3NIGB

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
466
structure length
466
Chain Sequence
b'GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
molecule tags Cell adhesion/blood clotting
source organism Homo sapiens
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
total genus 127
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nigB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nigB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nigB03
4NENA 1SHYB 4GZ8A 1U0NA 4IHKA 3N2NA 2XGGA 3TVYA 2ICAA 1DGQA 1M2OA 1FNSA 4HQKA 5E6UA 1M1XA 3ZDYB 4UM9B 2VDRB 3BN3A 5KYWB 2XWJI 3AL8A 3ZDZB 4MMYB 3ZQKA 3NIDB 3AL9A 4F1JA 1UEXC 3PPVA 5E6SB 1JEYB 1JEYA 1MHPA 1ATZA 2M32A 3K71B 4HQFA 4JDUA 1ZONA 1M1XB 3FCSB 3ZE1B 1OLZA 1IDOA 3PPXA 5KYXB 3V4PB 2VDNB 3NIGB 4MMYA 3OKYB 1IJKA 4C2BA 5ES4B 4NENB 1M1UA 1BHO1 1SHUX 3IJEA 3OL2A 3HXQA 2ODQA 3ZE0B 3VI3B 4WK4B 1QCYA 3EGXA 3NVQA 3BQMB 1YVRA 2UZYB 1JV2A 4CN9A 5KYXA 2VDOB 2NUTB 3TXAA 3OKWA 1SHTX 1PCXA 2P28A 2WW8A 3IBSA 2NUPB 2ODPA 1ZOPA 4HQOA 1V7PC 3K71A 1U8CB 4Z7OB 1M2VB 3EG9B 1CK4A 3F78A 3M6FA 5E6SA 4WJKB 4UM9D 1L5GB 3EFOB 5E6RB 2NVOA 4XW2A 3QA3E 2B2XA 2VDLB 2VDMB 4WFQA 1AUQA 1RRKA 1JEQB 1RS0A 4IGIA 3ZDXB 1OAKA 4BJ3A 5HJ2A 4FX5A 4JX0A 3VI4B 4NEHB 3T3MB 2ADFA 2I6SA 3EH2A 1PD1A 2X5NA 2O7NA 3FCSA 2QTVA 3T3PB 1T0PA 2IUEA 4O02B 4IXDA 3EOAI 1BHQ1 1QC5B 4MMXA 3AFCA 1JV2B 4WK2B 1RD4A 3HXOA 1NA5A 2I91A 4K3JB 1IDN1 1PT6A 1MJNA 2XWBF 3BQNB 3EOBI 4F1KA 1JEQA 3AL8B 2VDQB 4Z7QB 4A0QA 5KYYB 4C29A 5KYWA 3NIFB 1MF7A 1MQ8B 3TW0A 1U0OC 4HQNA 5HGJA 5KYUA 4C2AA 4MMZB 1AOXA 3E2MA 5E6RA 4DMUB 1L5GA 1JLMA 3EFOA 3F74A 3PPYA 1LFAA 3Q3GE 2WINI 2VDPB 4MMXB 3ZE2B 4O3TB 1IJBA 4FWWA 1SQ0A 1XDGA 2NUPA 1ZOOA 3K6SA 2I6QA 5KYYA 1SSLA 1YVPA 1T6BY 5KYNA 1XUOA 4M76B 4WK0B 3EG9A 4G1EA 1MQAA 3EGXB 5HDBB 1QC5A 1AO3A 1TYEB 4O02A 3EGDA 1RTKA 4CN8A 4PN7A 3RAGA 3HI6A 1DZIA 1XDDA 2VDKB 3GXBA 5BV8A 4MMZA 4O3UB 1U8CA 1M2VA 4G1MA 1YUKA 2VC2B 1N3YA 3PPWA 3EGDB 3K72B 5KYUB 1N9ZA 1MQ9A 4G1EB 3FCUB 3TCXB 4UM8B 2NUTA 4CNBA 2P26A 3EH1A 5LN1A 1PD0A 3V4VB 3K6SB 1FE8A 1Q0PA 3K72A 5E6UB 4HQLA 3IJEB 3OL2B 1M10A 4G1MB 4Z7NB 1CQPA
chains in the Genus database with same CATH superfamily
4K9KA 2ZWKA 2AOTA 2YC4C 2OYRA 1IT9H 4BC1A 5TDNA 4NDMA 4H1LG 3GOHA 1Z4QA 3CF4G 3UYPB 1XIWD 4F4HA 1ZP6A 4NKRA 3BH4A 4KH9A 1XEAA 3H7BB 3FCSB 4F21A 1G0NA 4HEA6 4TYPA 1CO1A 1NBYA 3RIHA 3T0FA 2YEZB 5H37A 5D5MA 3FB5A 5F89A 2GBIA 3IR5A 3WBDA 3FT3A 2DE0X 3G5ZA 4YHMH 1MJFA 3SHOA 4JQIL 1UKZA 2I6TA 5KSWB 1KLUB 1ZGLB 4F97A 2ZBPA 3CXFA 3GNTA 4L85A 3Q0EA 1HDIA 4O4HB 4XBPA 4FR2A 3X2EA 3AJAA 4C2UA 1RP7A 1X13A 2YD5A 1NCCH 1IPFA 1YUNA 3SC4A 4U2GA 4PIRF 2V5TA 4PY8I 5F5LA 4JR9L 2F1AA 1GR1A 2Z5FA 1DEHA 2LQRA 4F4UA 5D01A 1E5XA 1CDOA 2DY0A 3QE4A 1NXQA 4J2XA 2WJIA 4ZAVA 2C3XA 4E3WA 4X7TB 4OH2A 5CB4F 4AY4A 3ROMA 4GUQA 1LY1A 4Q1FA 5GRYA 1RFDL 4BFKA 2VRNA 4V03A 3BKJH 3E1ZA 3FTSA 3TV3H 5L3QA 1CBUA 3H3KA 1P5VA 4I2NA 2HJLA 4YO0A 1UGNA 3L3OB 3CUEF 2CLHB 5IJVA 3PRJA 2IOFA 1P3Y1 4BUGA 3WDHA 1SR8A 1T8WA 3H2HA 3AIKA 2ZROA 4MGXA 1BC5A 2J9YB 3HS0A 5FW6A 4RH3A 4MQUA 1IGIH 1SBSL 4DF3A 1FYTD 5BOSA 1P7KA 1D5RA 2FWLB 5HHVL 2A0FA 1PJAA 4MA8L 1IEQA 1Z33A 1P1HA 3S5LG 3AL9A 3GSVB 5EC1B 3N44F 4IBLT 3ZGHA 4GX0A 4P2RA 3HEMA 1GPH1 4JFZH 4GKZA 2ZSIA 2XAAA 2JZOA 4B3VA 1JI3A 4EUKA 1IN7A 4ZU3A 3HN6A 4L8CB 3IJRA 4ZYKA 3ZHBA 1MEXL 3CSTA 4ODXB 1IK6A 1L5SA 3OOSA 5EQFA 5I3CA 1GADO 4U2YA 4CM3A 4ZV4A 3MRCB 3WY2A 1I8IA 4JKMA 1XHFA 1T36B 1GARA 3VXNA 1A2OA 4NQDA 2I69A 2G3YA 3B9KB 1Z06A 1Z6ZA 2QR2A 3TM4A 3ZW3A 1J0CA 4ZVVA 2XNAA 2VF5X 3F2LA 1LNUB 3JV4B 4WW2B 3SZKC 2B59B 2XG5B 4LRIA 4H0FA 2QTNA 4WCFC 2XRYA 2BZCA 1KYDA 3AL0C 1QTIA 3O3CA 5I15L 1X44A 4FNQA 3HC3H 1C08B 4GOOD 3R6WA 3V7NA 4AKEA 1NNEA 3E2IA 3MT0A 4QHSA 5JPMA 2XTAA 1GG2A 3HAEG 1GHFH 3UMSA 3GNSA 3RDTA 4MAZA 1SXJD 1T1ZB 1AZNA 4GVLA 3Q01A 3W5NA 1MIMH 4IILA 4JJAA 2B8JA 4Q4JA 2E7ZA 3UGJA 2GUWA 3SDZA 2VWHA 1U4OA 2QVCA 1JZIA 1MEOA 1YB5A 3CUWA 4JH0A 1TKAA 2E6KA 1XK7A 3NR2A 3LCJA 4N2IA 1E66A 1TVCA 5KWJA 4UM5A 2OXFA 1E9VA 3KJXA 4YPJA 1CZUA 2ZZKA 4Z7QE 2WVVA 5KSAC 4BH7B 2YPVH 2ECQA 1U28A 2AJYL 4F8PA 3AUYA 3L41A 1FJ1A 1H9AA 4NRDA 5B36A 3K5PA 2NIPA 4HH8A 5E8PA 5C92A 3KR3L 1V95A 2QV7A 1U0EA 5GZOC 3FVWA 3JTMA 4A7TA 1YK0A 2C58A 2J85A 3OIYA 3RRXA 1C9SA 4RX4A 3FPEA 3JD4A 1WFMA 3HDJA 4WN3A 4N2OA 1LRKA 5BRZA 5L6LB 2DKUA 2JI3A 4PYMA 3OZIA 4FAAB 3DO7A 3NDPA 2FZCA 4UHJA 3VZDA 1BGXH 4RMVA 1THGA 5LQMA 2WC7A 5D70L 3I6LD 4FA6A 2Z98A 4G0MA 3W06A 4PWFA 4YC2C 4Z7QF 3VFMA 1ILEA 4H7IA 4RZCB 5CD5C 3GXFA 4TQ8A 3T04D 1L3CA 3SSOA 5ECWA 1SHSA 2NR6A 3ARXA 2MWMA 3EAFA 3PL6A 5CSZA 4G42A 1Q11A 5JW5A 8ADHA 1Z68A 1NSNL 1N0UA 5AW2B 4HGZA 1UKBA 2WEKA 2NX5E 4EUPG 2O3QA 1FDUA 2HN7A 1T10A 4CVXA 3P9YA 2EVGA 1ZLYA 5K45A 2DPLA 3OZEA 4WV1C 2VISA 1E1RA 1RJWA 1EDQA 3FZGA 4IH4A 1NDGA 2DT8A 4E0RA 2DHRA 3PVCA 4D0CB 1V4NA 2RG1A 2FKAA 1ZJWA 1G20E 3DMYA 4PIPA 3VR6A 1D6VH 1VGQA 1YOBA 3AZPA 4JFZL 3L1GA 2VSKB 2YN4A 5ALNA 2OCYC 2W59A 1HL7A 1IGJA 2IOMA 1V47A 1XGQB 4KC0A 3SJZA 2KS6A 1Z2NX 4JT2A 4N3GA 2GM4A 2PN5A 5EU6A 3ULVC 1BNCA 1MY7A 2GSGB 5AKYA 1QHYA 3FBKA 1XSEA 4KV7A 4O8ZA 1S7WB 2W83A 4K26A 1QGUB 5CINH 4TZ0A 2FY8A 2WLIB 1VRWA 1NULA 1VF5C 3ZE0B 4TWBA 3GUZA 4HJUA 3JQBA 2OE2A 2E89A 4JLWA 2AOWA 1DVRA 3UDWA 5FYKE 2V3DA 4TOIA 3RHSA 1BKYA 4Q1DA 4XO5A 3QUZD 2EWVA 1LK0A 3MLVL 4N40A 4P3DB 5AVQA 4FI7A 2R69H 1P4LA 3FUHA 1OV4A 3LKRA 2FW0A 4M8RA 3U1TA 1ZJBA 2NY6D 1LPMA 3GZOA 1XO1A 4G4GA 1SDDB 4D4HA 1O6BA 1N9GB 3BP4A 1COBA 3GRWA 5TR9A 4I36A 1PTJC 1QTSA 4GSDL 4XARA 1IM3D 2KMWA 4ZEVA 4H25B 1SC4A 2BEVA 4XTRC 2JH3A 2MYPA 2Q2NA 3E3AA 4X99B 2DUJA 4RA3A 1I0IA 4Q3AA 4GSUA 3IX7A 1XZ0B 4UT9A 1ISHA 3P9QA 3TQIA 2A4EA 3EIWA 4OJYA 4HHGA 3V8EA 1ZLDA 4LZJA 5IMSA 3ANTA 1URLA 1OF0A 4G8IA 1DQQB 1Q19A 1XX6A 3NHAA 1YIAA 3TU6A 1WWWX 2A3TA 5SWZB 3UJDA 1Y3AA 2ENPA 3AL8A 1K5HA 4AD8A 3U4HA 4XLLA 1L9PA 5SY6A 1B6UA 4MQTB 4EI5D 5D2LF 1TU3A 3VRIA 2J45A 3RNOA 1K06A 4ZS7H 1BGVA 1J18A 4LMBA 5FTNA 3TRDA 1CJBA 3QUYD 4LGMA 2EX0A 1NVVR 2LU4A 3VV3A 2FB4H 4XNDA 3AETB 2PA0A 2V7HA 1Z4OA 1FZOA 3DCIA 3GRPA 1CMOA 1DBVO 3AF2A 3PJDA 5EUQB 3KPSB 4RPCA 1RLUA 2BT4A 1QLFA 4QZVA 1EP3B 3C7TA 4KI5E 1JG9A 4NMWA 5HGBA 3K0AB 1AOHA 1XZGA 3PS9A 3A67H 1J21A 3HA0A 5AW0A 5AW1A 3WICA 2BFPA 5ERWA 3OTQA 5T4BA 3SIRA 1AQMA 2WKSA 4EKXA 1S7XB 2B4RO 4KHPB 2XYQA 2N59A 3M5DA 2FZKA 5FBLB 3NNNA 4CF4A 4R68A 4N2BA 4Z77A 4ANWA 4WGFA 1Z62A 4X71A 3QXCA 4UTBH 4B09A 4CNBA 1O77A 3O0DA 3DYIA 1DJPA 1W2WB 5GJVC 3AB3A 3UV7A 3DCYA 5E03A 1ORDA 4Z7UB 1GRCA 4C0QC 2F0CA 1EHAA 4NZUL 3U0TB 2GW5A 4P31A 2WN2A 3QDMA 2IXQB 2IUTA 4I48B 4HRAA 3ZE1E 1GZPA 1RDFA 2H2FA 2IC2A 3MOAL 4MRRA 4DDMA 4PFSA 4LZKA 4UUOA 3T1FB 5HPMA 3S97C 3MV9E 1T9KA 1OP5K 2X5OA 2ZSEA 1GPOH 3AY7A 5IOPA 4FBGA 2R7KA 4OHWA 2BVYA 3ZE7A 1QYGL 2X1OA 1RWXA 5CLGA 3DUWA 4APQD 1XFDA 4KTEL 3GZ4A 3KQSA 3U4GA 1QXSA 4M1OA 2QRGA 1VLLA 3HE7B 4HHAB 1UH3A 4QUAA 1Y6QA 4NE2A 5EN2B 3BFXA 3BAZA 1VFBB 1YZUA 2QLNA 1U7DA 4KVNL 4WY7H 1AHIA 3BAYA 4L02A 3L7EA 2PT9A 1E61A 1E0AA 4RIIA 3DKPA 4OVVA 4HDNA 1NIFA 3X3GL 3CX8A 3MXTA 2ROYA 3PGDB 5GGRY 4WEUD 1WU7A 4N0QA 3BAJA 1RQNA 1OW0C 3TX2A 3FHJA 5F1OB 3F0TA 4NAHA 3VSCA 3IMUA 1UXJA 1JU9A 4OM1H 5EHXA 1ZKMA 4MITA 2X6CA 3SEQA 1HEJC 5ALVA 1DWQA 4BWVA 3DBIA 2VDVE 2HT2C 4X6CF 1EXDA 4GMSH 2X6TA 1JUFA 2XA3A 1QZUA 5M29A 2Y0SA 5DR5H 1AD0B 5F96H 3G5XB 4NFLA 4LDOB 1EP1B 3RUGF 2WVJA 1RULH 3L0YA 3ZY7A 3ARFB 3X1GA 1BN7A 1G7RA 1XZJA 4FNTA 3MV8D 5B8CA 4KXUA 4PSVA 1CUHA 1J5PA 2OSWA 1KJ2A 4Y19D 4DCJA 4PYNA 4NQDB 3VWJD 4FHBD 1E4VA 4B7UA 4HKXA 5CEYB 3RBXA 3APMA 1YL7A 3KYNB 1NM5A 4LKRA 3LPFA 4G82A 4NCJA 3L4XA 4Q6IC 2F1IA 3MCAA 4E08A 1E30A 2GD2A 2NYRA 5HYVA 5A9RA 3LSOB 1ULSA 5KSAB 3T0EA 4QLAA 2ZOOA 5GZNC 1E2DA 2CQVA 3O84A 2BTQB 2G9RA 3N1UA 1H93A 3RT1A 3EQZA 5HGDB 2EFDB 2JCCF 3O82A 3ETJA 3FDZB 4DR6B 3DVLA 1UJ2A 3MJDA 3QA3B 3ZE2B 1T0UA 2M2IA 1LQBC 1U8AA 4UUQA 2Y6SC 2HTFA 2HMVA 3PLRA 2WOOA 5JS1A 3SQNA 1QG3A 4K5NA 1A2BA 3VR0A 3DFMA 1SFDA 1VERA 5J5AA 3LGAA 2WKOF 5HDQH 1JEEA 2XGJA 4ZT6A 3SBWC 1V2GA 1SURA 1GPJA 4HAYA 5FFFA 5EIWA 1SXJC 1XF1A 3HY3A 1FYDA 1JA0A 2FOXA 2P44B 2PV7A 3UOWA 5I17A 3GNLA 4OGXH 1NVMB 3GAMA 2GI0A 3F1KA 3BZDA 3MMSA 3E22A 3AADB 2YMOA 4PTLA 5JPNB 4L8SB 2VN5A 1DGQA 5BV7H 1EESA 1E1RD 2VPPA 4RTMA 3Q9PA 1RXIA 4NYLB 3HHEA 5TT1A 4I87A 5EU5B 1MHPA 3C75A 3O26A 5EIXA 5JHLH 1ZIOA 3OZUA 1I2DA 1TTAA 4Q2ZB 2E9BA 1U8PB 4YJ3A 5L3SA 3VXSB 3S27A 4BGIA 1RIIA 2Q3ZA 1S1MA 2BWDA 2XQYK 3LNEA 2ACKA 4BKQA 5JNVA 4WN9B 1FLNA 5D7EA 3IE1A 1O95D 1V8FA 2I0FA 1AD9A 2EX4A 2GNPA 4AKHA 2VO8A 2GNAA 4EY7A 2OAGA 5DCWA 3MV9D 1CU1A 5DSZA 4FNLH 2PZLA 3LUJA 3UBHA 2PT6A 4LJAA 2X28A 4LJ7A 3LCUA 4CDGA 3TO4D 4BQEA 3WS3A 1HE5A 1Z0MA 2DQEH 5I9MA 2PGIA 2G3XA 4MMZB 1WFNA 3QA9A 2Q3EA 4I5BB 4KKLC 2OUKA 3TF4A 1Z28A 3QXUA 5LPNA 3OAUH 1Z2DA 3QDAA 2NUBA 2ODIA 3ES9A 1PL3A 5EF1A 3P8ZA 3R77A 2CIIA 3PC4A 2QQLH 3LKPB 1UBSB 2OFFA 5BMOA 3LRTA 3RL1B 2VDKB 2VZSA 2XGSA 3QPCA 3STYA 3M5WA 3I42A 1L5KA 3WFCH 2X38A 2MKWA 1Y4SA 3ZS9A 2LCQA 3X12B 4PG5A 1N75A 1EGJL 3BGDA 3NVAA 5J06A 3VXKA 1PFWA 5GV7A 5K39A 3DOUA 4FFYL 2WUDA 4D9LL 1I6MA 1KO7A 3A3KA 3LXAA 4MGYR 3HUUA 5K9KA 2GH1A 5HM8A 5F7EH 4PJ5E 1PLCA 3CUVA 3FUJA 1GU1A 2OOSA 3PHQB 5E0QA 3G0BA 1TAQA 5DZNA 2O2IA 2Q0SA 5C3UA 1JF1B 1ODCA 1UOOA 3MW8A 4C08A 4R4BA 4PJBE 1WUJS 2RD0A 4QRHA 2C2GA 1QW8A 2J32A 2C4NA 4G1BA 1ZCRA 3PJNA 2HYIC 3G2IA 2OC4A 3I5AA 1IVNA 1QSFD 3RQIA 1DZ3A 3JWOL 4FXKB 1A47A 1QFMA 1ID8A 4DABA 1QVVA 1A4KB 5M04A 4PJGB 2C4VA 2Y69B 1M66A 4OR1A 2QL7A 1Q17A 2UY6A 2QSUA 3TL5A 2I4NA 3TW0A 1BP3B 1XZ0A 1KY6A 2P2SA 3FCXA 4EG1A 4ZVKA 4OZGA 1QU3A 1RIHH 1PX3A 3H1FA 3W8RA 1IBDA 2A83A 3KPSA 3GSQB 1S5IH 1XSJA 5SV4A 3F6JA 2DPKA 1X5IA 4B6OA 3SFVA 2IDTA 3GROA 1F4LA 4P1ZA 2NZYA 2ADIB 5BSKA 1KMIY 3U3DA 1EBUA 2R9HC 2Q9AA 4UM8B 1WXQA 3LLVA 2AQIA 1FVCA 1MB3A 2IA5A 5I1HH 4RFEB 1G9EA 2ZX9A 3SKJL 4PSPA 4C1NA 1KCSH 1T5IA 4YHKL 1JIXA 4QYAA 1U1FA 4OZFG 1LLQA 1E8XA 3DAGA 4DQOH 3GT6A 5HKLA 3TOZA 1Z4JA 3QZNA 4I99A 4PHHA 3VNUA 3QUYC 2YQ5A 4ATTA 3ARFC 4N2GA 3DSFH 3G5VA 5J12C 5EEYA 3IMBA 2POQX 4E4YA 1ZLXA 3CZJA 1UWVA 1FUKA 5CGQB 4W5RA 1XU9A 1XZFA 2AZDA 4DQDA 2VW4A 1N64H 3A0RB 3MM4A 3HXMA 5JW4M 2WF5A 2ODQA 4QRAA 1V7ZA 5FA3A 4ZAGA 4CM8B 2VJLA 5A1JA 15C8L 1E79A 1NFRA 4AG3A 4GUPA 2JHCA 4R7TA 3BAWA 5CEZD 4YH1A 5FF9A 3EYUL 3O73A 4HAKA 3QDGA 2MSEB 1NMBH 5ECDA 3O4GA 1ACJA 2L69A 4RK1A 1OH7A 2BM1A 3G79A 5BQDA 2WU0A 3BC9A 2H52A 2NU9A 1CQIA 1XDSA 3PP3K 2DN7A 3UYRL 3TH3T 1DX9A 2ZTHA 5H3LA 3ZXUB 4LHXA 1SDDA 3JTEA 1E0SA 2HCBA 4LV5B 2OK0L 5CUSL 1AO0A 3WRYC 4YDHB 1PJRA 1YMMA 5DD6A 2PKEA 3MXVH 5EUMA 2FMTA 3UERA 2V7BA 3GD5A 1BGXT 3BQ9A 4RK5A 1ESDA 1GKKA 3MHTA 4K9PA 2HCJB 4LKCA 1RW4A 3D3EA 3JD2A 4A15A 1L9KA 5TF1H 2QAGB 4Y6QA 5I2IB 3WJLC 2V8BA 5FB8A 1QP4A 4UHHA 2DBLL 5BW8A 4ZV7A 1OT4A 3GFFA 1IGTB 3G9XA 4L9RA 3W6PA 4L5FL 5GGXA 2AQNA 2YLKA 4M1YA 4OI1A 4GI9A 5DDHA 5FWXA 1MHHB 1GPMA 4KXFB 4JITA 1A4UA 2WO4A 3BA1A 4EZMA 3WQRA 4OLYL 3NTRA 2HM7A 2ZXQA 2AWOA 4P7JA 5EP4A 3UG5A 2JJVA 5KTMA 1K98A 2QA5A 2QKIA 5YASA 2H9YA 2GOYA 1R6TA 5GONF 2R5NA 4TS3A 5IFLA 4HCRA 3MCZA 4QBKA 3BMCA 4PYKA 3QFJE 5DI3B 2ICEB 5B1JA 2FG5A 3EO1B 4ND1A 2BKVA 4KN5A 5GISL 1PGNA 3NKFA 2YJ3A 2R0KH 2ZSWA 3WNPA 1CICD 1G8AA 2XXAB 2YFNA 1PLLA 1SYSB 3UPRB 3DZGA 1B3BA 4QY8B 4YCDA 2JTYA 4LXYA 3ZPXA 1HL8A 1MXHA 1L5VA 3RDTD 5ECGC 3E2HB 2H3NA 1KMGA 4R90H 4UUMA 3SOTA 3PWVA 3J07A 4DFDA 3OTGA 3O4VA 1N6KA 4LK3A 3PQ6A 5IAAA 4LGVA 2Y76A 3I6KA 5F3HB 1KDIA 2BGRA 1NKRA 4UAOC 4GG6A 2E1PA 1LD9A 4LSSH 4ZO7A 1ISIA 5KVAA 4XZ4A 3EGIA 3URMA 1TCBA 1GGVA 5CJPA 3HJEA 1GGBL 1G9NC 4P06A 4RBPK 1D7OA 1ZN9A 3GFTA 2YEQA 1VMDA 1ASQA 5BO0D 4W6QA 1W1UA 3NB0A 4MEBA 4HB3A 5FAKA 3CQFA 4ZIRB 5GPRA 1GR7A 1ECBA 1RHKA 3JASA 2JE8A 4RJLA 2DL9A 3EIUA 3ETLA 1DJSA 4HQFA 3OHPA 4GOJA 2Y3IA 3UTZB 2FZ5A 2DDQL 1VHWA 1KJVA 3F3YA 2VR3A 4K7PX 2XPGB 1ODFA 2RHOA 4KV5F 4Y2HA 2L42A 1YZZA 2C96A 3PWPE 1DQPA 1CVSC 4NC2B 2JVJA 5E5MA 2CXGA 3EBOA 4YJDA 1P3DA 2W6OA 3LQMA 4Q00A 5M5BA 3F3MA 4LRTB 4WEOA 4LF4B 2B61A 4Q34A 1NP3A 4X66B 3VR2D 4J3OF 4QUJA 5L53A 2ORYA 4YPOA 1K89A 1QC5B 1VP9A 3G5TA 4KN9S 4N54A 2GFHA 3FRPB 1E1QD 5IQ9A 3HVUA 1IE3A 3ZHDA 1SFRA 1VA5A 3IAM1 2EIBA 2PCPA 3SYCA 4RVBA 3K1AB 4ZWNA 4OV6F 2VDJA 5EERA 1HH4A 2IQAB 1Z2KA 1YA5A 1WB5A 1R5BA 3ESDA 2BLFA 4QULA 1I9IL 4PFQA 1D5BB 3AI7A 3W7VA 4H1LH 2LVCA 2JCGA 4RGNE 3WKBA 3F9IA 1ZTXL 4HOWA 3MJGX 4QHMB 2O2YA 3OGCB 2ZAMA 3M8KA 3F5DA 3CONA 2ODBA 1MWAB 3E7XA 4DEXA 5IJ0A 3P9CA 2LTAA 3PB3A 2P24B 4J1NA 1DIBA 3ARVA 1RLJA 3EEFA 2P7IA 2DETA 3ZTCC 1SVIA 2B5IB 3R8BB 3UTOA 3UV6A 4KI5F 1JWUB 3W3BA 4ABUA 2CNLA 4YCMA 2GRAA 5A2FA 4R90L 1T8TA 4YHKH 1NC4D 3GMOB 1KFAL 2XWXA 3DKKA 4X44A 5IEKB 4G7VH 2OGUA 2G2RA 4DLZA 3AJ9A 3N40P 1SC3A 2F90A 1G7IA 3L8YA 3GLQA 3S5YA 3ABRB 4PHCA 1U4EA 3J81k 4YDKL 1CVLA 1NW7A 3JQBC 4PYJA 4E51A 1P5UB 5GGRA 1OGIA 2WJYA 3FU0A 5C0JA 2WKLA 3V2HA 1CLOH 4KFRA 3BIKB 4Q15A 2VUTA 4XVUD 4JN1L 4ELKA 4KDCA 5CXPA 1QX1A 3CVYA 5C3MA 3DTTA 3L06A 4F85A 4OJNA 5E6RA 1Y89A 3JATA 5IKOA 3Q2NA 3T7TA 1ML3A 1H1DA 3AIIA 2HYDA 3VZRA 1KEGH 1DADA 1K86A 1NDTA 2ZE5A 2CBTA 5JHDA 5ADVA 2PPEA 3NHFA 2VDRH 5D6DC 3REWB 3H7LA 4XB6B 1IC5H 1W72H 2OTWB 3AGQA 3JTTA 2ZXBA 4RKYA 4HXEB 4CV0A 3IU3B 4KUCD 3WY1A 2NY6B 2G83A 2VP9A 4C78A 1Z07A 3ICEA 2CNBA 5G53C 4C7JA 4IGFA 3IFPB 4MI6A 4YXWA 2F08A 1WWCA 2C9PA 4JA2A 2P4UA 3QJQB 1DINA 4A2EA 1XAJA 4FQLH 4GAYA 1NBOA 3OEHD 3S8MA 2F17A 1RM0A 4LZWA 4O4JB 3HRZB 2QQNH 3N8NA 3F9CA 4HS4A 3OE4A 1IRXA 1K2VN 2A99A 2BNQA 1OGAD 1E6LA 3E15A 3TOXA 4RZSA 3TLXA 4JIGA 1V1RA 2J8UF 1DHRA 3DX8A 3F7VB 1XHLA 2YOFA 2B1RA 4MHSA 4CKEA 2QLVB 1BEEA 1OZFA 3LKZA 3UJBA 1G7TA 1J2EA 1MU0A 2VQ6A 5DXFA 4YAOA 1MAKA 5LLTA 4R31A 1Z4KA 1KNOA 2IYZA 1V48A 4UU8A 4BEIA 2V37A 1BD4A 4JGMA 4NO5B 5IESL 3QF7A 3DK2A 3QULB 3HV2A 4GAGH 4XGKA 2NUPA 3WBKA 2AK2A 2EGUA 4FDWA 2XN0A 2BFAA 4M76B 1N3NA 1MFDL 1CEYA 3GJFA 1TW3A 1QP1A 5FA3B 1R27A 3FKSD 3SN6N 2ZWLT 1JH8A 3QYNA 1NKGA 1KFKB 1J56A 1VMAA 3GRKA 1E4WH 3UTSA 1N2ZA 1XDTT 2FLVA 5FJJA 3AO0B 2HPAA 2QPOA 3UICA 1U42A 5D6OA 3NHZA 5JADA 2R85A 1XZ8A 3ZXSA 5LC1A 4PS7A 4OBBA 1OGTB 1ZTXE 1Y5NA 2MQ3A 4JKPH 1BCSB 4Z0BH 2HX1A 2Z6UA 1SPDA 4O5AA 1QG0A 1IOZA 2AZ4A 4A7GA 2MJLA 5ABPA 4EPVA 1U33A 3JYBA 4HH0A 1VE5A 3LQ2A 5C0IA 4MCHA 5CLYA 4JR9H 4OJFH 2O5XH 4WX2B 3RT9A 3JWDC 5KQPA 4ESOA 2R69L 1UPAA 5ICYB 2E9IA 3F6IA 2QD1A 3GXOA 3V0VB 4L4ZA 3GLDA 1GNVA 1G7MA 1L7XA 2G5UA 4D2NA 3E80A 3IU3A 3LVTA 2UZ1A 3DMTA 3QQ3B 5GGVY 3ZR5A 2VSNA 3HSKA 9ABPA 4PS0A 1T2UA 5KQMA 1DJOA 4I0KA 2G70A 3OC6A 4LA4A 3TLAA 1KPUB 4F2HA 1TUIA 4MUYA 4RGMC 4IIEA 2VP3A 3EPJA 4CBZA 2Z31B 1H1LA 1PS9A 5IB5A 4B7XA 5BJTB 4RAUB 4TUUA 4HU2A 5JOFA 5IVPA 2KLHA 4KQIA 1P7WA 2EL9A 2VP6A 3DYPA 1IGFH 5DYIA 3QPDA 2VF7A 2ZIEA 3HZOA 4PCLA 3S2EA 1DLHA 5L3ZA 5CIPH 4OAWA 3FOMA 1MCIA 4PGJA 5ETUA 1R3HA 1GUFA 1YR6A 5DEZA 1PV4A 5E1AB 3PC2A 4LEOA 4JUTA 2G9UA 3PL6D 5F9JB 4NNPA 4K2HA 1AR1C 3UIEA 2WINA 5F3RA 3UUFA 5A2AA 4YHYC 1TVBB 4LY6A 3UBXG 2GLXA 4WWKD 1V16B 4KXLA 1VZGA 5GS3A 2EKBA 2R9HD 1M2JA 5IMLA 4G6JL 3W9BA 4A6YB 5DD5H 4TUJB 1LD9B 2J6CA 3IJYA 2C9ZA 2VHZA 2JD0A 4C4YA 3JVGA 1RJDA 3N2EA 2ZYVX 5IM4A 2A9FA 5D6NA 4KRNA 3SKMA 2ZWYA 3N3AC 1AGFA 2GVZC 2A1WL 1ACYH 5T41A 4BEBA 4JV5B 2H2IA 1LX7A 1IK4A 4B9FA 2AZMA 5F7FA 4UM9D 3C2AH 2CFCA 5J1AB 3US0A 3IDIB 3AU1A 2Y7QA 5LMUB 3BESR 1PW3A 4IDLA 3F2IA 1UZ8B 5H80A 5P8WA 2FLMA 4Y2NA 3N85H 1JYVA 5DNUA 6FABL 1MT3A 5EF3A 2AR0A 1XXHA 3KK0A 1QUPA 4RGBA 4JXZA 2XNDD 4F4JA 4MVJD 3VZSA 4M5YH 4IINA 5EEHA 4GC5A 5B4MD 3HMXH 4H2CA 3U4MA 4JUBA 4LWQA 3LCVB 3TO2B 2O5XL 3ZQ4A 1I9GA 3M4JA 3SP1A 1DOAA 2WQXA 4X6BB 3V4PL 4AIZA 3VFOB 2FPIA 3FLAA 1RBMA 2G0TA 4BO1A 1G2QA 1EX0A 2Z92A 2G4LA 2FDBP 3PF8A 1KXTB 3N1FC 1OB1B 3VR1A 4JKLA 1W0VA 1BSIA 2Q6LA 3KYBA 4MCZA 5E8EA 5CJJA 3QXHA 1N5DA 1U3VA 4KRLB 1I82A 4BX0A 1AJ7L 3CFBA 5J23A 2R1ZA 3SGDH 3AS3A 3ICWA 3Q5YA 4UVEA 4BFWA 5CNKA 3CDGA 2W9LA 3IOBA 3WGUA 3FZUD 3KE8A 3RWJB 2Q2QA 4J4BA 3D6HA 4ZTOL 2F3RA 4PTYA 4MKTA 1RC0A 3K74B 5KKNB 4MUEA 3F78A 1TITA 4E4RA 1JQJC 2NXZB 1T5SA 3PWPA 4FFBA 4DLLA 5SV3A 3BP5B 4AZUA 4ODIA 3NEXA 3ZV6A 3WA6A 4XNZC 1CN4A 1UIRA 3O2JA 2DQJL 2PCFA 1JTOA 5EWLA 1RQRA 4AX4A 4I3RL 1YECH 1FL3B 2G82A 2BJMH 4OXKA 1N2CA 2IKQA 2BMJA 3KJHA 1G1KA 2WP3T 3JQGA 4J8PA 4N90D 4EZEA 1JV5A 4TPRH 3PL6B 2GY7B 3U0TA 4DAGH 4X24A 2ZATA 2V3CC 5GGRB 2QENA 3VI4E 2GTHA 1N5YL 3QEQB 1XNRB 1JYFA 3AYXB 4N5HX 1RERA 4BVLA 3JVEA 3VYWA 3QU7A 1ZGZA 5C0AA 4EUPA 1XN4A 5JPCA 3K31A 1BQ5A 4JFDE 2XN9B 5F7MC 2L82A 4JVUA 4E15A 1XSIA 3TCLA 2XDHA 1D7DA 4GQ9H 1CJYA 3FOMB 3MMPA 3X11B 3A6ZA 4XCQA 4RESA 2JFZA 3COJA 4N0UA 3QFJA 4WFGE 2B1AL 4YHZH 5A3ID 4DCNA 1EQWA 3MV7E 4KQ4H 3OOHA 1KU6A 1V5FA 1IM5A 1GEGA 2BKAA 1DPGA 2BIQA 4DNFA 5KSVB 4ZYLA 3EJSA 3HNSH 3O9WC 2J7KA 2BHFA 1T5BA 2V2TA 3VTMA 3KJ4B 3EYVB 3QKSB 4US1R 2EDCA 5KYVA 4BZ2L 4YMPA 3RRMA 2I80A 3G2KA 2C29D 4F57H 1AZRA 1Z88A 3KAKA 4A66A 3BDAA 1IC6A 3EQ9A 4WI5A 4M7LL 5HJ3A 3INUL 2VNAA 3VYPA 4LQFL 2Y36H 4MPPA 1VHPA 2X6RA 1FDWA 3ECUA 2F64A 2X5NA 2GKIA 1U3HA 4GMXA 3DOSA 4CF3A 3RU3A 2WGNB 4IOIB 3I0MA 1VKZA 1XJWA 3AV3A 1O6VA 2JKZA 3QHFH 4IIUA 1T8SA 2Q5FA 3ATDA 4BVHA 4YBHA 3HS3A 2WQRA 4AEFA 1YKGA 3PEFA 1RM3A 1TNMA 3RL2B 4K1LA 3IXMA 4AITA 1APBA 3MMEB 1J70A 1YJQA 3GYRA 4NS0A 3ZE2F 1DBWA 2G40A 3HVRA 4XUEA 4AXBA 1QGYA 3OM1A 4N2CA 1G7CA 2JK0A 3V9CA 4OGQC 3RS8A 3R1GL 4DGVH 4UC0A 4G0XA 1LPSA 4NQXA 2AG1A 4KFZC 5D86A 2XFXB 4W9NC 1UFRA 1NXXA 3MCWA 3U4BL 3U9SA 5ISMA 1ZM3A 2IU0A 5JARA 1VGRA 2IF0A 1DIHA 2BERA 5IB4B 1K2WA 2WMPA 3OECA 4F3KA 3H0TB 4CT4B 1FG2A 2V0AA 3GPEA 4ZXBC 2V7EA 4AO6A 5IJWA 3E9YA 2COEA 2VT6A 3IB3A 1M0EA 1GIGL 5EQDA 1CF4A 1O89A 3U7QB 4XJXA 2MQCA 4OM0H 1NM5C 4JASB 1MJGA 2JJ2D 3P2YA 2FCAA 1BTOA 1B16A 5ALXA 2BRRH 1UYWH 3FWYA 4DPAX 4P7KA 3HFRA 4NQCD 4KTGA 4DA9A 3O4LA 3VXSD 2WP0A 4YDQA 4DLPA 1E1YA 3ZI7A 5JW5B 3VM7A 3E8VA 3ZJ5A 3EYVA 4CU7A 4KIJA 1YMMD 3IEXA 5HHPB 4I2XB 1TM1E 7AT1A 1RJFA 4ZI2A 4JFDA 1DP0A 1GFSA 2QU8A 4OYRA 4IX9A 3DP7A 2ARJB 3ZZMA 5JHDB 1DC5A 4YVNA 2GEBA 4EI7A 3B5GA 1OZ0A 3RJ9A 4HGQA 1JKFA 1AGDA 4YRKA 2D0DA 4MNTA 2IIBA 3P1VA 2O61B 1KYUA 3EZXA 1SF5A 4KH1A 4KQJA 3MJ7A 1RM4A 4PHTA 1DQKA 3LQZB 1M3JA 3GZTB 1KTVA 3V7AE 1GAFH 5EZIH 3B6JA 5AW8B 2Z3FA 2FYVA 3I9IA 2WHPB 4JL6A 4V11A 5I7OA 3PKIA 3UTPD 1PY0A 2IDSA 3VTKA 1TW2A 3OX1A 5D7LD 3DZBA 3EIXA 3MLSL 3KWMA 1ED3A 5B2FA 1WJGA 4XWKA 3E9MA 3M6IA 1VXRA 5IM5A 4LLUB 2YJZA 4DQXA 1GGTA 4AE0A 3GLFE 2X4SB 5KYXA 1P1CA 4PIVA 1P4HA 4UINL 1ZM9A 2ONZA 3QRGL 2WYIA 5ECYA 5JDCC 4KTTE 5D2NE 3BLBA 3BYYA 5CN3A 3QUXD 3LWBA 2YAQA 4L5JA 4LF5B 5FOUA 4TM9A 5G4OA 5K8TA 3LRMA 4U1NA 1TJ3A 4X6DF 2J71A 4YIKA 4NQDD 3IT0A 2AXJA 3VDMA 5C1DA 1CR9L 3E70C 1XQYA 4PZEA 4A0QA 1V37A 4DKEH 1PFQA 4J0HA 4NQRA 3JV6B 4QARA 1F6BA 3KHSA 3OT1A 5DUPH 4FZEL 2AN5A 4XKJA 3GSWA 5ESVB 3DTVA 1HNXB 4WUUB 2A5YB 5KYYA 2IYFA 1JQ5A 4JS7A 2H7WA 4UQAA 5CJ2A 4LCIH 2BV3A 2BSXA 4MWBA 3ZWDA 2X0NA 3LDFA 3P4LA 1GNLA 2QP4A 2WTMA 5FDFA 3CZRA 3UTSE 1RJZA 3BCUA 5HUHA 4RF5A 4JLUA 1FC0A 3MRBA 4KUGA 3NSXA 2J6HA 1SVCP 5EGSA 2KC0A 5E8OA 2IO5A 1I36A 1OGTA 5LBTA 3TO2A 3ARTA 1RVDA 1NW5A 4B7ZA 2XMRA 2XGOA 2SNIE 3KPVA 4BQ8A 3SO3B 1ZKAA 4WEQA 3V9PA 1ETZB 2R4SL 3OIUA 2HMTA 1B41A 4IQGA 2O59A 3OMLA 2CLCX 2WNHA 3W6UA 4M1GH 4KJPC 4TZ6A 4TWZA 4ZI7B 4PYHA 4AW9A 5D9SB 1Q22A 2A74B 1OGPA 3EDFA 5TNXA 4ELMB 4B3JA 5FHBL 5KW9H 2BVOA 1SXPA 1T3HA 4P84A 5DFWH 1NBQA 5ICCA 1H8EA 3TT1H 1OP3H 4R9RA 3SSMA 2J5RA 5SYNA 3GIDA 1J0JA 1DFIA 4ESVA 4Z4FA 3HABA 1CJMA 5HSGA 4HDIA 3VDXA 3AFMA 2NTSP 2BGIA 4PGGA 3TT3H 4MJIB 1DQDH 3ZTNH 3VFPB 5F98A 2O4UX 2ATAA 4CSTA 4UDTA 3EN0A 4E88A 3EJYC 1FFHA 2XSZA 3A6DA 3NSFA 1UJ3C 4YDLB 4EG5A 3LPMA 3VGFA 4FFBB 5BS0B 1IL1A 3H42H 3QFDB 1ZL0A 4IHJB 3E9TA 4KACA 1FL9A 4K94L 3KT8A 3U4BH 1Z4LA 1MHCB 2NXZC 2WJHA 1YR2A 1GZUA 1V8PA 2W9EH 3NCTA 2VPXA 3DZHA 2FBOJ 3LZFL 1XG5A 5CTJA 1FNAA 3RWOA 3C41J 2ZNXA 5C9KA 3VG0L 3HWRA 1LU9A 3ROEA 3I61A 2FE4A 4LO9A 1A7QH 1EQAA 5DJDA 1VKXA 5HRAA 3AM8A 3TO4A 2QDWA 3C8KA 1XZPA 4K8RH 4YLEA 3RGGA 1OI7A 1AR1B 4FHEA 1TUBA 1F2XK 4HXFB 3DVNB 4JB9H 4YFEA 1MCCA 1NVDA 3BD9A 4MMYA 2VH5L 4E41B 1M71B 1QH8B 3G1WA 3UB3A 2VXUL 2Z8XA 4LZZA 4NK4A 5JE8A 2Y3AA 1KIMA 1EXWA 5BO1H 4EY8A 5NLLA 5HHMD 2UYYA 1A64A 1I4DD 4UPEA 2H4HA 1Y8QB 2J8UB 3ZGZA 5FFNA 3MODH 3D43A 4XFDA 2EARA 5FFOA 3ZW8A 2DQGH 1ET8A 2GN0A 5H83A 1UJNA 4N7JA 3EC7A 5DI9A 2C7GA 3C3XA 3RVTC 1DAFA 4RO0A 5B1SA 4N82A 2E9JA 3ANNA 4K6FA 1J0YA 1U6AL 3KKMA 4F2GA 2JA1A 2CDRA 2BOBB 5AVWA 3P27A 4MQ7A 4M7KH 2RB4A 3CISA 5EOCH 3EF7A 1I1AD 3RR2A 2KUTA 5C80A 4MNHA 4MKRA 4I6EA 3TDNA 3Q6GL 4K9QA 4QLBA 2MMXA 2FYYA 4X6FB 3GTTA 4FGWA 2X4OA 3H8SA 2I7VA 2LP4Y 2NY2D 1ND0B 2CK3A 1NGZA 4DP6X 1GGKA 3G8CA 3HUJE 1SBCA 3LUGA 2O06A 4Y30A 2FJUB 2CGRL 3P9MB 2VMFA 3BPCB 1Z3GL 4B41A 4BKTC 4MCAA 1SG0A 2RSLA 4D7AA 4H1TA 2UUBB 5FL7A 1EJFA 1YCGA 4CU6A 4L5BA 3V0HA 2HA3A 4JY5L 3FHQA 3E8XA 1KXHA 3LX9A 1KC1A 3LKQB 2N56A 4NQXB 1QORA 4OV6B 2GT1A 4S12A 2H51A 1WCWA 2QAJA 3KYOB 1N57A 2HHAA 3LYLA 1G3RA 3KTOA 3OEWA 4KTDL 4ED9A 1FW6A 2AT1A 4GRMA 3RJ5A 3EYFA 5AVZA 4KR9A 3ZDRA 1AQHA 1ZNWA 3AEXA 2Z8VC 2PR9A 2HQSA 5CURA 4MA8H 5EMNA 1TMOA 3TN0B 4CADA 4BWUA 3DJTA 1QVWA 3OR7B 4KFCA 1E62A 4B76A 2ZJSL 4MYTA 2ZUQC 1T2CA 4EM6A 4K3DL 1I51A 1FL6B 4GGPA 3PXEA 4BAZA 2IV7A 4UQPA 2XNDA 3VHLB 4B9YA 4N1EA 4N6RA 1LE5B 5MERB 2C5GA 3RHWK 1FVOA 5KZCB 2FZGA 5L8JB 1YT5A 1P53A 3ZZTA 4HADA 4KY1L 5SZHB 2JFHA 2JKRM 1W581 2OVFA 4MBOA 4L4VB 1IZKA 1QG2A 2Y06H 5JH7B 3EVZA 2BK8A 2I6GA 1KLFA 2X2HA 4F6LA 4YI5A 1IC4L 3D18A 2OCLA 4P22A 1E5AA 4L2IA 1WXIA 2CC2A 3UUGA 1L4HA 3AG2B 1PF3A 4OLVL 1CERA 4AMUA 3AVTA 1U8PA 5E1HB 5LAPA 4Z4CA 2A9MH 4PGEA 4G41A 4FGKA 4GYYA 1FU8A 5IP4A 4J0FA 3TIEA 1FL3A 4BFIB 4WECA 1MG3C 1R3JB 3NESA 4OZHE 5HHOB 3F58H 2BHYA 3VM6A 4R7NA 4EMBA 2GBCA 4D57A 1FDLL 2XMSA 4IIYA 5EJFA 1JJBA 2ZCKL 4TQAA 1SUFA 5H0IA 2K7ZA 4H1LA 3Q7IA 3WG7B 5LOVA 2H0FA 3T1HB 2YKGA 2VF8A 3VC1A 3U17A 2Y7OA 2WAXA 4L78A 4XO3A 3AERA 5I7EA 3BIFA 4G65A 4BRUA 1UT5A 1NMSA 4LDAA 4N2DA 1Y8CA 3JYCA 4RZCA 5FFLA 3GXIA 2E1RA 1W72L 3HO8A 4GM1A 1IVSA 1FXUA 4YV2A 5ID0A 5CZRA 2XWJB 5KNBH 3THYB 3OQRA 4YC2B 4CWAA 3BD4A 2L8AA 1PG0A 1MW1A 3TIFA 3QDMD 3IDUA 4WOKA 1YAHA 1JCVA 2F1KA 5A5DA 3WAGA 1WZCA 4NNJA 3TLBA 1K8IB 1XCGB 2DWXA 2AK1H 4AIXA 2DGDA 2HC9A 4J8RA 5JXEA 5G02A 5IW3A 2DJUA 5EP3A 5KBMA 3M33A 1X38A 1BEUB 3KCNA 2EW2A 4MW4A 1ADCA 4HWNA 1TK2A 2JF1A 4UZUA 4X62B 3J81A 3ZN2A 4DLYA 1N8SA 4KW7A 5DWDA 3MTDA 2I4OA 3H3XA 2FX7L 3S3CB 4K9EH 2HFGH 4HWOA 2IBTA 4M56A 2JQMA 1HHKA 5GJBA 1KRXA 4TYUA 2YR0A 1ROCA 3TI7A 5GONA 5I6OA 5IW6A 2W4QA 3WO0A 1W46A 1H3WM 3THRA 1L4YA 3C5WP 3SQOA 3FNGA 3I3SR 3GDCA 5TPWH 3GHEH 5AHOA 1IDOA 2CCGA 3NFPA 2W60A 4AUEA 1RCUA 1CWUA 4M5TA 1OJLA 2JGKA 4OKIA 3NYQA 3P3SA 4PV8A 1MN6A 2D7PA 2Y27A 5KSVA 3HB3B 3RWDB 1RLWA 3ESYA 3INOA 1IBGH 2BP7B 3LN4A 4FHKA 1IYZA 5KYGA 2XG4A 3UJTH 4AJJA 1CF1A 4TTDD 2IQ9L 1ZW1A 3W8EA 4Y18A 4J39A 1YBVA 4A36A 2P3YA 1DE4A 1PG2A 3W78A 2CJXA 3SSAA 4N3AA 2A4MA 3I4FA 3UPDA 2B3TA 1XTRA 1AQDA 5CZKA 1R0CA 5I8OH 3A6BH 5KTSA 2FMXA 4IUDS 1BVLA 1XCXA 1E7RA 3QNYB 3C6LB 3THSA 3PPYA 3ULVE 3ROTA 5IVNA 4JFRA 3OLWA 3WNVA 5GGTA 2DG2A 3ESBA 1OARH 1EE9A 1SBBA 4HLJA 5D6CA 4B7LA 2QP3A 5T5FA 5GS0L 1YMQA 1JHPA 2B4AA 3SGJA 4E9TA 3QWBA 1T83A 4FQPA 5M7QA 3WX0A 4YMGA 1F2QA 4DKDC 1JPJA 3QSKB 2AFIE 1T0JB 2WT8A 4R5HA 4LSWA 3STLB 2ZP9A 3BFQG 1NAMA 2X0KA 5KSAD 5BN4A 1GNPA 2VVTA 4KRMB 3MBIA 3L3IB 3GKWH 4FLOA 3F7TA 3IV6A 4CJXA 4WTZG 2XTZA 4G83A 2WXPA 3TBYA 4FERA 4CMEC 1FSKC 1ED3B 1RAIA 1XYVA 4TTSA 4GUPB 3ISVA 5HQTA 2ZSVB 1WAPA 4G8EA 5C0GA 2FFBA 2AABH 1XRQA 4ZVMA 3O31A 4YSDA 3C48A 5IBUB 4KN6A 5BMVA 1M6VA 3MUEA 3AFCA 1H85A 4DDTA 3HJFA 4L8BA 3KDMB 5EN4A 1N2EA 2QKYA 3L05A 4PY7B 2AQPA 2R39A 3K6OA 3B1VA 4TMVA 5I9QC 3IU4L 3O6KH 1QR6A 4EENA 2AI3A 1U31A 5L4IA 1UK9A 1EHLL 5SZIA 1KY3A 3ZU5A 2JATA 3BYTA 2P5TB 5A0TA 5KQRA 4U2KA 4AC2A 3W9SA 4LCUB 2OGWA 3CZ4A 3I2CL 4JPIA 1S46A 4MDIA 4KJWD 2HRQA 5EOVA 2ZJ8A 3VKHA 1NI3A 4OBWA 2CJSA 1VXOA 5LM3A 5KYTA 5AW3A 4A38A 4FI8A 4P3NA 5I2IA 4XB3A 5EE9A 4CFSA 1YEGH 1BFVL 5C0BD 3FT9A 4MAYA 3QNYA 2CUIA 4JPKH 4HDKA 1H5QA 5JY1A 4WFGD 1U9KA 3LPNA 2PSSA 4E03A 1HYBA 5IARA 2YOCA 3N0XA 3PEYA 1C2YA 3WHXA 3BISA 4GO6B 4PJIB 1YBFA 5LWYL 4XFJA 3TNMB 2RKOA 3T4AA 3FSJX 3CT4A 1W72B 3BQVA 5D93C 4ESEA 3H3PL 4HZUB 1P7KB 3AXTA 5U4XA 2Q3CA 4ZX5A 1RI5A 4WVRA 4ZFOB 1XJ5A 3D09A 3ZK0A 3GDOA 4J75A 1H0DA 1NCBL 5EB9A 5ADPL 1K7SN 1BQSA 4NERA 3K5WA 1YJXA 2NVOA 2FN4A 3ED5A 2A30A 5GJSL 3P4MB 3NHJA 4CL3A 5BPHA 1YS7A 121PA 2D2IA 3ARRA 1DN2A 2KERA 3WIFB 1AGYA 1JLHA 4GZ6A 3VVMA 4FOLA 2Z31C 3EGEA 5CVVA 1KAOA 4GPZA 1D2NA 4PRBA 2ESRA 4LW8A 1POXA 5G4KB 2P1YA 1ZDQA 1CB0A 2PXXA 1W5TA 3G2PA 5JDCA 3IE0A 1O7DE 2GIMA 3KW7A 3N41B 4HF7A 1ZAYA 3WMXA 4BHTA 3LZPA 1BMTA 4DQ0A 2X6UA 4OHKA 4A1OA 1CL7L 3GIZL 3K2UH 4K71C 2HU5A 3W2TA 5CMAB 3QEHA 3DRQB 2V98A 2C8LA 3VGAB 3JWHA 1KELH 3CEPB 4EY5A 1YCHA 2V7NA 5T1DL 5BOJA 1STOA 4HUWB 4X9FA 1WSDA 2VJBA 3IDGB 4POOA 1BVNP 4UJ3A 1Z3RA 4URUR 3QIWA 4H3SA 6CHYA 3NFPB 3T4AC 3TGLA 1H94A 3WYDA 2YUTA 2GITA 1X9UA 2Q8PA 1GXSB 4OD2A 2VSFA 1Z16A 4QBIA 5A5VA 2IQ9H 3VX0A 3WGQA 3JSAA 2DQUL 3DB1A 3Q5TA 1J0HA 5T6BA 2XUDA 1CUEA 5REQB 1NVWQ 3VZQA 3AP3A 4L22A 1G6RH 3TBWB 5BT9A 2UAGA 1J87A 5EFIA 3UO1H 4YXKL 3MWEB 1MRFH 43C9B 3RV3A 1Y3DE 2HJRA 2UVQA 1WQ4A 1BHQ1 2FUG1 4HR7A 4Y1EA 4P59L 3QVUA 4N9WA 1EUTA 1CK0H 3BW9B 1MWAL 4JKPL 1UM5H 4MJIA 2I22A 4YWHA 2ZYRA 1NCCL 2PEZA 3R9XA 1X5ZA 2VBCA 3ZT7A 2XUGA 2QM0A 2IELA 3RV4A 1N3NB 5E8EB 2WWMD 4ODVL 2Y6UA 3EHBD 3O1IC 4B1FA 1KJ2B 3LMJL 3LFUA 1F6AA 4RFNB 4L4TE 4PN3A 4L07A 4YHML 4I3HA 3GVXA 4N2AA 2GTIA 5FK9A 4M4RA 3AUJB 3LFHA 2VA9A 6PFKA 5CA1A 3LI2A 3OA0A 4L4SA 3FO1B 2D1TA 3H7IA 5T3ZE 1N0LB 3B1WA 1GQFA 1YBMA 4WRLA 5CSBA 2XBLA 4HGPA 3G5LA 1O57A 2J1YA 1KN2H 1QBLL 4EOWH 3IDQA 2XWJI 5J8OA 2IPAB 2OSBA 3QUZB 3GHYA 3LH8A 5ERWB 4LRSB 5FBHA 2YDYA 4BDTA 4EPSA 1RUQH 1GOTA 1WB4A 2EDKA 2HA6A 2F00A 4PVLA 3TZVD 4HCFA 1BMGA 4LCWB 4P3DA 1BVUA 4ID3A 2DHEA 4NXKA 3KQHA 4B81A 4P4UA 1JGUL 2ZSVA 5ADUS 2D0GA 5AYVA 2C3YA 4XB7A 1R64A 4R2LA 4NQTA 1FTNA 4RHCA 2GHIA 4MYHA 3KGRA 1WUIS 1XTLA 3HP4A 3FH0A 5EG6C 1QGUA 4TQUS 3ES6B 4EEXA 1TEVA 5KI6A 3PDIB 2HDWA 1KS9A 5A6SA 2Z9CA 2QSCL 1UODA 4KJXA 2QR5A 2IGBA 1A5AB 4ZW5A 4WSJA 1E2JA 5J9PB 4QO1A 2B59A 1BJTA 4PTZA 2JLRA 5CIQA 2QVKA 3QXDB 4Y2DD 3NTVA 3B9KC 1PMYA 1TLTA 4OFPA 2VZ9A 2G75A 2BSBA 2KMLA 4CN8A 4QNRA 3H1PA 4KY1H 2H54A 1TOAA 1OJ7A 3IU4H 3O6KL 3IRPX 3T6QC 1NW4A 1NFIA 2JPDA 3RUGA 4EIWA 5LG1A 1RZ8A 4ZVOA 3QDHA 3WKYA 4UIKH 4KBGA 3FOZA 3Q8KA 1DRJA 4MQFB 4P36A 4AJWA 1MJ7L 1J12A 4KE8A 1FTQA 2OLKA 2A1UB 3PHHA 4G9GA 3C5ZA 2R8ZA 4IBZA 4J5VA 3RUPA 1Y7LA 3B9RA 1G1YA 3ZL4L 4G9FE 4EN3A 4N8CL 1A76A 1FYXA 2ZVPX 2ZU0C 3Q8EA 4XBGB 1AY1L 1EGHA 4E5DA 4KGXA 2P1RA 1RNLA 3DNPA 4F86A 4HNQA 1PEYA 1YEKH 3CPSA 3VPHA 3C8UA 1DVSA 5CGYC 3TBFA 5GM2A 3PUHA 4PJAF 2XTLA 1E2FA 1KMNA 2WPGA 5EKUA 4YAJA 5C4GB 3FKQA 4G0ZA 1JPTL 2BHRA 4RTSA 2VXYA 4CR7A 3PSHA 5H9VA 1D04A 5B58C 1HDZA 3O9MA 4L8SC 4ARSA 2RONA 3W11C 1USWA 1YVDA 4EMUA 5TQVA 2CV2A 4XBMA 4PFJA 4H20L 1NFFA 3F67A 3U1PA 3W5SA 1H15A 2A6IA 4IP0A 2NT3A 3R3VA 4JLRB 4D8OA 4CF6A 1U7OA 2BR4A 3TVTA 1HT1E 2YD9A 2Y99A 4MQ6A 2R97A 2WJVA 3B3IA 5FO8A 5BJTA 1OP4A 2PRZA 3AM4A 2I67A 1CPYA 1MDBA 3TK1A 1JR3E 4XI5D 4QHNA 3MFQA 5AH0A 3E82A 1YR3A 3FGOA 5F3DA 3LZ6A 1GITA 2PWYA 2OFWA 3JWNH 4XD2A 1FO0H 1U9IA 4FQ7A 1M2OB 4OXIA 3K2UL 4FQ5A 2QADB 2W2LD 3T7AA 5MENE 3VDRA 4KLAA 3AITA 3BAXA 1X1RA 1DBMH 4AT1A 2JI9A 2FHPA 4DVRL 1U63A 2VRQA 3DA0A 4KE7A 1DUVG 5IANA 5C07B 5J59A 3C5ZD 5JA8B 4IDCA 1IFHH 2YFOA 2HO4A 2L3BA 1DC7A 2ZKHH 4MHTA 1VPOL 1G55A 3WY4A 1KEEB 5EFOA 2YMQA 4GMFA 3PC8A 4GNRA 2BR5A 3FROA 1GUZA 5ESWA 4LP8A 4DCTA 5E23A 2HH9A 2Z8WC 1KTJA 5IHHA 2E7MA 1IOWA 1KJ2L 5IIEA 3VA6A 4C30A 1L7PA 5KBLA 5I9IA 2IGTA 1N19A 1NC2D 2CCKA 5TJWK 1P0CA 4NBVA 3BXNA 3VMOA 4S1NA 4P2BA 2VRBA 2I3BA 4OHBA 3DMDA 4LFCB 1CLZH 1E7UA 2O7QA 1II8A 1UCBH 1O6SA 1TR7A 4F5WA 4OTZA 2JI8A 2VF4X 4GXRA 1NH6A 4E2FA 3IE9A 5JXEC 1JQDA 2DFNA 2P62A 4J16C 4BM7A 4MV9A 4Q7JB 1FYWA 1LMKA 4N8PA 5FLVA 5KNLA 2ZJOA 2DRUA 5DHVH 4C7KA 4H8UA 5CEZE 4MV1A 4BRWA 1E4OA 4NQVA 1E2NA 1WD7A 1DU4A 4K71B 1N10A 1DVYA 4JRFA 4Y88A 2VZVA 4JFOA 4NYMR 2VZ3A 3VV2A 4NZOA 4OHOA 2SICE 1HF3A 4JQSA 1PR3A 2VR9A 1ENOA 4NBSA 4BQNA 4MZDA 4H6WA 2OHIA 2X2JA 4BO8A 2NQDA 2W9EL 1OIWA 2EH8H 1IGCH 4OI9A 3UOGA 2DJIA 2C2BA 1TQWA 4YN3A 4GI6A 3HNTH 5HJGA 4U7PB 4CLOB 1Z9SB 3P2EA 2OPCA 2AXEA 5FAXA 1PT5A 1QLEB 3I9GL 2Q49A 3PHQA 5DWUH 4RYLA 3QUKA 3QWIA 5CR1A 3K73O 3MLTA 4TKVA 3ZJTA 3NKLA 3QEUA 1H8HA 2E47A 2W38A 2OMZB 2QTTA 3SKUD 1EAJA 1B3RA 4ZCQA 1I32A 5LMCA 2ZQZA 4CM9D 1DEKA 3SIXA 1KIPB 4RL6A 3JVUA 3UJAA 4LLYA 3BJ91 4DQAA 3GEMA 4TOYH 3KV1A 3IS3A 2QKSA 2AOXA 3SU8A 3D1VA 1E28B 3GAZA 5C5DA 2WYUA 3SQOL 2EIZA 5C0BA 3ZW9A 3D85B 1JWMA 4P6VF 3ZRFC 2HZBA 1PX0A 4Y1RA 1U3HB 3N5KA 3U3OA 4LVEA 2JFWA 2D0HA 4B3BA 2YMXH 3JAMA 3QVTA 3KSMA 4NF2A 3T3IA 3BZ5A 2NU8A 3ICQB 1BM3H 2JVIA 2WB1A 5JWRA 5JIBA 4NC0B 2R44A 1FYTE 1LNQA 3CS3A 1SQ2N 1IEWA 4H8WL 5JQGA 3DETD 1E1CA 4HWRA 4HPOL 1E65A 1NBZA 3KYMB 2X10A 4ZSOE 4F60A 3T0WA 1FF9A 4KKVA 3ABOB 1MY5A 5DD1H 3WNKA 4C4UA 5KEZA 5B3LA 2QUAA 2DHDA 1UCBL 1IXSB 4WA8A 3RAEC 4XP4L 1COZA 3GY0A 4B4KA 3KWVA 3GJRA 3HHSA 4NJAL 4KWCA 4XBEH 2RGUA 2IHKA 3LS5H 4X9HA 2G9HB 4OZIF 5HHPA 3KHOA 5G4KA 2XICA 2GQ0A 3I1FA 5BYAA 1VE3A 1N6IA 5MFZA 2JK5B 2XB4A 3MRNB 3VFWB 3MTXA 2EWMA 2GI4A 4RNRA 1NLBL 4Y4KD 4NO0A 1GY2A 3QEQA 5GGQL 3HY4A 3TW4A 5F3WB 3K0FA 5DMGD 1IHXA 2EJTA 2B2CA 1EPUA 2PHZA 1KYIA 5T5NG 1NL0H 2C4WA 4HC1L 3VNVA 3ANSA 2XZCH 4BKLA 4MSWA 2JIXB 2DHCA 1F3LA 4IL5A 1ULVA 3LS2A 1HCYA 4XH2B 2HD4A 5FYLH 1Q0PA 3UKOA 1PQ4A 3AR4A 4R3WA 4GRLD 1F1BA 2NLJA 3QGVA 4LIQE 4K5QA 1ODKA 4AQOA 1YRYE 3HRPA 4Y5XC 2FO1A 2QADC 1JEYB 2WBJD 3F65A 4MO2A 1QIKA 4EI2A 2X3CA 3GZNB 1U93A 2ZSDA 1QGOA 1WAAE 4OFYA 3GJQA 2PAFA 4TX1A 5E1IA 6TAAA 5K3OA 4ECAA 4PU0A 2VAXA 3EWSA 4L5YA 4AJPA 1RR6A 3DLBA 2ZRIA 4FQ2H 1EKXA 1O94C 2WTRA 1OSPL 2Y66A 1UOVA 4JB9L 3RFXA 4ZYKB 4XW2A 5JEEA 5FOSA 3LJKA 1LH0A 1CUOA 3FN3A 4PJ9B 3I9MA 1TZAA 5IK3B 3FT2B 1BM3L 2FWJA 3T8VA 2VMEA 1GRWA 5C0CD 2ZRPA 3CPJB 1OCCB 4B53A 2QLLA 3LK6A 2X41A 4TKMA 3GG2A 3IUYA 3L8CA 1NBZB 3KYMA 5FGRA 3PQ3A 1EGJH 3IP8A 3RBVA 3LWZA 5DDIP 3OXRB 2FR0A 1ZUIA 4BNJA 3U0PB 1T4KB 2XQJA 5K3DA 5HQJA 4G8GE 4OLVH 1X7QB 5HI4D 1XPRA 2QLJA 3ANLA 1XR3A 2VXSL 3EBAA 3CURA 3ILYA 5ESAB 5IVZB 4NQZA 4OAPA 4P53A 3ECAA 3QHZH 1Y3CE 1BWPA 4DFHA 3EXFA 4N5NA 4OIAA 3SEZA 4KXZI 3EGSA 4Q9IA 1T6ZA 4IICA 2QV0A 3FONB 3OQ1A 5GGQH 3UAJD 2G5PA 2D9CA 4JM2D 3V8VA 2JFBA 1YC2A 1AH2A 4QHNB 3JALB 1L9TA 3K0CA 4C2BA 3AOEC 4MXQC 4LHSA 4MA3B 2XG5A 4HDRB 4LN1A 5HDQL 3LEVH 4OZGE 3A4IA 2ZR7A 1UZNA 1PNRA 5FECA 4GR5A 5SX5K 2ATXA 1AXTL 4XX1E 3DIFA 4EYOA 4NKIH 4BLVA 3IODA 3RSOA 2C1PA 3N1QC 3ZYCA 5ELIA 3JTSB 4J9VA 1XZQA 1C1XB 1TF5A 4DA7A 4MB2A 4DZTA 4AGMA 3LRKA 5DK6A 1MUJB 3H87A 3RTGA 1XZLA 3VWJB 5G2NA 1GKOA 3UPRA 5EIFA 1JDVA 3L0IB 3MV8B 2ZLBA 4Y9CA 3G7SA 2EO7A 4HD5A 4H1UA 1E94E 4DEUA 2M6RA 1HHGA 4Y2GA 2CUAA 1YLBB 3HAEA 3F8SA 5C7IO 1B4LA 4ZCTA 1NYRA 3FRPG 4EHIA 1GGEA 1RI4A 5KVDE 3OZRA 2ARJA 1AO7D 4FQ1H 2BMFA 1V3LA 2JMRA 4QGHA 1NWCA 2OAQ1 5HYQA 1MAAA 3NWEA 1GDTA 4HB2A 1PKQB 1GT91 4L8GA 3HL0A 4AZWA 5K05A 2PWGA 3BOVA 2PETA 3PDOB 3T6WA 4N8VB 1XCMA 4CF5A 2O8DB 1KLFB 1PFOA 1ACYL 1WPQA 2EV9A 1JFTA 1MEXH 4OP1A 4K9EC 4WEBL 3HCNA 1CK0L 3T2OA 3CFKB 4KX8A 4XUDA 3SZLA 4GG6F 2Q46A 5KAQG 1IGTA 3C12A 3FOCA 5AIBA 4XXWA 4HDOB 2P9GA 4ZFGL 1XDZA 1KK0A 4Q4HA 2W58A 4HWEL 4B2YA 4PQFA 1NSFA 2HA4A 3MUOA 4JKIA 1HK7A 4LSQL 2IYEA 3ESZA 4NQVB 3HJBA 3GO4A 1M1SA 3C7KA 2R3SA 2Q8BH 3TF5A 5J6HB 4R5TA 1G16A 4PIMA 2JS7A 1GC1H 1E8DA 4QHTA 1KIQB 5FF6A 1KCWA 1PR6A 4PG6A 5H35A 2F7RA 1CP2A 4JR2A 3U3KA 5SWSA 1ZLWH 3G6DH 2WSMA 2AANA 4TLCA 4E7PA 3RRNA 4X98B 4LLAA 3ETTA 5DLYA 3AJ7A 1UBTS 2G71A 1FL5A 4DCQA 4LI3X 4JBYA 2CJPA 2NNRA 1DFBH 2I7OA 3QVJA 4R1NA 2E7DA 3IFNL 1ZAKA 3QMVA 3WLFA 3IWVA 2NNLD 4JDPA 3PV6B 1TQ4A 3LV3B 2JAUA 1C3LA 4G0QA 3NJJA 1AHWC 3F64A 5D6DA 3RYTC 4II3A 2W07A 4AJNA 3SZ6A 2YMLA 1TQ6A 4O4LA 3BAEH 1E8NA 2W4IA 5IVXA 3EVCA 1W2HA 3L4ZA 4KVNH 2XDQB 2E6PA 1KB5H 3E8SA 1YULA 4U1LB 4U4AA 2ROXA 2PR2A 3N8GA 1GZQA 5DRWA 3CF6R 1W30A 2WAMA 5E9QA 4M4PA 2CMGA 2R86A 3N9GH 4M7PA 4EPWA 4EI6B 5GS1B 3WA7A 1J8RA 1MJUL 1F3JA 4IEEA 4NQQA 3QUKB 3SXUA 4BIMA 1D07A 1A8IA 2VPWA 1QHPA 1XTSA 4JLRA 2GILA 2YBEA 4DP1X 2BGKA 5KTNA 5TDOB 1SOVA 1Q1ZA 4Y1AD 4QRRD 1NW3A 2XKAA 2FOIA 1LI7A 3K5HA 4PS4H 1U2TA 3C6SA 4LOUC 5BNZA 1FXWA 5JW4N 4HPJB 3MV7A 4EVNA 1GNSA 2E7CA 2IEGA 4IKOA 5A6IA 5GINE 4I9FA 2FWUA 1UBHS 2ATEA 1D1PA 2HRCA 2PQ0A 1U36A 3KG2A 3G5UA 2P8LA 1DE4B 1LV7A 2MSLA 3LPAA 1CHNA 3BREA 5CITA 2UZPA 1N92A 5GIOE 2EZ4A 3I9FA 3N85L 3DJYA 5H16A 5F1KC 3ZWVA 2AX3A 4RWEA 1BFVH 4PZZA 4YT2A 1TO4A 2QXUA 5HOEA 5T4HA 5DC0A 1KGUA 3SS7X 1MREL 4LQ1A 3IAS6 1WSAA 2BEWA 2CNOA 5FO9A 3UZEC 2O7SA 3EZ9A 3DDOA 3QFCA 5D7KD 3ZX5A 3K6JA 3PD7A 4DMMA 4NQSA 3K9FC 3CVHL 5HHXH 1JFVA 2G2NA 3IC5A 1J4AA 3ZGLA 1M3SA 3GLUA 2X8JB 3WYCA 2N1BA 4WV3A 3Q87B 3RY6C 1U1CA 1GKYA 3TQHA 2Y36L 4P2RD 4FFDA 3HADA 2ZM6B 4PS3A 3G6JA 2KQUA 2ZW9A 1FV1A 3JQ7A 4Z3EA 1WBXA 3V2AR 1NBWB 4IG9A 1DEEA 1ZXKA 1C3VA 3ULSA 2XQFA 5IROD 5F2KA 4LZLA 4AMVA 2WVUA 3VG9B 3L4BC 5IOPB 4HKBB 2OMVA 2IMMA 4RGVA 3CZ9A 4D8UA 3UTQB 5DK2A 5E9DD 4OFZA 4DUVA 3UP1A 3X1KA 1X9RA 4I1OA 1RPNA 2BNRE 3MA9H 5EEUA 2DWPA 1T89C 1LE9A 1EFXD 2CHWA 4M6ML 3FMVA 3PZRA 3DARA 1FLRH 3ROKA 1LK3L 1PVHA 4MVJE 4DIOA 1N6OA 2E76C 3JT2A 1OTSD 4PRPA 1Z0DA 2WJPA 3IXQA 35C8H 3AQYA 3V0WH 3FHOA 1JJ7A 2E86A 3KBOA 4ND4A 1FFYA 5IJ9B 3GSUB 3IN0A 1I8KA 3EFHA 1KO5A 1PY9A 1JHTB 4M3JA 1JHRA 1UWCA 1JPFA 2YNMA 5ACLA 3P4UA 3Q1EA 1ETA1 2BP8B 4C20A 1HMYA 4KIFA 6CGTA 3NH9A 1OAKL 4FOOA 2V9UA 5CJ8A 5EXEA 3C1AA 3W1VA 3LY5A 2ZEJA 4KZPA 2DKNA 4FQXD 3MRVA 3IVRA 3O8XC 4BWYA 4F9PA 4JPQA 1H3EA 1KERA 3JWDL 1XGUA 2ADJB 4XMWA 3LOUA 4WU7A 4UCXA 5BVPH 1T4KA 1O0SA 1A77A 2IQ5A 2OBXA 3ZE0E 1VG9B 4U0QB 2Q3JA 2BOVA 2Y1LA 1VPWA 1ZZGA 2XFGB 4X9XA 3CPLA 4IIGA 1T6XA 2X09A 4UZGA 3H2JA 3Q8CA 1LP9A 1D09A 4YR6A 3JQRA 3IDXL 4TUJA 4DTIA 3EO9H 1T29A 3DE5X 3ZBTA 4JDTL 2B0SH 4HIQA 2H17A 2ZRDA 4U3JA 1PEKE 2HTKD 5JD5A 4U1MB 3MB5A 3OURA 3G17A 1DYZA 3COYA 4QPNA 4JBWA 5TH2B 3MROA 1G5HA 4ZI7F 4AICA 4NNPH 3NYRA 4PV8B 2ADMA 3OPYI 1P6FA 2EXWC 4UT6L 3VG9C 4P32A 3SF8B 3ZVRA 4TKZA 4OD2B 4N86A 4KQKA 1GDDA 4WENB 5GGYA 3JQDA 2X53A 1XF4B 3H2PA 1QHQA 3KXDA 5JOPD 4OK5A 4GUDA 4Z8FL 1I1FB 3RROA 2Q41A 1MUJA 4P5TA 3SS8A 2K4AA 3B7WA 32C2B 1VYVA 3UAWA 3VDAA 1VLXA 4G1CA 3O38A 1L1EA 1NJ9B 3T77A 2X4DA 1A2QA 3INGA 3Q48A 2RAUA 3FRUB 3DA8A 3CWQA 1KFBB 3AW8A 3HR5A 1AP2B 4PNHA 1SVKA 2AZUA 2UWEA 1R9FA 5B3JE 4H44C 3QCVH 3DD1A 1NW9B 2H6PB 4JRYB 1EHLH 4NO0B 4EQZA 3NH7L 3ZBMA 5JTWA 4QWWC 3MJWA 4HBCL 1J1XH 2L0DA 1LEKB 3TEZA 2W60B 3BXGA 3GDHA 2ADOA 4ZJUA 1HINH 1VRSA 4WO4A 4KR3A 3IPRA 2WAQA 2SECE 4KI7A 3QYFA 6YASA 1P2SA 5EHGA 4EAAA 2EO1A 5CZVH 2ATCA 5F9FA 3N8DA 4K5OA 5J11C 3BOSA 2YWJA 3KOUA 3WZLA 2VWQA 4LXUA 1P5UC 1ES0A 4YCBA 3MTAA 4XCEB 1QO0A 1PV1A 1BVYF 3U82B 2EDQA 5CEFA 4KXZH 4UQEA 1PKOA 3WJJA 2R6HA 1J1PH 3LRHA 1AZWA 3S68A 3FUCA 1PJ9A 1CSEE 4NARA 1U7HA 2JEOA 1T8RA 4IIJF 2OR9H 1KE2A 1P6AB 2HN7B 1G0XA 3NBFA 4JC0A 4AMBA 5DF1A 2VDNH 3MTJA 3T54A 3PTAA 3AVYA 3IT3A 2MHAB 2WOJA 5LDHA 5B1JC 1SJVA 4F45A 2ZCKH 1PF7E 4AVHA 4RORA 2J57A 4TXHA 4L27A 2X4LA 1C9MA 4CN1A 2NY0B 3CG0A 1QKJA 2DBQA 2UX7A 3IS1X 3QTLA 3EBPA 2C3HA 4RAVB 1CVIA 1U3DA 2VHYA 2R1WB 3VX4A 3B6SB 2CR6A 2W2KB 3X0DA 4D9JA 3A2NA 2H4JA 3I8SA 3DMFA 4OBRA 1TYAE 4PW4A 3VNQA 3QC6X 1E3WA 1MI5B 5IVXF 3UCXA 1ETJA 1KLGA 3OMIB 5AVRB 1FFNB 3REFA 2Y0DA 4R8VA 1PZ5B 1T04A 1T8PA 3BB4A 3W5DA 4PJHB 4GKNA 1I1QB 3G2LA 4GO1A 1T5XB 5AHXA 4HS6A 1I53A 2PE5A 5HHVH 3WO1A 1UP7A 2CKBH 2YR3A 1Z6JT 4MXQD 2WP3O 4US0R 1AO7A 3U2SB 1IMOA 2XRFA 3DROB 4NDZA 3H3BC 2PW2A 4IDOA 5F5XA 1F12A 4E09A 4CDMA 4OA8A 1JHLL 1HH9A 4Q4DA 1Q94B 2Y7SA 4ENTA 4NIKB 1TZOA 4S2SA 3BMOA 7MHTA 3SN6A 3ZMEA 3S37L 3E2HC 4LF3B 3L8FA 1N70A 4S1QH 3QVXA 5IWLA 5FRDA 4CVXB 2K4MA 5HG0A 1BZ9B 3CV5A 2GM3A 4NT6A 3AESA 4EKYA 3U2IA 3E03A 3HWWA 4C3UA 1YTUA 4M5SA 4R3SA 4C3OB 5BWLA 5DGDA 4Q9QH 3HKDB 3QQ5A 3PNWB 5EXDA 3ZRCC 2BMEA 3KYDA 1A6TA 4FIDA 4GW1A 1K6JA 3TONA 4BWWA 1H6UA 4KK8D 2IXGA 1NEZB 1EUYA 1F14A 2EU8A 4PC1A 1VZHA 4JQIA 1XH3B 1WA1X 3KZ8A 2GEVA 4O0LA 4B44A 2O9JA 1PJ2A 1CF2O 5DRWB 2SCUA 4QGFA 3CXHJ 4ZAWA 1E50A 2VFAA 3OJOA 1AZUA 3GRVA 1JOIA 2QN9A 5F21B 4IFTA 2FSPA 3VGDA 5JW4R 5JQ6H 3H9HA 3VTAA 4U1MA 2F53A 1TYCA 2VXTH 1J05B 2FSEB 4AK2A 5AYUH 1NN0A 2G5BA 3KB8A 3E27A 2G6TA 2EDNA 1WB9A 3GPIA 1ECCA 1TF2A 4M7KL 3RBZA 2OHGA 1TU2B 5FCUH 4YSQA 2AK3A 5AUOB 5L3VA 4PS1A 1AGRA 2QRVB 3X1MA 3L5KA 1PL8A 3NCCB 2R69A 1DBKH 2BELA 2AGJL 5GAJA 2WZDA 1Z3CA 1W36B 3LQAH 2XZQL 3NBZC 1UH4A 2BGMA 1FPMA 1WOYA 2WP8J 4J0QA 3MV9A 5E1MA 4BO4A 1Y5LA 2JA2A 9ATCA 4ZFOL 4KXMA 2UXBB 3TZVA 3E6HA 3N44B 3M8OH 4ODWB 1BMWA 4OFQA 3NIFE 3CIFA 1YR8A 2YPLE 2VNSA 1T7XA 2GQHA 4DLTA 3D5OF 1IBKB 1ZOSA 5LZ5A 2QZ4A 4LP4A 3H17A 1RZFH 2UZYB 2CCWA 4Y1AA 2FEXA 2MIIA 3SYMA 4JM2B 1TAGA 3U40A 3TQTA 1K4MA 3I2GA 3DAYA 4WA7A 3PXGA 3HN3A 3JVFC 1M1ZA 5I9BA 5D8DA 2OSLA 3VXME 1MABA 3TD9A 3DX2A 4QWMA 2I91A 5EA0L 3RA7H 5KHAA 1GQRA 3WLAA 5ALBL 2QVGA 5CLXA 3B2MA 7REQB 2BO0A 2VNHA 2YC1A 2W0FA 3C3EA 5MI0B 2XUOA 2R6FA 4P57B 5J4HA 1QYXA 3HJNA 4BXOB 3LUHA 2QE7A 5KJRL 3IK2A 5LXGL 2UV8A 3WGNA 1NMBL 5HS6A 1Z74A 1QRDA 1KOJA 2JKSA 2OBGA 3LP8A 4EHHA 4AENA 2PZKA 4GZ3A 3OLDA 1G18A 2XODA 3F6PA 3UGTA 3H9HB 2OXTA 4TUOB 4G5RA 3ZKAA 4Y8DC 4MAMA 2D1FA 1MEEA 4FQHA 1T5HX 4EHKA 3OOEA 4H77A 3CC1A 1RK0A 2YV2A 1SD5A 4FTWA 4L4TD 3WLSA 2Q8BL 1U58A 4PJ9D 2PGJA 3ZWKA 4A8JA 2R2GA 1ZQ9A 2ITDA 1LNZA 2DWDB 4XP4H 1L4FA 1EVLA 2HSJA 4BU1A 4WJLA 2JGDB 1KY4A 2JDIA 5T4EA 3WFDH 4DKXA 3RX8A 5KS9F 2DWEA 1EA7A 2X7JA 2DV6A 3DDSA 3WFIA 1IBMB 4F2ME 4O8CA 3WLMA 1FORL 4XQEA 4RS3A 3WK6A 4MXWH 2RBEA 4I50B 2QD2A 2EYTB 5C09B 1YQVH 2R56L 3WGHA 3FPAA 2WBJB 4AKPA 1I3MA 3I6KB 2EFEB 5DYFA 4Y0GA 3UWPA 1VYUA 1I3NA 1W8NA 5C18A 1UADC 2DI7A 1YDWA 1G7LB 4Y8AA 5JD4A 4ZARA 4P46B 1PBYA 5LO7A 1MOPA 3VNZA 3SD2A 2YWFA 5P21A 4CCAA 2EYSB 1F90H 4N25A 2Y25A 4OSEA 1UZLA 5BNIA 4FNPA 5F7XA 1PX8A 4KRPC 2ES4A 3D4CA 1YJDL 3NTCL 2WWYA 2H6UA 1ISJA 2KBEA 1K8ZB 1NCAH 2AOVA 3FOLA 1YXMA 3B7PA 1DTWA 2X8WA 3EYQD 1WMEA 1J2TA 2Q8AH 4M00A 5FPKA 3K72B 4M87A 3K70D 3KVNA 3GDGA 2E3JA 4CW7A 2OW7A 4X6UA 4O2AA 2P26A 2NSQA 1UKEA 1ADJA 1LS6A 4FKHA 3O1HB 2RQ8A 4L8CA 2I5PO 1Z5VA 4JROA 2UXFA 1ZN2A 4NBTA 4R6WA 5CIWA 3UDWC 5JLAA 2JB6A 4MJ4A 2VR5A 1INEL 4X7SL 2F8VA 3O2NA 3R0QA 2R00C 1OWPA 1QMPA 1UEMA 1TMKA 2OCPA 5ES4B 4JYMA 3LN9A 3DDNA 4JREB 5C0RH 4LIPD 1YZKA 2X4RB 1JE6A 3PUYA 3A1VA 3QRLA 3C24A 1G17A 3RVJA 2E2WA 3K1DA 4BO6A 1GJIA 3ZU3A 2ZT8A 1D6EA 2QUBA 1Q9WB 2PKQO 4GIBA 2Q9CA 1N0WA 1NU8A 5EEXA 5WRFA 1J8KA 4P7FA 3H5IA 2JIMA 2WIFA 4Q1EA 1JK8A 4UUPA 5IT5A 3LIZL 2PFSA 2NCMA 4XGNA 2DQ4A 3GPSA 3KUCA 3AQDA 4H17A 3L5WB 3RUHA 4F5YA 1XLTC 3D6VA 4NZPA 4CILA 1MCJA 2BS71 4RF2A 1SYVA 1MJJA 3A36A 3GHPA 4N47A 5HK8A 1GCYA 5D96C 4FZJA 1H2ZA 3OLCX 2IS1A 4X4ME 2DJSA 3DXYA 3T0EB 3G1TA 4ZFNA 4BRVA 3QI9D 4HT1H 5LBSH 3FUWA 4KXCA 4KWIA 2JI4A 2VCHA 4QDXA 4TNVF 4CV3A 2EIMB 2P69A 1NGSA 5DA0B 3IM1A 1U8FO 1FNFA 3R19A 3A2KA 3BEVA 1FC1A 1DJGA 4EI5A 2YD0A 5BV1A 1DKUA 5JD6A 1AHNA 1NUUA 5IJCC 2QYSA 5ELLA 4K0OA 2REQA 1RZFL 4KAJA 3BH8A 5KOVC 4NOLA 5H3CA 4RSVA 5KCMA 3UC2A 5CXUA 1QWNA 3MCTA 1P1BA 2J3EA 1WFIA 3FO0H 2EEFA 3I52A 2DWTA 1C0IA 4JQCA 4QHKJ 2YUIA 3C1TA 1UZ6E 4NRXA 2XZAL 5DD5L 2O5ZH 4H4CA 4MVJM 4R9UC 4NRYA 1SKQA 1OFGA 2Q4TA 3HJTA 5AW7A 4G43A 5C07E 4M03A 3CCCA 3RC9A 2IRWA 4AY5A 2J1XA 1MRDH 1QFXA 2OM6A 1ODAA 3CX5K 4KGVA 3O8OB 4QCIA 5IN5A 4G6FD 2ONYA 2VLLA 1U0RA 3DFZA 4REOA 2Q50A 4LRQA 5CEEA 1II9A 2PG3A 2VH5H 5HHNB 4ZMPA 4C6HA 1AG9A 3CN3A 3ZIUA 4M9PA 4GMSL 4X4YB 3TBHA 3NC1C 5DN6D 1E89A 2X8AA 3ZCTA 4KX3A 4FCVA 4QRPE 1CVRA 1PX2A 2FAXA 4ZQFA 2VSXA 3SQRA 2YYAA 4G4JA 4RDXA 4L0YA 5IIEB 2C88A 1FNNA 4DYHA 1O3YA 4LL1A 3MS7A 4C4XA 4QUEA 2APXA 3QFDA 5DHDA 4XR8C 5T1KD 4W6WB 1PJLA 2HUPA 2XCRB 2APSA 3DP9A 2HHJA 2JD2A 1R75A 4TT8A 4JG0H 3AXIA 3C3DA 3X1DA 3U6XA 4FFWC 2VN3A 5AZ2L 5E38A 3DG9A 5DWVA 4PJ7F 3IUMA 4UXJA 4LPTA 4NYMQ 1XDBA 4L3WA 4WWNA 3LBAA 4IGBB 3KD2A 2H4WA 3PX7A 2IQAA 5HGGS 2B1AH 5C0GB 3ESMA 4YLQT 1QUNA 1MHPL 1QVOA 4EYKA 5DEFA 4Y1TA 4DJFC 4O4LF 5FC9A 5K51A 2Y9MB 4N7RA 3N42F 4JHAL 1KXZA 3SJCA 2BXZA 5E2VH 1RKXA 1XD1A 2ANBA 3CLFH 1KY2A 1MFPA 1HI6B 3I9JA 1EEQA 4H26A 2ENWA 3B1YA 3C5JB 4F8LA 2A6PA 1ZCFA 4PB0L 2RK6A 3C70A 2VJDA 1E3EA 4BFRA 4PCVA 3LN5A 3Q43A 5K3FB 4WBSA 5KOHA 4GQIA 4AH2B 4Z2AA 1Z0IA 5HVNA 2FEWB 2YSSA 3M46A 4JFDD 1QG6A 3WL6A 2LKDA 2EDOA 4MD5B 1M9SA 4NH4A 1A6WH 3EA0A 1S7UB 4LSUH 4HJIA 4P4KB 5I1KH 3QHAA 3RLSA 1MB2A 1BYPA 2XIDA 4KZCA 4JZNB 5AUQA 1RPTA 3D33A 3DSNB 2VLMD 1X8LA 4QXPA 2QTCA 3DPUA 4AU1A 4GKZB 4C87A 3ETBJ 1KIRA 3I0NA 4XJVA 5EWMA 1V9LA 5CFAA 1BXZA 5EA0H 1JEYA 3KEDA 3KZOA 3LIIA 2P68A 1I1OA 4WACA 3RIEA 3FUEA 4NUPA 3K7EA 1P4LB 1SXGA 3ZCRA 2C26A 4HW6A 3CIAA 4OHCA 4FZEH 3DO4A