3NIGB

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 127
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nigB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nigB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nigB03
3FCSA 3ZDYB 4F1KA 3EGXB 2I6QA 3OL2B 3K71A 1MQAA 2WINI 1U8CA 3RAGA 1DZIA 1MF7A 1M2VA 4HQKA 3Q3GE 1MQ8B 4F1JA 1JV2A 1V7PC 1JEQA 4G1EB 5KYUB 1M1XA 3K6SB 1AOXA 4MMXA 3EG9A 3IBSA 4BJ3A 2NUPB 4O02A 3VI3B 1OLZA 1FNSA 3BQNB 5KYXA 3AL8A 1DGQA 5E6SB 5KYWA 1IDOA 5HDBB 2O7NA 1UEXC 1QC5B 4IGIA 2VDQB 4G1MA 1N9ZA 3OKWA 2VDOB 3EGDA 1L5GB 5E6RB 1SHYB 1QCYA 4MMZA 3PPXA 1PD1A 4WK4B 3EH2A 5E6UA 1JEYA 1ZOOA 2I91A 1IDN1 2B2XA 1Q0PA 4M76B 2VDPB 4FWWA 4CN8A 4IHKA 4NENA 3ZE0B 1XDGA 2ADFA 3EFOB 3M6FA 1SHTX 3PPVA 2ODQA 1XUOA 4UM9B 4WFQA 4MMYA 1T6BY 1RRKA 1IJBA 3BQMB 4HQLA 3E2MA 2I6SA 4JDUA 3IJEA 1YUKA 2VDRB 4FX5A 1PT6A 1U0NA 2QTVA 3EGXA 3K71B 3ZDZB 1U8CB 3NIGB 1FE8A 3EOAI 3PPWA 1M2VB 3TVYA 5KYYB 1U0OC 2NUTA 1JV2B 1NA5A 1MJNA 2IUEA 3HXOA 1JEQB 2XWJI 2XWBF 4HQNA 3T3MB 4UM9D 1M1XB 1TYEB 1ZONA 3EH1A 4UM8B 5HJ2A 1AO3A 4MMXB 4G1EA 3EG9B 3K72B 2ICAA 4O02B 5KYXB 1OAKA 4CNBA 4WK2B 4WK0B 3AL8B 5HGJA 4A0QA 1SHUX 2XGGA 2WW8A 1M1UA 3ZE2B 4G1MB 3AL9A 4C2BA 1PCXA 1XDDA 3EGDB 1SQ0A 3OKYB 2M32A 1BHO1 2VDLB 3FCSB 3EOBI 5E6UB 1JLMA 1JEYB 1RS0A 1MHPA 1LFAA 2X5NA 3ZDXB 1AUQA 4Z7OB 2NVOA 4NENB 4DMUB 3HXQA 3OL2A 3EFOA 3V4VB 2VDNB 3HI6A 3TXAA 1N3YA 2VC2B 3NIFB 2VDKB 4Z7QB 4O3TB 4WJKB 1YVRA 2ODPA 4HQFA 4HQOA 3IJEB 3QA3E 3PPYA 4IXDA 5KYUA 3NVQA 3K6SA 4JX0A 3N2NA 5BV8A 3FCUB 5ES4B 2P28A 1ATZA 2NUPA 2NUTB 5KYWB 1IJKA 5KYYA 3GXBA 1CK4A 1CQPA 5E6SA 3TCXB 5LN1A 1YVPA 4CN9A 1ZOPA 1RD4A 1PD0A 1QC5A 3TW0A 1BHQ1 4Z7NB 3K72A 4MMZB 1L5GA 4K3JB 4O3UB 5E6RA 3ZE1B 2VDMB 1MQ9A 3BN3A 4XW2A 3ZQKA 3NIDB 4NEHB 2UZYB 3F74A 1M10A 4C2AA 5KYNA 3V4PB 4C29A 3T3PB 3VI4B 3AFCA 2P26A 3F78A 1RTKA 1SSLA 4MMYB 1M2OA 1T0PA 4PN7A 4GZ8A
chains in the Genus database with same CATH superfamily
4ZYWA 1PW5A 1JECA 4LOEA 3CRRA 4MB5A 4HX1B 1K63A 3RTQD 3ANSA 1T9DA 1VB3A 5HVHC 1S4QA 2WSSA 1M42A 4H1LH 3T4AA 5B1KA 2OM5A 4OHKA 2KHAA 1S7XA 1CYDA 1INDL 1WVGA 2Y1WA 1YAJA 4RIGA 3IJ8A 5IQ7H 1GV1A 2Q0HA 3IQDB 4GI2A 2ZITA 3K4AA 1S78C 2KWIA 4MKHA 4UHJA 3GGOA 3NWEA 3VDRA 2FYTA 2EP5A 5CBKA 5H3LA 4JANB 3KZXA 1G63A 2PZAA 5E5RB 4XM2A 4AW4A 3DV4B 3I73A 4MJLA 3FVTA 3KYNB 2WTRA 3N05A 2P9ZA 1QHOA 4L1HA 2HLFD 5JIPA 4RKFA 5HEKA 4M22A 4F4UA 3RVMA 3O9VA 4H20L 1YNTB 1G55A 4FHEA 3BMCA 3DKRA 3DFKA 5L6LB 1NL3A 3IMWA 5B64A 5IMSA 1OXVA 1UURA 3AJEA 1WAPA 3GJ0A 1CBJA 1ZD4A 2O4CA 4ZCLA 1F12A 4O0MA 2H7CA 2R29L 3GMMA 2VK4A 3VYWA 2A0YA 2C3XA 1RKVA 3A6PC 2VPYA 3IBCA 4LF7B 1QUPA 4Q6IB 3L16A 3QXSA 4KXAA 2CXUA 1GGNA 5LU9A 1WEKA 4F7TB 2F7QA 5F97E 2YD2A 4NCJA 3T99A 4RCAA 1FU8A 4EVIA 5PNTA 4A0FA 1RMTA 4FQPA 3U79A 4OA8A 3C5HA 2DMGA 1PZXA 2B35A 3OKYA 1XA4A 4WWHA 4BH7B 1J2JA 4W6WB 3L7KA 3UBXI 3RTGA 3HBPA 5LDGA 4BUJA 3KZ1E 1D1SA 1O7JA 4PPTA 2ZZUT 2BPOA 2A4CA 3LXBA 1J2RA 4Q1BA 1WFJA 4RPHA 3EG9A 4NNXB 3CFKB 1MPTA 2RAMA 2D0IA 1SUJA 1TCBA 3HLYA 5HP5A 5LQSA 1OARL 4K3HA 1BEYH 3RC1A 4OTXH 3L4KA 2Z2YA 1BXXA 4JEUA 3L48A 1S3FA 1KDOA 1KC5H 1LD9B 4MWBA 3PEEA 1L3CA 3TPZA 3SYMA 1WHPA 5BN4B 5T5QA 3OE5A 3VYRB 2J3IA 5GGRA 5ADWA 2HA0A 4PZAA 4RAVA 5IMMB 5KBDA 1NA5A 3X17A 2DEWX 3NG5A 2QL9A 1XPJA 4G9GA 1RVFL 2HLDA 3S1AB 3WNMA 2QQ0A 1ZE3H 1WMBA 3NAMA 4YECA 1KDZA 4KTVE 4QRSA 2A88A 2XNDD 4FG6D 2C2OA 5LNGA 1LILA 5BSMA 2PT7A 2YMTA 5FULA 1CUEA 2D7NA 3D39B 5CA1B 4DGUA 2JB9A 1V3TA 3DV6B 4ANFA 4W7IA 2IW3A 2B5WA 2FGWH 5DHVB 3K6OA 1NR1A 2HRRA 1QRNA 2PA3A 4MAZA 4TUUA 2APFA 1SKQA 1WD7A 5CDYA 1ZLDA 3QZLA 5C0IB 5D5ME 4RWZA 1N32B 2GB4A 2OCIA 5CK4A 3C5JB 4PJAF 2BSED 3VJ6B 4RGNC 2BVQA 1MV8A 2CNWA 3NIDF 5HVGB 1S3SA 4QTUB 3TKYA 4AVYA 4ODTL 4PSRA 4LLAA 2LR0A 4NRDA 4AH2B 5IW6B 4J3OH 1JWAB 4CNQA 3C5XA 4G0VA 4TXLA 2B1IA 1U7ZA 1V8ZA 5J12C 5BVPL 4QJIA 1N6KA 5CW1A 4MCJA 4MMXA 3GF4A 4OLAA 3GBML 3LC1O 4NRXB 1J1IA 1S9VA 3BD6A 5CTAA 3IMGA 5L3ZA 4R0LC 1MIOA 3I5UA 3PTAA 3ZTDC 3N76A 1Z12A 2EKBA 2UVDA 2A0UA 1UWEL 3H6AA 3LKVA 2H2WA 4TZTA 1YJDC 3JWHA 2OYLA 3K81A 2RGYA 4PCAA 1E5XA 3I9KA 4X4ZA 2I55A 4E5SA 3ZZUA 4CMIA 4HEA6 4MHSA 5FNVA 4TYPA 1EVJA 2WYWA 5A2KH 5JHDB 4N90D 3D7RA 2ZAHA 1TEZA 3ILQC 2CDGA 1OXUA 3IQXA 4X4XB 4KKVA 4DREA 5GVRA 5KYTA 4JN1H 4JQOA 3JYNA 1B8VA 2PMFA 4YRIA 4Q4EA 4CC1A 1Y4ZA 3DOCA 2C4MA 4PGEB 5BRNA 3PJSB 4BE7B 3MPCA 3ODPA 5JIIA 3MU3A 3FWNA 2AFIA 4O0LA 4B5KA 1JRHI 3VVCA 2V7QD 3CZNA 5IDYA 1OWNA 4HKXB 1JH8A 1P3DA 4D3CH 3K9BA 1AN9A 3HEIB 4F57L 4G0XA 2GSIB 3ZE1E 5IHUL 5TJHA 2CNNA 4O5OA 3ZWPA 5JTWA 4JZJC 2G9HB 1ONQA 1ZLXA 2ROXA 3B3JA 2VXBA 1EA9C 3EB9A 4PPQA 1ZJ5A 1C1XB 1ZV5A 1JTPA 2RGCA 4MGIR 4ZJUA 4UNIA 1ID8A 2E27L 5FLXA 1RYDA 2N47A 4PAWA 2AH5A 1RL1A 2A0KA 1OWLA 5AHOA 5K39A 1Y6RA 1A8ZA 1K8IA 3O47A 3LQFA 1CUAA 3Q4GA 1G8GA 3EZJB 1M6UA 3FQWB 3IBFA 4RD0A 4WCYH 4G09A 3QEMA 1A95A 1TZOA 1SCNE 3GLHB 2BZ1A 2P8LA 1NVFA 2ZI4A 2DQIL 1W25A 3Q12A 5LN4A 4RC9A 4WNQB 3MT8A 4WN9B 2OA0A 4P5SA 1CUGA 3HBFA 3ZGOA 2VJ8A 1UWGL 1YCHA 1XK7A 3PC4A 1H2BA 2FT6A 4N68A 2VP9A 2X2IA 3GGPA 5DI3A 1OTUC 4JM4H 2UVPB 2OR7A 4F3NA 3EW9A 3TB6A 5F1PA 1C8VB 4Y19D 5SZJA 4F56A 2ZU0C 3G88A 1F56A 5D7IB 3C6MA 3V8RA 5HYIA 4WZ9A 3WSVA 1R3JB 4E5UA 4RW0A 3HVIA 2F6RA 1LEHA 1OB1B 3IQWA 1CY8A 2EGUA 1PN3A 1EFUA 2MCPH 4Y16D 4HV8B 3JQBA 3LIPA 1F8YA 5ENDA 1GYAA 3BWSA 4DW8A 5F3BA 3R5TA 4C4PA 1GJUA 3DI2B 3TJEL 4TMVA 3MRNB 4KI1A 4ZVPA 3DG9A 3RRXA 3OQOA 4UUJA 4X9GA 4G85A 2GXAA 2Q86B 2ZSBA 1RZRD 3ZU5A 3ZIAD 4QRPA 2J6HA 3CR8A 3D8RA 1Y6JA 1JN6B 2C5SA 3D7NA 3LUKA 4S2UA 5C0DA 5GQSA 4IP0A 4QVKA 1IHPA 3OESA 3C3AA 3VHXB 3BFXA 3HLKA 2I60L 3Q3EA 3WXVL 1U8HA 2Z2IA 3P1JA 2VWHA 5H70A 4HGWA 1B4JL 4BGUA 5B3AA 1RLUA 5JY6A 3NSDA 2WM2A 3K6NA 3X13B 4U02A 4Y4KC 2AZDA 4QPEA 4JAMA 4G6JH 2QK4A 3QEBZ 5D2LF 2V5YA 2XWJI 5F7DB 2BVYA 3F8WA 4DIDA 4LZPA 1ZPUA 2PMZA 1NA8A 2NY2B 1U8MA 4HDIA 3FI0A 4LMRA 4HMEA 4C30A 5BW4A 2VC2L 2FHSA 3OE7A 4DC1A 1XGPB 2HJLA 4F20A 2NVOA 4ZI8A 2GXSA 5BVHB 3QZBA 5IBPA 2WXPA 4PR5B 3FT3B 3LHIA 1AKYA 5F21A 2ERYA 1T43A 3TAHA 4J7UA 4YMUA 5IANA 5D5MF 3HJUA 2QTHA 3CN7A 5FTLA 4HIQA 1AC6A 1WRFA 1MFBL 1KRWA 4HJEA 4B9FA 2ZM5A 3ZWDA 5AI0A 1EHLH 4HPYH 3GS4A 2HLNA 4EYOA 1VG0B 1YIDA 2QN2A 3VXOA 1PL7A 2CIIB 1E65A 1J05A 3H6HA 3QZOA 1ISFA 1NM4A 3VSUA 3WY3A 1L7PA 2QLTA 3TZEA 3HG0A 3ARPA 4NP6A 5ERYA 3RSHA 1ID2A 4MBRA 3ZL4H 3ULUC 3QQ3B 3EW7A 4LDJA 4S1SH 3KZ8A 3N2ZB 3EDCA 1MCPL 1ZZGA 3CN4A 3WNDA 3WL9A 3QFJA 3W90A 3ZV5A 2ES4A 2WE7A 4L0CA 1JQ3A 5FYJU 3V79C 5TE6L 4PHZA 4DZZA 1JXFA 5DXFA 3M6DA 3O38A 4O2AB 4K9QA 5THQA 5H16A 2XQ0A 3HQ4O 4C4KO 1FFSA 4FDMA 3OQPA 2DH3A 2LUOA 4LDCA 1EHXA 4GRAA 1S2MA 4UNPA 2KZBA 1O6BA 4PO1A 4COOA 3NEAA 1A4RA 2G60L 3AESB 5HGDA 4X6CB 4QQFA 3BB4A 3EMVA 2XV2A 1WUTA 4QHKI 4NHUB 1RAFA 4TULH 1XEUA 3OX3A 3I74A 1MPXA 4CR6A 4FCTA 3IJHA 3WE6A 5GS3A 4DCJA 1OWOA 2PWYA 1HE7A 1R24B 3INUH 5IAEA 4XDYA 5KBKA 3D18B 2EKJA 1Q0XL 1W88A 2OXCA 4JI2B 1XVTA 4R1NA 3BGVA 5ID0A 3PP3K 1ADQH 1QF9A 1T4CA 2W9XA 1UPBA 2FUTA 5ITZB 4G9FD 4KPHL 4AF8A 3MOAH 4N18A 4H1UA 4JO2H 2YMLA 2Q1EA 3MK31 2CXRA 4P92A 3WNCA 4MDIB 4OAPA 1HHGB 3ZE1F 3WGYA 4S2EA 3STVA 3E2HB 1CZNA 1FUUA 1R5IA 5JFGA 1E5BA 2GFIA 5B21A 1DQDH 2Q10A 2RHHA 3FPLA 2JH3A 2V7PA 5DNDA 1N2CA 3HRIA 2B4CC 4BO3A 4CF6A 4LRIC 3VH8B 1FNSA 2OKGA 1RLBA 2HB0A 1UBLS 5EEVA 5DHDA 5DJXB 3GJ4A 3K0BA 2AJDA 3QSYA 4PYQA 2D5AA 3QEKA 4JDPA 3HNVL 3NFYA 2PU7A 4ARAA 4HZLB 3OO0A 1J5XA 2J57A 3C6LA 5JPIA 4ZMNA 1HKUA 1FFBA 4P23C 3DTDA 3L3HB 4M7ZC 4QGGA 1DQSA 2IXFA 3GI1A 1NUDA 3AIMA 1B4DA 4OQ1A 5CLXA 3DLTA 3FPHA 4GXTA 1DJMA 4ZRMA 4J3OD 1U2GC 1R6UA 3TTXA 3L8GA 4OZIA 3NWJA 1VXRA 2Z3VA 1HJBC 2OULB 5C81A 3L4BA 4IBZA 4LNAA 4REQA 4QPPA 1DPFA 1H3PL 2IYQA 4A7TA 5GRWA 5EKSA 3DDGA 4ZXBB 1N3YA 1M0WA 2NCEA 1MAUA 1C4XA 4KPFC 4XWWA 3L1UA 3LXCA 2CBPA 3RZCC 5TQ0L 1J9CT 2NY1B 4PBRA 1E89A 1CI3M 1XGTA 1R0WA 3B1YA 2ZP8A 3GN1A 2W37A 5B1HA 1JR4A 2ENJA 1S89A 3F49S 3SFZA 4UBIA 3DMGA 2P8PA 2X0EA 5E2VH 1UWXK 2FI1A 1JVLA 1VPTA 1U8UA 2G88A 1QLRA 5T1LA 4PRLA 4BAUA 4UMDA 4JY5L 4UQIM 1UH2A 3IBOA 2MPAH 3R9KA 4FFYH 3WXWL 1PJ3A 2H4JA 2QTRA 4LRSB 3BFOA 3P9MB 1ANKA 5CFAA 4KRXA 1O6FA 1QRNE 2HH0L 5DD3H 1BD2B 4QULA 2O5CA 1RZGB 1SBHA 4TVPH 4ZYXA 1MFZA 1G66A 5A1AA 5TS2A 2IDTA 2NT3A 5F88A 2IWFA 3DZBA 3T9EA 2FQGA 4L8SC 2F8SA 3ALXA 3RX7A 4HUCA 2Y2UA 1VSQA 4DJ5X 1ICEA 4G6MH 5EEGA 2OMTA 4LCBA 3FPFA 3U1TA 2YLHA 1S9WB 1GY8A 2D74A 2HNAA 3KYCA 1HE5A 1NUAA 3UAZA 4YAKA 2VPQA 2NX5D 3LQMA 4W1QA 2Q3CA 1G5QA 2H2GA 3FO9A 4E9TA 2JZOA 2A1IA 3MWEA 1TJMA 3DX7A 4ODWA 4TGLA 1QAWA 1CRPA 3ZSTA 1UBOS 4FINA 4G1BA 3QV2A 1MHPL 5IF0B 2B3IA 4TMYA 3QEAZ 3JWOC 4NQVA 4PP2A 3Q1EA 2R1VB 3I8XA 3BKJL 2A0LC 3UAJD 3TURA 3IMFA 3CJQA 4K87A 4I1UA 3KMDA 3MFYA 2ZSFA 1ZAYA 4JUTA 1SPBS 4PC7A 2XNJA 1X1AA 1B3BA 4LJSA 3QWRA 4R4BB 4D4IA 4DH2A 2Y06L 5IJKC 1BHSA 2PWPA 2DE0X 3T1YB 3SJAA 3FB8B 1ISRA 5BV2P 4JKMA 3MRFA 4UBJA 3WIHL 1FL3B 3ARXA 4G0QA 4LPTA 1QLJA 4OHOA 4EZIA 5HJDA 1D5BB 3OU6A 4ND8B 4XFDA 3C5ZD 1JD9A 2JJTC 3GMQA 3BL8A 3FCTA 3ZQ6A 2FA9A 3PLAE 4DUZB 3PHCA 3HJGA 4CKCB 5EKUA 4N0UB 1OTTD 4NWTL 5EZYB 1YEKH 1FJHA 5E6IC 2AFIE 2IV7A 3Q9NA 3FGZA 4BM7A 4NYIQ 3PR3A 1SQ5A 4I14A 3U1BA 1NXOA 4WW1B 2Y0SA 2L69A 1WUYA 3VNUA 1JDPA 5AW7B 5HQJA 5LB4A 1JHTB 1TT7A 4JCMA 3V42A 3HHMA 3EF3A 3K91A 4KO2S 3OKEA 2R8OA 3QYFA 1XDDA 4CQLA 1CT8A 2DDQL 4JQVA 2K4AA 2VJDA 4M48L 3OF5A 1J4AA 3AUUA 4UNVA 1JWBB 2J1KA 4OO3A 3C0KA 3ZU6A 3JWNE 3CUUA 3QZWA 4X8MA 1KDJA 2DWTA 3TF7C 4ALLA 1RJLA 5I18H 1B41A 2LFEA 1MWAH 1PR9A 3EVNA 3I6ZA 3U4CA 4F11A 4NM8L 1SJXA 1VIWA 2QQ5A 1E4KC 1IGFH 2Q1TA 2BDUA 1BE8A 2IU0A 2B9AA 1I3KA 3CPLB 2J3LA 2ZVDA 4PJIB 3LZNA 5BUGA 3F6YA 1NDMA 5E99L 4X8GA 4YCJA 1PVVA 5ISZA 2DQEH 3U9UA 3E9TA 1UT6A 1EWTA 2VM3A 4D98A 2Z8YM 4MQ7A 1Q8MA 3S8GB 1PCSA 4DKFH 4U2KA 3CFEB 4OBSA 5JS8A 4P04A 3VFTA 3KDSE 2X2PA 3ESUF 1ORWA 4HWRA 2IG2H 1TUEA 2PW1B 3K9GA 1ZH6A 1BN6A 2PEYA 5FD8A 1KY3A 3RVJA 4UTCA 3DL4A 4AKGA 2XJLA 3HH8A 1TYZA 2D06A 1BJRE 1Z0ZA 2Q99A 2VA8A 3T5MA 3NJJA 5HM6A 3L9WA 5DMGD 4H0GA 4QRPE 2DQ4A 5I1LA 4IZHA 1TTCA 3LEXA 2DWQA 4FIZA 4EIZC 4X6BA 2PXXA 3C16C 4O02L 4G8AC 1F51E 2QROA 1VPWA 1ACXA 2ZUCA 1W1UA 2B6NA 3L3JA 2YV1A 4N8VA 1DQJA 3UB3A 2IVFC 4Q4IA 4FZRA 4S35A 2COEA 4HS3A 4GFXA 2OAP1 3T3PE 2FJPA 4G36A 5DMHA 1QRUA 3OA0A 3RHZA 3GSWA 4KQKA 1U6AL 4EF3A 1O4WA 3WB2A 2EFGA 4IMLA 3EXIB 3CF2A 2WB7A 3EHDA 4FNSA 4C55A 1EFXB 1IE3A 2D03L 4P4SB 4OYLA 4EZEA 2JFFA 1ID1A 4N2MA 1H9DA 1UD2A 1AZVA 1XCLA 2YYZA 1JCKA 5DCWA 5CFZA 5MENA 1RUPH 1YS7A 4RZHA 4LXIA 1KYOJ 3PTZA 2CXSA 2JLUA 3DXAA 3ORJA 4LN1A 2QG9A 2PM8A 3WG9A 1BGVA 1QFOA 2RK3A 2EBUA 5G0VA 1JEYA 2BO0A 2AVDA 5EU6D 2R60A 2Y1DA 1JHYA 1MW3A 1BFTA 4BFTA 4UUPA 3WYFA 2E4FA 5BUAA 4JYMA 4X7TB 1QGDA 4OHRA 4TOIA 1XCQA 5CM9C 3ETLA 4TRMA 1WCBB 2H59A 4DV7B 1X1CA 2YNMA 3QPQC 2VGLM 4Y0AA 4MXQC 3QCVL 4FCWA 1S7RB 1KB5B 3GMNA 2PO6A 1FC2D 4RA3A 3CDGA 3RE0A 3I0NA 4L08A 2CVPA 5F77A 4NAVA 4U7FA 2H1LM 3QFJE 4WSJA 1L9XA 4IAOA 5IQOA 3PUVA 3R77A 1IJEA 3R06A 3T06B 2ZCHL 2J12B 4OCRL 3EXG2 1L4LA 1IBHA 1E3IA 1QG6A 3C09C 3ORRA 1PZ2A 3HGTA 5JW3L 4NBRA 4U7JA 5IB2B 1BXVA 2OI9B 2GEVA 4OGFA 4TNEA 1L5HB 1M6VA 1TKBA 5DVLA 1FF9A 5DJYA 4M3JA 5DW0A 5U1PA 1NP7A 1CXLA 2QMHA 4GH5A 3F1LA 3QYCA 5FNVF 3FPAA 1I9JL 1XEAA 3UJIL 4QO8A 3AT9A 3LH8A 2P24B 3AB0C 4YRBA 1A0QH 1N6NA 4ND1A 1AOXA 1RPZA 1QHSA 5J9FA 2QE6A 1R8SA 3B8HA 1PIFA 1YAIA 5JATA 4ZAKB 3KM1A 5DK3A 4QPJC 3BO8A 1PVDA 3WUWB 3WR5A 2HHCA 3I61A 1KIFA 1KRHA 2BVPA 4BQQA 1KSGA 3TWYA 1ZWKA 3IVXA 3GHPA 2J1LA 3I5XA 2CDRA 2X0KA 3GXDA 4ZCMA 2WJ3A 1UBJS 1KFJB 3IRZA 4YE4L 4JE4B 4EG8A 2CNKA 2MQ0A 1ZHBB 3SC4A 3POHA 5EJFA 4OF6A 2GFBB 2RGBA 4KL8S 2CYBA 1N2CE 3N86A 4K7FB 4JRYD 4LTNA 2FTKE 1KYOK 3DJFA 4EG1A 1ODCA 3ZZ0A 4Z6AT 2Z6VA 3Q48A 4OZ4B 3PVZA 4CFSA 3OJXA 1GTJ1 3O4OC 1B0UA 4TVPD 4R7NA 4OJQA 3MJ9A 3TB4A 3SDAC 3TOCA 1F11B 5IDXA 2B4YA 3V0HA 3A6ZA 5B1YA 1RUAL 4HUVA 1WDTA 4NCBA 3BIOA 4NXSA 2ZIUB 1V35A 3IL2A 2CKBH 5KBPA 2XWZA 4PRPB 4TSAH 2O2XA 5F9AC 3C3DA 2WIFA 3MJVA 4D0BB 4L1BA 3MCKB 4OZIE 2MSEB 4LU5L 5EHQA 4JFOB 4URFA 4CSPA 4XPBH 4PJ9C 1M2NA 3OL2B 5MGBA 2GJZB 3AU1A 4X1KA 1T0OA 4YEEA 1T66D 2I2CA 1FMJA 5LC1A 3TT1H 1ND5A 4YUYA 1ZEJA 4CKWA 1R5NA 3NGBB 3B38A 3JVDA 4CVNA 3FWYA 3ROGA 1XGUB 1TIPA 4RJLA 5JPDA 1LO2H 3M3HA 2WHEA 4QVGA 1CS0A 4XP6H 5FYJD 3RSLA 1T3TA 4WY8A 1NM5C 3QXWA 4FNOA 2YLKA 5JHBA 3TOXA 5KSOA 2J5QA 4M9XA 1GL7A 1XI2A 2OTPA 2Z92B 2MTAA 2NUTA 2W65B 2OM2A 1TYEB 5DC9B 3DNMA 5GS0L 1U1GA 1UASA 2CO7B 2NVBA 2CUTA 4JNKA 2AYZA 4FHFA 4OZGB 4DLZA 1L7TH 4GEGA 4WLUA 4LNHA 4NQED 3VXUD 2VIRA 2UZIR 1F2UA 3LT5A 4EG4A 3ZV3A 4I13B 1SM3L 3MFFB 1P0CA 1KOGA 3VSVA 3T3PF 1IKOP 4L4ZA 3Q88A 4E31A 4L16A 1OSZB 5E2UH 2IYVA 4QRRB 3ESMA 4QBTA 1XTSA 4OUDB 3UJCA 2L8AA 2V54A 4JI4B 2EH7L 4ABQA 1KFEB 1FGNH 5B57C 1MCOL 1BRTA 1GGUA 4I4WB 2EKQA 3KQYA 2JQMA 4GBXB 2XADA 3IYLW 3D4CA 5DRNA 5DM1A 3L5HA 2HH9A 4JPKH 3BCHA 1GA1A 2IHKA 1HBJA 1SKMA 4LSWA 4GLLA 2OB1A 3EMDA 1WZCA 3MRJA 4AG4H 2CHDA 3DJ9A 5DUJA 4YTEA 4WWKB 4FMVA 1ABFA 4OGXL 5B38B 4R1UA 1G1CA 1DXQA 4FWWA 1G9HA 2JB6B 3F73A 2NY6B 2QLYA 3RVVD 5EQDA 3CFJB 1A1OA 1SBNE 5CR1A 2FRDA 4ZAWA 4GSRA 3ZCUA 5CN3A 3GNML 1JJ7A 3L2OB 3OPZH 4NPKA 1E62A 4D9RD 3GW8A 4CQJA 5IFLA 4JPIA 2EQ5A 4DGVH 5CJXA 3GSNH 3O2DL 1KQGA 1QUNB 4DVJA 2Y0EA 2J7LA 2VSOA 3O2VH 1G2PA 5EUQB 3TZBA 5H4ZA 3HE7B 5DE3A 5CGYD 4XFJA 7FABH 1TZHA 1LNSA 5ESQB 2GNOA 4W5NA 3NTVA 2R8ZA 1JG4A 1OTSD 4MLIA 5I8KL 2A3NA 5E2WH 3DH0A 4JG0H 3AXHA 3VO1A 4JZYA 4FI6A 4U8GA 1JXKA 4FN4A 3GBDA 3LYHA 3O8XB 3H2HA 3V5KB 1KCUH 1RK0B 1SXPA 4BQNA 5AW4A 4MS6A 3N2YA 1BC5A 1NICA 1GKEA 4ZFZB 1ADYA 4HNAB 4JQSA 1KVSA 4OQTL 2AXHA 2H9AA 2VKTA 4ODUB 3JU3A 4DDVA 5TFSH 4B41A 3QJYA 4JEGB 4X6YA 4OOFA 2OXRA 4RZ2A 4EMTA 3P32A 3O1JC 4Q1AA 3OG9A 2Q1YA 1E1QD 2V3FA 3UAFA 3QHFH 3WK9A 3VPHA 2WTEA 2A5DA 3D9AL 3WFCL 4ETYA 4M8KA 2WSYB 4DOMA 4WDQA 2P48B 3JQ9A 4IH1A 2BFEA 4YSTA 3L3OB 1AQHA 4V1CA 4O00A 4HS6A 1TVEA 3KLNA 3H3XA 5TE4H 3NJKA 4F8LA 2BBOA 4FFLA 1Z0SA 2GD6A 2ZM6B 5IOKA 2GASA 3S88L 3FO2A 5EJEA 4JCWA 3BUSA 4M0KA 4BNMA 1QA9B 3OIDA 2G8LA 1V27A 1J97A 2J21A 3VO8A 4EIBA 3UJPA 4J3FA 4L4TB 2VDNL 5ISZE 3UHAA 1YZLA 1CY4A 4NOLA 4QIRA 3L0SA 4CDGC 4KN9S 3DROB 2EYRA 3QFDA 1RQPA 1ABBA 3K7EA 1JWMB 1T2AA 1ZSDB 3K05A 4NDAA 1XWIA 4BWVA 3R3HA 3HC2A 4OAWB 3FHOA 2VUOA 3CUPA 1IM8A 5B53A 1BVYF 4L27A 1U2EA 3KZMA 3GB7B 4HLZH 1IEHA 5L8LB 5C09A 4YQFA 4XGRA 2GBPA 1NGQL 4QHMB 3PCYA 2JD2A 1HFEL 1KP2A 5AKYA 1LO5A 4MKRA 3D43A 5F0JB 3EF0A 1FFEA 1R5VB 3WICA 2NV6A 2NXEA 4B84A 1P4BL 1GAWA 1HETA 4Y5YC 2QLVB 1QHQA 4FR2A 2ZUFA 3PS9A 4YP7A 1EA7A 1NIDA 4B3GA 1K7XB 5IPFA 4N49A 4YJKA 4YEFA 1Y0LB 2NU6A 4CJXA 5LGJB 4JELA 5BOSA 4KR0A 4U1LA 4X4MA 3QBVA 4K9EL 5D7LB 3RNQB 1JKFA 5DWDA 4CM9A 4Y2OA 3GSQA 2YIVX 2C2MA 2ZIZA 3F2IA 5B8CB 2GCPA 4FMBB 5KX5B 2C4KA 1DLFL 2F53B 2OJZH 1NLMA 3TMYA 2W6CX 3DO7B 5FYLE 3HCVB 5IMOB 1SKYB 5AK3A 3V5NA 5ALOA 5B58T 4GG6B 2CT8A 1BWMA 4RZSA 3QPUA 1GTZA 3MAJA 1RXWA 4BGIA 1S7VA 4KV5E 5IESH 1I3UA 2H4EA 1L4GA 2IZZA 3GWZA 5MENE 2WB2A 4PNHA 4ZQEA 1E5ZA 2V8BA 2A5UA 4NENB 2QMQA 2PNJA 4LMPA 3DXAE 3AUVA 2V7BA 3H1GA 5JSFA 4OAOA 2ATPB 2BWJA 2VXSH 3HNSL 4QOSA 5EFIB 3RHSA 2O7VA 2G0NA 4OSUH 3B2VH 3BK7A 1B2YA 2GCYA 2VO5A 5IUKC 1VRWA 3EH3B 1W87A 4DLXA 4B6SA 4NHCL 3OAWA 1ONNA 4OK3A 2JELH 2PPAA 1A8HA 4XVJL 3KXLA 3A0RB 1P9MC 3VVWA 4WUTA 1HZJA 3KETA 2KQNA 4FKEA 2QI9C 1XDTT 1Y3DE 4ZVKA 3UTZA 5DJ2A 1UUFA 2C5AA 1ETHA 1DOHA 3BUQA 4BLPA 1RUQL 3FPJA 4ZX6A 4KMTL 2AVNA 1Y48E 5FJJA 1W6RA 4QYOB 2FGZA 4Z2AA 2Q4DA 1PHRA 1SYVA 1GV0A 2WUDA 4HWBL 3BA1A 1SOMA 4EQ6A 3O8DA 5CT8A 4NN6C 3ZE9A 4NBLA 4CV0A 1IGMH 3VFRB 1TK3A 5B1EA 3B6JA 1S6NA 1XV8A 1J8RA 2R2BA 1F0NA 1PNOA 5J11C 1ZUIA 4PV1C 2C3HA 2AEFA 4WGWB 1TF2A 2X3BA 1N6QL 3IM1A 1KEZA 3ESXA 1ZM7A 4A66A 3VO9A 3UGQA 3LC7O 5COQA 4I08A 2RI1A 3JD3A 4MX7A 2IAMD 4EQ2A 4X80H 2ZPUA 2ZJ8A 5TMDA 3VG0L 2E47A 5BV7A 2G67A 5KWJA 5BNXD 1CQIA 1UBSB 3H2GA 3I2IA 2ADFH 1DRWA 3ELDA 1E9PB 3RT9A 3FIJA 4Z3FA 5HD8D 3CWQA 4LCJA 2FWSA 1OYVA 1DSYA 4U3XA 3GRPA 4LOKA 3HG1B 5F1KC 5BYBA 1KI8A 3NASA 3TAXA 3EJZC 2HT4D 1TVHB 4YUZA 4X7MA 1ZG3A 2C7UB 1DFIA 4ISCA 3G5ZB 1LGYA 3M6WA 1BYUA 1H0SA 2AFHB 3HTXA 3NUQA 4RGMC 3W11C 4Q03A 2W93A 3GVHA 2XVKA 2Z9CA 1FNCA 1L5QA 1I8KA 1IWOA 1TM5E 2IO5A 5I6XB 1GPUA 5JXAH 1VI2A 4P4RA 4IZ6A 1EGJL 1O8BA 4XI5C 4HP8A 5LG6A 4I9XA 4O2BB 1CUWA 1ZVSB 1GARA 1Z9BA 5JASA 1FNGB 2JI4A 3T0WA 5TMPA 1C7RA 3NBQA 3NR2A 4KX5A 4MVYA 5IMLB 2IJ0C 1IQUA 3FDFA 5BZXA 4ZOQI 5AW2A 4B6FA 2WPNA 3V4PA 3EZ6A 4P6VF 4DIXA 3VJLA 3E9QA 4L29B 1XVVA 1P7ZA 3RVPA 1RY7B 1OZHA 3GIVA 1NDGA 4UBNA 1RJZA 2ZIDA 3OKPA 1EAQA 3O3OB 1MG5A 1S5HB 3OF2A 4C8XA 1P7YA 1QHPA 1WK0A 4YRDA 1ZP6A 2UUAB 3G08A 4FUQA 1ITZA 2QTGA 4NAUA 1DN0A 1RHJA 4XVTH 1B2LA 1HJCA 2ZG1A 4Q9RL 2VWPA 1N6LA 3CNEA 5DM2A 3U0PA 4ZC1A 3PGCA 3TL5A 4W8OA 2JAWA 5G4LA 3H9ZA 1YB6A 4WKGA 4R2GB 1NVVQ 3EOBB 4MW5A 3TBFA 4YPGB 1VJTA 4JJKA 4HEJA 3GJZA 4XB3A 1WJ3A 4TVKA 5FUMA 4KQJA 4TZKA 3ZGXA 5DHUA 3AHHA 4WCFB 1KC3A 2Y1OA 1F4YL 1BHQ1 1MPAH 1GPBA 1EQAA 1UZUA 4XNBA 3NS7A 3DETC 4L4VB 4WFEE 4YC2C 2VNAA 2YAHA 4GSDH 3JS5A 4L9LB 3KLPX 1NXPA 1JLHA 2C9BA 3HKDA 2DM7A 3THYB 1I7RA 3E7JA 4JGBA 1SRRA 2B1HL 5FGBC 2XA2A 1ZNWA 3HE6B 3CNLA 3BW9A 5CGZA 3MRHA 1FTYA 5BMVB 7AT1A 3FU3A 1I7UB 2B9BA 4W93A 3LT0A 3VH1A 2FT8A 5FUYA 2QZ9A 4FJ0A 3GA5A 2WM3A 5JZMA 3SIPA 3NP9A 1FFTB 3BQUB 3ENWA 4ENVA 5EHZA 2R8BA 3WBDA 4CN8A 1VGEL 3AWFA 3IXMA 3W5BA 1MJ8L 2CEAA 3LUHA 3FAWA 1KDPA 2VDWA 4H3SA 4L75A 4QEDA 4R9NA 3HHEA 1JOIA 3AAZA 5MEPA 2M1XA 4XPTH 1R8JA 3R75A 4HQQH 4DAOA 1EIBA 3MRLA 4F7MA 2WTXA 3FB5B 5F93C 2VXCA 1HKFA 1PKEA 3T4EA 4KV5F 4ER5A 1IBCA 2BBWA 3TA3C 3G5LA 3D81A 1WTLA 4W6XB 2MNWA 5KOHB 4Z7QE 1IIIA 1BEZA 3BPCB 3UP6A 3IXAB 1ZH0A 4R01A 1NWCA 3KPRB 1I1AB 4UEWA 2AKEA 4GOND 4X8JB 4ANVA 3IB4A 2ZYAA 3MB8A 1A8UA 3AJ9A 3CWCA 2ADGB 1PIGA 2ACKA 4QNRA 3R7AA 2AJUH 4IGBB 3CXDH 4HBCH 1Q11A 2Q6WA 1NT4A 3HAEB 4ZOAA 1ZLUH 3RGVA 3JWIA 2G5TA 2D3JA 2QTVB 2YZ8A 4P7JA 3BIKA 1RJGA 2APBA 1NANI 5EJ7A 1LQUA 3I9OA 1KNXA 3A9SA 5FL3A 3CT6A 2G06A 4J3JA 1F06A 4ZJZA 3OPYA 3LMJH 3A1TA 3CH6A 3NHJA 2WNIA 3UJ7A 1W8OA 2CSXA 4KV7A 3RWHA 1MCJA 2FEPA 3DTYA 3PPXA 1FA4A 4HO1X 4MWGA 3PZRA 2EE6A 1AXEA 4U1GB 1HEUA 4PCVA 2Z4QB 3RGHA 4FYPA 3A3YA 5J2UA 1GNQA 1YQEA 1W2HA 4NO3B 1T91A 5BSEA 5KJCA 1JPVA 2SNIE 2HUNA 3D3VA 2A1WH 3FH8A 2B8JA 3PNWA 1MX9A 3ZBQA 5HVFB 3Q5YA 4L3CB 1J70A 4XGZB 4ZMTA 1YUMA 2QPAA 4I9UA 2BIHA 2P0EA 4LOVA 1N4DA 2X4GA 3KZOA 3RDTB 2BIMA 3FRJA 1D6EA 2VWEC 5JAOA 2WQRA 1XTJA 4GF5A 5JH7A 3SVLA 3R7LA 1YA4A 3L8YA 1Q0LA 1FYHB 5AAPA 3FUUA 1KGUA 3E1SA 4G43A 1A5AB 4FS3A 1SUHA 4JFED 4DC9A 3T7KA 4P9NA 2RC6A 4E2ZA 4L3EA 3T4UA 1WUZA 5EIOA 4YWHA 4ICWA 1MCKA 4PV9B 1TSRA 1DRVA 5IV2A 3L1IA 3OXSA 2UYLA 1GSOA 5AHKA 5DEZA 3GZNB 2YWYA 1TU4A 2PMBA 4HF5L 3BSZL 1QHGA 5HKAA 4TV3A 4I6EA 2ZXEB 4F2GA 1WV7T 1KENL 1KMNA 1WW3A 5ER9A 1QLEH 1BIIA 2J3SA 2A7BA 3LVQE 3LJKA 2VP6A 2C7GA 3O6VA 1MFAH 4JJFA 3THXA 2R4RH 5FP0A 2APVA 3QC6X 2JZCA 1NBVH 2OORA 4Y2DB 1TKRA 4L8GA 4MTCA 1JXMA 2DG2A 1G0OA 2YFYA 4EI6A 1PG7L 1OTHA 4JPVH 4GO9A 2B2XA 3JY6A 3MUUA 4Y89A 4H0CA 2NACA 4MVXA 5JBQA 1IM5A 2XNHA 1ZXXA 4HSAC 4HWGA 1YG9A 3CU5A 1U2DA 2EWWA 3I5MA 2C9CA 4EAEA 5C09E 3KJQA 5CZVH 1OX4B 4NAHA 2KYIA 4UE2A 2AQHA 4NIYE 2O0JA 1IATA 1FQWA 4X24A 1D8AA 4TV9B 2YHAA 4C5AA 1KJ3H 1H4QA 4B60A 3ELWA 3TRDA 1IZ9A 1P4UA 5FFNA 3L4WA 3SGJA 4ZANA 4MASA 4KZCA 4Q1VA 3S7ZA 4X4ME 4FNPA 1ES9A 2C7PA 2L2QA 3BEOA 1MFCH 3W2IA 3SHTA 4MDRA 1F3DH 2SICE 5MP6H 4ZTPH 4UPVA 4RESA 2JLQA 5DNYB 1CFSB 1R5BA 4IJUA 2AZAA 5KKNB 4M21A 3AF5A 2A83B 3VR6A 1Y7PA 2R7AA 5JUWA 4QF1A 3P9IA 4NECA 2H5UA 1HTWA 3BSFA 1PV4A 3DL0A 1KNOA 1JV2A 1PDVA 5DJAB 2DPXA 2NM0A 2JFHA 1XNGA 2PXYD 2ATKB 3PABA 3DCJA 4BQBA 1KTKE 5MHSD 5IJVA 2IXTA 3O7MA 5CILH 4ZPVA 2OTUA 2P69A 4KQCA 3ZDEA 1UWYA 4AN4A 2C94A 1J5OH 2W71A 1KDTA 1RVV1 4UZFA 2P49B 3AUFA 1C16B 3QS3A 4EY6A 3AZUA 1ECLA 2ECFA 2C3MA 1G7LA 4ABUA 5KJFA 4GIOA 3BXFA 1KBGL 1MH9A 1IBSA 4JM2A 4XX5A 4RY9A 3Q6GL 2BFNA 2QN6A 3GSVA 1QLHA 3OCCA 4DFDA 1UM4H 3HNTL 1FFNB 4ONFL 5CJJA 4HEHA 3ZNOA 2IFFL 1H9AA 2NW2B 3RUAA 5GJCA 3ZCVA 4KO5A 5AKTA 5DH9A 1ZT7B 3F7OA 4WO4D 4PG9A 3INNA 2ZXBA 4KVPA 3T1NA 1T2EA 2CO6B 3QI9A 1L2TA 1TTTA 1VE5A 1XJCA 4J9UE 5CLGA 2WP0A 1NSTA 2ZWLT 3KNBA 5E08H 3Q3GB 3DNKA 2XA9A 3VPGA 2CGEA 4TTTS 3WHE0 4WKZB 1P62B 4QD3A 3AM8C 1LO0H 4H8UA 2J20A 5CCHE 2X3AA 1XFDA 3UKJA 1RXCA 4HUNB 4G8JA 1UJMA 4XIIA 3PNMA 1D9KD 5IAJA 2B3RA 2KPNA 3W5VA 4AMGA 2NDFA 4FQ5A 1XMWA 1JZ4A 1M54A 2Q3BA 2H1SA 1T4MA 1SUDA 3PEYA 3DV9A 1QQ7A 1MJFA 4L5JA 1YE3A 2XWTA 1RC8A 4FB4A 4I5BB 4UOW0 5B3JA 1OGTA 5IF9A 1M8KA 2DV6A 1N2SA 2I67A 1JHVA 3JQGB 1G5FA 3PX7A 3KXFD 2H8PB 2GPZA 2ODTX 3I37X 3FCCA 1I6WA 1XLTC 3CMOH 1SC3A 1SIOA 4Q4DA 5JAHA 2FZ3B 3V8VA 4AZTA 3EBLA 1W30A 5AB1A 3USCS 4OMCA 3L4XA 3JUZA 1GUYA 2ESRA 4UQ2B 3EZ2A 2AN5A 3P4MA 3BIXA 5F6IB 4QX6A 4HW6A 2OB2A 2NPOA 1DG3A 4MRCA 1JFTA 4AYXA 1RUKH 4M54A 2BFBB 3FR8A 1H9VA 1H3TA 3CFBB 5L4FA 2XV1A 4GLJA 4ZFNA 3L93A 3AYZB 5JIHA 5C3UA 5C8ZA 2R8SH 3WGKA 3ZUCA 4F7EB 1P6QA 1T04B 2BI8A 4BXVA 1S7TB 2ZYDA 4JKYA 2W9LA 1ZMXA 3KUKA 1CFBA 1Y8RB 4OB7A 2QYOA 2F43B 5DVPA 1GGEA 3S40A 1TOAA 2QTMA 3NAQA 4NEHB 3X1NA 4OLFA 2A74C 4F15B 2Q8PA 1Y1TA 4LZKA 3MCAA 5CUQA 3ORHA 4OIAA 3AJAA 4CQMB 5ALZA 2AN1A 1DIRA 43CAA 3PJRA 4UQ9A 3QIBC 2YN2A 3PFQA 1KIQB 5FEBA 1Q1PA 4Z8FH 3FXIC 5DEFA 2I91A 3SY6A 3D50A 5GRJL 1UDXA 5J3JA 3RBGA 2ID9A 5FKAB 2QL6A 4JT2A 3GX1A 3Q72A 4ZQKA 4KZKA 1AKJA 5JIQA 3UH8A 1CQWA 3QK7A 1T8SA 1BCIA 1TPXC 3BAZA 5FTJA 5CD3A 4XB8A 5H7XA 4LSMA 4XWGH 3HMQA 4HHGA 4OU4A 2GD0A 3BXZA 3NKVA 1VIVA 5E7BA 4HDMB 5E3JA 1G6HA 3GHEL 2OCAA 2AR9A 2QX8A 1J1XH 2CZNA 1FTNA 3MGCA 3B3QA 3MGAA 4JX0A 3ECBA 4KHZA 4AGPA 4IY1A 4J4PC 3EJYC 4F85A 4DADA 3MLWH 1YEJH 3BSWA 4R84A 3CVHB 3KOOA 3HG7A 1H6CA 3TIVA 1VLXA 1JBQA 4NO0A 4AECA 3O8RA 1BJ8A 3KIPA 3AG3B 4HOYA 3WTBA 5ECGC 3CX7A 1T6YA 4ATTA 3MKKA 4K07A 1GXEA 4F7DA 4S1QH 1P29A 2WJ7A 4R05A 3NN8B 5SWQA 5AUOB 3CLWA 3IR7A 2VQDA 3BWBA 2OR9L 4EGSA 4K8RH 1DIBA 3KB1A 3GSUA 1CZHA 5DK0A 2Z91A 1FNHA 2LW7A 1EFPB 5ESVB 1MRDL 3K0AB 3HS0B 3W57A 1A9EA 1D5IH 1B4LA 2P9YA 4L5CA 1U7WA 4WSOA 3OOSA 1Q9OB 3ZI7A 2I2FA 2VPXA 3C3PA 2CHWA 3F98A 1YEFH 1DT5A 1OBFO 3U7WL 1DL7H 4Q3EA 5IJXA 2G9QA 2QZQA 4LRNH 4QXMA 1FO0B 3H05A 3CVWA 1HINH 1AGXA 3ZHYA 3U7YH 3T7SA 1MCHA 4F3RA 4H25A 3JQ7A 4TLEA 3ZGNA 4HHEA 2EW2A 1KT2A 4Z7VF 4BXOB 3PC3A 1AKPA 1CFTB 4CKBA 4RJ2A 2C98A 3LBNA 4C89A 2XF2A 3UOWA 5ES4B 1VCMA 3UH1A 2O61A 4PFJA 4PYRA 1XIWC 4IDQA 3GH3A 2UUCB 1D7BA 1RMFH 1P77A 1TOXA 4JKLA 3CIQA 2PMKA 4HGZA 4JB8A 3D3VE 3FOMA 2D7DA 4LPCA 2R6GA 2FPIA 2EXYC 3ZY4A 3DT6A 4I5EA 3P4NA 3PL6D 1E58A 3IJ5A 1FMFA 4IU3A 4D9IA 4M89A 1CULC 3IS0X 4M1CC 3BHBA 1H6UA 1SUAA 4XWOA 3OFND 3V8OA 3I52A 3K6SB 2VBFA 3KLLA 4OKVA 2YPKA 3V8PA 1USQA 4EPVA 3AABA 3OE1A 1GC1L 5JRDS 3RW9A 4LVOA 4HXFB 2HBYA 4I3RH 4EZLA 3UEQA 1JB1A 3BGMA 3K2IA 1RAEA 3DIDA 1V41E 4EL5A 1JMZA 1C7EA 4A1OA 3RK4A 2FY8A 3O8QB 2XBDA 4YAWA 5DURD 4AKQA 3IBTA 3PB3A 4RQUA 1IN8A 3EYSL 1XQVA 1RIUH 4RMGA 3UXFA 5FBQB 1XEDA 3ZW9A 5IASA 1CRWG 5C7IO 4YP6A 4LLYA 5D7SL 1FNSL 3KWJA 3L4ZA 3H1ZA 4EZKA 2BJWA 2EEPA 3QF4A 4QJ5A 3QUXD 1NIEA 2F55A 3SLRA 4OXKA 4DB2A 2XVGA 1N1EA 3QPCA 2GM4A 2F8OA 3TIDB 3BT0A 3UIZA 1OYOA 2CW5A 4B3MB 1WVZA 2F15A 5EOCJ 4K9EC 3DTVB 3IPFA 1E92A 3S3DB 3LGAA 1AUXA 5LLIC 3OV6A 1OAOA 4F2FA 4NFCA 3UG4A 1G4AE 2JLYA 2I62A 3GEEA 5K6AA 2KH2B 1U11A 3QVTA 3G0CA 2KLSA 4TVOA 2VQ4A 2HBRA 4Q3NA 3NQ41 3MS2A 1L5YA 4DPCX 5CEZD 3EC2A 1OF1A 4P93A 3FUDA 1TM3E 1ZA6A 1J87A 2P5YA 2IANA 3MRTA 3TL6A 5EDSA 5HMMA 1WZEA 1Q0EA 3IULA 3NH9A 2AW3A 5ABDE 1T03H 2W98A 4MB1A 3R5XA 1MVUA 2QVMA 4OCMC 1J20A 3RVTD 5AW0B 2HWZH 1SB8A 4AO7A 3A36A 2JNZA 1AZWA 5DRWA 2XYRA 1GAJA 1AO3A 4XMPH 5LNK6 2JJ1D 4J1NA 1PDOA 5DFVD 4RFVA 5GHWL 3SOZA 2Q5IA 5FOBA 2QSJA 2VHYA 3L7OA 2EUWA 3AW8A 1T5KA 5H4GA 4L78A 3K6KA 3IFOB 5IKPA 2ZWNA 4OQMA 1FTSA 1A9PA 4OKDA 1U58B 3ISJA 3R6WA 4EI5D 3MLXL 5CJ8A 3CNQS 5MEQA 1OW3B 4KO6A 1C7JA 3BZ5A 4FT2A 1NGWA 1KCRL 4U9IS 3LECA 3V1NA 4P7FA 3LZFL 3P69A 1L7DA 1OIVA 2J4CA 1FSFA 5EE5B 4TQAA 2OXFA 3A67L 4GZ8A 3O93A 3S37L 3F8TA 4DA9A 4NSNA 3ZW7A 1H8NA 2FPXA 2DI9A 5DRXB 2VHZA 4DV3B 2FBOJ 5CZXD 3GRWL 1M1XA 3QUBA 2Y92A 1I0IA 3F3HA 5GOTA 1KZYA 2FPGB 1NY6A 4LWOA 1PK7A 5KVFE 1VMIA 4WV3A 2UZ1B 1ACYH 4XBPB 3B48A 2XCLA 4Y4FB 3VQMA 4AZ0A 3N07A 3HYLA 1E79A 1KAMA 4Q9LA 4KQ4H 2O07A 5C7OO 5B7QA 2XQYK 1HDZA 3KSBC 3PF2A 5BMFH 3O2WH 4CVXA 1D0IA 3RWCB 3VYOA 2OMVA 4UILH 3ZJYA 4KNTA 3AFGA 1N64H 4EKEA 3L08A 3VXSA 4EVSA 2PGNA 2E55A 2I3GA 4KRGA 1NC2A 3PHQA 2ZYVX 1PW7A 1RQ7A 1XN4A 3T77A 4XP5L 4R7XA 4CKXA 3EGDB 3DXXA 4C6TB 3GLEA 4KBFA 2FUQA 4ZSOB 3SZRA 2QVBA 1A7NH 1QQBA 2QLMA 4JGJA 1A9XA 4AEHL 4EP1A 1UMBB 3LRHA 2CCLA 2MEJB 3U48A 2ZRJA 2GJ6B 4F4JA 5J2UF 1OAKH 5B3JE 2D13A 2HK8A 1VYHA 2RHBA 3M8KA 3VXNB 3CU1A 5DQ9A 4DUGA 4XOBA 1W5TA 1BWSA 4GG1A 1E69A 3AB8A 1OZGA 3WJMB 5FA4B 4JP1A 1QOQB 4ZT2A 4N20A 3BHIA 2NAPA 3KE0A 5ANMA 3MTDA 1NQ5A 4WQMA 1EJ0A 3O4LA 5E4OA 4CMKA 2X3UA 1G0XA 3QQDB 2VCYA 1SBSH 5FK9A 4YXLL 2PW2A 3U2SA 4GMTH 1R15A 2VDRH 1HQ4B 2AOWA 3WTWA 4EGAA 1TQCC 4X7FC 3PHGA 5JH7F 3DWIA 2QWXA 1JP7A 3LS4L 4Q00A 4PS1A 2VQ3A 4I1PA 2E0PA 1QDLB 2I7CA 3IPAA 3VPCA 1JMXA 4ZOEA 4KO9A 4YNYA 1K8ZB 1DDOA 1YFKA 1ETB1 1EQUA 1P73A 2R1TB 5D2LE 1FB5A 3NRQA 1DC6A 3GEWB 4QHKJ 2WY2D 3C6QA 2AJTA 5FM4A 1EX0A 1FFHA 2PL9A 3E8VA 1KGYE 1UOKA 2M8XA 4CNIB 4XUCA 2CPCA 2VQUA 3VFSB 1Q72H 4R5MA 5EPOA 3ARDA 3ZZMA 1HNYA 1A5ZA 3SQNA 4PVBA 5K0NA 4HLJA 2XMZA 3STBA 2PWBA 1W0KA 3ARFD 4P5TD 4Q7QA 3VRJB 2FSVA 4OD3L 1XMQB 5D8JL 2IPXA 4K8RD 3HFFA 5K9JH 2BMVA 4HIHB 2CUZA 2OXGB 1RKRA 4OHPA 4V2BA 1XQ9A 3KPTA 1CFVL 4ZW6A 1M8FA 4IDOA 2G0AA 2Q76B 4Y2JA 5FTMA 1JZFA 1P5JA 2KDYA 3VRIA 3WP1B 2BEKA 3MRMA 1ATZA 2WKWA 4Z95H 1INEL 4H6XA 5DJ8B 2OFOA 1FFOA 3TNJA 4QFCA 5GVSA 1QKIA 1U8ZA 2YD1A 4A10A 5F96H 5I1JL 2JB5L 1KOAA 3U37A 1JG1A 1HTTA 2H16A 2DXIA 1WMEA 4N28A 4OCLC 4BEJA 4TWBA 4LGCA 4JFDB 2ILVA 1SJ9A 5I1IL 2NOAA 4TWRA 1BF8A 2H29A 2XVLA 1QS0B 1SVCP 1WW8A 3R0MA 1QO3B 4UQCA 4E5XA 1MC8A 4G81A 1J8QA 2C9PA 3KSAC 4R96A 3N5KA 2BGIA 3QRGH 3BYTA 3DC2A 1CETA 4C59B 1EK1A 2QRZA 2ZG6A 4BB0A 3V4OA 3CFNA 1HHKB 1CERA 1Z8HA 3MTIA 2O1WA 5KSBF 25C8L 3IT2A 1PT8A 4R1SA 4KDCA 2X5PA 1LJLA 5JC1A 5JTTA 2X1MA 1QP4A 2HFGH 4IFBA 1I8LA 5LQDA 3T6QC 3PPVA 2MCG1 3E48A 3RC2A 1K0UA 5FHRA 1TJIL 4XPHL 4CN1A 5BZZA 2X2OA 4IIHA 2QKYA 5JW4Q 3DWFA 3CK0L 1VPLA 3IETA 4US2R 1JZIA 2CF6A 5FYLL 2WF6A 3IO5A 4LHWA 5H37A 1ZA1A 3MOBH 2VJKA 1SXSA 2APTA 4RZKA 1MIEL 3WJJC 2FMHA 3LIZH 2VKQA 5A2LH 3HB0A 1TFUA 1UXIA 1T24A 1JJUA 3PX2A 3H5IA 4F7CB 3QUZB 2A5YB 1FDRA 1YXMA 1A1MA 4JVNA 3A4TA 2LVBA 4UQEA 4JVPA 5JLZB 2DIBA 4PJCB 1G7IA 3ENVA 4LFAB 3TJMA 3SYPA 1YFZA 2YVUA 3C5CA 2NR6A 2N3ZA 1NYLA 1NMAL 4CM7A 2PD3A 1UCTA 1P91A 3DGGB 1U92B 4D97A 2FAUA 4Z4GA 4DUPA 4PJHB 3ZXIA 4DR3B 1QSGA 2CCWA 3D2AA 3SZGA 5J1TB 1B43A 2ZKYA 1P60A 2CO1A 4JM2F 4UDTB 4ZUTA 1B8PA 1WKCA 5T7BA 3BD5A 1MEEA 3EQZA 1EWHA 2UXDB 3AYXB 4G24A 1FZOA 3O4RA 4TQGA 3VOAA 5I9QC 1TM2A 3ZKWA 4S0SD 1CKEA 5JRJA 2XWCA 3RG1C 2AXNA 2IHZA 5ICEA 4XHJD 1L0YA 4IRZH 1NW9B 4AXXA 3QJXA 4R90L 3T4AC 4ILKA 3M6IA 3QDJD 2JLSA 4W5QA 4TTPA 2X9NA 4ZOBA 3AETB 2FHCA 4PG7A 5GRVL 4PJ8B 4P8RA 4P5KA 4N1CA 4JS0A 2PTHA 2QT9A 2HFTA 2OMZB 2WOJA 2UYCA 4EGQA 3H1FA 4C4KT 1APBA 3N8HA 1IQDA 2FWBA 2Q50A 5DASA 8ABPA 1E9EA 3DSNA 2Q20A 3QNXA 5J06A 3EBOA 3K5IA 4NQQA 3Q85A 3GJ8A 2AKRA 5CCDA 5AUMB 2QR2A 5LD2B 3KDAA 3QBTA 1UCBH 1HKLH 4I4IA 3DOUA 3JTSA 3QORD 2RCNA 4ZVQA 3V7FA 1UXJA 1FVCB 2WEKA 4PWGA 1OT3A 1TZBA 2XKJE 2Z5FA 3OQVA 2XPGB 3AIIA 2NUAB 3GUTB 4RQAA 4XP9L 3T1HB 3U3OA 5B3JF 1WSDA 2H0RA 3E15A 1HNZB 1X3LA 1AANA 1JVBA 3IPCA 3I2YX 3TCXB 5D7JD 1PKOA 1TZ2A 1WWAX 5FO9A 3MLZH 2R8YA 3M83A 4BO1A 2X1VA 1LEGA 3REOA 3P4XA 1OE0A 3O4IA 1Q84A 3KHQA 4HIIB 4KJPD 2OUKA 3KLDA 2RQ8A 1KYDA 4PHFA 4AS3A 4KJXA 1FDIA 1IV8A 1JPUA 2C00A 5I7AA 4C3VA 4C87A 1UJBA 1N7ML 5FA3A 1RU9L 4JFFD 3N7AA 4EI2A 4RFNC 3UPAA 4PSVA 1YOVA 1IM9B 1CJUC 1ILEA 3MJ9L 5FHAH 2XXFA 4UASA 1ASOA 1R75A 3EEBA 3LQ1A 1RLJA 3U44A 1KIRB 2IXDA 5JIMA 3FSJX 4A9AA 4ECAA 1RBYA 2GBTA 2DI7A 4OFZA 1FAKT 3PWJA 5FWNA 2C2XA 3PEVA 1KRXA 4OM0H 1R64A 2IWRA 4OLEA 3RJ5A 3VKVA 4TYWA 4RD4A 2P8SA 1VLZA 3CFUA 3KLSA 5DRZB 4V1CI 1SU6A 4QFMA 3FSGA 4XWTA 2YWJA 3ICQB 3SOTA 3NHWA 4D0RA 1NW6A 2IANE 4GW3A 1C8KA 4QXTA 2BSAA 1GTFA 2GT9B 3NBFA 1WU7A 1Q3HA 1FS4A 1V43A 3EA5A 4APXB 3DNPA 2YMXL 2OX5A 5HHOB 5HSFA 1JRHL 2YUZA 4RJTA 1TZKA 2PYZA 3R40A 3GXIA 1PJSA 5ALIA 4J07A 3GMRB 3GIZL 5E4TA 3ROOB 5I1EL 1G7JA 2XNAB 2FGKA 3O6LL 3TIEB 5B37A 1DFGA 3EYQD 3OIVA 1CE1L 1BQHG 1ORIA 4X98B 2ZKHH 3WIIH 3FYTA 3ZEIA 2CCKA 5EOCL 2P43B 2GN9A 1CXFA 1S2LA 3UGUA 4EYSA 3NFSL 1YECH 3NV9A 2VJBA 3U0WL 3SDDB 1ED3A 3AUAA 1V1MA 2XZPA 4QJBA 2DQHL 1EXVA 3M6AA 3UMVA 1QHFA 3Q7RA 4QTTB 1EPUA 3JATA 1IMHC 3LGSA 5IKCB 1SFHA 1ZLEA 3CT4A 3T15A 5FHQA 2CNBA 2VUHB 4H1LG 1KTJA 2BGRA 5C0CB 1UQSA 3AMLA 4Y9UA 1IZKA 1GSMA 4EXPX 5K1NA 2V5VA 1JPJA 4E0RB 5DRTA 1EEYA 1E6EA 2ZVPX 3NHFA 3DHMA 1XTZA 1KL7A 4OXRA 4IOJA 4DNXA 4N2DA 1MG3C 2IKSA 5IS2A 3HABA 5KAQG 1NLUA 2KYRA 1QH0A 3G6DL 4H1WA 2CLZB 3RS2A 5TGZA 2K3HA 4PLOB 1GGBL 4F9FA 4HQFA 3OWOA 1G8FA 1WCYA 4UEJA 4ZYVA 2H08A 2ATIA 3TC9A 3B9KB 4HTFA 5KAPA 4UHKA 4MNQA 1OLSB 2WIMA 1U3TA 3IJRA 3GUZA 4ZEOA 4H6PA 1BVZA 4WDIB 3VXSE 3CZUB 1VDMA 4YCSA 1N70A 2G36A 3UJHA 3S97C 4Y0NA 2E8ZA 2C83A 4UTZA 2NDGA 2RGXA 4HWSA 1SD5A 4UKDA 4KU1A 3WKEA 1XCMA 5CP8A 1FPTH 4OT1H 2WSKA 1QYCA 1ZLWH 4RFOH 2R2EB 3ZNNA 1W72H 5HDBB 1AF4A 3W5UA 4U1JA 2O1EA 2W43A 3JWNC 2V1UA 4RSHA 2UZIL 3MGGA 4LL1A 5IM7A 3DDFA 4OXNA 3WY2A 2I2BA 1JGVH 3LOQA 1VGKB 1EGHA 3QPXL 3UYOD 2WTAA 4LF5B 5ANME 1VLHA 3O4LE 3TMAA 3SBQA 4TZ6A 3KR9A 3APMA 2QKSA 1KJQA 2AZ4A 3MC1A 2BLNA 5AVUB 4Q5IA 4IBVA 3I02B 1R5OA 4EF6A 3UO8B 4FI8A 1TDJA 3PDCA 2OMXA 3FCAA 3PWZA 3IP7A 5KTKA 2LVEA 3ESNA 2MSPA 3S1SA 4KQFA 2PJDA 1E4XH 2QORA 3W3AA 1PFUA 1RKBA 4LY9A 5DEGA 2JJWA 4BLWA 1DJGA 5E6SA 1RZFH 5E56A 3AHGA 2ISCA 4YDQA 3V9PA 3U83A 4PYOA 5DQDH 3HY3A 4DR5B 1XZMA 3ZZLA 2DIAA 2K45A 3JQBC 2YAPA 5HZGA 4YAUA 4GI6A 4MMYB 1DLHB 3KL0A 1DQVA 3BH0A 3IDXL 5KJRL 1S2GA 3S1LA 1ZS2A 1IE5A 3O3AA 4YR6B 4A6YB 2HXAA 3N42F 2ACWA 3QUYD 3GJFH 3FUIA 4NJOA 3I9V6 1THMA 1GRCA 3HP1A 4BSWB 1U8IB 1I75A 3E5NA 4M9QA 4ESVA 1FLTX 5EPUA 9GPBA 4FDUA 2Y2YA 5E6UA 2WBWB 2BS9A 2WB4A 3ZZ1A 1OH5A 3BDYH 4N3GA 2PR4L 4U6YB 3L1KA 3K1KC 2NZIA 4J3OG 2C1EA 3QENA 4PGHA 4GKNA 3WYGA 4WFHD 2AMJA 3O83A 3L7BA 4MRRA 1JI0A 2VDLL 4HJJL 2Q2VA 4OMFG 4REOA 1U42A 2ENUA 1F4XH 5AQ1A 2ZSUA 2Z9DA 4Q9DA 3NTOA 1JEAA 2OESA 2H2FA 3SIKA 3R7QA 1UZLA 5FYJH 4RL4A 3KM2A 3BMXA 4WWOA 3VR1A 2KC0A 2OYMA 1RLMA 3COYA 4WNYA 2F61A 3DVNB 3GDFA 3VQLA 2I9LA 1OKKA 5AW5B 3RUCA 2W0SA 1KJ2B 3SKNA 3W9YA 5EBLA 1Q77A 1ZD5A 3N75A 1ZTXH 1DEEB 2ZI6A 3DQPA 5HDOA 3ZTJH 2VNCA 1C9MA 3ELQA 4K3DH 4XVSL 1SC4A 4XR9A 3WS3A 2QP4A 1GCFA 4KUGA 1A8JH 3GHBH 2GPNA 1XYVA 3CN9A 5HI4C 5D85A 3ZRCC 3NAAL 1DL5A 3BEVA 2CSUA 1DQIA 4ZOCA 2MINA 1K9SA 2QTFA 1J0EA 3RI3A 4OD2B 3OWRA 5G1NA 2Q3AA 2XMBA 1L5RA 5L0QB 1NVWQ 4YRAA 4WIAA 4IVQA 1MU0A 3SO3B 2VDQL 2BY1A 4MRAA 1OGJA 4GQ9H 1PYOA 5HCUA 1I4EB 2GAZB 3U3ZA 5LKRA 1TA4A 5H5JA 5CP3H 1CJVC 1MWOA 1PDKB 1YI0A 3GK8H 2GEQA 1GRRA 3OLZA 4OI1A 2K7FA 1UFGA 1EESA 1DBPA 4CKEB 4HX5A 1TNMA 5E5MB 5TQJA 1PFYA 5LNEA 3MROA 4M00A 3KZKA 4M7PA 3RT7A 4RSYA 2JKWA 4GLBA 1HFJA 3EGXA 2XKNA 4YV2A 5EO9B 1M2VB 1G5IA 2B3TA 3HRHA 2PPEA 3A10A 1W4BA 3KU4A 1E6MA 2VQFB 2HT1A 1N1GA 1PSZA 3GP8A 4MDHA 3OF6D 1AXSA 4LJYA 5KU1A 4BBJA 3GP5A 1BH6A 4IJKA 5I75B 4Y6PA 2PIDA 2G09A 4BNDB 1D7FA 3BWDD 3HVKA 3W8EA 4EAAA 2EP7A 4OV6F 1C8QA 2CE6A 1IKFL 4XO5A 1IBFA 1JI1A 5BT8A 4I55B 4OF3A 1GC1C 1MRNA 3LKRA 2XXCB 1JERA 3D48R 1KJMA 1Q1JL 2IODA 5F7WC 5FECA 5FXMA 3C4VA 3QUMA 5DUPH 1BG6A 3WZ2A 5K3OA 4PY8J 3SZ6A 2WWOA 2NN3C 3ZWAA 3LBAA 3LY6A 3POCA 4LK2A 4XNZB 3IDGB 2QRGA 3VDXA 3SQRA 3LP6A 1H23A 4WEQA 1T1WA 4OFBA 4DILA 4C7OA 2JCVA 3BZEA 3GSOA 5GGYA 2RGUA 5DHEA 1YPZA 3ILXA 4WKCA 1ONOA 4Z0TA 5IB4A 4G07A 3R3UA 3D3WA 3W77A 4NYLA 2GSDA 2NY0B 1B0RB 4RPIA 1KPGA 4WI7A 2Y1EA 1FC1A 3O9MA 4XR8C 5LWHA 3SKMB 3C3KA 3U6KA 5EIVA 1FE8A 5DM70 4F8OA 3HCRA 3OPYI 3U3XA 1D2RA 2X6CA 5EJAA 1RHKA 5T1KD 2B4KA 1BVOA 2BP7A 4FXGA 3NACL 4XMWA 1YJQA 1IQPA 2GO7A 4E5YA 4GQQA 1MAMH 1NBZB 4ZT1A 2PR2A 2OD2A 3MRKB 2BN4A 1UC9A 1NURA 5CLTA 2E4AA 4AICA 2XFXB 3K8ZA 3M34A 2XKUA 5FUBA 2QT0A 1MUUA 2JJMA 1NHGA 4QKQA 1TUPA 5EQFA 3V4UH 5JY1A 1FYWA 1A9BA 3V4PL 1K8DA 3ZWOA 2DTSA 1KPRB 2OCCB 2IUSA 1LNQA 1T2JA 4WV1B 6NULA 3SJ7A 3C08H 1R0SA 4KPGA 5BYKA 3CLVA 2P26A 4HXAL 1P0IA 1NZFA 1PJ8A 4U1IA 4UQPA 4CDRA 2YGNA 3ZR6A 2XTJB 5F23A 3FT4B 1XMXA 3B8YA 5K09A 2D1FA 4HAVA 1N6HA 3D6HA 5KYXA 4IGFA 4D96A 2RGWA 2O59A 4PJEB 4ITRC 3W6OA 2HFFA 1D9XA 3BZFB 2PKEA 3WQHA 1DWUA 3KFVA 1CFNA 4O3FA 1IBYA 5JCOA 1CG9A 2WVAA 4HIPA 3BBLA 4A8TA 1AH2A 3MJ4A 1GKOA 1NRIA 3EOYG 4JAVC 5FRDA 1IJBA 5CLIA 7MDHA 3OZKA 3E2MA 1E0KA 2W2PA 4PF1A 3FOLA 4LLDB 1A2YA 1GUBA 2XEDA 5DLPA 4GAYB 2FRVA 4FOSA 3Q7EA 4L8CB 2V45A 1SXQA 2OSBA 3TSYA 1K0FA 1YA8A 3H2BA 1EXNA 4UNQA 2IXQB 221PA 2H32H 2OL4A 4UAOB 4HRVA 3MUJA 4FGMA 3CF6R 1HZHL 3L4UA 3PQ6A 1O7DE 2VL7A 3QVWA 5FWXA 4F9EA 4P3CL 5KSAD 1AGBA 3UJNA 1T22A 4CU7A 1I0LA 1BE1A 5LUBA 4BRJA 5JAUA 3G2NA 3MRDB 5CPFA 1P44A 3SHQA 4LXQA 2YPVH 3KPPB 2AQ1A 3ND7A 3BP6A 4U1RA 3WS7A 2WXGA 2W90A 2Z31B 1EZSA 3AFMA 1T5HX 4WGVB 3ZGZA 3OHXB 3N1FC 5ALKA 1P1JA 4FYYA 4K94H 1Z5LB 2EYTA 2WP8J 3ROTA 2HCBA 4MA8H 3ARGA 3OR6A 1JK9A 4CJ1A 1T3FA 1SRDA 2E9IA 1SC6A 2J6EA 4X99A 3JT0A 4XE5A 1ZJYA 4CG3A 4ZD3H 2PJZA 5AG9A 4NO2A 3KQLA 4XM0A 5LB1A 1WE2A 1X7QA 1U3DA 4P4KD 1QP1A 3H2JA 1L9RA 1SXHA 1LEKA 1Z9MA 3SODB 2YJQA 4FQ1H 3NWOA 4GBGA 4TT3A 3TN7A 4F86A 2L3BA 4MNQE 1GPLA 2WG0A 4FF9A 4TYQA 3FGNA 2VHJA 3ZOKA 2WHXA 1PNCA 1P31A 1MCIA 3FSEA 4HSQA 1SXJD 4KK5C 4QWWD 1K72A 3RWFA 5HHVL 4EXKA 3QIWA 2BISA 2XVYA 1RXSA 2FSEA 5CPBA 1OH7A 4FFSA 1KFKB 3AUWB 1ZD2P 3W8FA 4LNUB 1KFGA 4BIKA 2NXZC 1P4GA 5FUOH 2J8UA 2W38A 4LCCB 1V5GA 1B6GA 2AC0A 2FX9L 2Z6QA 4P3YA 4ZKDA 1CIPA 1E9QB 1EMDA 4EB6B 1HNXB 1MCLA 4JQVC 5EZJB 2WPDA 4RE6A 1XQYA 4YXHH 2DZDA 2PWAA 1FOEB 2FMUA 2J3MA 3DEYX 1FG9C 4OCYL 4FXKB 3H9SB 1KJVB 3NYRA 1GTMA 3PHAA 4ZMVA 4BLOA 3ICEA 1CUHA 3KALA 4FQLH 2Z35B 2QMOA 4K9SA 2J33A 5C9JB 4ME6A 3GNLA 1AE1A 3LCMA 1X13A 12E8H 3TZVA 3LCJA 3HR6A 4R5XA 1LWNA 5JS1A 2ZOKB 5IH7A 4ZUSB 1F8TH 3V4FA 4CGUB 4G8IB 4QD2E 3FQXB 4AVHA 4BQ8A 3BEDA 1TPYA 1SDDB 3ETTA 1UT2A 4JRXD 4A2WA 3S6JA 1B0GB 1OLZA 3CCBA 4YCMA 2A9PA 4YOKA 4X6FB 1W6UA 5T33L 1GRNA 2BK8A 5JSKA 1IYZA 2PZEA 2NTVA 4JFYB 1K5DA 4CN6A 4C7JA 1ZANL 3OMXA 3WKYA 1NBCA 1TQBC 5BW8A 4MRMB 2GTPA 2DM4A 4QGSA 1SJVA 2YWCA 2H6UA 4HVBA 3U61B 3AXSA 5AXBA 2EUVA 2VUTA 4KR7A 4EPXA 2RFXB 3ZKND 1CZ8H 4BH8B 1JV5A 3IDMB 3PUCA 1SPDA 2OZ4L 2WQSA 4N2IA 5DUMH 4KH2A 4GQIA 2Z65C 3EDDA 3BE1H 4GO6B 4RJJA 2CLMB 3N0WA 2YMPA 1RM4A 3O5AA 1ORSA 4MXVE 1WW2A 1ZL2A 2QW8A 4KVZA 2JI7A 5SZKB 3N2EA 3C7TA 5D1ZD 1U4OA 3FH5A 4MVJP 2IYNA 3QVLA 1P19A 1DANU 3VOBA 4I0PD 4KK6D 3PCRB 1DX4A 2NXJA 1MHHB 3Q9LA 4ANKA 4EUFA 1NIBA 3BMWA 4HRYA 2DKOA 5KS2A 5L8JB 2I7OA 4N9QA 4GSLA 3KWTA 4QO7A 3H4FA 4DKAA 3WHXB 1FDWA 4JQXA 5CBEB 1J9RA 5BNIA 5J4HA 3HO8A 1XZBA 2H63A 2HG0A 4Q1FA 4BCYA 2CHUA 5ADUS 4IKIA 5DTQA 3S81A 3VTMA 3CW9A 3LHPL 1C80A 4K5MA 1AQUA 5FO8A 3QEHB 3HFMH 2FNWA 1RZ7H 1SVIA 3WKMH 2NT4A 1WXWA 3G8CA 3VC1A 4FRWA 2C61A 3IAAA 3CW2A 4X6UA 3LUAA 3ZTJG 1QCZA 4FYQA 1C3OB 3GQVA 4I9GA 1EQWA 2BMFA 3UNXA 2FWJA 5T57A 5DQJB 4B7AA 1DSFL 3AL8B 2YNMC 2JJ2D 5C08A 4MPPA 4BQ9A 2PO6C 1WBJB 4M3HA 5BQ7A 1EH5A 1TFPA 1XWVA 3G9XA 4A2LA 1BWWA 3HJAA 2W83A 3MXTA 3H42B 5D6NA 1P81A 3T5PA 2FVXA 4JUAA 3QIUD 4K6KA 3IPEA 5GADl 1WWBX 1IH8A 4O2FA 4RZCA 1QH1A 3GXBA 2L4OA 2QQKH 3MJTA 2A9KA 2DR0A 1S8NA 4HMQA 1WPCA 1V54B 4PJGB 4HIXL 4C1BA 5AM2A 1E8MA 3K5HA 1BZQK 4G80B 1YKSA 3VGDA 3BN9C 1YAZA 3E0XA 2EQAA 4AE0A 2WXIA 2HHLA 5DTJA 3H04A 4RD3A 5A3QA 3EYOB 4ERXA 5BQ3A 3JQ8B 4I7ZC 3ZKAA 3EJQA 1XTMA 2X89D 1T3GA 2DIJA 4D94A 1ZVJA 5G2NA 2D4HA 2GJ8A 2BC4B 4NLHA 4AJYV 3FTPA 1I7DA 4BO2A 3TMKA 2HI0A 2BI7A 3C8KB 3GJ6A 4JBIA 3SSGA 1W29A 3GQBB 2RHGB 4OM7A 3PVSA 1FZMA 2ALWA 3D2TA 2BFFB 3AERB 5DGXA 3GJRA 2ZTLA 3PPEA 3GOQA 2IUEA 4YK4B 2BRRL 3ONNA 4X5WA 2OQIA 2A8YA 4NOMA 1KLGB 2I6UA 3S2EA 4CMJA 4JFTA 1CR4A 3GB9A 3B2EA 4NT6A 1WFUA 4RK1A 4ZPTA 3A6OA 2QNBA 3LDHA 1QZZA 1UUNA 1YPZE 2C8JA 5SY6A 1EPFA 1TTQB 2W60B 3OAYH 4WINA 1LS6A 4BWUA 1JFQL 3GTNA 3MINB 2YA0A 1NF9A 4LF4B 1L7OA 3DEAA 3F6RA 2LTQC 2A2QT 4FJYA 3GLIA 3DC0A 2QAJA 4GBMA 1O95A 1E61A 4WI4A 5EN2A 1AKTA 1WFIA 3DVGB 4N2OA 4P4UA 4HB0A 1J23A 1W2GA 3D30A 3ZTNL 3SOBH 2FUNB 4F38A 1PZCA 5IEHB 1VP9A 2ZCVA 1LQ2A 4DZBB 5AB0A 2O7RA 1Y63A 4NNYA 3WNBA 1CDBA 4J49A 4MZ3A 1GNRA 4TQEL 1W2KT 1G7HB 5E1BA 4DCVA 1LX6A 4C4AA 3FQUA 2ZYUX 3ABQB 4XEUA 4DSAA 3CLSC 5K3AA 1SHJA 1HL8A 4LVHB 3WQBA 4I9NA 1RWXA 4P46D 3H9HA 4OB5H 4MJ5A 3OOJA 4DLRA 4XYLA 1HOCA 1FGVH 4KAQH 2J71A 3PQ5A 5KTNA 2C03A 4JUIA 3OMAB 2UX6A 4S05A 2BKUA 5KTYA 5B1AB 3ZN6A 5INTA 3R7DA 1I8MA 3KPQA 1OQOA 3G6KA 3G5VA 2XMSA 3CS3A 1K3FA 2FPMA 3Q5DA 2HHAA 3T9WA 1M7DB 4KQGA 2FZKA 1JUFB 3B7YA 4RF3A 3QHAA 3IIMA 2VZSA 2XCRB 1ZD9A 4MXVF 4KXFB 4J6RL 5F1YA 4Q7EA 4ODHH 4PJXB 2GVDC 1IWBB 3LQZA 2X2UA 2C1ZA 4XXCA 2HJFA 2D0GA 3JZIA 1NPYA 4MRVA 1HV8A 3HVHA 1QC5A 1ZS8B 4NBUA 3AG1B 3HC7A 5GJTL 2XD4A 2IJGX 4Z7VA 2O5EA 3X11A 5KZCD 5DP1A 5CINH 2Q7AA 2CXXA 4GKOA 4BFRA 2WD7B 4K5LA 1EP2B 4NQUA 1XROA 3VG9B 3PWPA 1Z0FA 4BCXA 1DZ3A 2V8LA 3JR3A 2IIVA 4Y1RA 4X50A 5FDWA 2AX4A 3I9JA 7ABPA 5AYUL 1OBVA 2XXAA 2C1OA 4UULA 5KBLA 3IBYA 1P5UA 1JPTH 3HBJA 4OHXA 1ZGAA 4YHZL 3WGVA 5HRCA 1SBQA 3BAYA 1F4WL 3P4YA 3CDZA 1EGVB 2ZTVA 3UMRA 5IJ0A 3M6FA 1R3HA 4CPDA 4NLAA 1ZS9A 5GSRB 2FCAA 4M5YH 2FRDC 2ZDQA 1Z0UA 4OHMA 3JYCA 1UC5B 5CJXC 3KYKL 4P4GA 4Z51A 5DBGA 1R0AL 5K99A 1JF6A 1YC8A 2VYRE 1U0HC 3VKGA 1EVLA 1I3CA 5DYTA 3OU2A 1JGIA 1JAEA 5ICXA 3LHFA 3FQYA 2JD0A 1XD2A 1ID5I 4NF2A 5AI8A 4TNFA 2CD7A 2FB4H 5ALNA 1YRAA 2WHYA 3RNLA 4ZX3A 4ISVB 5KOJB 4G0PA 1SR8A 1TXGA 4NSKB 2G1KA 4UUAA 3M6LA 1J2TA 1VB9A 5FAKA 1UMDB 1TMOA 4EA6A 4LSUH 1W0VA 5FA6A 2CRIA 2WSDA 1J5IA 4E12A 3BJMA 3FNIA 5K3DA 3CC8A 3OQRA 4C2AA 4PBTA 4PSDA 3REVB 5BV0A 3BIFA 1RYBA 3O1IC 2O2YA 3O6FA 5CIPH 2G40A 4XTRD 2XWSA 2J8UE 4GXFA 2VISA 1EAJA 4M43L 1Z0IA 2HLPA 2QMJA 4DCUA 1UOLA 5LNK1 4KY1H 2YD4A 4TLTA 2EVWX 2AITA 5DRYA 2XGMA 4HIJB 4INZA 4RZXA 4I0CC 4S12A 3RJDA 4NZZA 1FSPA 1IL1A 3IN0A 5J4KA 4X94A 3T6WA 4AKTA 1F3JA 1ZGHA 3JTEA 2CVHA 1IXYA 4F3YA 4ETQA 1O0VA 1AQDB 3BT2H 3IB3A 5J63A 3W5AA 3JQ9C 2AEOA 3PITA 5FFGA 1F1DA 4ACTA 1X38A 3WNLA 1E3TA 2XZOA 3V3TA 1NAKL 1TZIB 3AR3A 1U6JA 4P5MB 1RQGA 3O3MB 5CVJA 4KQ3H 5F9JA 1A82A 4DLKA 2ZB8A 3O74A 5E38A 1YPZF 1NCAL 2KLHA 2E46A 1R37A 1E94E 1OAZH 4I50B 2MKWA 5AI6A 2X9WA 3KB6A 4PVCA 3ARQA 3HRZA 3GO1H 4RYLA 3CO5A 1AI1H 4B8YA 1GYPA 4H0IA 4JHWH 2N0KA 1YBMA 5BSKA 1M7XA 5LVAA 2DW5A 4ND4A 1EK6A 3RVWC 3UYPB 2UWEA 4LPWA 1CICA 1DLJA 2CJSA 1MJ5A 2GB2A 1ORVA 4XGNA 2XUDA 1OAAA 2IP1A 4L8WB 1T83C 1MOEA 3W9EB 2X0FA 5C3TA 5FV7A 2AK4A 2CUNA 2GPYA 4U7TB 4D9EA 3GTVA 3RLIA 1UFRA 1V3KA 4YGXB 3FPSA 3SLGA 3OQJA 1U8PA 1QVOA 4P99A 4R3SB 6TAAA 2IOQA 2ZAGA 4BKUA 2G1AA 4ZOLA 3BJ91 2P6MA 3CPSA 2R2HA 4DMMA 1XAGA 1GKKA 3W1EA 1DIAA 3O6ML 2RE8A 4NCKA 1R9GA 1X80A 4QUHA 1W47A 3T0EB 1K5HA 2V2WA 1EE9A 3ROZA 3LEVH 1LMKA 1MIMH 4J1TA 4XOCA 3FJ1A 1C3JA 3GNQA 3VM7A 4OCXH 1T5IA 2R6AA 5HJBA 4UC0A 3J8F7 3DF9A 3JYBA 4JY4B 4IDBA 4KXXA 2BNQA 3EUAA 1EVTC 1MKYA 5AVQA 1PQZA 2HN7A 3QISA 3K1AB 1QIEA 3B7UX 4XOUA 1GVIA 3V5HB 3K2KA 3G9VA 4QYWA 1HZZA 3FFCD 2PX3A 3BVPA 3IMKA 1PG2A 2QL5A 2Q2WA 4OV5A 3HS8A 5H9VA 1DBKH 4TTRA 5IX8A 1ISMA 1M9NA 5TPWB 4LZOA 3FCGA 1AR1B 4RGYA 2QPTA 4ZCSA 3IIEA 3V6BR 1PFQA 3GZ4A 5I8ZA 1JLLA 1SY7A 3O3NB 2FW8A 4B4WA 5T5FA 4RD6A 2B34A 4J0QA 3L2MA 3OLYA 2LWIA 4FLMA 5C07B 1U7HA 5JHLH 1CTOA 1T0PA 3FCOA 1ZIBA 4Z6KA 1YN6A 4LE1A 3V1TC 5C08E 3CR7A 2WSPA 5M2QA 1MG2C 5A43C 2JF0A 2NQ2C 4DQOL 5C8YA 4ZUWB 2QUAA 4ZVSA 1D5MB 4G0ZA 4K73A 3OJCA 4WT7A 4X54A 3RUGB 4Z53A 1F2XK 2Y6UA 4US0R 1AK2A 1MW0A 5F89A 5EORL 3ZD6A 1Z0AA 3IEXA 3FQRA 2Z7WA 4N87A 3Q5EA 3WFHB 1YQUA 2XB2A 1EO7A 4GQAA 3EJUA 2FX7H 3T8VA 1W96A 4YJHA 5CB6A 4Y2TA 2AE1A 3OPUA 4IJVA 1RKUA 1RP1A 2BH9A 1JTVA 3L1OL 1X2BA 1G42A 1KLUB 4UCWA 4H44C 1UFOA 3HN3A 3HBNA 3R20A 3RANA 1CS6A 2EV9A 2HK7A 4W9DC 3F84A 3IV7A 1MAVA 1LF5A 3HC4H 2GY7B 4X8CA 2ODAA 3KJEA 3PIDA 2PBLA 4GOKA 4U6VH 1G8SA 1UXSA 4B5ZA 1TM1E 3NW9A 4JS7A 2NPLX 4PGBB 1XGRA 5TE7H 3U6BA 4J29A 4MLCA 1X0XA 1N12A 1NOLA 4TL6A 5IVHA 3W8DA 3ASUA 1JMKC 1WDLA 5C5EA 5KVDH 5FADA 4HEA1 4BK5A 1DOAA 1TF7A 4IIQB 4IS2A 3MTXA 2GYSA 1SVLA 3DLPX 1ETUA 1UVQB 4UPEA 2J8UF 4ZJYA 1ML0A 4M8IA 1F17A 1PEZA 5BXQC 3S70A 1A21A 1P8AA 1ZJAA 3D09A 2Z0MA 5A2AA 2GITA 3L9XA 2OZLB 4GRIA 2MCMA 3HBZA 3GAFA 2QE7D 2Q4BA 2VL5B 3LBHA 3KVPA 1BHJA 2ESVD 4RHCA 2BTOA 4HLZG