3NIGB

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alpha-IIb
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 127
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nigB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nigB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nigB03
3Q3GE 1Q0PA 3RAGA 1L5GA 1AUQA 5HJ2A 4Z7NB 1RRKA 3EGXB 1XDGA 3ZQKA 5E6RB 1IDN1 1PCXA 3PPXA 2ADFA 1RTKA 1YUKA 3N2NA 2VDMB 3BQMB 3HI6A 3EOBI 1M1UA 4DMUB 1SHTX 3EGDB 3M6FA 5E6UA 3BQNB 3EH1A 3IBSA 2I6SA 3AL9A 4IHKA 2NVOA 3OL2B 1N3YA 2XWJI 3HXOA 1CK4A 1MJNA 4MMYA 1ZOPA 3NIFB 1IJKA 3EG9A 3EH2A 4WFQA 4CNBA 2VDOB 4A0QA 4JDUA 1MF7A 2VDQB 2WINI 3K6SA 1CQPA 4F1JA 4M76B 2NUTA 3FCSB 4O3UB 4Z7OB 2QTVA 1BHQ1 3PPVA 4NENB 1AO3A 1PD1A 1JLMA 4K3JB 1QCYA 2VDRB 4PN7A 5E6SA 1AOXA 5KYYA 4MMZA 5LN1A 1JV2A 3V4VB 1UEXC 4WJKB 4F1KA 3VI3B 1PT6A 3PPYA 3ZDZB 4WK2B 5KYWA 3ZE2B 5BV8A 1U8CA 1M2OA 1T0PA 1M1XB 3TCXB 4MMYB 3NIDB 2X5NA 4HQLA 1QC5A 1FE8A 4UM9D 1SSLA 4CN8A 5KYXA 3K6SB 1M2VA 3OKWA 1ZONA 3NIGB 2ICAA 2NUTB 1IDOA 3K71B 1PD0A 3FCUB 1MHPA 2O7NA 3IJEA 4XW2A 2ODQA 1JEYB 2IUEA 5KYYB 2B2XA 1L5GB 1MQAA 1JV2B 3NVQA 4O02A 1XDDA 3TW0A 4G1EA 1JEQA 2XWBF 4G1MA 5KYWB 4UM9B 4IGIA 1FNSA 1ZOOA 2VDKB 1QC5B 2I6QA 3K72A 2WW8A 3ZE0B 5E6UB 5KYNA 3GXBA 5KYXB 4MMXA 1U0OC 3QA3E 1DGQA 3HXQA 1SQ0A 1RD4A 3IJEB 4BJ3A 1NA5A 3F74A 4C29A 1MQ9A 4CN9A 1ATZA 3EG9B 3E2MA 3EFOA 4O02B 4FWWA 1JEQB 3EOAI 4HQFA 4G1MB 5HGJA 1BHO1 1U0NA 3EGDA 4WK0B 4Z7QB 2M32A 4HQKA 1YVPA 4WK4B 3VI4B 5E6SB 3AL8A 4MMZB 2VDPB 1V7PC 5KYUA 1DZIA 4FX5A 3F78A 2NUPA 1OLZA 1T6BY 1RS0A 1U8CB 3T3PB 3AFCA 4NEHB 3V4PB 3TVYA 3TXAA 3FCSA 2ODPA 3EFOB 2P26A 5HDBB 4NENA 1M2VB 2VC2B 4UM8B 3ZDYB 1IJBA 3T3MB 1MQ8B 3ZDXB 1OAKA 3OKYB 3EGXA 1TYEB 1SHYB 4JX0A 5E6RA 3ZE1B 4C2BA 3AL8B 1M10A 2I91A 2VDLB 5KYUB 4GZ8A 5ES4B 4G1EB 1YVRA 3BN3A 1M1XA 4HQNA 1XUOA 2VDNB 2NUPB 4HQOA 2P28A 1N9ZA 1LFAA 4C2AA 3PPWA 4IXDA 2UZYB 3K72B 3K71A 3OL2A 2XGGA 1SHUX 4MMXB 1JEYA 4O3TB
chains in the Genus database with same CATH superfamily
4JO3L 2IAMC 2UUDK 3X1WA 1B8NA 2GCNA 3FB8A 4F24A 3EMVA 1UPCA 2J09A 4IX9A 5B7PA 4OF6A 1MREH 1SN7A 4G1VA 4JUCA 2X2FA 3RQSA 35C8L 5BRPA 1U5BA 4IH4A 2WO4A 2XU9A 3PIQB 3JATA 3SOBL 4AMZA 2DLFL 2C1OB 3QUMB 2P6PA 2WB2A 2NY2C 4ANWA 1Y0LA 4EM6A 3BDYH 4P2QE 2GEUA 2EERA 3QIAA 5TIIA 3GVHA 1S9VA 1VTKA 3HXLA 3AJAA 3NCBB 1RUAL 4MICA 4XASA 2GRUA 1VE5A 4NBVA 3N0RA 2FJPA 2ITCB 1LTHR 4NBXB 2GRJA 1PK9A 4XO4A 3OPZH 4OVKA 4PZAA 2YASA 2I5PO 5IWAB 5BR4A 4O2AF 4O4HF 4FYRA 4IWNA 1F2TB 3SXPA 1X5IA 3FW1A 2BONA 3EOAI 5EOQH 4M1OA 5LZ9A 3WWOA 4QDTA 1A6WL 2YC1B 3CXFA 2KE5A 5FF6B 5ISMA 2IDUA 1JHMA 5EJAA 1F4XH 2ZF9A 1BDMA 3KPRD 2P3OA 2Y93A 3CLUD 3OKEA 4L5FL 5JPCA 4CCYA 1NJSA 5AL8A 1KJ3H 5C3LD 3GLSA 1QYRA 2H1LM 5GZ3A 4CKCB 3L5WB 5BWLA 3E4DA 4R0MA 1VA4A 5TX7A 3ZN2A 1IILE 3Q3GB 5F1IB 1IBSA 2P9QA 4YAQB 4OZIF 1IULA 4LJ5A 4P80A 1A1OA 3M46A 2OR9L 3JTTB 4P0DA 4YHIB 3VDBA 2VO8A 3K6SA 1FNGB 3RVLA 1Q94A 3QRBA 5TFSL 3TM4A 1D5IL 2VBIA 3CZ9A 2OQVA 3L1FA 3LHPH 5BO1H 3QG6B 5F8RC 3H9SD 4DGWC 2XFXB 2G1JA 3CXRA 2ENPA 2AK4B 2PGJA 4FDLA 1HCYA 1PUJA 4DREA 1GTVA 5JTWA 3DS8A 4LIPD 4AYBA 2N47A 3IESA 1TEXA 3NXKA 4WO4D 2VPQA 4QPZA 1N2OA 2KDYA 2YMLA 2JJ1A 4NSNA 2JFPA 1AOHA 3Q2VA 4AN4A 4CG2A 1I1YA 1YZTA 1MUUA 4BCCA 4NPYB 1BBJB 4PRNA 1SGWA 3OFKA 3GSVA 5KN5A 3L0ZA 2W6JD 5T8KA 5AL0A 1CRZA 3GZNA 5IJWA 3BEWB 1HTYA 4AW7A 4Z3JA 4WI0A 1E59A 421PA 5BW5A 1E9RA 2QTCA 3GGCA 3T3MB 4JI0B 4DVJA 3RWBA 4DCSA 3BN3A 1L9QA 2X4OB 4GUPB 4AIZB 1J56A 5B1KA 3CGTA 1IPFA 4X6YA 3EOAA 1W0VA 2GZAA 3WN5B 1ESZA 1Y1SA 2J46A 3P11L 2VZ1A 2HPAA 1U93B 3G2JA 1R6BX 2C61A 3KKQA 4GIBA 1MWAL 3GIVA 2X86A 1TVHB 4M7WA 2AVDA 1YA4A 2NR6D 3EVNA 4XR9A 3FNIA 1Z39A 1ESEA 1Z8DA 5C0IB 2P35A 3FQNB 4B9FA 4RK7A 1I1RA 1U8LA 2QTVA 3MGOB 3H54A 4HLUC 4L5JA 3P9LA 4LL9A 1ZSDA 5I18H 1DKMA 3RFZB 4FLHA 1IAVA 3WWZA 4RVDA 1OVGA 5I2IB 5HIAA 3CPHA 3VYRB 3R8XA 3IQDB 4QUBA 4DSOA 3SK0A 3BKJH 2P5EE 5B8CB 5EMKA 1Y8AA 2EKSA 3Q9NA 2RGSA 3I2JA 3TB6A 1IKOP 1WPXA 1M6HA 3TVTA 2FJHA 5HQ3B 2XNDA 3IA2A 3WENA 2EXWC 4I7EA 1TM1E 2C7OA 4CL2A 4JVLA 4HZ1A 3IAEA 1YMQA 4D6YA 4K3UA 3IBOA 1QFXA 1UMDA 1B3JA 1WNFA 4HV4A 1B93A 2P4EA 2A35A 2QDKA 3Q2CA 1GITA 3ZD6A 2F43A 3WL9B 1R9JA 5IVXF 3W90A 2G2RA 2OXCA 5ERXA 1WB6A 2YN4A 5B38G 2XQYA 3TN0C 3FS9A 3QV1A 4IIFA 1T2FA 2PCPB 1ZIAA 3EO0A 5FI5A 2H2PC 2AFHE 4OD3H 3JSAA 1TGYA 4O2AA 4O4HA 4U7DA 1LXCA 4UQ2A 3L8MA 5ALEA 3CEAA 2W70A 5FJJA 2QZJA 4EJMA 1M7UA 5IZ7A 1DCTA 5L95A 3DJZA 1U3JA 5DHRA 2AQ3A 2DPMA 2YKGA 3SR0A 4O2RA 4X8CA 1ZCBA 3IP1A 1TQVA 3QXGA 4OV5A 4WEBH 4TQ9A 4L0DA 1WITA 1YUKB 4JHUA 3CX4A 2YGOA 4OV6B 1JQBA 1V5WA 4ISCA 1DJOA 1GMEA 2J8ZA 4IBOA 4RF2A 3CRZA 1IZ8A 2VPIA 4B7AA 3OZTA 4Y2DA 4EUPG 3OLQA 2OBXA 3GX1A 1I2BA 1YTUA 5DLML 1XAJA 4C4KO 1AKJA 3EG5A 4N2DA 2Z2JA 5DMIL 4OZIA 2CUIA 2YNMD 4PBVC 5D4JA 2R9VA 3AESA 4I5IA 5EUOA 4ZTZB 2YWJA 4KJYB 5LP6C 4RFEB 2GLUA 4BBPA 4RHFA 4TVSa 5DKFA 2FZ3A 2Q8AH 2MINA 2JLVA 1H5UA 5KG9A 3TJMA 2ZX6A 5DI3B 2Y5EA 2VPXA 3IFPB 3RGHA 3VQMA 2VXTL 2B9EA 2W2OA 3QPQD 1TQTA 4KRYA 3BXFA 3ND8A 1SA0B 1FF9A 2VEOA 1R33A 1NCBH 2BSSB 4HAKA 4XOAA 1RZ3A 2BMEA 2RMNA 4MCHA 3AI3A 3RAFC 2O8BB 1ONBA 4KDCA 3KWWB 1N0IA 4P3YA 4ARZA 1QEWA 1E43A 4MQ4A 1Q7CA 4LHZA 1KMMA 5GHWH 4AE0A 2INGX 3U79A 1H0KA 4HHAA 3ZBQA 3JD1A 2CGRH 4R01A 5AKJA 1EP2B 4JT4A 3PABB 5EJEA 2ZS9A 3EDYA 5BR1A 3V2GA 2F90A 1IY0A 3HG7A 4HXBH 4B2YA 4IUCS 4J90A 3LD8C 1KXQA 2DS4A 1II4E 3WG7B 3QRFM 4PJBA 1GTG1 1SG6A 3UTPE 3DE2X 1J8FA 3U9PH 3EZ8A 3NP4A 4BFOA 1GFIA 2QB5A 4DCQA 4LKCA 1GPYA 4D42A 1T0PA 1JYVA 1MAJA 3URMA 2IEAA 4OHYA 1RJZB 4G3YH 4W6WB 1I3GL 3T2NL 3VG9B 4FW8A 2YPLD 3IBCA 3UYLA 4URZR 4KDVA 1K6QL 2NW2A 1JDAA 4OJYA 3GHHA 4Q0XL 1FBTA 3F3KA 43CAA 3A1DA 2WUEA 3ZGZA 5DS8B 1A2QA 3REGA 5HJDA 5E8DL 5GRJH 2E6QA 4X5LA 2PL5A 1P80A 3R0IA 2QSZA 3M4ZA 3W04A 3MXWH 4EA8A 1DS6A 1O94A 1NIEA 3QVWA 2HPHA 2KX7A 2B14A 5BN3A 3HU5A 4B31A 3FT9A 1BD2D 2XIDA 3BGMB 1TZJA 4NO5B 3O45B 2IZZA 3FDZA 4XLZA 4UBNA 1K6MA 2WKOF 3G82C 2ARJB 4GPD1 3SR3A 2OD7A 1QSVA 2E86A 2GYSA 4OCMC 1OSZB 5J2UB 4BWFB 3KPVA 4I5BA 2BW4A 4TMPA 4KU1A 3OPYB 4E1BA 4NBYB 5L2JB 1K1EA 4UUOA 1KCRL 4Z95H 3FOBA 1TE2A 3DV6A 2L7JA 1E27A 4GZ6A 2Q6WB 4ENRA 4RWHA 1QCDA 2AGJH 2NAPA 5IVXA 4QRQB 3DX7B 4ODUB 4HLZH 2XQYK 4AMYA 5ADPH 1M71A 1NMAL 1QB7A 1I24A 3OKNA 4Z7UE 2TRYA 2H48A 3LT5A 3MMXA 1IDOA 5TD4A 3DTVD 1SF3A 1E7RA 3QA3A 2A1IA 2OAEA 3P52A 1XYVA 3FUHA 2GVZC 4DZZA 4ZV9A 1JB1A 1XDWA 2WSKA 1L5NA 1HILA 2OFPA 4KI1A 5FWRA 3JQ6A 3CZFB 3QWBA 4A73A 1QE5A 3X3GL 2D7OA 2O05A 4YJ3F 2II6A 3ZTYA 3PX3A 5LDGA 3U9UB 4G1MB 1LC3A 4JY6A 5FFFA 3ZZNA 3COJA 3CX6A 2WJZB 1L3BA 2F8LA 5C07D 2EVWX 4MWBA 4NN5C 5IQOA 4PRPB 1PEYA 3HWRA 4EATA 1Q0QA 2EDFA 3SVZA 4GUCA 5F23A 3HCVB 1KO8A 1PVDA 3IQHX 1W4RA 1QRDA 3ZKXB 4KKRA 3FTGA 4R31A 3OX3A 4RIEA 4NE7A 2HCZX 4MW9A 5P8WA 4A38A 2IH5A 2E1PA 3ZWOA 4JZNB 1PX4A 1HBJA 1B4JL 2IH3A 1FNMA 5B1JA 3W39B 5CJ2A 3ZDXF 3PKIA 2X6TA 2YQBA 2FG7C 3GO1H 1NDQA 2VDUE 3RGWS 3ZY5A 3QTBA 4GJTB 1SBQA 1M5UA 4C4XA 1LNZA 3POHA 1CDEA 3B78A 3AJ9A 3OKKB 1DQZA 1BQSA 3FB7A 4PPTA 1LK3H 5JH7F 1URZA 4N2AA 2O3QA 1FFOB 4TUOB 4EVNA 4JOCA 4EQ6B 4X7BA 5AYUH 1P7BA 1TETL 3CU7A 4NUGH 4S0TD 3BZEA 25C8H 1Q12A 1Z66A 1KI6A 1ZCZA 1XLWA 1JDTA 4UNNA 2IAMA 1O08A 1BM7A 5JA8B 1DSYA 2VIIA 3IMEA 1UPFA 2H45A 3X1KA 2YZ2A 5KCMA 1I9JH 3TPUB 1YB4A 1T9BA 5BWOA 3FA2A 4FTWA 1P1VA 1ADBA 3M34A 3CPEA 5DYIA 5EBLB 4GH5A 3FQWB 3FCCA 2GD2A 1BEYH 4IDLA 2I7VA 4G5FA 1G3RA 4N2EA 5I76A 2VL5A 2QADD 4E5XB 1NLDH 5E1QA 1WCV1 1Z12A 1UT5A 1LTXA 5KSVB 2R2BA 4UBIA 2BSAA 2YMQA 2DFNA 3H5TA 4X1YB 2NUPA 4A66A 4JM2F 4I0PB 4Y4KB 3TVMD 4JKMA 3PJFA 2YRPA 4LARL 1QHGA 1TQDA 5E1AB 2AZMA 3RRZA 1YRQA 3D0LB 1MCPH 2HLNA 2GITA 5EDXA 2ZTUA 3HV2A 1KUMA 1UEMA 1OYWA 2ZJ8A 4AUNA 1KZYA 4N0CC 4Q3LA 5HF8A 5AOBA 4LRYA 4N1AA 4OKVA 4QT5B 2QV7A 1NYRA 1IBDA 5AM1A 4IRZA 3MM4A 3IAAA 3BFVA 4N01A 1LS1A 4PAOA 1HXYB 3RC2A 4PXSA 2D3NA 1D5CA 4DCCA 5L2KA 2N42A 3LEVL 3WIHH 1XA0A 3F01A 1PJAA 2V2TB 2AR0A 1RAAA 4XZ4A 3CVYA 5EVJA 2GPSA 4M1CD 5J0BA 2WKOA 3BWVA 4H7HA 2OHVA 4CW7A 3BPOC 3GOQA 1J2YA 5BRZB 1MRDL 2OB1A 4ER3A 2IL1A 1XPOA 4I50F 1HKHA 1SMKA 1XWIA 1RZJL 2C9SA 1FU8A 1MZVA 2JIZD 1IE5A 1NGYA 3DTXB 1E6EA 1UMBB 1DJMA 4R9VA 4GP9A 5LP6F 5AZUA 1UOVA 2H0QA 4KU4A 3JCZA 5ESQA 2F1BA 4MWDA 3GZPA 4BS9A 2CJYA 3MCVA 2QVYX 4GBED 2I6XA 5HKKA 2IDCA 4YDQA 2WHPA 1JVOA 4ENED 3GEMA 4LHYA 1A66A 3T2OA 4H7DA 1NKVA 4ZQKA 1CWVA 5PGMA 4C3VA 3EQ2A 2VJPA 4QXTA 4NCJA 3AHCA 5BV7B 4HULB 2VAXA 2C4FU 4PJ7E 4NICA 4JC8A 3KR2A 3V7AE 4NENA 4S2UA 1YDWA 1NGSA 5C0GA 4Z3IA 1TLFA 5LQBH 4XP4H 4ZX5A 1X70A 1MQSA 3BK7A 3IJHB 4BO9A 4M4RB 4WSJA 1NUSA 4GC9A 2KBEA 4Q4AA 1VL8A 4F84A 2PANA 5F0LB 3FSVA 3BDXA 1W8IA 1H3EA 5T1LD 4FKZA 1MI5B 1KI4A 4TWRA 1WZMA 5CZRA 3HB3B 3K9HA 1QJ4A 4F72A 2C2ZA 1G0OA 1UL1X 1RWNA 5EIXA 3BXXA 3VXSB 1LDGA 4CMMA 4MRRA 4GL4A 2X89D 1CTOA 4OLWL 5JLJA 2EYSA 5I74C 1OH8A 1J0KA 5EESA 1AIZA 4H4DA 3UTZA 3DRQB 1FPTL 3GSNA 3R3SA 3TCXB 1SQ5A 5KSAC 3EWIA 4K0OA 5F6IB 3GB7A 1Y63A 3UUWA 2UUCB 4JA0A 5IVDA 4H26B 3UJIL 5EI5A 1RUKH 4XO8A 1IHXA 5FXCH 4B17A 1ND0B 2PMWB 1W96A 4WACA 3QARA 1TEFA 4B32A 2L18A 3UUGA 5GJTL 3OJLA 4INJA 1YECL 2MOQA 3DX6A 2EVHA 3U0TA 1M4KA 2GT9A 1BEZA 1N32B 1WMEA 4MB2A 4ONFH 4ZRNA 4AJVA 3OECA 1QYGH 4NRYB 1QZ1A 4G6ML 1PR3A 2GCOA 1ED3A 4LKXA 1VZ3A 2X8JB 3ETTA 3ZJYA 4XAQA 4ND1A 4P5KB 4UAGA 4A5OA 4Z7VB 2JJVA 2H3XC 4RDQG 5TK4A 1CJUC 1L8QA 3ME0B 3QDAA 2C31A 3KM0A 5TGBB 5E5LA 3K9FC 3NANA 1V35A 1RTTA 2JELL 5ICMA 4BUGA 3EVZA 3TH4T 3PPEA 5I7WA 1KCUL 2FGWL 3HR4A 2VLRD 4IQFA 3IHKA 4P86A 1JAXA 3NYRA 3VTKA 1FSGA 1PLJA 4LHSA 5EJ5A 3S98A 4QBKA 3QFCA 5ID1A 1WUJS 4IHKA 4TM7A 5H35A 1JUFB 4JM2A 4CEHA 3GLRA 3TN0A 1MF2H 3IE2A 3D8BA 1VSCA 1NATA 5FA3A 3GQVA 2CO4A 3I23A 5KUMA 4QOIA 3IE9A 2MYTA 5FOSA 3SKJL 4TZ0A 1XF3B 4UASA 5FF9A 3U9LA 4AZ8A 4GSKA 3MERA 1TMOA 4ZV4A 4BZYA 1NN0A 5C8XA 1L9RA 5BRJA 3FFDB 3QP3A 5GPRA 2YZKA 4WGFA 1WSWA 3ZGYA 1HOCB 2WQVA 1DFIA 3DXAE 4X6DB 3ZVMA 2GI0A 5EE1A 2CDGA 3PXAA 1W88B 2OQRA 3WMPA 4QHMB 2NZ9C 2BGIA 3FN4A 5K3SA 1UB6B 1AU9A 3MOAL 4I50A 3GLQA 1TA4A 3OHXC 5A9SA 1BJMA 4MAZA 1O1YA 4AEHH 3GBMH 3ZQUA 4MQXD 1XMEB 5JDCC 4BWUA 2IVFC 2O93L 2FCRA 2XHEA 5LP6A 3DKVA 3RFUA 3A7DA 4MJHA 4X1KA 5BCAA 3DOUA 2XCSB 3R5JA 5J58A 3U36A 4U8HA 4FMCB 1WUHS 1ITCA 4G1FA 6ABPA 1W59A 2RC6A 2H6PA 1TM2A 2GTHA 1M7HA 3VFGL 4WL0A 1DDHA 4NCC2 4MZRA 3OZFA 4MDHA 4PGZA 4HA1A 1U91B 2FF7A 2XB8A 3DEFA 1S6NA 4UDYX 3HJ0A 5E5MB 3ER9A 1D0IA 3P4NB 1F45A 4IGBC 4DHEA 2CGEA 1E9VA 4RDBA 1DDGA 1OAZL 3U1SH 3MLEA 1ZM4A 3A0OA 5LUBA 4D4KA 1Y07A 4LRQA 2QM0A 3RHWF 1D2RA 4GE0A 5KTPA 4JKYA 3BAWA 2FYTA 2FWRA 5EH1A 4YI3A 3FI9A 5ISZB 4NNYA 3HI1A 4LCVA 3C87A 5C7ZA 5C6WH 2XV1A 7GPBA 2VAAB 3SDYH 4FI3C 4PJ8C 1IGFH 3R5FA 2BHTA 1KT2A 1DIRA 4FDMA 2DJ4A 1JXAA 3WAGA 3MFYA 1MVFA 2H0FA 1Z9SA 4N82A 1YMME 4EGQA 1DWOA 2NSLA 2GZHA 4FX5A 4CGYA 5GIPE 2V9UA 5EEYA 1SXIA 3WIUA 3QVAA 5H37G 1C5KA 2FK9A 4LSSH 2GZSA 1EDQA 3E1GA 3ML9A 1PNVA 4UW9A 2G0AA 4O6VA 1GUBA 3DOSB 1PYGA 2FCAA 3GYRA 5EWMA 4PC1A 2CZCA 1DAGA 5K0FA 4OGLA 1NAMB 4D0LB 1DBIA 1OB5A 3W11D 1T9DA 4G24A 2DEUA 4ZDKA 2UZ1B 4JRXE 4ZVPA 4PZ9A 4P2RB 1DKUA 2C9XA 4A0SA 2NX5E 3FUWA 3DC0A 5KVAA 3H65A 2WMDA 1UZUA 1X9RA 4PJGE 4Y6LA 3AK4A 3BEVA 2YFYA 1N64L 3RKDC 3IEIA 3CT4A 4BFFA 4MJXA 3WMEA 3N5KA 2CKBB 4FFYH 2VDRB 2XSZA 3UM9A 3WGOA 2C2GA 4J6IA 1VPOL 5T67A 5DK4A 1KAHA 3L8HA 3APMA 4PWEA 1UA6H 5EZPA 2OAAA 3PCXA 4YLCA 3OWXA 4G67A 1BCSA 5F7FA 1GFSA 1UGKA 4NM8L 3QHAA 4L9SA 4E12A 3P77B 2DUMA 4UQ3A 3F49S 1TZ8A 3RU8H 5DM60 2HXYA 5IDYA 2RAUA 3SJVD 4ZUWA 5IVHA 2VM9A 5DV9A 4BKPA 4WI2A 1JKXA 1SC1A 1GA4A 2CRMA 5JEDA 4GGMX 2B4CL 3M6IA 2ZBRA 2XWSA 3QRLA 1P4IL 5CD9A 5CBAA 2J3LA 2Q5FA 3EXLA 2G7MC 1QHPA 1HEZB 4JN1H 2SNIE 2YOGA 4QOGA 4ZO9A 2KS0A 3H5VA 3QU7A 4FMDB 2ED7A 2O3SA 5IJAA 5E23A 3ZRFC 1B14A 3ONVA 4BCDA 3RX8A 2IWFA 4D96A 2DLTA 3RILA 1J23A 3IAM6 1FFXB 1S9XB 4HVBA 3WS7A 3UJTL 621PA 1J1IA 1DJZA 1GR0A 4Z0BL 1A9BA 1MJ7H 5DHVH 4Q3KA 1OAKH 3M6WA 4F57H 1QSFB 1WZ1H 2NTEA 3WNOA 1EESA 1AXIB 5B3NA 2DFDA 4RXTA 3UAZA 5D1QD 3MWLA 4PCUA 4XRCA 1AI1H 5J06A 3LPNA 2AEQL 3C85A 4MAFA 4FNQA 2RQ8A 1FZQA 2OMKA 4OQLA 3KHOA 2XV6B 4FQXB 3L7LA 4HLCA 1TQBB 2VXVH 1ISMA 1NIJA 3KXFE 2GJRA 3FUEA 3BMQA 1RK1A 1WULS 3QUKB 4G1EA 1IC7H 3I9NA 4DNOA 4ZU1X 5KNBH 2Z95A 4AUMA 3SZRA 2JZOA 5A6IA 2W9EH 5IBTH 3HSKA 4IIHA 4U2KA 4HPOL 4NQVB 3T2PA 4H0LC 3AL0C 2VJLA 4DSAA 3VXTA 5HDQA 4CQNA 3ZQWA 2VJXA 1N5MA 1GUYA 2DDQL 2QYSA 4Y2JA 5AO9A 3SDDD 1LBQA 1VRCA 4MV4A 4ER5A 1FI8C 3ESUF 1NTRA 4AZWA 5L4FA 5JOQA 4B3IA 3DTDA 1MXHA 4P8QA 4BXVA 1N5LA 3U0PA 3ZI0A 1Z9NA 3ZQJA 5IVIA 2VCOA 3HO6A 5EEXA 3KYKH 2QELA 2APFA 2P80A 3BESR 5CGYD 4GM0A 3IMKA 5C9KA 3NBNA 3KRTA 4XN7A 4WKNA 4LNRB 3SIKA 2AGVA 2QQKL 1QGAA 2OHHA 2Z09A 5AHRA 1P18A 3KB1A 1IJFA 4PYGA 1FG9C 3LKNA 1CEQA 2B8TA 2V7VA 1J1XL 1RYHA 1DUZB 2WLLB 1H4SA 1A7BA 3LB6D 1UYWL 4BPBA 1GZPB 4NFSA 3E9YA 5CA0F 4QGFA 1ABBA 3V42A 1S9DA 3KV1A 3QUMH 2WA2A 1O6VA 4N8CH 4P32A 4ENVA 3O6VA 4XPFH 5JNTA 5AVVA 3LUCA 3K2IA 4L3WA 5KNBD 4DG5A 1HSAB 2YXFA 1I7LA 4UHBA 3SZMA 5HCUA 4DMKA 1NVKA 3ZE2B 4MUGA 5DHYA 4JJFA 2Z7UA 2NTFB 1ISGA 2GY7B 4TV3A 4OUKX 4RFSB 4MKHA 1CJVC 1QU3A 1RQXA 4IBLT 1FSKB 3ROGA 3H18A 4OZHF 2BLLA 1DFXA 2Q6IA 4L1KA 4QU0A 2FUG6 4JSYA 3K16A 1T0MB 1I4DD 4IINA 1E3TA 3H8NA 1Q0LA 4NFLA 2FECI 4Y2UA 1P1BA 2HB6A 4HG2A 3ZCTA 4J9VA 3N8GA 3IBTA 1IEAB 2ZXAA 3LHFA 1RC8A 4RHXA 5BUCA 1FC1A 5HQTA 4QOHA 4BVAA 3QPCA 2PW2A 3PUHA 4GPIB 4EF4A 2V7NA 2AN9A 1OSNA 2NX2A 1P5UB 1PPIA 1B16A 4TXMA 3L08A 3QFHA 1MKFA 1HLPA 2VSDA 4NYIR 3KPRB 4E4RA 2WWFA 4GT0A 2CM5A 4TLSA 4A2LA 2AZTA 3FFAA 4UT6L 4JLJA 4XKJA 3TTSA 1U0BB 5DXFA 1R3LB 3W0LB 3PDGA 2XQ0A 3USCS 1N9GA 1HM5A 1K2DA 2QKIB 3L0CA 1NP7A 1M9SA 4BFKA 1CR9L 1MCEA 2ZRDA 2IFGA 3T4AB 1R5BA 3I5UA 5A2GA 1QFJA 4NUPA 5F7JA 4NNOA 3NNNA 3C3MA 3C60C 4U3CA 1JWSA 3M7FB 1BAFL 1KYQA 5C1MB 1PT6A 5GGVY 3LEXB 3KVQA 2P9FA 3BXNA 3JYCA 1SRDA 3C5CA 4TX1A 2LVBA 2SKEA 4J0QA 1MHPA 3IHWA 1RJGA 4JKNA 4FI3F 3DPSA 4IF4A 5BVJB 1XROA 3WNBA 4OLBA 1RUMH 2YBRB 3H9SB 1IB0A 3PQDA 5JHMA 4E6EA 3U80A 2BDEA 4LRSB 5JXAH 4YJFB 4BO4A 3FHEA 3A3NA 1F60A 4BNZA 2PCLA 4OHCA 1NANI 2OMWB 2IVZA 3KHTA 4X4XB 4HP8A 1HYQA 1KJ2A 2OMVA 2BYTA 4RK6A 5G02A 4WNQA 3BRWA 2I3ZA 4WKXA 4JODA 4GZLA 1PR4A 3WGLA 2H9AA 3KYNA 3WEXA 4DIOA 2FRGP 4G9EA 3BMWA 5E5RB 5JSQA 3OKYB 4E41B 1KQGA 4BNTA 3FU9A 3I6YA 1RKUA 3RT9A 2YD1A 3IAQA 3SX0A 1Y81A 3BXGA 1PY4A 1DVFD 3KD4A 1GIAA 1HL9A 3EDRA 2J8UB 4CU2A 2AK4D 3A4LA 1LO4L 1N2CA 2CXUA 3LZPA 2GTQA 1G6RL 3DE5X 4Q97A 5DRXB 3RHWK 4X8LA 5DZPA 2ZI4A 3R7AA 1NGWB 4LMQI 3OKPA 1DQML 2ZXEB 4H1TA 4P57A 4A8JA 4MTLA 4J3JA 1AG6A 3QFDB 4FT2A 3BB4A 3MT0A 5D1NA 5I4KA 3EVFA 4H88L 5L8KB 3A2LA 4C0JA 3CX2A 3MREB 3NRPA 4MQFB 5KVEE 2GKGA 4HSCX 1DC4A 1ENZA 1G8SA 5A40E 2EVJA 4DGYL 4XT1C 3ZKND 2COQA 1SRRA 2P41A 4B9JA 1O9WA 4OIAA 2M6KA 5CA0A 3AT1A 1RFDH 3HZOA 4M6NL 5JY1A 4ZP1A 1G7HB 4Q9AA 2ZWIA 1J0IA 4UEKA 1AGEB 4DN3L 1JDDA 2BS71 1N6UA 3LQAC 3ILDA 2QW8A 2PRZA 4X0KA 1RWVA 1PF3A 3S36X 2ENYA 5FA4B 3TB4A 1Q3TA 4F33A 1QF6A 5BOJA 1I4LD 4C3ZA 3PXCX 3OCZA 3AB7A 3ETHA 4DDHA 2R39A 4OZGE 2JXMA 4GBJA 1Y3IA 3H9ZA 3LUPA 3DIDA 3QQPA 4F8JA 4MLIA 2LVEA 1CKEA 3CJQA 1ZGLA 2Y07H 1UT9A 4PCYA 1NC4B 4JFDE 3A1CA 4NBSA 2VM3A 5K0TA 2I7XA 2WAXA 4FGZA 3HS9A 4KAAA 3MRBA 4TQEH 2ORBL 1SVSA 4TLDA 4E5MA 5HHOA 3VC7A 2BNRE 3GV0A 4HKBB 4I1PA 2ZOSA 3S3CB 2X4RB 4UUJB 2REXB 5I6OA 1IN7A 2CEAA 5L3SA 4EX7A 3OHXA 4AOFA 4OKIA 3UOAB 3HADA 5GJSH 2IPKB 4NNPL 2X0NA 5JDCA 1G8KA 4O51B 2IVFA 4NDNE 4NY1A 1XEFA 2ZONA 4DZBB 2D0PB 4MO9A 2A9RA 2EZUA 2Z2IA 3EFDL 1WMDA 2HCJB 3MC0A 4RZQA 5LN1A 1GAFL 4JHWL 3MQIA 1DKOA 5JE8A 3A3YA 4GOXA 1I31A 5J4KA 4K9RA 4TWBA 1TFUA 4CL8A 3DXXA 1GZQB 1C0PA 1GNLA 2ZW9A 1Y3FE 1M66A 3QXXA 3U46A 3U7WL 1K4DB 2FHSA 1EHXA 1WG3A 3QOWA 3QUBA 2REOA 3KCWA 3N2KA 3TBKA 2PWHA 1ZHOA 4IGBA 4J3BA 3DDGA 1QBAA 3PNQA 4YS4A 1H9BA 3PNSA 1DVZA 3W77A 2B37A 5DCLA 2LXNA 3SLGA 2I69A 3WL4A 2PZAA 4IOSA 1LDYA 1HEIA 4ZGGA 3NBFA 1CB7A 4B40A 1T6VN 2V55B 4MROA 4LY9A 3ULVE 3BCRA 2FPIA 1MIMH 5JW6A 2R2EA 3V0DA 2B8NA 4B7IA 4HH9B 3B2PA 5D3MA 1G7JB 3AIOA 4XVHA 4PJ8A 2GBTA 1CLEA 3EDMA 2BFDA 3HVIA 2YIHA 2PXXA 2VC2L 1MRCL 3C6LA 4WFGD 1SBSH 4C7KA 5FM5O 4X8JB 3TO4A 3WEMA 3EVCA 1QG4A 3WLQA 3RSOA 3HY4A 3VRHA 1AGYA 4ZOCA 4OX9B 4L1LA 3SDXF 3HN3A 5JO5A 3B8HA 5TR9A 3FUTA 2FAXA 3M9LA 3JALA 4ZYVA 2ZI5A 3RVXD 5EOCH 1GKOA 1UBOS 3THSA 2CYBA 3U4CA 1WEJL 1F58L 4ECEA 4KRLB 5BMOA 3CVIH 4RO0A 1M2HA 4QYTA 1F4VA 1G0YR 1U0EA 1FV1A 2V3VA 4JP1A 2QQ0A 4ZPJA 4HZLB 1IWPB 3HEMA 3V8NA 4BCZA 1CURA 1QGED 2EEPA 4RTJA 4N2LA 2JAOA 5EKDA 1VERA 1T9AA 1ASPA 4X90A 4U1LB 1LSOA 4AT6B 4Y16A 2KZKA 4H13C 5GZ6A 2GO1A 4FPXA 3SD7A 5JOPD 1A6UL 5LAPA 1ZITA 2AEEA 3S7TA 1Y80A 1NMBL 1A8SA 4PJFB 2E6UX 1TMYA 2DOKA 4U2FA 1A21A 1ZN7A 4L07A 1I2DA 1N2RB 4GAJH 3T41A 5LQUA 3NMUF 2GK7A 5HF9A 3GS0A 3W5BA 5KSBE 1AC6A 2HA5A 3DLQR 3HC0A 2VF2A 3KW7A 5KKCA 4E03A 2X2PA 2MQ0A 3KQTA 2WUCL 2BY4A 3LS2A 3FHCB 1QTRA 2PUQT 3TA3C 3TH2T 4UDTB 1XB3A 2BM1A 4IU3B 5LUAA 1AK1A 4A6PA 1IQDA 3G79A 1J49A 1OX5A 2WZPD 2J33A 3ISRA 4EENA 4JFED 4B4VA 1NINA 1G5QA 2DQJH 2R8RA 1X42A 2D59A 2BNQA 2ONYA 1PZSA 4ARAA 5JIBA 5BXYA 1KEEA 3KEGA 4FGMA 4QQ8A 1Y3DE 1G2QA 3O1IC 5EXEA 4ASUA 3II6X 1VRVA 4KLAA 1PJ3A 3LLMA 3T3IA 5I47A 3Q1SL 3KPLB 4J39A 5BSFA 2Z2ZA 3HIZA 4RKEA 2DHDA 4IIVA 2X4LA 5AKZA 15C8L 4PLWA 2ZM6B 1G7IA 2EEXA 3I02A 1QIIA 4BGIA 4EJ0A 4GL2A 2AJVL 1QYCA 4CU8A 1E3JA 5GXBB 2X4QB 4UV7H 4XWGH 1Z8NA 1M2JA 3GMPA 2I99A 2IPTL 3HJNA 2F1RA 4XBEL 1K6XA 3GTVA 4BVGA 2CLRB 2WA1A 4GPBA 5IJXA 2QPOA 5CB4F 3V4PL 3BXZA 3Q8XB 2HFFB 4XVJH 4E32A 1WD8A 4U1JB 3IKJA 2WKLA 2WHRA 2NSXA 3DTNA 4UTZA 2XGOA 5DK6A 3DXYA 3QDGA 3QNXA 2B3DA 3VGJA 4RY8A 1UT2A 4CQMA 1Y33E 3B1FA 2VLJD 1U5CA 1RJCA 1KC5L 1GC1H 3VHXA 3ZR5A 1SN0A 2JHCA 2BD0A 1GTMA 1TT7A 2O6LA 4CMBA 1J8SA 5CZKA 3E6FA 3CX7A 4OQXA 4C07A 3ZBPA 1SVOA 1ZK0A 5LQKA 5EIHA 3KSAC 2NZ8A 3UIYA 5A05A 1RIIA 4XEHA 4K6KA 3RBGA 2EDBA 2EQAA 4EDWH 3R77A 3MT8A 4KAQL 1C12B 5B4MC 4YPFA 4UVIA 2EH8H 1SWVA 3B20A 4NBZB 4YO8A 1G84A 4EG5A 3CBJB 4HFRA 1DQNA 2ZOWA 2WQSA 1NPYA 4DYVA 5IVPA 5JXJA 4NJEA 4N4YB 1TD9A 3TTWA 1JEYB 3HI4A 2E4YA 3T7CA 2CV1A 1GY2A 1WVIA 1FNSA 2ABWA 3SZ3A 4AIRA 2IG2L 3IMFA 3VMMA 3INGA 4XOUA 3UHOA 4OQTA 4MDJA 4K9OA 4JFQA 4RKYA 3K6FA 4YSSA 3D6NB 1GTFA 3VVBA 1ZHHA 3TX6A 4AQEA 1XZFA 1MABA 4GOOD 4KI5D 1CFSB 3SMQA 5EPMA 3VX1A 2QADB 4IM8A 5E1HB 1KPVB 4OFZA 4TL7A 4M1MA 5JSHA 1EVTC 4HGOA 1JU9A 4OJCA 4FSDA 3TVMB 3GUTA 3MMNA 2BOCA 1UBKS 4MIOA 1VSTA 3IRCA 1YZLA 1MJGA 5D72H 2ZR8A 5DZOA 4F93B 5ALIA 2GCGA 2PTTB 1F0KA 3ZE7A 1QWUA 5HVHC 3FQRB 1KF0A 4IYRA 1VGKA 3H5WA 5IJ9B 3M6UA 4M48H 2G88A 4RA0C 3Q2IA 7MDHA 3N2ZB 1OV6A 3L7IA 3MTRA 2F9FA 4DSZA 2JLRA 3QWAA 3T1OA 4AGLA 1VMIA 3D39A 3VG0L 4KK3A 2OR3A 5LQSA 3MSCA 1EDEA 2Z65C 2GAFA 4KW7A 4NAQA 1KEPA 1XZGA 1MAVA 2N1KA 4I0PD 1X7SA 5F7EH 2PQMA 4Y4KD 4KKZA 4U3SA 3WSQH 2EW8A 3PNPA 1ZK9A 3AHIA 1E1YA 3N70A 4YDRA 5SYAA 3DBSA 4Q34A 3EEYA 4J1UA 4ACTA 3KQMA 2PWEA 1TJPB 4ABUA 1LK5A 1REQA 3RK0A 1U0OC 2E59A 4PP1C 2CBZA 3D3WA 3C60A 4PCSA 2CJ3A 2DTXA 3DBHB 4F15B 5BV7H 4I81A 3L45A 1TTHA 4MZ2A 5LOVB 3FKSA 4YO0B 1WA0X 3KLBA 3CSSA 4EQ2A 5CEZH 1EB9A 3P26A 2VUTA 1NPNA 1ZH6A 1W30A 3SHSA 5K6TA 3TBVB 3H17A 3QW9A 1J5DA 4LLYB 5BRZD 4XA8A 1LP9B 2CL6X 3L4YA 2WR8A 3BVNB 1OTUC 5CB4A 1YGYA 3N53A 4C4YA 1PKQA 2XWDA 3VVMA 2YZNA 2IXEA 3ARFB 4HQQL 4YSDA 4PJCB 3JRXA 2VF4X 3KZXA 1RY7B 5T1LB 3VD1A 2O61A 4R69A 4RGOH 1WDLA 3O2DL 3SCMD 2L4OA 3D5QA 4DJDC 4B3SB 4YHPB 1K89A 4GAAA 1SB9A 4OGYL 2WWIA 1BBDH 3FPJA 1S7UB 4C6SA 5IB5B 2DLIA 1SQ6A 4NM4L 1JT2A 1DSSG 2VRCA 1QC5A 3ZYIA 4CN8A 4NWTL 4C06A 5I28A 2FEEL 3ATFA 3LPAA 3JQBA 2GPWA 1JNHA 5AVYB 4ARSA 1CGXA 2AG5A 1MO4A 5AYTA 2XWBF 1N2EA 1JQAA 3A3OA 2HA0A 3PLAE 1CBVH 5SWZB 3EGVA 5CEZD 4JCMA 2IGFL 4GKSB 1DQJA 1NGPL 3CJRA 4LF7B 4NHUA 4IGFA 2E6PA 3KOUA 1GNTA 2DBLH 2KDGA 2ZZKA 4DRXA 1XE3A 3T7AA 4ALKA 2G83A 4WKPA 5IB2B 2K2QB 3IC5A 1OGYA 3QR0A 2AABH 5SICE 5K0SA 5CJOL 3HL0A 3HB3D 5CBPB 2V7XA 4MPDA 2DEYX 4JG9A 1U8CB 1LK0A 3TJRA 2D7DA 3L0DA 2ZXGA 1GGKA 1PJTA 1F3RB 5L8JB 5EU6A 4D94A 5FCSH 3RRYA 3SE7A 2QW0X 2G4LA 3LW8A 1JWMB 5DJ6B 1NRXA 2GHIA 4WVRA 2RH8A 4UPDA 1UOOA 2LNDA 1JEEA 2ZIGA 4HYYA 5LDHA 1CY4A 4EEEA 4I3RL 1D1SA 2BCEA 1L3IA 4YR6A 3ESDA 5DLLA 3RA7H 3DBLA 2R5WA 1O0BA 1JZTA 1OLLA 3C3CA 1MB0A 2C5LA 5T8KC 3UFIA 4D80A 3H6JA 4NLLA 1QDLB 5KJ4A 3K0YA 1BA9A 4R3NA 5BNWA 3H7AA 3QZNA 4PANA 3K1AB 2PR2A 4IICA 1UA3A 1WBYB 3BWSA 1GQRA 3A4AA 2CXQA 4W8HA 3LSOB 4R4ND 1NDTA 4KPYA 2QY9A 2C4WA 2A58A 3VV2A 4OAWA 3HNRA 9MHTA 5FBZA 4I1OA 4PJ9C 2HX9A 2RH0A 4JM4L 5EF2A 1T0HB 4TKLA 4YHML 3AAZA 4OFKA 4WY5A 3G17A 3H1AA 4S0XA 1JZ8A 5IAOA 3WHXB 4KQ4L 5ERGB 4ZT5A 3IOMA 5A7EA 3OZLA 3UZQB 5GGVL 4YMHA 1S0UA 2YMTA 5KYXB 1IE3A 4PZ0A 4YBQC 3CH1B 3C12A 2HA3A 4JD5A 5C18A 4E9WA 4A2GA 5E00A 4LYHA 3R1GH 2F00A 4Z3DA 3L93A 1A7NH 2TRHA 5I8KL 3ZE0F 1PW5A 2BZCA 4C57C 2WJIA 4HT3B 3VXRA 2Z98A 2WIFA 2YMXH 4YDSA 5HYQB 3H5RA 3WO4B 1DE4A 5E6RA 3UAVA 1TEHA 1ZD9A 4XDZA 4YRRA 1WO2A 3N87A 1W73A 2EBHX 1C81A 3L3BA 1IEBA 5D4QA 2A5FA 4F2ME 2QTZA 4HWZA 4OIMA 4HYTB 4MJ6B 1WIUA 2WLTA 4JG0L 2WJWA 1NF8A 5I1AA 3I6LE 1JHXA 3PUXA 4N0RA 1SVCP 1EVYA 4AXWA 2YJ6A 1H2WA 5KSYA 1PCXA 5DMGD 2H26B 1SCUA 2Y3IA 3GROA 4EARA 1BGXT 3T7RA 4NONA 3F84A 2KPWA 1QORA 1E7VA 2XNSA 5MN5A 3OQIA 5A2IH 4M5ZH 3MLSH 5IZ4A 4G26A 1OPRA 3A9UA 3F1LA 2HWZH 1FF5A 4Z6KA 4RK4A 4BZZA 1TAUA 3O83A 5GJVC 4ZKEA 4KFUA 3RWGB 1U41A 4PGEB 3K71B 4RLQA 2ZBQA 4XOCA 4YV1A 4B3VA 3V97A 4P5PA 5K8CA 5IANA 4O4IB 3W82A 5INCA 4QNRA 2W2PA 1CR4A 1Y9DA 2O7RA 3X1XA 1IBHA 2HUEA 3S1LA 1MIOB 3TH3T 3EBLA 3DC7A 3OESA 3G6DH 2OTWA 5C7XH 4LJLA 5AKHA 3BILA 1UM5L 2BCMA 2P6RA 4NYMQ 3T5WA 5IW6A 3CS3A 3MB8A 3MVSA 1FVEB 4N7RA 3RLSA 4L4VA 1M0SA 1T3ZA 2O4CA 1PFCA 3DMTC 3JWNH 3GMNA 2H1LA 4QOJA 4CL3A 5EFIA 4G9FA 2X4NA 4Y2DC 5IHLB 4FHDA 2ZJSH 5I6DA 1SU6A 2ETWA 2I4OA 3GTTA 4C6TB 5CBKA 4A0FA 3NFYA 2RGAA 1RIHL 1FVOA 1IRAY 3T71A 1ZLSH 3BULA 4LSQL 2FWOB 8GPBA 2BVPB 4J3OC 2WIIB 2ZUVA 3GBVA 4S2EA 3B3IB 1XG5A 2DFPA 4TT8A 1Z7JA 4QBFA 3N1MC 3KPSA 4CKWA 2QJOA 1B76A 5GISH 3B7WA 3N0XA 2CKBH 2NU7A 3TYXA 4R0NA 5CDTA 3HO8A 4PONA 4IEEA 3B7UX 3B9DA 3T5AA 1N3NA 2FT6A 1U2CA 2JWHA 1G9ML 2A2ZA 2W37A 1JYSA 3VVLA 4NKIH 1KJJA 1YN7B 1NEZG 1HYSD 1U1FA 2W71A 5DRWB 2VMJA 4P9HH 3V4LA 2PMFA 3G7UA 2WM2A 3H83A 2Z1NA 4LPSA 1LBEA 2B4TO 1A0QH 1FORL 2J45A 4H8WL 3CEJA 1Z45A 3FAXA 3CT6A 3V8PA 3CVCA 3UMCA 2B82A 3AU9A 3BAFA 1FNEB 2H32B 3N5AA 3N0WA 3V4UH 1AKWA 1E6JH 1RIUL 1WP6A 4PV8A 3TFKC 5EEHA 3RYCB 2JFHA 4D0BA 2MQCA 3WLWD 2WMOB 3FRHA 4I0KA 5HYEA 4XCXA 4DP9X 4N8VG 4IBYA 5L3ZA 4JFFB 3DSFH 5H8DA 4YSAA 2DKSA 2SKDA 3DHEA 3O8OB 3DFMA 4P2RD 4NQDD 4N86A 1MC1A 2Y6SD 2R97A 2PCYA 3K5WA 3MTXA 1HO3A 4PGMA 5DGCA 2R66A 4LCCA 2ESVB 1KPGA 1YLBB 2H5JA 2Q3JA 3H99A 2B8WA 1L9NA 5JY6A 2CWDA 1UBUS 2HOQA 1O95C 3UO1H 4G63A 5B1DA 3MRPB 2J57A 2AXEA 2ZUCA 1TQ4A 2WABA 4RMGA 3WOVA 2XZDA 2ZWOA 5K59E 4AN0A 3UPDA 1H8LA 4QUHA 4BV1A 5CLFA 3CGWA 1IWBB 5AUQA 3F83A 3P32A 4UTAL 5CEJA 3DDNA 3GELA 4Z5RA 4CMEA 4DN4L 4IOJA 3W8EA 3CR7A 2X9QA 1CUJA 2ZIWB 5C08A 1EGAA 4U2CA 4KRGA 3GZOA 2JH9A 4Y2QA 2B1QA 1C4XA 4AJNA 2HPZA 4KTDH 3PR3A 3PF9A 4KGJA 1UPXA 3H2KA 1R6UA 1ORQA 3G9UA 5BW7C 2A1UA 4KNUA 4RJKA 3RUPA 1Q22A 4HPJB 2CMGA 2VXQA 3HKBB 3HJBA 5K39B 1QYIA 4YIHA 4E31A 1JG3A 3NJKA 5C09B 2VTFA 4JPKH 3JQCA 4TL8A 3DEZA 4M5YH 3WNJA 4K6MA 1Q20A 5GRUL 2Q1SA 3ZQ9A 1HH6A 2AQ1A 4FHKA 4JG1H 4LVOB 1DDIA 3ZO9A 1A6AA 2WMYA 2OXHA 3OHPA 3R76A 5L3QB 1KENH 3CQPA 4KKXB 3O41B 4AVKA 2GFBA 1EQUA 4I5FA 3ZJVA 5KQLA 1Z68A 5FX3A 2Y0EA 4HOXA 3G8AA 3SDDB 2WQ6A 5AOVA 3ZPDA 1QSFD 1KFAL 3CKMA 5C0CB 3C41J 1E1RA 4XP9L 2WZ0A 1Q0SA 1PZ3A 4NF2A 2PO5A 4MX8A 4M61B 1GU0A 2NY7L 3E9NA 1JGEA 4F4UA 2RONA 1S3KL 1G9NH 4ZJ9A 3SQLA 1TTBA 3F73A 2I7DA 3MUGA 4FQXD 4V0SA 2FJSA 5CFAA 3WHIA 4UQPA 1XZAA 3AWGA 3X13A 4NNXB 1DC8A 1QM5A 4JYPA 3L7OA 4JAMA 1HF3A 3G2KA 3OSZA 4KN5A 5T3ZL 1TJ3A 1XR3A 3EGCA 4KTVE 2JCBA 2WI8A 1T9GS 2OYKA 5C0BB 1QTPA 5CYGA 4J3SA 3KHQA 2WINI 2BM8A 5IUJC 2CNYA 2ZAGA 4ETWA 2OZEA 2G8NA 5CZVH 4I4TF 4FL4C 1WFTA 4LYAA 2Q9BA 5FPHA 1LB1B 5KAQF 3H3FA 2NXZC 5B1JC 4Z7OF 3H7IA 1AIFA 1DQVA 3ZZ0A 4KJWC 5EORL 3LUAA 1J48A 1KFBB 4OI4A 5TMDA 4PG7A 5J6GB 1EI9A 3BAZA 1FRGH 1MCQA 3SX4A 1WR8A 3VO2A 4NXNB 3HYSA 4FNUA 4GW1B 5C34B 2I6FA 3DX1A 4FGUA 1E0AA 4MQUA 4DY4A 5JMTA 2XWQA 4J6RL 3INYA 3E2MA 3DX8A 3ZZQA 3I9GL 4MQ7A 3DDSA 1HK7A 4WGGA 2IEPA 5D7IE 1C8VB 1HE1C 5JHDA 3D06A 5CT8A 1DN0A 1CG9A 4FJ0A 3IGKA 4NHCH 1GTSA 4MYDA 4MRVA 3EDFA 4URKA 1Q7TA 2ZRKA 5IJ0A 2X6CA 3RWHA 2D9CA 4MTMA 2FDCA 4HRAA 2EADA 1YR9A 1NDUA 3NBAA 4DUGD 1J42A 3DVSX 4YCJA 5EMNA 1W1WA 1VA5A 1OCWH 1IC1A 5LVEA 1OE0A 3CNHA 3QUSA 4UM5A 1PRYA 2OSLB 3ICWA 1YZZA 1CO1A 4GKKB 2H16A 4O4LF 2J6EL 1NFDA 4UTBA 2OGUA 4OM8A 3A1UA 4A6EA 1OWNA 4OFBA 3CUPA 1YZKA 3QKRB 1AO3A 1JGUH 2F4VB 3WS3A 5KAMA 1TCAA 5TS2A 3N6YA 4LNHA 2DX7A 3FIUA 3NAZA 4DQDA 4KXYA 1SY6H 5F7DB 1VJ0A 4UEJA 1F3DH 3WHPA 3KM2A 1Z75A 5K5YA 3K70C 4RH0A 1KZYC 3LX9A 2GPYA 2YCBA 2DSNA 4TXJA 4MKZA 2H1FA 3QX9A 5HZHA 1XR8A 1Y1RA 4OSUH 2E4FA 1DBKL 3AW5A 1HDCA 2VJKA 5ECWA 3UAGA 2VPTA 2WINA 1PV2A 1EAMA 3IVMA 2QPAA 3W4KA 2BWJA 4LDZA 3FZGA 2Q6TA 1RQ2A 2NY1D 2PPEA 3QZWA 2P8LA 5KJ7E 2FSDA 1HRKA 3HG1A 3DBIA 1OREA 1DOHA 5C71A 4Y1FA 3UP1A 4YHYC 4KMQA 4KR6A 3QORB 2QLTA 3VXME 2G9UA 5HD8D 2HV9A 3UH1A 4A82A 5DDHB 4NN6B 1R3KA 2XXBA 5EUOF 2ZRGA 2P9JA 3U3JA 4LGYA 3P9WB 2QP9X 2P9CA 3GRPA 4J3OF 5M04A 1BOYA 3MRHA 5J11B 4PZEA 3A6KA 4BLRA 4MWZA 2IW3A 3GMMA 5CP7B 2BVQB 1W48A 2J31A 1X7GA 4FKEA 5E0QA 1MFCL 1NYQA 4EHBA 1T1XB 4QRRA 1N5YL 4CHGA 3PS9A 4RZCA 3HMXL 5TE4H 3GSOB 4XHJD 2X3FA 1DVFB 5JO9A 3VWKC 2B0CA 4OHPA 2IV7A 4E3ZA 4EZBA 5DX1A 3T5BA 4BK4A 3TE7A 2H3NB 1ZLWK 1BQ4A 4MI1A 2OJZH 2HFEB 3C6MA 3OAUH 3BSZL 3NPMA 3AXSA 1H1LB 2BP5M 1NL0L 1ND5A 4KRXA 5KBKA 4G2NA 1PJ9A 3QXWA 1E3XA 1UKVY 3ROEA 1TITA 4GX1A 1KJMB 5WRFA 4MP6A 2IZOA 1S3SA 3C43A 3CNEA 2PL3A 3QH3B 2QMKA 2AEMA 1QMGA 1ADQH 1R9MA 4E41D 2XH8A 4MD0B 4Q9BA 1CFQA 4JBIA 2YHAA 4ZVSA 4PJBF 2BF4A 4R7NA 3QX7A 1RU9H 2FPKA 3MHZA 3BICA 3RUDA 3AETB 1BKDR 2HKFL 4PREA 4NZRH 1NIAA 5TH2A 3EJZD 1KJ9A 3UAJD 2AXFB 1KN4H 4I4TA 2FIKB 1XTKA 4PJ9A 2VYNA 5ARBA 2JWGA 5EEGA 1IU1A 3ARGB 1I3LA 4DILA 4NBUA 3QUZB 4EI5B 4NJ9H 4QQKA 3KW8A 1BZEA 5EP1A 2Y2YA 2AIRA 3JYBA 1FFSA 3LKRB 4KRMB 1YEJL 1KIAA 1BFDA 3TASA 1MAKA 4ID3A 3PQYA 3R7WA 3JWPA 1PR5A 2EH7H 3BSSA 2I33A 1E1QD 4NQCE 4PWHA 1OAQL 5TDPA 3ELQA 4U3JA 1TU2A 1DBBH 3ULVL 4ZUSB 3EJUA 2HVJA 2C98A 1A7RL 4PHTA 4QRDA 3D2AA 1E1DA 4BP8A 1CQPA 4LIQH 2ALJA 2BDUA 4G5GA 4B53A 1R8XA 5D6CA 3NM6B 4TLLB 3ZH9B 4X41A 5AOAA 4D8PB 2BOVA 1MCBA 1IYZA 3KJZA 3F04A 5HFJA 1X7QA 3GEWB 3GNLA 2NNAB 5D96C 3S81A 5D1XD 3G0CA 5FD8A 2FZEA 4AQOA 1ECBA 3QGVA 1J25A 1SBYA 4K8RC 4AYFA 3TW8B 3AC0A 2GG1A 1JR3E 4XP6H 4F8PA 1OFGA 2VR5A 4B6GA 1B0RA 1SN2A 1NC4D 4H4EA 5I8CA 4O4LA 1NICA 4DIDA 1I94B 4JM2C 3C98A 3GAAA 3U7RA 2YKKA 4QNPE 1RI2A 3EOTL 4S2SA 3R4CA 1CD0A 2QSQA 2QLLA 4JIMA 3VZSA 5KDLA 2GPAA 5CKGA 4KK8C 1P9MC 2M32A 2IXAA 3ZV7A 2FETA 3HCDA 3AEKA 3L8GA 1WWCA 1SC6A 2YUXA 2YARA 4FN4A 3L2LA 3RP1A 1YZVA 3OMIB 2G75A 3Q1KA 1JLLB 4JO5A 1HDZA 1II8A 1GZSA 3LUKA 5I1KH 2XJKA 5KSUB 4KPUB 3WGKA 3JQ7B 5E08L 4IIJB 2QQEA 1YS6A 5HW0A 1PU0A 1Y98A 3GM0A 3GLZA 3UGTA 4W9NC 2Q3XA 2HEIA 3DMTA 4RL4A 1UKYA 3HL4A 2R7AA 2HLEB 3VA2C 4AM0Q 1CRLA 5SX5H 2NYVA 8PAZA 3FT2A 1X7WB 1FYHB 3CE6A 3QVVA 1N8ZB 3VSDA 2CK3D 1JLMA 1H23A 4QCIB 1Z18A 1EGMB 4BEIA 1TO6A 4H77A 3CCHA 2PGNA 3G49A 3REOA 2FW8A 3PEEA 1A7JA 2XUHA 5IDXA 4UQCA 3LZRA 4C0LA 2KMLA 2WIBA 2IU0A 4J2OA 3PHQB 4UDUB 3LC7O 3P4LA 1GPJA 4NPAA 1DL7L 3QVKA 3LIIA 4CN4A 4UUQA 1LI7A 2BMWA 2P43B 1C1DA 1D2GA 4Y9RA 2FA9A 1IHPA 2BFEA 3OB8A 4R84A 5F64A 5KW9H 5FOTA 5T5NF 3W78A 1KELH 3VDXA 3FDJA 3B6ZA 2YS4A 2OHOA 1Q15A 1TTPB 4MKRA 4E1AA 3TLGA 5I9SA 4BWGA 4A7QA 4CHTA 1A6PA 3MJ7B 3TCNA 3ICEA 3K8KA 5DHAA 4F5EA 3DV2A 1XIWA 2X0IA 2VDLB 3MAAC 2R0KL 5A9TA 4CIWA 2I2XB 2E27L 4HG4K 5IV2B 3BWCA 3IFNL 1UENA 4Y0GA 4L1HA 2X1XR 3P9XA 4MAAA 3VNZA 4PSDA 3GBLA 1M2EA 3NSYA 1NW7A 2V0GA 4IJQA 5FDFA 4LF9B 3RDJA 4BA8A 4LKOA 4WGWB 1XF4A 3ETSA 4MNHA 2RFXB 4ONGH 2HJSA 2Q3DA 4UIMB 4FFDA 2FMKA 1DJWA 4JFEB 1O95A 1L4KA 4MOWA 2ILLA 3QDMB 3QK7A 3T2QA 3OOYA 2R1WA 3GLIA 1JIXA 3IAHA 2K0RA 3BKMH 3WDMA 4RA6A 2WWNA 4MJIA 3FL7A 3DXZA 5DLQC 1CLZL 5DUBB 1A3LL 2O5YL 3F3YA 2CLFB 4JPVL 4FGSA 1AGCB 2REQA 1O5PA 2LLGA 3IRPX 5DTJA 2PXCA 4KQKA 4NZTL 5CU9A 5JBIA 3UA3A 2RCYA 4RSVA 1OU0A 2WD9A 5B53A 4Y1RB 1TGVA 5FI3A 4UZEA 4K3VA 5TPWB 1OJLA 5BW7A 1IJ9A 2OHXA 3MO1B 4MRMB 1QVAA 3RHTA 2EYUA 1CJCA 3AUWB 1AO7A 3TZCA 2ST1A 4GDFA 4QC2A 4QDGA 3S8FB 4QAQA 3Q11A 1Z25A 5D55A 2IW1A 1CFTA 2FX8L 3T0AA 3LQRA 2LU5A 2XRAH 2V6GA 5EF3A 3DDHA 1U8OA 3HZZA 5F2NA 2VCEA 4FFTA 1DG3A 2D7JA 3A6FA 3V00A 1QQDA 4DJ5X 1V43A 1FLRL 3ZUNC 2VLJB 3CZKA 4DKFL 4EYKA 4C3UA 1L7XA 2XIJA 3VVCA 3MUOA 1K7YA 3O3DB 5DOVA 4DWJA 3QLUC 4U6YA 3P2OA 4HS6A 1G8MA 5JJBA 3KGRA 3VR5A 1S9YA 1FQKA 2OCBA 1AQDB 1THCA 2IMMA 2FK7A 4APQC 3SJZA 2IIVA 2YWBA 1J18A 3H2BA 1EM6A 4XOBA 1TJGL 3TBSB 4L7VA 4BZ2H 2BKLA 3FQ1A 4KDRA 5EXXA 2TECE 3L3OB 3A04A 2ZF8A 3G5ZA 4O4YH 1PHRA 4XNXH 3QHFH 1EVKA 1GYVA 5ALQA 3UCFA 3HU3A 5A6SB 1B15A 2Z35B 3M82A 3K7UA 3IQWA 1NNEA 5DQDH 1ZS9A 4YDKH 4IYKA 2J1KA 3WG9A 3IP9A 3LMKA 2YD7A 4C14A 2DLNA 5K1NA 4DR6B 4U1MB 2HSWA 3T3HA 4N6QA 3OLCX 1R7RA 2CO3A 4F21A 3MRVA 3V8RA 1FQWA 3IQGX 3DZDA 4G72B 3B53X 3A5VA 3ZQ4A 5LXVA 3JV5A 3IVXA 2C3VB 3K1DA 4ZDJA 2QR5A 4YRCA 4HU2A 5CEEA 3OQHA 4P59H 1I6MA 4KIGA 1OARL 4MHOA 1BEUB 3U1QA 3Q43A 3TF4A 5FULA 1UFQA 4JX0A 2X0FA 3WGVA 4P98A 2ZTSA 4MHHG 1X8LA 1YKGA 1G3IA 1RBYA 3MJ9A 2F1JA 4PRBA 2FTAA 4FQCH 4Q05A 2AFIA 1QBLH 3DM9B 5L7YA 4HDOB 3WHE0 1IKNC 1Z6ZA 5IHUL 3R41A 1HZJA 3ARED 3UEQA 1W4BA 1AB5A 2XN9B 1XXHA 1J9QA 3Q8KA 1IM5A 3N8DA 3C6YA 4Y8VA 5BSEA 3KGTA 4PJAB 4M7PA 4DV6B 5H7XA 2C9RA 1IFHL 3F5FA 5L0QC 2MSCB 4ARUA 5F44A 1OX4A 3N41B 3DT8A 3O8RA 4I2XA 3K32A 2IY7A 5ITBL 1DWQA 2A4EA 4XI5D 5GGRY 3N39C 2PKDA 4G25A 3NIDB 5EHIA 1N25A 1UQTA 3TDNA 3HKDA 2F19L 3WSWA 3PNWB 3VSQA 3WJAA 1S7XB 4TVSA 3TH5A 1EEZB 1J9EA 5IFHL 2HN9A 1XCOA 2XMZA 1IGMH 2CKMA 4NZMA 4HDKA 1NXTA 3V0GA 1PFWA 1CHDA 3FDWA 3G2IA 2O4EA 3APCA 3BRDA 2M6SA 2DTDA 4EKJA 2QTTA 4LNUB 3V2HA 5DCCA 2N59A 4MLZA 1P5JA 4OM0L 4FYIA 4L76A 4EMTA 4M0PA 4BNKA 5C9JA 5GIOE 4LEBA 3GMRA 1U1GA 3WKPA 3G3EA 2DTSA 3VZDA 4J8RA 2X0DA 2FX7H 4GRWE 5K1ZA 4FFBA 1K86A 4AYWA 4H0NA 3HBGA 3WGUB 1TVBB 3PAUA 2OWEA 4LFBB 3W9EA 1I3NA 4O5OA 1XGPB 4LSVL 4BQ8A 4HWTA 4GGOA 1I1QB 3H2JA 1X4XA 3ZIAD 2JLLA 3UBXG 5EZJB 2QVLA 2XG4B 3QENA 1FYTE 4QDZA 2X3YA 3DUSA 5E6ID 4JZOA 4E08A 3QWIA 3QEUB 1MIHA 4G42A 1EPUA 4PFJA 4F5CE 3U7QB 4D4GA 2FAUA 2NQDA 5C81A 3TSWA 4Y2NA 5H68A 4V1DA 1CWUA 3FFWA 3LBFA 1BGVA 5I7FA 3V2UA 4DNPA 4MKTA 1NURA 3SCMB 4FLEA 2AHRA 4PHGA 2QSTA 1OI2A 2K7ZA 1HKLL 1I0LA 3MRDA 4REMA 3WFDH 1VBFA 3NIGB 1U98A 4AL8H 5AM0A 3TZHA 3WLRA 4K3EH 1H9CA 3VWKA 5A6LA 1HETA 2HRPL 1IBZA 2J3MA 4IBZA 2BEVB 5ACZB 3I9JA 3D0OA 1TW3A 1UASA 3RRBA 4XXHA 4L8DA 3GT3A 4E5UA 5SWQA 6YASA 2AEPL 1GGMA 2BRQA 1N2BA 5JNWA 1KEML 3PEFA 3LDGA 4JHZA 1GGYA 3IS1X 2YJZA 4GAYA 1JJ7A 2H7CA 5K8UA 3FMIA 2R69L 3ARFD 5CWSA 4YRIA 4Y5XB 3A1TA 1VL2A 5DD0H 4G5OA 3C8UA 4ANKA 1OTSC 3VFDA 5A3RA 3S29A 1VMEA 2WVAA 3NPSC 4FTVA 5FO8A 3SQOH 2CJWB 5FIUA 4YJZL 3RWFB 2EACA 3L2NA 1H0DB 5EUMA 4XSHA 5JJCA 3I4FA 1LPNA 3NP7A 4L5IA 1DJSA 1ZD2P 4PC3A 2QMUA 3SGDH 5DPMA 1E2PA 2BMDA 5HYSG 3C1TA 3RSGA 1MO3A 5SWZD 2QYHA 4YCLA 4LRXA 2IK8A 4B3RB 1OO2A 4MB6A 4QPNA 5AKGA 2J0UB 4W1RA 3RSQA 4X7EC 2JIXA 3GPIA 4KMSA 3SB3A 5ECDA 2B39A 4LCUA 3FWNA 3L7MA 4DIEA 4Z77A 5KQSA 1JVSA 3NDYE 4ZFOA 2ZE5A 2ZRHA 1S8NA 4R81A 2XZCH 4OFPA 3G1UA 3PWPA 2LQRA 1T9HA 2BMFA 3HB5X 4HETA 1XPRA 1BSVA 5DW0A 5JXWA 2HWUA 2X0EA 1IXKA 1EJ8A 1YAHA 1T4GA 1KCBA 3SS7X 5DF0A 5TVKA 2RG1A 5GGSY 1T5BA 1N4XL 4A8JC 2WN3A 4KR9A 2R1TB 2CCJA 1SVKA 1E77A 3H2SA 3C5HA 3RIKA 3LCYA 1K7CA 4YSPA 3K4HA 4CT4B 4PG4A 4RNRA 3T77A 4R5XA 4PM4A 4XYMA 2AK3A 4NO3A 4DKDC 5ELMA 3CXDH 3LV3B 1V1MB 4KQIA 4BEBA 2FJFA 1I6LA 2V3EA 3STZB 4BB0A 4JBHA 3O9MA 4QEKA 5SY9A 3SPHA 4GIAA 2O3RA 3JRWA 1ZHLB 4DAEA 4AMKL 5IT0A 3O3AB 3TL3A 4DJAA 1WMSA 1P9MA 4GHWA 2BPOA 2PIAA 2A3TA 5ITSA 1YYMH 3KUDA 1RTKA 2P9YA 4I8IA 3EJCA 1V8BA 4CLDA 5C4GB 3VC1A 4JQSA 4IHJB 2PAAA 2ID5A 2ZOLA 3FAZA 4A2WA 4L3OA 3U37A 3PXHA 4WSKA 3B9RA 5J1SB 3HA5A 2VJAA 1OX6A 1PG7W 3AR6A 2Z7WA 4HLDA 3L9WA 3GFTA 2OP4L 4OPMA 2WFLB 2QOEA 2X70A 5I1EH 5JDSA 2R29A 1TTFA 3RK1A 2WXRA 1JGLL 1ODUA 3G8BA 4W9NA 5TJ9A 4NC2B 3V52H 1JDPA 3EIXA 3MHTA 4KKBD 3DDWA 1X0XA 1VCIA 4GSUA 3WMSA 3AHHA 2AKEA 3O2WH 2WE8A 1PF7E 2BR4A 3HS0B 3EXG2 4G11A 3PGCA 4WFED 1KQ3A 5CD5C 1PLLA 5J6SA 3JVIA 3QY0A 4JPWH 3TECE 3W05A 4G7VL 2XQVA 4DEPC 2JFGA 1N5AA 5IBPA 5BJTA 5I1DB 4WY7H 3V6FB 3HGTA 3KYDA 5EDSA 1SUCA 4YDJA 1FVCA 1BQRA 2GI7A 1KY7A 4PJDF 4DVBA 4X7TA 4IS6A 2DM6A 2QFRA 2VQFB 2G1UA 4IUDS 5GM2A 5D7KE 3KXLA 1AHIA 2J59A 1YY9D 5GTDA 3VJ6B 2B83A 2G4VA 5JWRA 4EDHA 2WF7A 4MB0A 1H4TA 4OUDB 1Q9WB 1L4EA 4HUUA 3WELA 2VXYA 3NABH 2Z8VC 4E5PA 3WKBA 1Y8CA 3V4SA 5AW3A 4PJHB 2W42A 2F54A 4MS3B 4EY8A 4EEKA 3LDHA 2JK5A 1Y6RA 1Y7IA 3B8EA 2A84A 1XZQA 4TWZA 2HUPA 3O90A 3MAJA 2IHUA 4MQEA 1BHQ1 4U8GA 5A3QA 1QFWL 2R0WH 3EYVA 1GW6A 3IAUA 3C6LC 4OXIA 2V9TA 2QIPA 1X5JA 4LJYA 3TO4C 2H32H 2BRRL 5TEVA 2DQHL 1BDBA 2B92A 3TSZA 4Q9QL 3RL1B 3R9XA 2BFFB 3S5ZA 1IN8A 3KJXA 1CJSA 2IPUK 2IYYA 1F42A 2PX3A 1M0EA 3GSUB 3C24A 3SN6A 5E1BA 3RWOA 4QPCA 1IOVA 4WVLA 3LTNC 3MNZA 2CLLB 2DW5A 4Y4FD 1YRHA 4ZXBD 4BQ6A 2WNIA 4B5KA 3R0VA 1G9TA 4AMBA 3ARBC 4OZFA 4Z3GA 2Z6UA 5SZJA 4BELD 1E89A 3MIZA 2CFTA 1O4VA 4BLPA 1ZVJA 3GEPA 5GS1B 3FG9A 4NQDB 2BL4A 4W8GA 2APWA 2DJIA 4L8SC 1RYZA 2N1MA 5U1PA 1RKQA 4CI0B 3U4QB 1S2MA 1SBTA 2BSEA 2WSBA 3ZDYF 3U62A 1F2QA 4Y16C 1YO6A 3GA5A 4XQ9A 3AP1A 3IOCA 3QELB 4WECA 3IEAA 4BGUA 3NHWA 1WWKA 3OU7A 3C6SB 5B21A 3UYRL 2Q10A 2I4NA 1F8UA 3BHMA 3EPRA 5CG2A 4F1ZA 1MXDA 2AV6A 1E4XH 1I6WA 3ILEA 4JFFD 5BSRA 3L4CA 4RX4A 1ULBA 3OJDA 2CK0H 1QP1A 1WF6A 4FZVA 5EZLA 2VJ8A 2P6UA 4GYKA 2HB0A 2ESVD 2BFVH 3H8SA 2OORC 1SBIA 4MIEA 3QLUA 4J4HA 3IXTB 2EE9A 2ZITA 3OETA 1VFOA 2AANA 3NRQA 1QNFA 4ZSOA 3HZYA 4APQA 1D1TA 2WJ3A 1P2SA 1Z4PX 4NJAH 1K8ZB 4YGXB 5H4YA 5TEWA 4B44A 3AQDA 3RUIA 2J72A 1DBWA 3TMKA 3OXRB 1JQJC 5EA0L 3U7IA 2OLJA 1N5RA 1L5WA 1NVVR 5IQLA 1R0BA 3NK3A 3KPWA 4YXFA 4BWVA 3O8QA 5L4JA 3IH5A 3WFHB 4DSTA 3E81A 2IXBA 1FFRA 1DC6A 1YE3A 3ILVA 4UT7L 1TAHA 3IUJA 1ZR4A 1YEIL 4QATA 2GJ6A 1RWQA 4X4YA 5C09D 4AKIA 3IFOB 2ZBGA 5ITZB 1H4VB 1HSZA 1QVOB 4PLKC 3MRRB 2GTZB 4OHBA 4X8MA 4N0UE 3VH8G 3IXAA 4ZVUA 2YRWA 2DT8A 5FUYA 4PJDA 4IMIB 2D3TA 4DQXA 3MAWA 3RVUC 3HC7A 3OKAA 2IIPA 5I19L 3L4VA 1T2EA 4DUXA 4XH2A 3QQDA 1ZH2A 4H1LA 4WA7A 3GJRA 3FQ4A 3D85A 2DJMA 4I85A 2EJTA 4HDRA 4Z7QE 5EZ6B 1IKNA 1HE5A 2OZKA 4G1UC 3ABMB 1CD9B 3OB0K 4EPSA 2IHZA 5HEKA 4B9ZA 1OGTA 4DP2X 1YDFA 5C0CD 1R46A 1KNOA 1QFPA 4HWBH 2I5YL 4UTXA 1QIGA 2ZJBA 3BE4A 3NCJL 2PPDA 2UVEA 4P2CG 4Q9RL 4H1WA 4MCYA 2UX7A 4JT8A 4H27A 4R7DB 1TUEA 4JX8A 4YMWA 3QNUA 4ZPTA 3SO3B 3U30B 3MROB 3ISWA 5K8LA 4MYPA 1FTWA 5TQJA 2ORYA 2GBCA 3V6ZA 4GP8B 3MRCA 4WHYG 1OCOB 5AVQB 1T3LA 1L5MA 2ZRCA 5T3XH 5C0BD 3GRYA 2EGUA 1HH9A 4AWBA 2FP3A 1K5GA 1TFHA 3BQUD 3W56A 4OGAC 1OTTC 3GMQA 1UD6A 3T5GA 1NY6A 1T2CA 3TF5A 2FX5A 1X7ZA 1PZ5A 1P3JA 4JDPA 1EK2A 1JSCA 3C09C 1FRNA 3NAGA 1Y9EA 5G53C 5EHXA 1K63A 3HCBA 2ZWPA 4X98A 3ARZA 3DGDA 5A2JH 2VWEE 1MFEH 3QH4A 2M26A 2QORA 3GRKA 2BMKA 3DP9A 1U9ZA 1AGBB 4OI0A 2VMDA 3JWGA 5J1TC 3NWEA 5A5FA 2EF1A 4X6UA 4NQEB 1RKVA 4IUBS 1MGPA 2BVUA 1QYWA 5DXAA 3CIOA 3LIZL 3D6MA 4U2DA 3KKOA 4ZVTA 4Z3HA 1DQYA 1RVDA 3RPBA 4B4DA 1PGNA 1G16A 4N25A 5GGTH 4CDMA 1VJDA 5T3XD 4YALA 4CBVA 3MUJA 3PV6B 1KH2A 1DO8A 1NAKL 4HLJA 2Z5FA 4RKFA 3DFKA 2FHPA 3THRA 1X7XA 3CVWA 2A0FA 4FQQB 4YP9A 1J87A 4JU9A 4BTVA 4FAAB 3TI9A 3QEQB 1UGNA 4MYRA 3GXNA 4K6OA 4YAGA 1B2LA 1EAJA 1T2AA 1EO8H 4JFRA 2VP4A 2FSIA 2B2XL 4HQ0A 5TQ2H 3A36A 4FYXA 3TKLA 5EO9A 2NY1B 1QK4A 4KTYA 1Q1NA 4KB5A 2QAGC 4M1SA 4QY8B 1Y4AE 3CG4A 3GDCA 2GWHA 4FHZA 4Y7OC 2AZXA 5HP4A 4ZAXA 1LJ8A 2F15A 3OMLA 4DKEL 4ZNEA 4POAA 3LBNA 2IOIA 4KQXA 1WWAX 3RE1A 4K7PY 1J5EB 2NT0A 5I71B 4IFEA 5SYNA 1IATA 4HDSB 2F8XC 3IMWA 2HDWA 2AW3A 1C3JA 1T5OA 5JW4M 1KJNA 2WP8J 3SC2A 1D9KD 5TGDA 1BDJA 4MJ5A 3ZWXA 1V3UA 1N8SA 5DT2A 1U90A 4U4AA 1A6VL 1ZLEA 2FU5C 5IM7B 3JUZA 3KUCA 2QT0A 2MMXA 2YXNA 5L6YL 3CVHL 2C7QA 1AMNA 4ZYWA 1UXLA 4HKZB 2EAEA 3MLWH 3QORD 1URLA 3WL8A 1XGYH 3GJSA 3BP6A 3RS9A 1DVYA 3KOYA 5HJ3A 4MULA 1FAIL 4MAYB 4JO8A 3FOLB 4FCHA 3TEJA 2PKRA 3U4GA 2FQQA 3BMXA 3BP5A 3BJ91 1YUBA 2E9GA 5DCUA 1Z38A 4F58L 3K7EA 1BMFD 2W2QA 3DYVA 1ZC4A 5JSZA 1MUJB 3GNML 5KNCH 1GFZA 3I28A 4ONHB 3DI3B 3AJ7A 5TF1H 2QQNL 1ACMA 3IU3B 3D4ZA 3LN5A 2OC4A 4OIIL 3JQBC 2XYHA 2FQWA 1THAA 4BIKA 2FE1A 1M8GA 5LLTA 4LF5B 3RWIB 3OIVA 3P9SA 2QZ5A 5DJZA 5BQOA 1J2UA 5DJYA 3IELA 3RK4A 3QUYC 3UBGA 2QQLH 3OEYA 1EFVB 5BS0A 1P6UA 4BAZA 3CE9A 2OK7A 1J97A 3H4VA 2ZJ1A 4KC3B 5J5EA 1KY3A 1SIBE 3Q3HA 4PAGA 3VWJB 1XP8A 4X9IA 1FZOB 1QNZL 2XBMA 1EEHA 1NJ9B 1MTZA 5L9AA 2BPBA 1H8HA 4KZEH 1NBOA 1ZL2A 4R6UA 1FUKA 4PRLA 2OXRA 4K94C 1HOTA 1ZVHA 3IHLA 2JFVA 3ZWDA 4IMRA 4NMHA 2Z6VA 3VMOA 4GXUN 4LSUL 1M2OA 4DF9A 4HGYA 2UUBB 4CYMA 3KYMB 4FW9A 2EABA 2C5EA 1FL6A 3OU6A 3E3AA 1Y1KE 3G5LA 5KNCD 5CIPB 2CO6B 1QAQA 3ARGD 4WV1A 2FMFA 1E2FA 4Q6WA 3E7FA 3QUZD 4CMIA 3N42B 5D1XB 4EI5D 1J8RA 2DCMA 3AGQA 3HLAB 4OJAA 1ZS8B 3X3FH 1SXJD 4QJ4B 2A1TS 2JBHA 2PUHA 3G5UA 3OH8A 4LLDB 4L23A 4OZIE 4E2FA 1R50A 2H4HA 4DZ8B 5C70A 2LU7A 2Y0SA 1SJHB 1Y48E 3NPZB 1OTHA 1N8OE 1U8MA 5EUKB 4JPIB 4ZARA 4CL0A 2J88H 2BJML 2FWLB 2ZUQC 1MPAL 1T6XA 2CF6A 5H80A 4P0QB 3G6JF 2EX4A 4HG4J 2ZCKL 1IN5A 2J3HA 5C0JB 1ISIA 1Y6MR 2FVXA 4UNSA 3P9KA 5F9OL 3CCFA 3KVYA 5GM1A 2QHLA 2CVQA 5D6DC 1UWXK 3U7GA 4L8CB 4Z7NB 1L6RA 4HIEA 2EX0A 3NSDA 3CN4A 3DMMD 3INUH 2PDAA 5FBKA 4BMYA 5L9DH 5JMWA 4LXFA 1QAOA 2HRRA 1KPUA 1OOWA 3TNNA 2XE8A 4CM6A 4LXXA 4OLVL 4ER0A 3ROLA 3GLTA 4RGMB 1SH7A 1PZDA 3ASWA 2D2FA 3QWRA 3B1YA 2XSKA 1KXQE 1E6UA 1USGA 1FS5A 3Q2KA 3UWDA 4E5VA 1R3JB 2BEUA 1TM5E 3PDIA 2A9NH 7ABPA 5BYKA 2UZIL 3LPPA 1H4QA 1NMCC 1FP4A 1OZFA 3FVRA 4JI8B 1A1SA 1I4WA 3OOEA 3ZU8A 1PJRA 5BP7A 4XMXA 4J91A 5C0DB 1CYDA 5AAPA 4X44A 4TLTA 1DV2A 2A94A 1RD4A 3FONA 2C95A 1XGQA 3RRJA 1OMOA 4RIIA 4TVUA 1HOXA 5INDB 4X9FA 3S8YA 2Q4OA 4XCFH 5G5DA 1POWA 4ZYKB 3S44A 3WR5A 2IANE 1V26A 4BX8A 1MEXH 2NU6B 1WK0A 3MLRH 2G1AA 3W6ZA 1JEOA 2NZJA 3VU3A 2ZE6A 3W0WA 4PLVA 1VGEL 3VSBA 1QE0A 3RTAA 2VDLH 5HWSA 4CM9D 1UC4B 4JZJC 4BO3A 4QA9A 2XUJA 1UF9A 1XMPA 2I7CA 1UXIA 1H19A 1JTVA 3BKCH 4KXAA 5TQ0L 3I75B 1RADA 3BAEH 1DAOA 3ZHLA 4ZRMA 2VN5A 4CQLB 4BUJA 3FTUA 4JLAA 3GHYA 3IFSA 5AI9A 4BUZA 3ARBA 1UB5A 3W5IA 3C1UA 5AI5A 4UT9L 1GCYA 3UTSA 5D2NB 1WUYA 1SRQA 5DFVC 4R5HA 5AVSA 2RIPA 2IYRA 5DNWA 4ICWA 1XHEA 3MRLA 5BV1A 4FFZH 2ODTX 4QHNB 4L8SA 3OKLA 1BWMA 4XJSA 2X6RA 1V7ZA 5FYKE 5GZOA 1KY6A 2UY6B 1UXGA 8ADHA 3HZMA 4YCAA 5IBCA 3LHAA 4PNPA 2YL2A 4K9PA 1E79D 1N2ZA 1QHFA 1CQXA 4Q7LA 4ZU3A 4QE3A 5KSPA 4KN8A 1Y34E 1X9LA 1S5HA 4IJ3C 4UMSA 3E2IA 1N0UA 3VNUA 4IRSB 1HE4A 4AW9A 4EVQA 5TPWH 4CTNA 1XTLA 3RGVB 2RAPA 1BF8A 3QA3E 2VE6A 2BI4A 2C88A 3AS1A 1HZLA 2VISB 3CNLA 1E0KA 1KR5A 3UV7A 1V5IA 3IDSA 1JMYA 4RGNE 3EGDA 2YLHA 1WZEA 4W7IA 2ZOOA 2PSFA 1PJWA 4LG1A 3H1BA 2OORA 5IREA 1CL7L 3L9RA 1JLHA 4GEJA 4LSGA 4B96A 3F7YB 4R26H 2V4UA 2XKNA 1YEWA 1ZGCA 3LX5A 2JVJA 3ZD7A 4QHSA 3FO0H 4YSOA 3QDMD 3VXPA 4F7PA 2BS9A 4EF5A 2FWJA 1NLZA 2CXKA 1CZUA 3LUDA 5LLSA 5DO8A 1EXMA 3OAYK 2NTYC 2O0JA 4R7VA 3K72B 1Y7HA 3WRYC 4K1LA 5DLYA 1YNKL 5EIAA 3M17A 4POOA 3CZNA 1JDNA 4P6VF 2ZTVA 5HGBA 4L9DA 4DQOH 1WHPA 1DX9A 3BXPA 2VJMA 1WCIA 1IGYA 4L4SA 2I6UA 4XLLA 3TP4A 2XYPA 3OR7A 3ZV6A 4HFUL 2W9DL 4LCCC 3AG6A 4ODVH 2QEQA 2EDWA 2VQ4A 4B7UA 1ABEA 4A2CA 3G6JA 2QSCH 2Z8YM 5JUEL 1WWWX 3R6DA 2X8BA 1JP5A 1XV5A 4Y1TA 2AV7A 1LPAB 3RIMA 3NDIA 1X1SA 3FUVA 3IUSA 2J3EA 3OLXA 1MNQA 2PA3A 5FDWA 3QW4B 2CAKA 2I62A 4AICA 4BLOA 1YEDB 4FXGC 4I3HA 5SV4A 3TO2A 1QHIA 2WAHA 4IEIA 2E75C 1YN6B 1J12A 1VHWA 2A6KA 4CMEC 1HNGA 1ZT4B 1SQSA 4C05A 4PSPA 2WZ5A 4M7KH 4PB0L 2DR0A 4FMKA 3WOHA 1HCFX 1NW4A 3P1VA 2IBZX 2VLLA 5C37A 3WJ2A 4Q1CA 5B12A 3T8MA 3F9CA 1H3PH 1MRFH 3FO2A 2XQKA 3BL5A 5FW8A 3R18A 1M75A 3RARA 4BK8A 2G2NA 4S1RL 3TMAA 5CB0A 4RSHA 4JUAA 1DBAH 2ZFUA 4RWYL 5LXTF 2HWYA 3X1YA 5KYUB 2AAAA 4HT1L 5KVDE 1BLIA 4N0EA 2WQ7A 3OAZK 3NXSA 3L79A 1P1IA 2HA4A 2NXWA 5DUMH 1I4FB 4Z3KA 4EHHA 1HQCA 1W87A 1QO0A 2XY1A 3AXLB 4N7JA 1RXLA 4JWTA 4ND6A 5HI4C 2HXSA 1P1CA 1HYEA 1YJDL 1EEYB 4PV9A 5ICGA 3O8XD 4GXVH 3MGTA 5ESVB 2D2VA 1E9QA 1XCGB 4HGZA 2FSUA 4UAHA 2O06A 3AREB 3P9PA 1U9CA 4CF3A 2VH5L 2A1WL 2ZI3A 1E2DA 2RACA 4AUJA 5L2KE 2V4ZA 4WF7A 3DX2A 1Z3RA 3IUMA 1A9XA 1XVUA 3EUAA 5HI5D 3EF0A 2G3NA 3FI0A 4RJTA 2C92A 4QYIA 3H5AA 2A73A 4BWWA 4Q93A 4MI9A 1PFOA 2P77A 4NQUA 1HKFA 1TQHA 1TUGA 3DB2A 2GPZA