 1CDGA 3VUAA 3VOAA 3DYPA 4ARZA 1QTYT 1TAHA 1EBAA 3WTVA 4IMKA 3QDMB 5F7BA 1BFOB 3GEHA 5CDTA 4RK6A 1ZKAA 4WEBH 1FZMB 2NY5C 4Y5VA 4II7A 4TPKA 3W7VA 3CX5J 2X4OB 4IHBA 4P3YA 2NU9B 3TD2A 4AJYV 2C83A 2VNIA 1MZYA 4JT2A 1NCBH 4MLDA 3EIEA 4GXQA 4H8VA 1YEKL 2DWYA 4ZCTA 3ZY6A 3LPLA 1K75A 2Q5BA 1IC4L 3PFKA 2P5ED 4IZ6A 3WNBA 3LCVB 1TLKA 5JHDB 3SCMD 3AIIA 1EGHA 1XQ9A 3PNMA 1EGMB 1NFIB 2D13A 2E8ZA 2A35A 3MRLA 3O2SB 1Z36A 1ORWA 1DFXA 1JBKA 3IXLA 4EG6A 2WTEA 5C7OO 2QADB 4RISH 2XU9A 5LUMA 4GUDA 3U0WH 2ZSEA 2WTUA 3IETB 5A3SA 1XPRA 1HZZA 4QAWA 1MP0A 1L7TL 4ZRGA 3FGPA 3NFNB 5JWOA 5B57C 4AT6B 3ELBA 5C0IB 3FCTA 1U2PA 5D8JH 5I28A 4BNFA 4OKIA 4EQ6A 2DQHH 3DZGA 5GS0L 3D05A 3WKMH 3P27A 1MZVA 1G1YA 3UPRB 4OQTL 4UATA 3C3XA 4OUDA 1A6TB 4HJGB 1WU8A 4Q2ZB 4WXHA 1SDDB 1XV8A 3NJVA 3MGOB 1VXOA 3C60C 5FOUA 5IP5A 5T1KB 1GGBH 2BEKA 2JNZA 4UOEA 4ACAA 1IT9H 5DDHB 3CMOL 3EJTA 1U3GA 2HMVA 5AHRA 2A57A 2NTNA 1RKXA 5H4YA 3H4HA 3VPGA 4A7GA 5AWFC 4NUGL 3QDGE 8ADHA 3QIBD 4FJZA 1FNEA 3JZDA 5ANRB 4TKMA 1VLLA 4YWGL 3FTEA 3I6LE 5K45A 1UURA 5DFTA 2DQMA 1NPNA 1L7DA 3DPIA 5IF3A 4ZVQA 1UP4A 2G5BB 5KNCA 4IQ8A 4WFFE 5H37G 1CUOA 5JQGB 4EUEA 3IWUA 1U2DC 4FQHB 2JL1A 1COWD 1XNGA 2F7QA 4Y4FA 1GZUA 4LL1A 2POQX 1EWRA 3D4LA 3BZFA 3SR3A 1HDMA 2FWUA 4RTJA 1ZUIA 4DKTA 3I28A 2IPKA 4Y4KD 5AKHA 1DV2A 4L0CA 2AWNA 3O11A 2OXFA 2CCKA 4UW9A 4MNQA 3UBTA 4W9MC 3ITKA 5EO9B 5CN3A 3X44A 3ADCA 1R4NA 1S2OA 4I1VA 2A4CA 3LQMA 3U4BL 1HFKA 4PV8A 5F88B 2PMCA 4MUAA 2H3EA 1B6TA 4PZUA 3RWDA 2A3NA 1W72H 4WSOA 4KPHH 1JH8A 4X8HA 4Y8VA 1UBUS 1MXDA 1SXBA 2BI4A 3OJWA 4KKAC 1GW6A 1XAKA 3X1BA 1YMMB 5F1IB 3IPAA 1QF9A 3IILA 1YJXA 1OF2B 1T0PB 3JQDA 3W0WB 5I1AA 1F3JA 4Z86A 3GJXC 4BH8B 2C59A 4I48B 2K6WA 4JB8A 2Y36L 2MPAL 1I6KA 3AREB 3DX6A 2F15A 5HGBB 4FHDA 4OGLA 1QYIA 1A6VH 3B4NA 4UDTA 5DNEA 3MJGX 2ROYA 1ZD9A 3JZ7A 5CBEB 1WCXA 3CFJA 1T6BX 1Q1EA 2NZWA 5AW1B 3U82B 3A4NA 3O8XB 3F2VA 3L06A 3MOGA 1LQBC 1CFTB 3T9CA 2IAMB 2YPLD 3AWGA 1ADWA 5EPEA 3ZSTA 2OZKA 3UT6A 1DQML 4Z1PA 3CDFA 4TOYH 3RSCA 3KPSD 5I6DA 3N44F 4JOQA 1FF5A 4ZYVA 3I62A 2HZ7A 3ER8A 4FYMA 3HSYA 2IOQA 3IODA 1UKTA 3J81A 2GN1A 4XQ9A 2WXHA 2H92A 4LG1A 3P0EA 5ESAA 5C4GB 2CMRL 2VH5L 4BMXA 3E9EA 3OECA 4AZVA 5AVYA 4GXFA 2PXHA 2X2PA 2B78A 1AG9A 3LZCA 1IEBA 3ZDXB 2VSDA 3HMXL 4OD1L 4RTNA 3LS5L 4OD3H 4M0CA 3CD4A 2ZJ0A 2IHTA 2PPVA 1FA9A 3HPRA 5DM60 2Q6TA 1CFVL 3MODL 2O3TA 3GNML 1P4UA 2PTTB 4HYTB 3L7BA 2ZZNA 1GGMA 4DQXA 1FDVA 3DMTA 3T4UA 5GTDA 3VXUE 2C54A 1GKYA 5ICXB 3BXHA 5AVZA 3DT6A 4TWJA 1AG0A 4DPCX 3L8CA 1X1CA 3AF6A 1I8IA 5D72H 3BHBB 5ID0B 5FO1A 3LUHA 1CIVA 1RIHL 5GM2A 1V54B 4C5CA 3RUGB 2G1AA 4PR5A 3NPAA 3HZZA 3RWFA 2M1ZA 2OAP1 4O4HA 3TL3A 3F9CA 3ZUCA 4FXGA 2V8LA 4KQ2A 4H08A 1VMIA 4AB1A 4CMMB 2E9BA 5C0NC 2AKAB 1Z7BA 4EPXA 1NAMH 4N1HB 4MJXA 2UU9B 1P9OA 5CINH 5I1EH 3DM5A 4GAGL 4JPVL 2IYEA 3MRFB 3OZCA 4ZYXA 3S34L 3C7CB 3BH8A 4Q82A 3WWZA 2PS3A 5D6DC 4P2OD 3OP1A 5ICGA 2H8PA 3TT3L 4I4WB 5AL0A 3KJHA 3MVEA 4FKHA 1RZKC 4FMDF 1YG9A 5AWNL 2JC3A 2ADGA 2KHAA 5B1DA 2V58A 2WSYB 5IVDA 1YNTB 4FFZA 5BPFA 5JRZA 5B2ZA 3KZNA 1MXFA 3PA8A 3VH3A 2EDLA 4D9HA 4NOJA 3IC5A 1SD1A 3FY4A 1VLQA 1UM9A 1AGEB 1M8PA 4PJFE 4W5WA 1ZH0A 2ZR7A 2P3OA 1XQ4A 3R40A 1M1NA 3VU8A 2R6CA 5GRYA 5BSHA 4AC2A 3PDCA 3EHBD 2SODB 2NQTA 2R66A 1VI5A 2WJ3A 1S9YA 1AMXA 4JMPA 3VTTA 3FH7A 3OZIA 3K9LA 2F64A 3G08A 4I6JA 4RXUA 1RJDA 2ZXWB 1BZYA 3SC2A 5EVJA 2Z9TA 1V27A 4OZFG 5ERWB 1IUPA 2PMKA 1T66D 2Z34A 5KVGE 1YQGA 2QBYB 4K3JL 5ETUA 1UK8A 1HZHH 3JWDH 1KBBA 2ZBUA 3H5OA 1F06A 5HRCA 5CA1A 1J1IA 3CEJA 2PX5A 3L6CA 1ECLA 2NU7A 3RIMA 5CFHA 5TGBB 3CLUD 3M6FA 5HILA 1C3LA 1BM3L 3QDGD 1HE8B 4BQEA 3A3YB 2RD0A 1ENOA 3F96A 4G36A 1GQRA 1BBJA 3AW5A 2QMHA 3G59A 3I6LD 4XYGA 1KPUA 4GG6A 2WTNA 2QG6A 5D7SH 3DX9A 2MSEB 1P53A 4WFFD 2A73A 2AX3A 3H16A 6REQA 5ADOL 4D56A 4GICA 4AJ1A 1JF1A 4FFRA 1ICEA 4QRRA 3E9QA 4M1ZA 3GBEA 2G4CA 3O94A 1KEEA 3VNYA 5FCSH 5CLIA 2O8EB 2D2OA 4NJ9H 4Y6PA 1Q84A 4H3KB 4ZZKA 4DZZA 1FG2A 4LOEA 4OHPA 3ESPA 5MI0C 3B3IA 1GZHC 1UDXA 4LDJA 4K2HA 5A0VA 3EBPA 5F1OB 1RR6A 4JIMA 2RIPA 1RHRA 5EQDA 4EO9A 4XMKH 3V0IA 2VTEA 1XQ1A 1VIDA 3WLWC 1VFAB 3HBGA 5F76A 4GGPA 2XN2A 3VKUA 2FFBA 2IU0A 2ICWA 1U3ZA 3MV9A 1PG7H 3NH7L 1KENH 1HVXA 2OR3A 2C00A 2BP8A 4IOLA 1PKQA 3NEEA 4B4KA 5C4MA 3OM8A 5A9RA 4O25A 4O0LA 4G6FB 3LGAA 2V7HA 3VI3A 4ZGGA 3F65A 3QSGA 1CBUA 3SX2A 3KVVA 1JW9B 4K4KA 3KEOA 3AL0C 4RPJA 4F5CE 2Q3JA 3SPVB 1YFZA 3M7OA 1T1EA 4MKMA 1U8NA 1CUJA 3IXQA 1U7UA 3V48A 2JCXA 2IDSA 4ETNA 2PU5A 4XPZA 4DEPC 4TKVA 2K1MA 3L8HA 4R51A 4BRUA 4N18A 5J1TC 4WBNB 1OARL 3QEJA 1ZVQA 4UTXA 1E2VA 3TLZA 4EG7A 3BRWA 2Z2IA 2V3VA 5JHLH 4YP5A 3SM9A 4Z7VE 5FA6A 5MEPB 2Q1EA 5JG7A 3UA3A 4F46A 3LZFH 1W1WA 2XPGB 1A9PA 4DN3H 1T6ZA 4RJTA 1LXCA 1QH8B 5T1MB 3PNOA 4ZVMA 1X9IA 3RB7A 3ILPA 3PI6A 1TEGA 3BKYL 3BE5A 5L3ZA 2W65B 3BPNB 2VIIA 3FULA 4IJ3B 3NHWA 3NGLA 4HJJH 1MREL 1SUSA 2DAVA 3DGCR 3U2IA 1N68A 4TUOB 2KDGA 1XWVA 3HRPA 4IU2B 3AWEA 3NJJA 5IFHL 5E6ID 3WHXA 1SJEA 3WKQA 1R16A 2JEZA 3GNSA 3QLEA 3AI1A 3JTTB 3AHFA 3BCHA 9LDBA 2IH8A 2JLBA 4B0MB 3LHDA 3SZOA 5KZMB 1I2CA 4LDQA 1AD9B 2LIVA 2HA4A 4K9PA 4U5QA 4NXNB 1MCKA 5CFAA 4HWGA 1RRPA 5K6AC 3VXUD 1UMDA 3T2OA 1DQQB 2NXZC 4KIWA 5CHEA 3II2A 3BWYA 4QOKD 3UG6A 3G6AA 4F4JA 1UBGA 1U21A 5C09E 3IP8A 3APMA 3OLZA 2VJAA 4II2A 4DTCA 4G6KH 4PJ8C 1ZOPA 2B1QA 2W70A 5AW4B 1M53A 1YJDC 1RJWA 2YZ7A 4P3KA 3KD4A 2VCHA 1FIGH 2D7QA 3E8UH 2JIPA 3ESZA 1BFTA 3W9SA 2H0PA 1OYWA 4J4TA 2QTBA 4NMHA 4LP8A 5WRFA 2Y06H 2HPAA 5ALDA 5DD3L 3PL6B 3CV5A 4OHZA 2RAUA 5EWLB 5DLDA 2ICWI 3DQPA 2VNCA 5BV7A 3NSFA 5F0JB 1QFOA 1J5OH 4MUGA 2C3OA 4FTVE 2HK8A 4HV4A 3I42A 3PXUA 1CULC 3BMWA 5EZOH 1GG5A 1UCFA 1VEPA 4CT0A 1QHFA 1XLTA 2WV7A 3P1VA 3VPBA 3O3DB 4ZFOA 1TOXA 1LO4H 4BRJA 2NWQA 3ROMA 2PLAA 1VE1A 4WFGE 4C05A 3AU1B 3QW4B 4CF6A 2XZAL 3T1YB 1F4YL 4K8RH 1NCGA 2DH3A 4FQQA 2NVBA 3ZVVA 4LF3A 5DCYA 2HHJA 5F1KA 4E70A 4AYDC 3SF8A 2EL9A 5TDPB 1MAWA 1K8XB 1A3CA 4AULA 2Z6VA 2XBZA 1WEJH 4Y2QA 3M34A 5IAAA 1OQAA 1EX6A 2DWDB 4A23A 3NGBB 1ZIPA 3UC0H 5GGSY 1K5DA 4OGQC 4LHVA 2QELA 2R1ZA 4MUIA 5L7XL 1QNLA 3VX1A 1MT0A 4FOTA 3PXAA 3X12B 4RFSB 1OJLA 4G07A 5IK2A 3PHAA 3ESVF 3V8MA 3HKDB 5BSFA 3KVQA 4R7TA 3BEWB 3PJNA 3OM1A 2IHUA 4H6PA 4MUEA 3A4EA 3QRWA 1GOFA 4XI5C 3R09A 9LDTA 4OXYA 4NC9A 3K16A 1LP9F 5IB3A 1BCRA 4IIVA 3O6FB 5IVXF 4MA1B 4G5XA 1N2IA 3AIKA 3WLMA 3ZKMC 4PC1A 3SC4A 4F9PA 4J4PA 2P3YA 1O7DE 3N06B 4GBMA 2WW8A 3ZDDA 3WNKA 4L1TA 3K2IA 5CM9C 4OBWA 4Y30A 4ZW8A 3VO0A 4NBRA 1FFXA 2HKIA 2WHRA 4X2UA 4MPTA 3EGWA 4COKA 3OMXA 4EZKA 2XMQA 5DLMH 4OBRA 3IFLH 4BZZA 4ZFNA 4EF4A 3CFIC 2JKXA 4PJAA 4QJBA 3ZHYA 4MQMA 1WA0X 4R5HA 1O9HA 2E56A 3M9XA 4NESA 3EDYA 1H3EA 1UINA 3HACA 2CVPA 3ACDA 1DUIA 1EEQA 5KG9B 4GPZA 1I0IA 5DNAA 2MHAA 1P4IL 5ILQA 3ZE2B 1NF8A 3SY0A 3Q12A 5CP8A 1DANU