4UM9B

Crystal structure of alpha v beta 6 with peptide
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
470
structure length
448
Chain Sequence
GCALGGTCEDCLLIGPQCAWCRCDTPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVCPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQVNSSKCHNGNGSFQCGVCACHPGPRCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of Integrin Beta-Subunit Specificity for Latent Tgf-Beta
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords INTEGRIN ALPHA-V
total genus 110
structure length 448
sequence length 470
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4um9B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4um9B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4um9B03
1OAKA 2NVOA 3EGDB 4A0QA 2VDLB 2XWBF 1M2VA 1RD4A 3ZE0B 2B2XA 3FCSA 2VDOB 3K71B 1MHPA 1JEYA 2QTVA 3GXBA 1IDN1 2I6SA 4WK0B 1MJNA 2NUPB 1DGQA 1LFAA 2VC2B 2XGGA 1QC5B 3ZQKA 4C2AA 4C2BA 2ADFA 1QCYA 1CK4A 1IJKA 1PT6A 1FNSA 1YUKA 1T6BY 4IHKA 5KYUA 3EG9A 1XUOA 3TCXB 3K72B 1JEQB 4Z7OB 3VI3B 3V4VB 3OKYB 1ZOOA 1MF7A 3QA3E 4FWWA 1L5GA 3M6FA 1MQ9A 3AL8A 2WW8A 3F74A 1YVPA 3EH2A 1MQAA 4UM9B 5E6UA 4UM8B 4IXDA 1PD1A 5KYXA 3N2NA 1M2OA 2P26A 3IJEA 3FCUB 1M10A 1SHUX 1XDDA 4IGIA 5KYYA 3EGDA 4Z7QB 1SHYB 2ODQA 4HQKA 3BQNB 4JDUA 1M1XB 3F78A 4MMZA 3ZDXB 4CNBA 3TVYA 4C29A 2IUEA 2VDRB 1N3YA 5KYWB 1RS0A 5E6SA 3T3PB 1SQ0A 5ES4B 4GZ8A 1N9ZA 2VDKB 3AFCA 3V4PB 3BN3A 3EGXA 1U0OC 3OL2B 5HDBB 2O7NA 3PPVA 5LN1A 3ZE2B 2VDMB 1U8CB 1ZONA 3ZE1B 3NIGB 1JV2B 4NENB 4O02A 3PPWA 2NUPA 5E6RB 5E6RA 1AO3A 2I6QA 3TW0A 4JX0A 3K6SB 1JLMA 2M32A 4G1MB 1YVRA 4F1JA 3HXQA 1SSLA 2VDPB 3ZDYB 3FCSB 3K71A 3EG9B 5HJ2A 5KYUB 3T3MB 1UEXC 4WJKB 3NVQA 1ATZA 3EOAI 2ODPA 2NUTA 4G1EB 5E6SB 3AL8B 1IJBA 1T0PA 1ZOPA 4XW2A 3OKWA 1L5GB 3E2MA 2I91A 3BQMB 4MMZB 1FE8A 1JEYB 2NUTB 1M1XA 3K72A 1JEQA 1RTKA 4HQNA 1U8CA 3TXAA 4CN8A 1BHO1 4MMXA 5KYYB 3EOBI 1M1UA 1RRKA 3PPYA 2P28A 4G1MA 3K6SA 4NEHB 5E6UB 4BJ3A 3NIDB 5KYNA 1DZIA 3PPXA 4O02B 4NENA 1JV2A 3EH1A 2ICAA 5HGJA 4G1EA 4MMYA 1CQPA 4K3JB 3HI6A 3OL2A 1PCXA 3IBSA 4HQFA 1XDGA 4HQLA 4WK4B 3EFOA 2VDNB 2UZYB 3EFOB 1U0NA 3VI4B 3Q3GE 4Z7NB 2XWJI 1MQ8B 4WK2B 1NA5A 1OLZA 4PN7A 1TYEB 4HQOA 3ZDZB 1AOXA 3HXOA 1PD0A 2WINI 1BHQ1 4CN9A 4FX5A 2X5NA 3EGXB 3IJEB 2VDQB 5KYXB 3NIFB 4WFQA 4MMXB 5KYWA 1SHTX 4UM9D 4MMYB 4O3TB 1M2VB 1V7PC 4DMUB 1Q0PA 4O3UB 1AUQA 1IDOA 1QC5A 3RAGA 5BV8A 4F1KA 3AL9A 4M76B
chains in the Genus database with same CATH superfamily
2RD0A 1R88A 1S4MA 3GJ0A 3TLEA 1CZ8H 1MCPH 3QWOA 4KWHA 4F5CA 1LJMA 5D7LB 5DSCA 1EVTC 2ADFA 3ETLA 5A4IS 4I3SL 4BJ6A 4MHTA 3TBFA 1EAYA 3AETB 3FX2A 1VSBA 1JFFB 1XAUA 3WNVA 3JQFC 4GHWA 3ZL4L 2BJMH 2ZZUT 2IPXA 2BZGA 2BM9A 3LP6A 1OBCA 2Q8BH 2JLVA 2HB6A 2EXYD 4V0MA 4PJ9C 1CR4A 3VUAA 2PR9A 3PZBA 3NIWA 4FTVE 3DLBA 2QPLA 4U6NA 2YYYA 3SVZA 1NU6A 3RJMA 4OXQA 4UBIA 2EO9A 1IRAY 1ODCA 3OCUA 1PWEA 4GYKA 4HZLA 4BGEA 2VQ1A 2FE1A 3O1JC 1U93B 4PAZA 3GZNB 1J42A 2N3JA 1U2EA 2R7MA 4KQ3H 2HVJB 5I82A 3QNUA 2VT7A 1DBML 5F3BA 3RRQA 4B87A 3DYIA 2F2HA 3OPNA 1E6JL 5CJBA 3I42A 4ATTA 3DGGA 4LJKA 7YASA 3QFHA 5B1KA 4N1HB 1NMZA 5EBLA 4ZMQA 5K5YA 121PA 3FYHA 2VJXA 1KORA 1F0LA 2Q6TA 1XZNA 4OAWB 4A1RA 1EVUA 4GXVH 4EI5A 2MU1A 3ZVVA 1QKZH 3GSWB 5ED4A 3BCUA 4OHXA 5AM2A 4AQOA 3U19A 5KO2A 1XGPB 4O2CA 2EGGA 2I1LA 3DCIA 3EMBA 4FB5A 5FO1A 4PJBA 1IG0A 5JLZA 3VXUA 4CC1A 2QVKA 1YEHL 3MRXA 1J1ZA 1RKVA 4QHMA 2K7PA 3VDAA 2TRYA 4JX8A 3FDJA 2WTNA 5T3YA 3AC0A 2E3VA 1H15A 2WLYA 4HGNA 4C4AA 1SFHA 4GUOA 3M5WA 4G41A 3LIZL 1XB6A 2P41A 4GIOA 4IDNA 2IKSA 4IKJA 1KJ2L 3O6LL 9ATCA 4K3DH 1QEXA 2NQCA 2RE8A 5B6PA 2OZNA 4D9KA 3IFSA 1O9BA 4QBKA 2SKCA 1EBBA 3G2LA 5BMVF 3B6SA 3WYAA 3NDJA 5DT2A 2P44B 3FDZB 2DULA 4F38A 4PJ8B 2LFGA 4GQBA 1GHFL 2WLLB 3KWMA 3T9CA 4DDWA 4IIDA 1UEJA 1FFCA 2DKMA 3HCNA 3HJFA 2Q0SA 1DKOA 3N04A 4PLPA 5DW3A 2DLCX 4OSOA 2WM3A 2NQ8A 2W11A 3HB7A 4TQGA 5DTJA 4PGDA 1JNHB 2X2IA 3KG2A 3ZZLA 2DQEH 4O08A 3PKIA 3NR2A 5AUMB 1EIBA 2VJDA 3GPCA 3ULUE 2Y1FA 4P06A 3HJEA 3SFVA 1O6FA 3DEAA 4MCZB 3FOWA 2ZICA 3ARDB 3QPKA 1ZCAA 3BAYA 1R00A 4CM6A 1ZJ5A 4RX1A 3K1YA 4XWGA 1E4EA 5I8PA 4BDSA 1UBEA 1U1CA 3QRGL 1CK0H 2XRZA 2ZWIA 2JZOA 4JFFB 3NCJH 3TTXA 4PSRA 2QX4A 4MYTA 4N5UA 1P7QB 3N2IA 3V32A 2ZBQA 2FZWA 3SGEH 2B1HH 1EFRA 4KLNA 3QT2A 3WP0A 5JMTA 3F67A 2YS6A 3BTUA 4PRDA 1T2EA 1GFWA 5IN4A 2FECL 3CFDA 1BVHA 3RBAA 3ZDYF 1Z9LA 1TJHH 3CUPB 1J8HA 2IEBA 3KM2A 2WU4A 1P4LA 1YEWA 4H59A 3F7TA 5BJTB 3OKAA 4HJIA 5CEFA 1G18A 1XE3A 3K0AA 5IJBC 3L7BA 3ZCXA 2D0OB 3CU7A 4WAFA 3D3EA 4FE7A 3CBJB 3IPRA 1YVRA 5SV3A 1EZ1A 1G9ML 2FB4H 2FMTA 4GYWA 1CDJA 1NE2A 4E7PA 3WGZA 2OW7A 5D7IA 1UFOA 1X4XA 1EBUA 1UOQA 3EUAA 4B7UA 1U7ZA 1EK6A 3QBTB 2AOTA 1B2RA 2C3WA 2QQKL 5JQGA 3N1GC 3LN4B 2RCSL 2DWEB 2AJZB 2IL1A 1XDGA 3V0DA 3P02A 1AP2A 2BLNA 4C5BA 2DMKA 4D6XA 2XCSB 2SICE 2ZSBA 4UYPA 4XX1E 3H65A 2GRAA 2H1HA 2EZ8A 3B5TA 4ZVUA 4KMQA 2X41A 4BO4A 1J9EA 3ASUA 3G6AA 1H42A 4D99A 2VTVA 5DOVA 3FCCA 4OKVB 4QGSA 3P9YA 1FP2A 4CTKA 1MJNA 1E30A 1V11B 3QITA 2FDBP 3ZK0A 1XIVA 4O2BB 5G0TA 3K80A 1BVLA 5SYAA 5JVDB 1U2CA 3VJ6B 4LSSL 1RAIA 3AKCA 2GNAA 4L0YA 4AW9A 3KLBA 5D1QE 4XODA 1QQDA 3BGMB 3INGA 1CWVA 1TTHA 3PLNA 4FD2A 2P5WA 2PUHA 5I7UA 3IE4A 4AJYV 3DE5X 3KKZA 3ARFA 1E3WB 5IH3A 2CCWA 1M56B 4C4XA 1E3EA 1E2GA 5JG7A 421PA 3ZCSA 4FCWA 2CO6A 2LU5A 2Q3CA 3LTNC 1M57B 3UAFA 4B6PA 3AY4A 1S6YA 4MCYA 1W0CA 1JEQA 3W2DL 2WG2A 4HUXB 2D5BA 3U3MA 5HGGS 3B1TA 3TO5A 4E3ZA 1IM3B 2VABB 5E2JA 1MQKH 1E66A 2C59A 1HNYA 5HX7A 3HI4A 4MRSA 2XACC 2D4FA 1F38A 3NH7H 1JILA 3EFOB 1E69A 4F2HA 3JARA 5TDNA 2G07A 5DCUA 1HT6A 4PUBL 1AKWA 4KH1A 3SIPA 3ULVL 1EXVA 3FGOA 5C32A 3BVWA 1K2VN 4YSSA 2H5LA 1QQDB 2XHZA 4FZEL 4ZOAA 4KX5A 5ALSA 4L8BA 3CU5A 1LPAB 2BHFA 5EEXA 3C3MA 5H35A 1CT8A 4NO0B 3FMGL 5EHIA 4EJSC 3WKCA 3BPCB 1TAHA 4QHKJ 3COVA 1PQ4A 4UU7A 4JASB 3EZGA 3RWGA 3H3BC 3S3TA 3EULA 1M6VA 3ZE7A 4HWZA 3FM9A 1KQGA 2VT0A 3WXWL 4RTPA 3A37A 5FUYA 1KTLA 3EZYA 4OCRL 1WPGA 1QABA 5KI6A 3CFJA 1SJ9A 4Q9JA 2HG5A 3QORA 2V7XA 5AT1A 1TJXA 2HXAA 5SY4A 2QL5A 3O31A 1RVFL 1OWWA 1NKRA 1Q1ZA 2MMGA 1P7WA 1Q22A 1JIVA 4NZZA 1CETA 3KDAA 3MUOA 4YREA 4DWJA 3JASB 5IESH 3ZHOA 4ES9A 3FGPA 5JR1L 4AIRA 5KWIA 2WQ8A 1QCDA 3IQZA 1PZ3A 4IFEA 1EZSA 4AV4A 4J3OH 3IGAA 2XQIA 3K0HA 3T5AA 2AW3A 1X9QA 1PZUB 4ZYWA 1U04A 3WJMB 1WXEA 3CBRA 3I85A 3WHKA 3A67H 3TYXA 1N0XH 4HAWA 4A6XA 1NUPA 4RORA 1NVFA 1OY1A 3S68A 4LBZA 1UD8A 4KKCC 4HWZB 2EXWC 5TQ2B 3WLKX 2WXMA 3S9DB 1GJIA 4E07A 4Z95L 3SJVB 4PJGB 1OE2A 2CNNA 4UBDC 3C97A 3BVPA 2JARA 1AGNA 1GL6A 4KDVA 2OULB 4DGYL 2A4ZA 1C4WA 3LY6A 4DP6X 4DM7A 1RD4A 1SCKA 3A05A 1HEIA 2ZQZA 2H31A 3ARDC 4BUHA 1Y81A 3E48A 1MCDA 4ADGA 2O0LA 5LP6C 4Z0XB 2H8GA 5AKLA 1CS4C 2A1UB 3LM8A 4IDAA 1I1RA 4R7XA 5A9SA 1UC4B 3CNQS 3L7EA 1FX0A 3QXGA 3IBTA 4XN4A 1Y1RA 3KC2A 2R4RL 3ZTNL 5AK3A 1TVKB 4MCYB 3QUMA 4V1DA 5BNXD 1UKYA 3BP7A 2QQLH 5KYTA 3MJFA 2FF7A 3OGOE 1OGAE 1FU4A 3K1AA 4DCCA 2EQBA 4YJ3F 4JE0A 1R0YA 3TL6A 1HUQA 1NUTA 4JBLA 3SNKA 1BM3H 4AH2A 5CCXA 3BQUC 1R0SA 4G6ML 4DJDC 1E2FA 2JGIA 2TECE 4QTIL 2XBTA 3TS8A 2X8LA 3NDRA 3MREB 3LF1A 1TT6A 2RB5A 4C0QC 3G9UA 3SLGA 4PG5A 4Y6GB 3HO8A 4UQBA 1Y6JA 2Q3FA 1OP5H 4MZRA 3TA4D 4FA8A 3WA6A 3IRZA 3SR4A 1HM5A 1AB5A 2VUTA 4R3WA 2E9WA 5IDVA 1L0QA 3H05A 3KAQA 4OYLA 5FCSH 1ZPDA 2IP4A 3BSZH 3IT3A 3AGQA 1GCUA 2NY3D 3VXRE 1Z6JT 3BGIA 1XOIA 4LJ7A 3PHHA 2H3NB 3AB0C 3RWEA 4DHEA 3I2CL 4KK9D 3TEXA 3VFMA 4KXBA 5L7YA 3D0RA 1SEQL 4HO1X 4YP7A 4M37A 2ZJSH 1QP8A 2V7QA 1KJVA 1QFHA 1ZHHA 1RZ8A 4D02A 2WT8A 5E9DE 4RVCA 4CV2A 2R2BA 3MEQA 4NAVA 5FOBA 4BB5A 3APMA 4C04A 3F5WA 4J1UA 2RBGA 2WJGA 3HU2A 2YICA 1LRJA 5DRNA 1QANA 2BP3A 5E4AA 3IYLW 1D5CA 4TUJA 1JI1A 1FNEA 2CXGA 4RJKA 3BMOA 2FDCA 1SJEB 4Q01A 3GUZA 1VLXA 5F96L 1LZLA 2ECKA 1ND0A 4HIHB 1E1RA 3KBFA 1W5SA 2W07B 5JD5A 3GJXC 4L5IA 2FLVA 4AM8A 3K09A 4F8TA 3D6NB 1A9OA 3KJ6L 4BM7A 3U1BA 4JZOA 3H87A 4HEMA 2AP2A 4LL4A 2NRDA 2WNKA 5DHFA 4FE3A 3V8MA 1PFKA 4QTYA 5IDWA 1U8MB 1VGEL 3C41J 3RAJH 4FEEA 4YH6A 5K4AA 5IFJA 1RUMH 4N3UA 1NUNB 2O7QA 4AYSA 3GHHA 2WIGA 5FOQA 4EKEA 5IROC 5GS2H 4KFSA 3RC9A 4EDHA 1SHTX 4OUUA 4K87A 4HJ1A 1G7CA 5K9JL 1WB9A 3D5OF 2VZTA 2ZREA 5GGUB 1DLHA 5B7PA 4HNGA 3IXTB 4JW3A 3DX7B 3UJJH 2ZI5A 1HCFX 4IBOA 5ESXA 1ZWKA 2VCEA 5K0SA 1SN0A 1CF4A 4NCJA 3ANNA 3HP1A 3OSUA 4JUAA 4BBAA 3B9KC 5FOJA 2F64A 2XWRA 2JB9A 2WJ4A 3W82A 2VRQA 3AAZB 4JUTA 3QH3A 3G2IA 3VMMA 4HPWA 2DM3A 3W5SA 3MCKA 1CC1S 1Q90A 5AW8A 3B2VL 3TO4B 1DOZA 4CC4A 4XUGB 1KCSL 2BL4A 4YDRA 3F5FA 4X90A 3OJMB 3SBQA 1L9NA 3WKBA 3QBEA 3HS0B 5J2TB 2DQGH 1J12A 2BCGY 3JAKA 2CRYA 3MQ4A 4KB5A 2LVEA 3MYYA 3MACH 1TM7E 1OMOA 2XVLA 3RFUA 4MVJM 5JW4Q 1CFVL 5G5DA 1XLTA 1R7RA 4PVMA 5TF1L 2QM0A 1UKCA 3H8SA 5FADA 2XBLA 3FUCA 1NMXA 3BHBA 2QN9A 2GC7C 2J3HA 4HUQA 3QHTC 4W1SA 4Z7AA 3IDSA 3EPHA 1ZHLB 1FVCA 4GKBA 3L02A 2FJSA 2IV9A 5ALUA 3BILA 1SHSA 2BFEB 2Z7YA 2R27A 3MCKB 4FD3A 1TB4A 5I16B 3ZCPA 4UHBA 4F92B 2HNAA 3U6XA 1KBOA 1QMUA 5HF5A 4EJSA 1JL3A 1KOLA 3FU0A 1TQWA 3G6JB 4XH9B 4IQHA 1BECA 3ROXA 4ISCA 1CYWA 4KROB 4R4ND 1BW9B 4S12A 3K91A 4TVPD 1NAMB 4APXB 1DRVA 4GKJB 4ZSOA 1H6TA 3AB3A 2OLKA 3ZU2A 3I5UA 1TQCB 3DTVD 3W5CA 1HFEL 1IG3A 3IUYA 4HIXL 4YNYB 1GG5A 4IGEA 4LK2A 1JNLL 4BZ2A 2HUHA 5L4FA 1ESOA 2YXVA 4EQ2A 1UWKA 2JASA 1M1NA 5A1AA 3LUHA 4UV4L 4D0NA 4DVRH 1QEWB 1G43A 1ZJ4A 3FTEA 4JN1L 4IK7A 3NBQA 3NKVA 2XYBA 4MO2A 4OZGA 2NUAA 3IAUA 4PRAA 5KVVA 1AC6A 2QVCA 2FWNA 1MFDH 2WCPA 4EVRA 1XEWY 1G38A 4L0MA 5HKOA 3B3IA 2GXSA 4W9DC 2J0QA 2H08A 4PINA 1JMVA 3PC8C 5LUMA 3HJBA 5DTFA 1C16B 1ZNZA 3MUNA 4PJAA 5LXTB 5H4ZA 3QJOA 4A6YH 3VR1A 3KPOA 2OR7A 3UIYA 4WCVA 1KMGA 3W11C 3RV3A 2VRBA 3FMGA 4NZMA 4AEHH 3Q8BA 3GT6A 2G60L 1CDHA 2ATPA 1OXXK 2QN1A 3AXTA 3HJ0A 4IEFB 2GBGA 5K7SA 5H59A 1FNLA 3UWDA 5JVDF 3OLCX 2AE1A 2BW5A 2O5YL 4IOFC 2BOBA 5HHNB 1BE6A 2F4VB 1E6WA 5FFGA 3DDSA 4U1MB 4DC1A 4ONHB 1DQMH 1KGYE 2HT1A 2TMYA 1Q4NX 4I08A 1U0HC 4PHZA 1H0SA 4WEMB 4JFHD 3CFKA 2Q2OA 2QJDA 4IWNA 2NSLA 4FFZL 2PIDA 4CODB 2CKNA 4JG5A 2X0RA 3E9DA 2DLHA 4KJPD 1QIDA 4JX0A 3HUJE 4JX9A 5DHXB 5I15H 1A02N 2J5LC 2BHLA 3N0AA 4IGBB 3EGIA 2PPFA 3VG9B 4JL5A 4XDGA 2Z2KA 3ESPA 4YEDA 2UZ1A 2FLKA 2NTSP 1KFJB 4O02B 1IGTA 4OQTL 1GAWA 4MWTA 4RIHA 2DSNA 4XDZA 1LY1A 4NECA 1RFDL 3S7ZA 2HYIC 5EFIB 3AR2A 3M1OA 5JNTA 2PO7A 2I4TA 4OZIF 2ZYAA 4UPDA 2D1SA 1C08B 3EGXB 3PIIA 1NINA 2QKIA 2VXQA 2EAUA 3QWFA 3CZPA 1Y1PA 2HSIA 4YRLA 1EMDA 5K03A 1FLRH 3C3JA 2VA9A 3HA5A 4JJ5B 4P46C 1JDTA 2N3ZA 4RCZA 2EGUA 3C98A 3AQ4A 3RDTA 1AX9A 4QXVA 3ELBA 3QH4A 3EZFA 1Q9LB 3F7YB 1A3LH 5IVZB 5FJIA 1RZJH 5BMFH 1YQUA 3ARBC 3TRHA 3AU9A 3DMMA 3P4YA 2PJUA 2C5HA 3OPZL 1XX9C 2L8AA 4HFWA 1T15A 4LTMA 4CEHA 1M10A 1BX0A 2YD1A 5ALEA 1NBMA 2GM3A 3QFJB 1CCWA 1MWAL 8PAZA 1FDWA 4G0NA 4NKQB 1HQDA 4D9NA 4JZKA 2VDKB 4DDMA 5LN1A 4EB6A 5B12A 3VA6A 1LWNA 5HJEA 4BP9A 1Q15A 4NCXA 1L9SA 1QVOB 4BLQA 3K8OE 3VFUB 3EEQA 1AQMA 1DBQA 2IJ0C 1B2YA 2H1WA 4BSJA 4XAKE 1Z3RA 1V1RB 3RY6C 1IEWA 3TO4C 4XAKD 1EFAA 1NVGA 4NQDD 4AJJA 4DN4H 2OMXB 3EH4B 4P2OB 4FZ5A 4NKDB 2ZM5A 3BSZA 2BMAA 3FMOB 4K1XA 1NNSA 5AI9A 5GGQL 4PTLA 3QEUA 2C42A 2OMWA 3QEKA 1YEEL 1ID2A 2IALA 3OF6A 1DJPA 2OSVA 3TZLA 2MTPA 2WLTA 3RODA 1S9XA 1NSTA 5IUKC 3ZR4B 2HLAA 5L2JA 3ED5A 3EY9A 3V1UA 1F51E 3NK4A 4Y9FA 2JCXA 4BK5A 5ICMA 1ECPA 2XUFA 2R23A 4H7JA 1YEIL 5EWJA 1ML4A 1CICD 2Q5IA 4HXYA 3KQQA 3SSAA 15C8H 4W9NA 4R6XA 3RHFA 1YMQA 3BVTA 1KR2A 1JAZA 2VPWA 1FB5A 4RZHA 3I39X 1G1MA 5KOIA 4JDZA 1V1JA 1V39A 1X2BA 5KZCB 4DXAA 1YEKH 2P43B 3U5TA 3WE7A 2HPOA 4ZI5A 5FECA 4Z1OA 2XZDA 5EJ7A 3ZX4A 2DMBA 2FRGP 1DELA 3IERA 5D5QA 1XZMA 3S37H 2B7CA 2F4NA 4FMBB 1CDYA 1XTUA 1OXBB 3LLMA 1MFEL 4PJDB 4IGIA 2OHVA 4HN4B 3VVWA 1VIWA 2VUHB 4GI3A 4IH1A 3EJSA 4FABH 5KZCD 5DBFA 5KJRL 1MCLA 3DBOB 2VPQA 4YHYB 3HI6H 4NF2A 2XA8H 1KXVC 3X3FL 2OQVA 3UJTL 4YBZA 2NXZD 4KDCA 3TW0A 3E1GA 4O4LB 5K39A 1P1FA 2FZGA 1GIGH 4QRPA 4CM9A 4PV9B 1WT5C 1JE6A 5FB8A 3UBMA 2HEIA 2WU0A 4CG1A 2DQDH 3DVGA 4BH8B 1XZDA 2IGBA 4W9CC 4H4NA 3AEKA 5CR8A 1K6QH 3QKIA 5T1LB 5CYFA 3QQ9D 1RAFA 4JR0A 1EEYA 3CZGA 3TFKD 2F00A 2PO5A 5EUCA 5LFAA 4NQUA 1U7XA 1PAUA 1UK9A 3V4LA 4YQYA 1EXHA 2H0QA 4CRWB 1UZLA 2GN8A 4BGUA 3A4DA 3GEBA 4CN1A 3QI9C 4HJ0D 5IWLA 4YE0A 1GY2A 3LXMA 4NRYA 4A2CA 2H9YA 3JQ8A 2AL7A 1U2YA 4FQPA 3D7NA 3ZO0A 1OQAA 1EDEA 5ITVA 1H8NA 2RGDA 2PD3A 4WUTA 3N44B 2RH4A 1W6LA 3ODGA 5SZKB 5EIVA 4PW4A 4PAGA 3QKTA 3T0IA 3CNOA 4JRXE 1HILB 4ZYTA 4F7TB 4O4YL 4JM2C 2XQFA 4AK2A 2QIPA 5KPDA 1FSGA 2CSPA 4QYIA 4L8DB 1X1AA 1N1MA 1RXVA 4ZDHB 5I1KL 1GW0A 1W94A 1Z9SA 1KXTB 4M7LH 1DJMA 3QIUC 4OXXA 4F5YA 4ELME 4JD5A 5F52A 2WJ7A 4XPBH 2AJYL 3QVGB 3ZDZF 4S2SB 2VH5L 3UAZA 5KJ1A 3IK2A 2AGJL 4RAVA 4RTSA 4YDVA 1MENA 2RQ8A 3ZKXB 1NFQA 3NJVA 2AS0A 4JB0A 3V3TA 3MRLA 5I8KL 2M6SA 4KFUA 4FG0A 1M8PA 5HI4C 1FAKT 1SUFA 2EIJB 5T1DL 2BSSB 1R3LB 2ZITA 3OC8A 1EXWA 4DGVH 4LCUA 3EOTL 1COBA 3BWUC 2F15A 4EI8A 4KRPB 4M1DH 2VH5H 1QG4A 5TIIA 2ONYA 3FK3A 5D7JA 4U1SA 1XU9A 4A27A 4CNQA 4P33A 2GPSA 4NXMB 1R6XA 3FLBA 4R1MA 1JQDA 3IKCA 5IK3A 4KKZA 4YEEA 4IFTA 3PIRA 4MKIA 4FOLA 3MHTA 1WP6A 4E4TA 4MAZA 4B4KA 3A9VA 2OQRA 1E9EA 4CR6A 16PKA 3K9FC 4N68A 4NZFA 3IHKA 2EKQA 5LBSA 2PGLA 4BU0A 3RM3A 1UC9A 2O5NA 3SCMD 5AM3A 1LO5A 1PD6A 1QBLH 2ZT7A 1CI3M 1Y8QB 5C81A 1T5OA 3I1IA 1D6SA 3X1EA 4NC0B 2FJPA 1JHOA 2O3TA 4J2XA 3C6EA 4HGWA 3MQFA 2QTNA 3B1VA 4DV3B 2B1RA 4D7PA 1JEDA 3IKTA 1NI4B 2CHDA 5D01A 3UEOA 1NQAO 1VGQA 2IDUA 4PCUA 5EIQA 3OAZK 2PO6B 4KPUA 1GUDA 2C4HA 3QUYC 2F8XC 3WIIH 2GZHA 3RGBA 1XF2A 2CM6A 2WP3O 3BL6A 1H3PL 5LNDA 2H54A 4EFNA 3HI1A 1H4TA 5HYJD 3SJAA 5GHWH 4F2GA 5HCIA 1MRNA 5IC4A 1V8FA 4PX2A 1BYPA 5KNDH 4RMVA 4DGIL 3VM7A 5JZSA 1OZHA 4ZALA 3ZN2A 3MXVH 3V7UA 2EYSB 4U31A 4P8RA 2ICWA 1E2ZA 3BD4A 2KQUA 3T77A 4RWHA 4H8UA 4NOBA 5F8QC 4GPAA 3HKFA 5CGZA 3O9WB 3MMSA 2WKWA 2WWMD 4WBNB 2CWRA 2WQXA 4ZK6A 2HT3D 5EO1B 3B6JA 3CJQA 1N9KA 3U31A 2MJWA 2VKQA 1QASA 1Q1NA 2C07A 2Z9CA 3RWBA 2YWXA 5HI3D 3OC0A 1BZ7B 3MRQA 1JG2A 1NT2A 4MNQB 3HCVA 3EF7A 2Y0CA 2JIXD 2VSMB 4F9PC 5I19L 3AL0C 2GYYA 3BMCA 3H8VA 4R0LA 3B37A 1QCYA 1AY1L 5IKCB 3I01A 4KRNA 4DPKA 4Z7QF 4C8XA 4ZI7A 1G1YA 1RRVA 1KFKB 2JAHA 1J56A 4V2CB 4M4RA 1T3TA 2NP7A 5KJRH 4DKFL 2J57A 3JSAA 1B8PA 3RYHB 3UK2A 1APBA 1OT2A 4CGYA 2ZS7A 5TDOA 2ADIA 3LD8C 1GYRA 2FWMX 1D6VH 4UM9A 3AWDA 4GRDA 3L6FA 3FFBA 4I4TA 4NQDA 2ZXDA 3VYTB 4RNDB 4MDYA 2YD0A 1G84A 3IJSB 1DL5A 5B1JA 1U3FA 3MLYL 1RHRA 5FQOA 2EERA 2BTEA 4HI0E 3KUKA 1N26A 4EUSA 3P1JA 4LBYA 3U5ZB 3UVEA 1WIWA 4RHUA 2G9QA 1A2YA 3TLYA 4Q9CA 4EQ6B 1XEXB 3DUSA 1SC6A 3MBIA 3MLZL 4KY1L 4OBSA 4YJFA 2QN6A 1MR3F 1P1CA 5IZ4A 3ENKA 1V05A 1AGCB 1CUAA 4PHGA 3NP3A 1KQPA 3P94A 3Q3GB 1WAAF 2JELL 3UWOA 4NC9A 3QNXB 3ARGB 1XXLA 3SQMA 2H26A 1B6RA 3AB0B 1SPBS 1WDKA 3C3YA 3RFZA 1G1OA 2FPSA 2NAPA 1F11A 3KL0A 1DEEA 5TMPA 1BFDA 2BXYA 2W6ZA 2XPZA 3SHQA 1FG2B 3OLXA 3DUHA 3L8ZA 4IMKA 1QLJA 5CBKA 4APXA 1N75A 2YSSB 3D5EA 5FWNA 1RURH 4CLDA 2WTUA 3CZ4A 2ZTLA 4J43A 4Y89A 3TVDA 2ESVA 2NTEA 4R9SA 5HSGA 2HT2C 5GGSA 4KVGA 4KPUB 1T4MA 3HDGA 1F13A 2FLBT 1KC1A 4EF4A 4YSDA 3A5VA 2AI1A 2XUDA 1RWWA 5EO0A 1HX7A 4X8LA 3FS9A 1KELH 4HUVB 4P6VF 2B14A 1BF2A 3GHEH 1T20A 2OV2A 3D4GA 1S2GA 3A4YA 2OO7A 4IEIA 4GGOA 4RDXA 2VOJA 1RWVA 4MJ5A 4ZOLB 3HCOA 4OFZA 1BXRA 2AK4D 1YUNA 1A6UH 1SMDA 4X4YB 4G9BA 5CVTA 2GXAA 1DCFA 4KMTL 4TV8F 1PYGA 4DLNA 2YSTA 4H0FA 3AGVA 3I4LA 2YWZA 4G1EB 3SZKC 2P9TA 5ITWA 2MEJB 1MA0A 3L2LA 5JHDA 2WSDA 1A5FH 3D39B 4XNUH 1GLGA 1MOZA 3N5AA 2I5YL 1L5RA 3OKLB 4WO4D 3LD8B 2D03H 4UPEA 1RIHL 4DCPA 2NW3B 4EUHA 2ICEA 3BLBA 3LPLA 1U0NA 1XCXA 4F6CA 3BQUA 3NH6A 4QXPA 5KNBD 3F3YA 4H4DA 1T7ZA 3UHJA 4FQLH 4ZHQF 2ZYDA 3HA0A 1NQUA 3L3KB 4BLPA 5CCBA 3VFWA 3ZK8A 2J8UE 2APWA 3V1MA 1N12A 1TUBA 1ZSNA 4WAUA 4FFWA 2YEVB 1EUTA 3FCYA 2BSDA 3THYA 4FNTA 2XB2A 3O91A 1NC4D 4N24A 2O19A 2VP4A 2XY1A 3QDJE 3DUWA 5F2FA 4KY1H 3GMOA 4P2BA 3IIIA 2P3LA 2JI1A 2KKQA 4IOFD 3VI4F 1VIMA 1W15A 4KBPA 2HU5A 3ZCUA 5JSFA 4M1GL 4CMHC 3GLAA 3ZTNH 5DYNA 1OEZW 5BRZE 4GE3A 3OMNB 3CD4A 1A8PA 3KOOA 1LDGA 4KPGA 2DEUA 4BQFA 4FYQA 4A7SA 1PGNA 1DX9A 2P4UA 4IBTA 2QAJA 3NOOA 3N5KA 2EDAA 3U62A 2WVVA 4DRXB 1KYVA 3OJEA 4CMHA 1AKVA 1A65A 2ATKB 5HDQL 4BTVA 2IHUA 5T7BA 3DZDA 1XPRA 1BPLB 3UC2A 3AUTA 4M86A 3ZJ4A 2B1AH 4OZ4B 5CWSA 4MKTA 4HEPA 2ZZNA 1IRIA 3T7IA 4Z76A 4B2LA 4ZV4A 3AQDA 1CUXA 2A5UA 2ZULA 4NCAA 5B2ZA 3QPWA 4CMMB 3JRNA 3FTVA 1JSCA 4KV7A 5F1YA 3VHRA 3OL2A 2E9IA 3SE0A 5B30A 1EJ0A 4P9HL 2W48A 1C5DB 4N8EA 2XG5B 1KBZA 1Y18A 1A25A 2JFZA 4CTJA 2XKNB 5T4HA 2N4IA 5IT2H 4AQYB 3AV0B 7MDHA 2DBLL 1JYWA 1SBZA 4JS7A 1T66D 4BH7A 4EHAA 1WHPA 1DMSA 1KTVA 1E2DA 1IFRA 2OMVB 3O9WC 1AXGA 3KQOA 3MWDB 3QF7A 4IBWA 3UJHA 1WUYA 3OPXA 1J18A 2ZXBA 2W90A 2AEFA 5FA6A 3PR1A 1EB9A 4DLVA 2FPUA 1OT1A 3TJEH 3F2VA 2CGRL 2EARA 4NC1E 1P5ZB 3GFFA 4KUZL 4AEEA 4YONB 1LSOA 1JDNA 2BM3A 3OTOB 3BZFB 2O6CA 2ZIUB 3HJTA 3P2OA 2NY6D 3RVMA 4X9HA 4RMSA 5T5QA 4NBZB 4IIYA 3ZJUA 4OM0L 3P9IA 1U3HC 1W29A 3BE5A 3FQRA 1K06A 1LV7A 4KK9C 1C12B 1I1QB 1U28A 3KELA 2F61A 4UOEA 5FBHA 2KE5A 2QROA 2FVNA 4JY4B 4OD1H 3TZHA 1WHOA 4MJLA 1RI8A 2AV7B 4G0UA 5IT4A 2PCFB 1IAII 3MV01 1DVFD 3FR8A 2I6GA 3ARPA 3GA5A 35C8L 3SKXA 1VGEH 5DUMH 4D8UA 2G5PA 4GQZA 4QGBA 4B6RA 1CZRA 2I26N 4WEEA 1WPXA 1DWOA 3SJVD 1RI5A 3PPXA 1GL4B 2YXPX 4NHOA 3IP9A 3EGEA 4APQC 1AKMA 4P3YA 4W5WA 1M7IA 3CINA 2PWPA 5E7BA 2HL6A 1Y9EA 2GZRA 2EJUA 1CBUA 1NBZA 1EFVA 3RVXD 2VXTH 2AVFA 1T1GA 1WLSA 3KHKA 1LH0A 3UPCA 4RH1A 1J00A 1I01A 3C3XA 4FYJA 1EIWA 4TT8A 1H1DA 4ZRMA 3WNMA 3SYNA 1ESDA 3OOWA 4QKQA 4Q47A 3VPDA 4MQBA 1PGPA 1B15A 3NBYC 2BF7A 1I9IL 2RGRA 1N0HA 1QIJA 2Y7NA 1BQKA 3CJJA 4PW3A 4XSHA 5DVNA 3QCUL 4JJOA 1A14H 4ADJA 4TNVF 2XNDA 1MLBB 3BT2H 4TV8B 4P5KA 4OI7A 4X64B 1NUAA 4FVTA 4P23A 4GICA 3TH4T 2Z1DA 3DE6X 1OFHA 3BICA 1JHTA 3NIGE 1VJ1A 4CGTA 3HN3A 3FETA 4CBPA 1E5BA 3QE2A 2JXMA 5G55A 3C5ZA 4YPGB 3WKMH 5DD1H 3GNQA 3EGOA 3NCJL 4ZBJA 3PWVB 4WCYL 3PWUA 3BP4A 1CJYA 1LLFA 5D85A 2G04A 3VFPA 2WUFA 1ZK9A 4WFFE 3T4AA 1YL7A 1L3IA 4BO3A 4OZFB 4TSCL 1JIIA 1XDSA 4LQCA 1Z5NA 4RCAA 1YEDB 5EORL 4WBSA 4JO2H 1SVMA 1JLKA 5CK4A 1XALA 4HOYA 2PNJA 3S3DB 2VQSA 2ZDQA 4HQ6A 4D4IA 3IEUA 1ASQA 4L9LA 3ZDZB 4OHVA 5DD3H 4HBCL 4QLRA 4RAUB 3GFBA 3AOEA 5JCOA 3I3DA 4P59L 2XE7A 4K9KA 2OG1A 1N6PA 1I2ZA 5EORH 1J1IA 4DIUA 2XQYK 4M7LT 3FDZA 1JS1X 3FCSA 3B2QA 2JJYA 4JZJA 5HHMB 4B53A 3WBJA 3PWZA 3DE7X 4OLXL 3MZ0A 4EPVA 3JWOC 4Y2DC 3CEMA 4A5OA 4GLLA 4FLSA 5K0JA 2GZDA 3J81k 2WO4A 5IQLA 3VI4A 4KQFA 2P5ED 5AVQA 4HLQB 3L5XH 4A2MA 4WXYB 5DTMA 1XF5B 1NMAL 4D45A 2IX9A 2IG2L 4JHZA 3EYFA 3RLSA 2VQ6A 2AKRA 4YDLB 4AYXA 5KTOA 4XP1H 2V0GA 3BH8B 3CJRA 1DXYA 4IQ4A 4C3VA 1TM5E 3KB6A 5LDHA 2C7VA 5D5HA 1U63A 1P77A 4WI6A 3K2UH 3FO1A 5IVZA 4X62B 3IAM6 1E6OH 1F9AA 2D5AA 2NYYD 4IKKA 3H2KA 4YZFF 1TJPB 2BPBA 3HHSB 3U7RA 1VFBB 2BVPB 4JM2A 3DWEX 1FFGA 3N2LA 1S9HA 3RX7A 2I5YH 1SD2A 3GW8A 4J0JA 1W52X 1BIIA 2Q7YB 2EP8A 3VD0A 4ILDA 1E3WA 1QSEB 2G60H 4H1VA 1M75A 3L95A 4IRMA 3TGPA 3D2CA 2C9PA 2B8OT 4NC2B 4GXNA 3QK0A 1GNVA 4UXJA 2CXNA 2DFKB 4FFWC 4WN3A 3DDHA 5LR6A 1IVNA 1EYZA 2YQ4A 3PLAE 2W8CA 5JPMC 2OKGA 2W83A 1ADGA 5KSYA 5LWQA 3OC5A 2WTOA 4QTXA 3NRQA 1PNTA 5CLIA 3JAWB 3N2NA 3ROQA 3CRW1 3DJFA 5HRCA 1J9ZA 2V7UA 4YR9A 1SCBA 4OZGF 4J3SA 3HDQA 1W8IA 4HC1H 4RTKA 2DL9A 1R46A 2X2EA 3TZVB 1JA9A 3N40F 4MXVE 3M1CA 3VQTA 1MG3C 1R50A 3D33A 1XH1A 3QWOB 3L0PA 3GPIA 4KQ3L 5KYKA 3ISYA 5BS0D 2G3NA 3LN4A 4CVZB 4S04A 4YGYA 3HEAA 5LBGA 1O7JA 4UMEA 2F1JA 2X2HA 3P3TA 2P2LA 4ZGGA 4CLRB 5CBAB 1FE8A 4DGWC 4POAA 1P1JA 2PSFA 2W2LD 4K71B 2FW6A 4F6RA 5FHBL 4JHXA 3OJDA 3KJHA 5C1IA 4YRQA 1BLNB 3BJLA 2XA9A 3ZVLA 3ZY2A 4GUCA 2XF2A 1W5TA 3DVFA 2WJWA 3EDYA 2VMFA 4F8NA 4HKBA 3DOCA 2DTMH 5DD6A 3T3EA 1IGYB 2R2GA 4GP8B 2L7UA 4KR6A 3NJKA 3S3SA 1U81A 2PKYX 2DM2A 5HHQB 3VR6D 2HT3C 4KQJA 4GUAA 4BX2A 4DRYA 4C7XA 1T7YA 3AR6A 3NG1A 2PYEE 3O2WL 3OOJA 4GP7A 4DTIA 4NRYB 4BMNA 2ZPAA 3F04A 4E7OA 4Z1PA 1KAHA 3Q2NA 4PR5A 2QSUA 3UG5A 3AZOA 4LXFA 2P62A 5T6BA 3ZQKA 5AQ0A 1KJ2A 2JA2A 4C06A 4HF7A 2TSBA 2AAVA 3G5VA 3VG0H 2XKNA 5C07E 5ICUA 4U2DA 4FNGA 3LUCA 1MCIA 1KERA 1REIA 5K3FB 3QB7C 2R2CA 2FVYA 5HTSA 1N3YA 2QQGA 1DIRA 4NY1A 3QXAA 4YX2H 2QTTA 5EWLA 1KIQB 3H9SD 2DC1A 4YUAA 4HIIA 1KTIA 4LZAA 4Y7CA 2H2PC 3EGSB 4N4AA 3VZPA 1WMDA 3MG9A 2B7BA 4FYKA 5EXEA 3SXUA 3K94A 1EKXA 1NFDE 3T3DA 2C88A 4M53A 2A2QT 4PP1D 1JHMA 1G4AE 3ARFC 1TTPB 1NIEA 3B36A 2HVKB 3GCZA 1BHO1 2Y2VA 2Q5HA 3VNUA 2LDXA 1A8QA 4RA9A 3TA3C 3KOYA 1AGPA 5HDOA 4S1VA 2BY4A 2AYYA 2G7ZA 1TQCC 3CDYA 3QJTB 3T3HA 2ZXFA 4WFEE 3KKKA 2QEQA 2HI0A 3QOYA 5DU2A 2NPLX 3EYSH 1QZ1A 5JWRA 3WE1A 3GZKA 4WFHD 1IT9H 2A9QA 3R7RA 1OASA 3M6DA 4KLZA 4NU5A 4HNHA 5LKAA 2QVFB 3GUFA 1SG6A 2NV2B 4GEJA 3H56A 3VKFA 3RIAK 3CRRA 3TXXA 3VI3A 3S8WA 3MAAC 4HBGA 1DBBL 1HDMB 4NN6C 3FAXA 4N0FB 2Z7ZA 1JSXA 1L5OA 1WV7T 5KC8A 1DQLL 1NL0H 2FR8C 3AP3A 3OJLA 3GY0A 4RKQA 1KGWA 1ILSA 1KPHA 4JLWA 2NW2B 1KMMA 4NP9A 1V3LA 5FNZA 4KR0A 3GBLA 4D0RA 3GMRA 3WUZA 1DANT 1CDZA 4HC1A 2HRPL 2YUWA 3LPFA 3D39A 5F1NA 4MGZR 2EO7A 2VOTA 4Y0VA 3P11H 5E6RB 4IU3A 3X2EA 5JNRA 3QIUA 3AVXA 4B2IA 3TPCA 2O54A 3QJYA 4Z1MA 5BV0A 1B9ZA 5IW8A 3DMRA 3GT7A 4X6LA 3G0GA 4OFKA 4PJDE 1LO2L 1AHHA 3PGCB 3O47A 3DEJA 2I54A 5C07D 4HAFA 3GRBA 4G6ZA 5IBCA 4TTAA 4WWPA 3PE6A 4PJEA 1JIQA 4K15A 4RESA 3N2EA 4JLNA 3M34A 5KJEA 3T9DA 4QX6A 4Q3KA 3RWIA 3ZGLA 5SYMA 3CISA 5H82A 4GJTB 1E1LA 2XZCH 4Z7JA 2IYVA 1E0AA 1VP3A 1YMMD 3VC7A 2DLIA 4B3SB 2Z5LA 3QQ9C 5C0ND 3ELYA 2HJLB 3A27A 1P5UB 3G6JE 3MFYA 5AG9A 3UC9A 1YYLL 3M4XA 3UTSD 5GISL 1NN0A 3TPZA 3OO0A 2R1VA 4NWIA 4DQUA 3P32A 2CVFA 4FHJA 4O2BA 2R8ZA 2IAAC 3AY7A 3FH7A 2D0GA 5DQDH 3MWGA 1HDRA 4E51A 3QORB 3SGKA 1PL7A 4JGNA 1QLEB 1A22B 4XP6H 1UIMA 3SI7A 3UJNA 3E3OA 2WANA 2EIBA 4ELKB 3EIUA 1B6TA 2BVQA 3LZFL 3QFJD 5J4HA 1DIAA 5F7MC 1NLDL 3M1YA 5EZOL 4J3OD 1QK3A 1SY6A 4WLUA 5LMNB 3V6BR 5MEPB 2ODIA 5AK0A 4XVJL 2J31A 2P49B 3UZVA 4R1NA 5FOBB 2MSDB 3DZBA 2P28B 2JLAA 1UPTA 4FNLL 3I8XA 3ULVH 1IN6A 4LCYA 1KFEB 4KI1A 1J0CA 1YB1A 5CAEB 4N0FA 4EJMA 1KCRL 4JY5H 2AB0A 4J6RL 5D7IF 3I8OA 4UC0A 3RUAA 2I2DA 2QDXA 2V96A 4HL6A 3RS7A 4LPTA 1CC3A 5BW4A 2Y69B 2X1LA 2LWIA 4UCWA 4OLWH 5DDIP 2CLVB 1G16A 4NPAA 2Q5QA 4QOJA 1E6MA 4WWOA 3KQPA 5E4TA 3ZHLA 5K0FA 3TLXA 4XX5A 3V7AG 4BGIA 4IIGA 4KQHA 4HS3B 4DDVA 3M1BA 4CGUB 1JRHL 2CIIB 1JU9A 3ORJA 2ARWA 1DEEB 2M9MA 1HXMB 1DAGA 1XZKA 3ASOB 3ULVE 1YVLA 2R7KA 4UFPA 2CUHA 2Q4EA 1Z7JA 2HSDA 3UMTA 4XVQA 4HJGB 4DC0A 1U3HD 4H0HB 1V4NA 5GONF 1D5XB 4X1IB 2AYZA 2IDFA 2CKBH 4GMTL 3M8OL 3DAFA 4XCEB 3SE8L 1O6SA 1ODUA 3VCLA 3EYOA 5FOXA 4P2QB 2B9VA 3ND7A 2WBJC 5E6ZA 5A5EA 1S2OA 4J2QA 3NXKA 1SVZA 3D3VE 1M1XA 3SPVB 3UJPA 3L0OA 5IB1A 1OFUA 1CY8A 3GGPA 3H55A 2UYCA 1U4NA 1LO5B 5I5EA 5SWZB 3LC2O 4DV1B 2W92A 4GMFA 2CKMA 1LNZA 3QCVH 5DISB 5DX1A 1HXKA 3UMMA 4E9RA 2WD9A 4AO7A 1ETZB 4BA8A 2CFOA 1MLBA 4ZCQA 4XMUA 5BS0A 1AA6A 4OIBA 3SE7A 2DTSA 1UZAA 2O1SA 4XJTA 1XD1A 3TNNB 4C56A 3FNKA 1Z68A 2WAAA 2RJOA 4W9EC 4XQGA 4MX7B 3B7SA 2H8PA 1UM4L 4GDMA 4U5XA 5IN5A 1PZBA 3P0GB 4AJ4A 1HO3A 4C89A 1IAMA 3JAKB 4I5FA 1U3NA 1WZ1H 4RSVA 1GIAA 3SIRA 3PA8A 1KB3A 5ECDA 5CIWA 3FO2A 1BDHA 4OQPA 5KSOA 5GIRA 4PV8A 4WEOA 4OQTH 1INLA 4NHUB 2F8OA 3CNKA 4AMWA 2IHNA 2X7HA 1R0AH 3FW6A 4JFEA 1OHHA 3CZ9A 3Q7PA 4IDEA 5HI3C 1BVKB 1FO0H 1OXUA 4U4AA 2CJ3A 3S97C 1ZGLA 1CFQB 3Q05A 5I1EH 3GFSA 4WOCA 2X6TA 3CX4A 4PYMA 2WE7A 1JHKH 5KVGL 3LEVH 5DWUL 5DGHA 2IU6A 4XNAA 4M7PA 4ABYA 3WIAA 1HINH 2VLJB 2RFXA 3SCMC 1EWYA 2W4QA 2RHWA 3H9HB 3LRKA 3OBAA 3QKRA 2QTFA 4KTTE 1ZLSH 1R24B 4QQFA 2VNCA 4A26A 1ZK2A 2XWQA 2HF7A 3QUXA 2ZRQA 2NY0C 3NHJA 4B6OA 2VO1A 4CDRA 4AF8A 3W5NA 1MFCH 3ZKXC 1VBKA 1DOAA 1G7PA 2O5ZL 2X19A 2ZQ5A 1TEZA 1IC5H 1KY6A 1BX1A 3CVWA 2Q9UA 3HTLX 3E2HB 3MROB 4D0LB 1ZJBA 5AKXA 3EGWA 1BLIA 3NYIA 2QVMA 5C0OE 3JTBA 2HV8A 1UJBA 3GXBA 3VR4A 5EE5B 3M46A 1RZQA 4E12A 3C6YA 3QULB 1OD7A 4AYMC 1UBHS 4ALAL 1UC8A 4OQLA 4WU5A 4HDIB 4JFQA 4CDGC 2O8DB 3THWB 2A1WH 2Z93B 4D8PB 4F45A 1FYTE 3W5VA 3K7EA 5BVGA 1A6ZA 1H1LB 1BOGB 4S10A 1IHXA 1ZLDA 1AIZA 2XT9A 4KUHA 4S1QL 5IM4A 2X0DA 1FJGB 3L41A 5IVOA 4KHTL 3VFSA 5FA8A 3UJBA 1TT5B 3VFRA 2DHRA 1TTFA 2XB9A 4NRZB 1Q2XA 3BWVA 1L7DA 2UZIH 1Z66A 5JD4A 1L4UA 4N2OA 4MGEA 5EUMA 4JLDA 1DSYA 1YMVA 1QG3A 1DX4A 3NOVA 1R24A 3HR7A 4FQHA 1CLYH 1X13A 2ZF8A 3OCWA 4DMGA 4PRNB 2ZBPA 3AEUB 5DC0A 5BNZA 3V8CA 3WLHA 3KTOA 5BNFA 4ODXA 4RD3A 3S5ZA 3CTMA 4QSMA 3WEOA 2TMKA 2JG3A 4G3YH 3N8IA 3V6ZA 1NPTO 4V1CI 2BE9A 5L3RA 5CEZD 2FYYB 2Y7QA 2ZJAA 3FTUA 1DUVG 1BAFH 5ANMA 2Q5LA 3G7SA 2IYNA 3RLFA 1BA3A 4R1SA 2H8KA 2R59A 3D8RA 4O3UB 5CCKL 1BZDA 1ENOA 1H2AS 4MAYB 4BFNA 1Z25A 4F3TA 1JGDA 3L16A 1SZCA 2WSYB 2LKDA 1YI1A 2FPIB 2YN2A 5A5VA 4JLJA 2GN1A 5LN4A 4PCSA 2YJ3A 4KQWA 4QRHA 4EF5A 4ZQHA 3QQ3A 4EX7A 1TZHB 4PRHA 4YGXB 2WKPA 3HZVB 4OFIA 1LYQA 2V6MA 4TN5A 2EDOA 3B1FA 4D97A 4WI7A 2I22A 3CZFA 4IKEA 2CWDA 4HUCA 4FG2A 4R71A 1XGUB 2FU5C 1W72L 1SKMA 4WDIA 2IS6A 5IBRA 1J0IA 4O4JA 1J0HA 4C03A 2VSXA 4D0BB 3COOA 4LNUA 1JGEA 4QDOA 3NSYA 3CVCA 1CRQA 3MUY1 3S8GB 3HG0A 4ZSOB 4O0MA 2QTWB 3IIJA 1N2XA 1Q1GA 5TD4A 4O02L 2GASA 1CEYA 2Q3XA 1QO9A 3QNZA 3RLIA 1UEXC 1Y4DE 3I64A 4MUFA 2OCXA 4HN2A 1CUSA 3KWUA 5BVJB 3KVOA 1TU0A 2XOKA 3AUJB 3I34X 1O96A 3FOAA 5ALZA 3QVJA 1R47A 1BEYH 1S3KL 3MJ6A 2AK1L 1KXJA 1LQBC 2QQNH 5K9QG 4A2GA 4XM1A 5DJYB 1HX0A 2DBLH 4O63O 3I6LE 4A2EA 1QSFB 4MVWA 5D5MF 2WPDA 2NOAA 3IUSA 2NX5E 2IU3A 5EQJB 1OREA 2TYSB 5A62A 1P4JA 3PEEA 4M8KA 3JYQA 3RDTB 4P57B 1B8VA 4MV3A 1EJ2A 4J6RH 4L78A 1KCVL 3IMWA 4CE6A 1JAEA 3CZRA 4N82A 1GS6X 4QTIH 4AQ1A 2X8JB 5BN3B 1Z17A 3GFPA 4I4WB 1BXXA 3RWFB 4XDYA 5EWLB 4PYLA 3VGJA 1CQIB 1X38A 3QXHA 4B75A 1Z73A 3JWNC 3EFFA 5AENA 3CA8A 4DW8A 1R6VA 4JH0A 2GYVA 4LMRA 4L48A 1MJJA 5GGRY 2DWDB 4N20A 2IP2A 3ZQUA 1ZVSA 5JPMA 4EG7A 3PUHA 3H16A 3CFUA 4HEME 1T66C 2A83B 4F4DA 2A99A 5CF3A 2CFCA 5EZSA 1DQVA 3GC6A 1HTBA 3ZRCC 4YIQB 2AW5A 4TL5A 4ANXA 1RAMA 1J8DA 1CZHA 1RIFA 1ZRHA 1FGVH 1XI2A 4HJJH 3BX1A 4J1TC 1K5HA 2XOEA 5EZ5A 1Y8ZA 1P7QD 5F1KA 3NEYA 4IYRA 2YFKA 3RPIA 4X6UA 2YRPA 3UO1L 5E2VH 4QUIA 4AP5A 4KX7A 3RTQA 3VMFA 5C0CA 1MFDL 5B1HA 3RSCA 3PLRA 3OKMB 1V6SA 5F7NC 2DZDA 2XWPA 1VF5C 4IOJA 4G6JH 2AI2A 3V00A 2Q4OA 1W72H 3M1LA 1F90H 3TA3D 3W0WB 5DYWA 3SKNB 2VCHA 1SXNA 4A68A 1TZAA 1GZ7A 2P6OA 2BN4A 1MIOA 5FKAA 1WFOA 2Y27A 4EUPH 1DC3A 3MXWH 3E5MA 3LFTA 2K70A 3KPMB 1CRWG 1P4AA 1W85B 1XL6A 3KYNA 5JO9A 1FDLH 3M4YA 8FABA 2GD0A 3C1TA 1XSJA 3VKWA 3MJHA 3RZCC 1HT1E 4KXLA 2DY1A 2IQAA 2WLIA 2F3UA 1B74A 4PBTA 1DC8A 2HPTA 3EOTH 5FDFA 1VL0A 3HXPA 3K71B 2ZUCA 1CFNA 1XZCA 2G1PA 4W8GA 2Y7LA 2JGEA 4J3VA 5J5EA 2PVPA 1CK4A 5DU7A 3QRBA 2RKOA 2A6IA 4Q7EA 4NIKB 2JWGA 3KPNA 3MFFB 2J87A 1UH2A 3Q44A 3KJXA 3K35A 1B3RA 3G9AB 1L5FA 5EIXA 5EIIB 5EU7E 4Z7QB 5IT5A 2P5YA 3NI2A 1JGEB 1QLEH 3GPBA 1Z37A 1GZSA 1WCIB 4AZ8B 3MUEA 4LJ8A 1NA8A 1UFRA 4R98A 2VP6A 4E11A 1N3NA 2O7VA 3TZVD 2PMEA 2Q5BA 1M7IB 3ZXSA 3PNWA 2Q3JA 4LXHA 1ZWLA 3RTDA 5C5CA 1PX4A 4PZPA 1R18A 1ZS8B 1U91B 4RJ2A 1EVQA 3WDMA 1ACMA 1JH9A 3MUFA 2RH9B 2AQPA 2XB6A 3PD1A 5F6IC 1S8FA 3KCNA 3TW4A 1CFNB 2JCSA 1BO6A 2F1HA 4MVJD 4Q66C 1WT5A 3OJDB 3BW9B 2V2TB 3CRVA 1XCOA 2MRYA 1DQLH 1NL0L 2H1FA 4P59H 4UZSA 3I5XA 2BD0A 2DQSA 1OWMA 2ATEA 4EJSB 4RZUA 4D94A 1T43A 4RFNB 2W60A 8FABB 1HDIA 2O72A 3CCHB 3MTBA 1UD2A 3BIKB 1KP9A 1CR9H 5B6IA 3C5VA 3OE4A 1Z6TA 1CFMA 3L6CA 1XCBA 3QGMA 1YC7A 3V9CA 5A06A 4JEIA 2HH9A 3F0TA 3WK9A 1FVEA 4TM8A 2YYSA 3ENQA 1G8GA 2JFXA 1GU7A 4BFGA 5F1SA 1BMZA 2QMKA 3LNFA 1J21A 4M43H 1EP9A 4UQIM 1CDEA 4QOIA 4ZQIA 3PUZA 5TGBB 3MFQA 4IZ6A 3SQLA 2B0SH 1K1EA 3BKML 3MV8E 4Q9BA 2HTLC 5C46F 1GKUB 5SZIA 1I9CA 2BKXA 3EJRA 4XZUA 4NBVA 4EG3A 3AG4B 3LC0A 1N5OX 1XXDC 5SWZD 3SFZA 1K2WA 4P82A 3LRMA 4O00A 2FSHA 2YS4A 4PJGE 4HK3J 4UIKL 5FDWA 1PNVA 4PJBF 2QHRH 1FIGL 3D3VD 1W8DA 1WUTA 1NFIA 1ZGZA 4NUJA 2IUSA 5KTKA 5D00A 3RC1A 3FIJA 2FRDA 3HAEG 1PW7A 1V9CA 2E9GA 3FQXB 3OZGA 2GKGA 3KYDA 2C3YA 2RG1A 4QO1B 3LPNA 3BFVA 3H0KA 4XFDA 2WLIB 2IQAB 4L8SC 4OAQA 2J5KA 3O6MH 4KE9A 1MCNA 1N6QL 3MLEA 3SDBA 4GMDA 4LXQA 4Y5YB 3ULVC 3MUZ1 3H9CA 1T22B 5M04A 2AS5M 4K3UA 1DVFB 1UKBA 5EC1A 3DI2B 4Y6SA 2BOVA 4ZU3A 2C3GA 1MLDA 4ZQFA 3MPOA 3GZTB 3NFSL 3GRWH 1GXSA 1OGAB 4FFOA 1YEKL 1B0PA 4UE2A 4OGYH 3EXIB 2GBVA 3DB1A 2FEKA 2EEFA 1KENH 3MFGB 1KOJA 3MTEA 1N6VA 1YZZA 2O6PA 2AKRB 2EXXA 1Q3KA 5TX7A 3UWSA 4UT9A 1M1YE 3S37X 3NAGA 5CEZH 1JEQB 5C08B 1E2VA 2NP6A 6ADHA 5AW7B 5F3HB 1WMAA 5F2OA 3ML1A 3VA2C 3HUJA 5EWMB 3VHLB 5L9AA 1UT1A 1T36B 5JO0A 1RJLB 2XZPA 2AG1A 3T54A 4GM0A 5FGRA 2I6FA 2DTXA 2HJFB 1AIPA 1F2TB 2XTJE 5E6IB 2FX7H 4IMLB 3IJ5A 4JCCA 1ISIA 3NIGB 5AFAA 2DF3A 4M9OA 2OMNA 3K9NA 3O3OB 2XETA 1WBZA 4EEZA 1JX6A 1Q9WA 5TE4H 3ZSSA 1XR8B 4WJ5A 3TECE 3BWXA 3IDGA 3IDOA 1FTSA 2PG3A 4Q7LA 3BP6A 2HT4C 3VUEA 3WGVA 2H5JA 3CSUA 2G9KA 2P1YA 3V0HA 3I2HA 3KJFA 1EG2A 1Q0XL 4EARA 3D4CA 2O30A 4G42B 3CVHB 1CUOA 4OJYA 1KOFA 1L0XA 4Y2DD 3V4UL 2YW2A 1SU6A 2VLLA 2BSTB 2IADA 3MV7E 3VD3A 2GD6A 4RHYA 1N0WA 1ET5A 1P2GA 4D25A 1GMEA 3U0PB 4RLSA 1DG9A 4ZJUA 3VXRB 5C71A 4K7JA 1JQLB 1U2ZA 3JTEA 4NFYA 2XIIA 2DIEA 3N3EA 2EATA 3Q0EA 5BXQC 5HYJE 5T3XE 2IUTA 3SBWA 2BWQA 4N7RA 3UBXI 4ZOLA 1B0AA 1NXSA 3MJVA 1G98A 3S6CA 4F7WA 3U61B 2MPAL 4AQ1C 2ENPA 4Z7OE 5B3JF 2ZSUA 3VVVA 1D2AA 2G17A 3PQ2A 3UA3A 2B1OA 4F7CB 1ZLEA 5LQBL 1DFIA 3F84A 2R7EA 3VXOB 4H2AA 4UQ3A 5CR9A 1NN3A 5AAMA 4QU0A 4GLBA 4JVLA 4R69A 3QA3B 1D5BB 1ZMTA 1W4BA 3QEUB 4NCC2 5EIWA 3HCWA 2VM9A 2WXKA 1KUMA 4KIWA 5IHUL 5CN1A 2E5WA 2WQ7A 4UFNA 3ECWA 2WF9A 1T2JA 1JCKA 3IT1A 5K0ZA 4RCVA 3PHIA 4PJXE 1SLVA 4FB4A 1RUPL 1NQTA 3ZW9A 5LG1A 5IVXA 5CZKA 4MQFB 2X4SB 3UO1H 2ZSVA 3W4KA 4B3TB 2B1HL 1IY2A 1LJ8A 1OARH 1AK2A 2VEDA 4PY2A 1RHMA 1E3JA 5BUQA 3EVEA 3OG4B 1VMKA 5BVHA 1Y8CA 4KXZI 4U7PB 4EMZA 1OBVA 2ZRIA 3L5IA 3ZLJA 3P45A 1GKIA 1F41A 3QUKB 1SOVA 3IQEA 3ET4A 2CUTA 5E1MA 3PPSA 4AVYA 1BREA 1OZ0A 4IF6A 1ZA6B 1VB3A 1X1BA 2W2KB 1DBBH 4NQXB 4YAQA 4YUEH 1PW3A 1CU1A 3BHIA 1QSEE 1C0LA 1ZHLA 1MW9X 3FF7A 4HETA 4RXTA 1FA4A 3LEVL 2VBCA 1EDZA 2VXUL 4GAGL 1BAPA 1RIIA 4IW3B 1YK1A 4I5EA 5FBZA 1XRNA 2HIMA 5CEYA 4M5YH 4MZXA 2ORBH 1JF5A 1YJ8A 3VOTA 2NZIA 2GTHA 4NYLB 1SHYB 2DAVA 3F1KA 4DV6B 4O0LA 3SZ6A 1R37A 3ZI7A 4U0RC 1SBQA 4TXMA 1S7UB 1ZGJA 3K30A 4PI0A 1SOUA 2IV3A 5JS2A 2B4TO 4GFXA 5A0TA 3CSPA 4O2RA 5BUGA 2HFJA 4NULA 4A55A 3CV5A 2BR5A 2OCJA 1S89A 1XTVA 4XEHA 1DEAA 4FF9A 2YMXH 2FTAA 4QNPE 2CYBA 2YJLA 4Y88A 1FS4A 1G41A 3OJVC 4NDMB 1TUBB 1R3JA 3BE4A 1WY5A 1ILEA 5F78A 3ANTA 1IXKA 1JVBA 2NU6A 3F3SA 1FX1A 2V55B 3I9JA 4FCAA 1CY4A 5TJWK 5EKXA 3X1FA 5T33L 2FQ1A 4G43B 1A7RH 4RH0A 3L1FA 4J27A 2CHWA 1MU0A 1S3IA 3L5OA 1UMKA 4XX0B 1OTSD 1KYOK 1KCKA 2P8PB 1KEZA 3L9RB 3WRYA 4PG2C 4L8DA 1WKCA 4GIBA 4WFQA 4OBEA 1ULAA 5AOMA 1ZKMA 4AUJA 4FBMA 1Z5GA 2GJRA 1YEGH 4Q9DA 3KEHA 1K8XB 2POQX 3FPAA 4P32A 3I4CA 3KUCA 1UTDA 1RVV1 1UK8A 2SKEA 2XODA 2CM5A 4ZX6A 3X11B 4Y1RB 1KF0A 3TGXA 3HCFA 4FKMA 4NQED 3QPDA 3WIDA 4D9LH 1O89A 3AG6A 3AQIA 2P2GA 1QXSA 2WUCL 3DYPA 4M6WB 1CDOA 1YULA 3FF1A 1ZGAA 3Q48A 4YS4A 3QNZB 5I9QC 1GU0A 3PQ6A 3ARQA 2J5RA 1OKKD 1YS6A 3CXDH 1ORRA 1OFVA 1Q7BA 3PDIA 2Z09A 2FXIA 2YOGA 1M2FA 4D57A 3PJRA 4RZ3A 1AO0A 1W5AA 2Z2XA 2FG5A 4U1SB 1FPTH 1RZIA 4URKA 2HCFA 2DV6A 4AT6B 5DXFA 4HCGA 2GAAA 3T2LA 2QHRL 5ISZA 3JXAA 2FQQA 1QPZA 3QLJA 3FBQA 1US8B 5JIDA 2DX7A 3LB6D 4O4YH 2QV4A 1INEH 3ECBA 1TTUA 5C2UB 1GA1A 1DXQA 1VDZA 1DADA 5TF0A 5CR1A 1NW3A 3ZKMC 4EYQA 1K97A 4UKDA 4DZBA 4Z86A 4B3JA 4PIBA 3OB0K 3QMWA 1KS9A 3GT3A 5IQNA 3X43A 1WM1A 4BJLA 5JRZA 3EEBA 2J5WA 3HNOA 3ABRB 4WDRA 4PJIA 1Z2CA 4PJ7E 3PV7A 1YRWA 4H8QA 5JXED 1I7LA 2QPSA 3W2TA 3TNMA 2AANA 4U1IB 4U7HA 1M7GA 3C70A 4FN5A 4GT7A 2AJDA 4OLYL 2JGFA 1XD9A 4A10A 1RIHH 5JRJA 3ZE1E 2DPKA 4LF9B 4UYQA 1FFPB 5DUPH 4WASA 4N7JA 1NCDL 1G6RA 2BZ7A 2X5XA 2QL1A 1KZHA 5KX5B 1DPGA 2OK0H 5A02A 5MHSD 1T4CB 3DOOA 5EN4A 2ISDA 5KNLA 5DD3L 2EXTA 3K16A 1JG7A 3L2OB 1L8AA 4FL4C 3P2EA 1P69B 3HLKA 1SYSA 1JXDA 5IJ9A 2WKQA 3T9EA 1WBXA 4X9GA 1H5UA 2H6PA 3ZU5A 3H1TA 2HLDD 1L3BA 3U4CA 2EFCB 3VKHA 1HKFA 2BH0A 4WCDA 4LLUB 4L4JA 5IC6A 3EOAA 4P46D 5F3HA 3KBOA 4OLXH 4D8PA 3SQDA 1A5FL 1SCIA 4IRSC 3L3IA 3V0GA 1PR0A 1B6SA 1UWXK 1BV8A 1CTOA 3OAUL 2OJEB 3P30L 5BSWA 1R75A 3IBSA 1B8UA 3GSOA 5FEBA 1DUYB 5IMLB 2IEIA 1JQBA 2MHAB 4Y9SA 4NO2A 4PJFA 5F7HA 2O2HA 5TRTA 3V79C 1ECLA 5I9NA 4HB0A 1BJMA 1G8YA 3OQMA 3GIWA 4M4RB 2O8BA 3VGBA 1FFXB 2EDNA 5E9JA 5JAOA 3CXUA 2F19L 4PVLA 2Z31C 3OKFA 1ISFA 4XBGB 3NEAA 4NESA 5HVGB 3ANMA 4QYAA 2OXIA 4XN2A 5IJXA 2G1KA 5SICE 3KW7A 2QTGA 4DPLA 1QTPA 4FHEA 2QN7A 3TN0B 4NVRA 1A9XB 1HYBA 1PDWA 1H8SA 1TUEA 4F1ZA 4AEFA 3E15A 5F1OB 5F8RC 5TDPB 3DI3B 1VFNA 5CLQA 4XP5H 1DAKA 4OKNA 1WDMA 3L0BA 3EEOA 3KPRE 1OXMA 4DTGH 1T2UA 4Y8DC 4AXXA 4FDWA 3GFTA 1PR2A 4BX8A 1J99A 4RWZA 1E9PA 1RM4A 4W93A 3ZHVA 1GGVA 2WXHA 2G77B 3F5MA 1PZSA 4NUGH 1KYAA 1P1VA 1XVVA 2HMWA 3I9LA 4XNXL 1BTOA 1US8A 3CV3A 1WG3A 1SJEA 1R5IA 2FCRA 1WA1X 2QJFA 3A21A 5JHLH 2O3SA 2LLNA 2C58A 3DE2X 5A03A 3TN0A 2GCOA 2GFHA 1T8YA 3V5KA 1SKYE 4RJTA 1DRJA 5KQRA 5DJYA 4RGNB 3WY3A 3QRGH 1A5BB 2O8VA 2YOAA 3PNMA 3RF6A 4BLVA 1DWQA 2RR3A 1NUQA 1P29A 1K5DA 1E90A 3D5TA 5A2IH 4PRHE 3KTDA 2OV1A 5JNSA 1YR6A 2IZOA 2W9XA 3SYTA 4FI7A 5CXXA 1U8AA 1NF2A 4FOPA 2MYUA 5ECGA 1BKSB 2ZXEB 4M4SA 1X6NA 3SYAA 2O2SA 2WUCH 3FAWA 3MNZA 3C1OA 3RUHA 1YNKH 2QW1A 4JMNA 2YXMA 1HDYA 5E8EB 5E4IA 1XGPA 4NABA 1HE5A 1P4HA 3GCDA 2WSSD 1FSPA 1PSDA 1ACYH 2QMUA 2GDZA 2FJHB 4ZXPA 3U44B 1EEUA 3DX7A 1RWXA 4EE2A 4NZUL 2BTQB 3LH5A 3WFHB 1C7QA 1XDZA 2FZ3B 5CBEB 5FYJD 1I9IH 4CKBA 3A1UA 3EB9A 3W38A 2A57A 2VNHA 3LYHA 3MPCA 1HDXA 3PV0A 1JV5A 1N19A 3QC5X 5J11C 3F49S 3EGXA 1A1OA 2DY0A 5EOVA 1JR3E 2JKXA 1OW0C 2V5SA 3LRSA 5EZYF 1LE5B 3ABLB 4M6OH 3KTAA 3X3GH 2O61A 3COZA 1K4CA 3UDWA 2OBXA 3GQBB 3IVXA 3WLWD 2QSJA 4XARA 1T9CA 3LMKA 4OF0A 3ROZA 2W9LA 2PV7A 4ABUA 5ICCA 1DQQB 4UANA 3DF9A 1QTSA 3ZVKA 3DDOA 4N18A 4P23D 4XB8A 1B6UA 2AJ3B 1GNLA 3Q2OA 3FU6A 1IILE 4YROA 3IGLA 5K8CA 2VDQL 2NZ1A 2Z1MA 4DMUB 4OLYH 3WMGA 3TVMA 3J7TA 5FLXA 2SCUA 4HRXA 2X88A 2ZXEA 4P5PA 2N1KA 5HIJA 1A8ZA 4NBRA 4LBAA 3S0PA 4PFQA 5EIOA 5BOSA 1XF3B 3TDMA 3A6CH 3EJ6A 3GLDA 1T3SA 1AO7E 4M83A 4CU6A 1CL7L 2ADMA 4BO8A 2OR9L 5MERA 2X7JA 4UW9A 5BRZB 3UFBA 1MZYA 3RYIB 3WB1A 2YMTA 2L17A 2ZTSA 1WXIA 4ZI8A 1E5CA 3HAEA 1PHPA 3VMPA 1OGIA 1U8IB 1U5AA 3D0QA 1CDCA 3HE6C 1BOOA 1MG0A 4F84A 4PLJD 3O4LB 4JROA 4AYFA 2OJZH 4IXWA 1JYEA 4DCQA 4R9NA 5D1QD 4NNPA 1YCDA 1FC0A 1NVKA 4B3HA 3SYQA 3TLMA 4G7VL 2VPYA 1R9FA 3UOGA 5F3WB 1GJWA 3OD5A 3S8YA 3EQ6A 4UTBA 3HCPA 1VKHA 4FKEA 3PCXA 2A6IB 3M8KA 1QLFB 2JLRA 3IXLA 1X80A 2I25N 4XVUC 3WJLC 4G5FA 3IQXA 2EYTA 3KZOA 3TQCA 3BGSA 2FL5A 1ONQA 5HHVL 1GSMA 1BVUA 4XYMA 1KWKA 2RJMA 1TK9A 1C5CH 3VRHA 4P5EA 4FZ8H 4EY6A 4XYLA 3B2XA 2O93L 3V0AC 1HZZA 3VVBA 2ECOA 5FCDA 2VL5B 3GJFA 4HGZA 1DAOA 3TL2A 5TLSA 4MP8A 3OAZH 5FIEA 4GXQA 1L1EA 5LJLA 5JDCA 1RIUL 2J85A 4XGZA 2XUJA 1QAMA 2VDJA 2O6HA 2UZPA 4CV3A 1JIXA 4I0PD 5CEJA 3F4BA 2FZ3A 3VFPB 2CLEB 2R00A 1I3GL 4RBNA 4CWAA 1S7XB 3TT3L 1BFVL 3PGCA 3W9EA 4BO7A 4KXXA 3CLRC 4WWHA 2GVZC 3V4VB 1MCZA 3QXAB 2UZ3A 5F98A 2E5FA 3PNPA 1HU8A 1SLUA 1VB9A 2DHEA 4MEBA 3X3HA 4R0NA 5IHZA 1W4RA 2BKUA 4MR7B 1IVSA 4QHUB 2I24N 3L7MA 2X7LA 4JPVH 4ETMA 2OQIA 3UJIH 4KMSA 5JZOA 4MUHA 4WO4B 3TRKA 1BIHA 1YOVB 5G0UA 3I9GH 2KSQA 5TARA 2XZCL 4LOHA 3K6OA 4LSRH 4PYOA 1AHWB 3QU4A 4FSXA 2Q45A 1YBAA 1E6UA 5FCUH 1NCAH 1X2EA 4UBJA 4MQ7A 3F6CA 2RAVA 2DDQL 2JHAA 3O3DB 2OR9H 4AUKA 3MWYW 2NNCA 4ZMNA 4XPHL 1T7XA 2BNQA 5EIIG 3DT8A 1MIMH 3APNA 1EUCB 4ACTA 1OTSC 1NM5A 3LKQA 4PP2B 1B88A 1E7VA 3T7JA 3TOPA 1V95A 1TYZA 4DR2B 1KXQA 4ERSL 4RRPG 3FB4A 2CLRB 2P6RA 1XZPA 3V6FB 2V7PA 3Q6GL 4YVNA 3EJZC 3CNLA 1ZQ9A 3GLTA 1SIWA 4G7VH 2ZYSA 5E5LA 1M8KA 1ZJJA 5JLZB 4A7VA 5TJ9A 2ZYTX 4B84A 3ZI0A 2BFNA 1QIFA 5DUJA 1YDPA 2AABL 4I1YA 4RVSA 3PHCA 4P04A 3V34A 4KP7A 1DBWA 2Z0MA 4YL9A 2UYOA 3WGYA 1CD8A 2HOQA 4K9PA 1XVIA 4EUPG 3BDBA 1RPTA 1ZIBA 1G291 5LA6A 4AWAA 4NFSA 5A40E 3IU3A 4LXYA 4R6WA 4Q1AA 2GK2A 4OQNA 4HG4K 2Y1VA 2HO5A 2WTRA 1RZGB 3MRBA 4KO1S 3PDWA 1UOWA 1FFBA 4L23A 1X9HA 1FFXA 2VYNA 5GGYA 4GL4A 4PZ9A 5K0BA 1ADFA 3S5LA 2NVWA 3O2SB 3N40P 2GM9A 1JBQA 3EH5B 1WW3A 4MULA 2VL7A 4YAOA 2F67A 4HFUL 1EPFA 1FFAA 2J3MA 3TKLA 2N75A 3U1QA 4A6YL 2YZMA 1AZVA 1PYDA 3JU3A 3I30X 3LW8A 1NW4A 2BY2A 3AT0A 4DNFA 3SQXA 2Q1YA 3JWDL 5ACZA 5C0GB 3TIXB 1D3CA 1Z75A 3EPJA 2DH5A 2JTYA 1E5XA 2R7NA 3IAFA 1CIVA 1ZA3B 1O58A 2YWYA 3IUEA 1JDSA 2PEYA 3Q2KA 3KE8A 1BCRA 1VHDA 3FNGA 2RSLA 1FVFA 3OWXA 5CDTA 1ZC4A 4AF6A 4PTYA 2W2LA 1OAKH 2G8LA 2OTUA 3PVSA 4GUPA 1J23A 4GMTH 4JHAL 4LF3B 1CQYA 3GJ6A 3QWRD 4CCAA 3PCYA 4A7GA 1WSDA 4IRXA 2PM8A 3M45A 3T7RA 3JWDH 1CL7H 1SUCA 2B61A 4UPVA 4EZEA 4JFFE 2RBLA 3KPSB 5JW4M 5HHQA 4RQQA 4WLFA 4YBHA 1KEUA 5KX5F 5L6MB 1IOZA 2YMXL 4ZVTA 1AFVL 1ENYA 2MSNA 1J5OH 4TYMA 5GGQH 4J1UB 2ZPTX 5TDHA 1H3EA 2QZ5A 4WNYA 3VGFA 1R74A 3FF8A 3HC0A 3FHOA 4LSGA 3O45B 4P2RA 3CH6A 3CLUC 4ZS6D 2IOHA 4GR5A 3BUBA 4MX8A 4AMKH 2JD2A 1U92A 1RPNA 3O3AB 3FKSD 3SY8A 1IIKA 3AFNA 5AJWA 3PYLA 1LGVA 2DRIA 3V80A 4M60A 1N6KA 4R7VA 1J5CA 3FVRA 3PXEA 4QJ5A 3I37X 1DFBH 3QR2A 5HP4A 1FFOB 3R40A 1BC5A 4M7KL 5ALVA 3A31A 3E1SA 4P31A 4QFCA 3QXDB 1QQ5A 4R26L 3K1AB 1Q0QA 1W4ZA 1A1OB 4I85A 2C9SA 1NLDH 2WZAA 5C86A 3MC0A 1PLLA 1VQ1A 1GYVA 3AQZA 5SX5K 1RAAA 2UZ0A 3MREA 2H1LA 1DQJB 4YRMA 3KTAB 4XIGS 5DA4A 1S8OA 3I9KA 1PU2A 2F3QA 4G2TA 3WGJA 3DX4A 4FS0A 2VCYA 4KI5F 3BXEA 3D7LA 2KDGA 2XYCA 4DV0B 4KRXA 1EAMA 4P48A 2WSLA 5B1SA 2C2ZA 1BEEA 5ECYA 5JAQA 1PFWA 5EIBC 4P05A 2FN4A 5SZHB 1A0QL 2FETA 2D6FA 4PJXA 4JGUA 1ONNA 4K6OA 1C3XA 3W5DA 4K5LA 4LXIA 1X9LA 2RGGA 3IXMA 4X6DA 4JV5B 4P4RB 2VN8A 1BP3B 1T5XA 4EFKA 2DTEA 1CXFA 4G3YL 3L49A 3IUJA 4MWBA 5AJZA 4H8WC 3GMTA 3FB7B 4QVKA 1GZ3A 3D4LA 5LUAA 3UV6A 2XXMB 4DMMA 2ZUUA 1C8LA 5PNTA 4AL4A 2V2XA 1TO5A 3FOEC 2GSGA 1OP4A 2D7JA 5E2IA 1Y4SA 4NU0A 5IXJA 3EQ8A 5BN4B 4MGHA 5ADUS 3DKRA 4UOZA 3KBBA 1LO2H 1OXYA 1LK2A 1M72A 1GUYA 3WQSB 1UQRA 3NRFA 3C9NA 5B3JC 3B12A 1SXIA 4PY7B 3G7NA 4X24A 3GFGA 3NLLA 1M7XA 5EZQA 4ASUD 1E4JA 3DPDA 3IPBA 3ET9F 2LU7A 4LHWA 3MNMA 2WKRA 3ZJYA 3H9SA 1LSJA 3SDDB 5J4MA 4IBSA 1P84K 4L4VD 2HG5B 1OWRM 3DC2A 3OPYI 4QAQA 4F37K 2HHLA 2YMOA 4M02A 3FO0L 3R6LA 4FS3A 4WWNA 2D2VA 3WY2A 2VDWA 3KDSE 3D7PA 5FO0A 4RKFA 4XP4H 1A7QH 1L9MA 3VDRA 3GBNH 1ZI8A 2AEJA 4O02H 2VAXA 4PRYA 3ZZ1A 2ODHA 5C18A 3LS5L 4MYPA 3CZAA 2V6GA 4FXTA 3CFCH 3ER8A 4QGHA 1SB8A 5K6AA 3V46A 3VPSA 1MABA 6LDHA 3GJTA 2ENWA 4YPJA 3X1NA 4KDRA 2W43A 4LDRA 2CPUA 1U1FA 3VNZA 4NB7A 3TX2A 2OL4A 4JU9A 4PRPD 4C01A 1XEAA 3VGAB 4CKZA 3BISA 4XYGA 3M17B 2CXTA 4CT4B 2WRZA 1ECBA 5FUXA 1SZPA 2WU8A 2Q1XA 3UAJD 4OKDA 4INZA 4HXBH 3CDZB 3GJEB 4DW2H 3OX8B 1SXQA 4ZP1A 1T0HB 4JLKA 3MWLA 1DDIA 3OFJA 3PT5A 1YTLA 1OP9A 2VNSA 1NI3A 1U8HA 2HFKA 5EZOH 3L92A 5FTLA 3LLCA 2PUCA 5IJKA 4OOFA 5FW8A 1WSST 4IM8A 2J7PA 2EKBA 5J63A 5BQXA 2BI4A 3P2JA 4P3WA 4K3JB 3THWA 1IGJA 3VQLA 2UYYA 4IVRA 2IYXA 4OCLC 4ZUVB 1NM5C 1A6ZB 4ZVPA 4LVNC 1MFAH 3PJSA 4UTPA 1U5BA 4ZZ2A 2HJKA 2KX7A 4JFAA 2Q2LA 5K2MA 3LRXA 5IB5A 2JGMA 3L3JA 4UM9D 1QKKA 4RDBA 4HIJA 3OP1A 1MX9A 4ANUA 2IIBA 2HNKA 4XMZA 1M6OA 1BMGA 3GROA 1VHWA 1QLWA 1YFZA 2AOXA 5DZSA 2AN9A 1QK4A 3AX6A 2B8NA 3MHPA 2E2WA 4TPRH 4R5XA 4AOFA 5CJQL 5KW9H 1IAOA 3EHEA 3L4BA 1MI5A 1HQYE 5L3QA 5KC9A 1U6AL 1JD9A 2ICWJ 3QYNA 3VDQA 2DWXA 5IOKA 2Z9TA 3SDDC 3FT2B 2ZIXA 3GAAA 4ANKA 4HDNA 2Y7QB 2R25B 4OHPA 4E21A 2D3TA 5HHPB 4NWUH 2DJ5A 1E27A 1DQNA 3TLGA 1U2DA 2KS0A 3O6KH 3AYXB 1QE0A 4NWTL 3UKDA 5DQDL 2YZKA 1BSIA 3DX9A 3AEUA 5CXPA 3BL5A 3IOMA 4OI8A 3SDDA 2A9ML 3KT3A 3D85D 3GP3A 4ZX5A 4P7JA 1REQB 3ZL2A 2BFFB 3VC3A 2MKLC 3B7TA 3GM0A 3DX6B 4O9HL 4OLZL 2WUDA 3FPEA 1WD8A 1SULA 2V4ZA 1AS0A 3PQDA 4JMXA 2YOCA 1JAHA 4JFEB 1ECYA 1O9WA 3DDUA 5TVKA 5ADPL 2DH2A 4DLPA 3DEIA 4LHJB 1Q9OB 4NXKA 3R7WA 3UJJL 4MVYA 2FR0A 1AV6A 3LQYA 3MMEA 1P4UA 4RZSA 4F2WA 1T1YA 2LDBA 3GHYA 4WUUA 4L9LC 3ZV4A 3TBWB 2P27A 4GZLA 3HHSA 1NNUA 4RTNA 4G8DA 4KNWA 1X1CA 1VPWA 1P1HA 1ZVMA 1EJ6A 4Y9EA 4G85A 2AEQH 2HZHA 1IKFH 2Y07L 4EQ6A 3QJ5A 2EVGA 2X9YA 3H9SE 3HB4X 3LT4A 4M1ZA 5A71A 4TROA 5KOHB 4ZMTA 2CHXA 3LH2L 2BGUA 1TUIA 3BAKA 1C1XA 3RVWD 1N2CE 4G0YA 3KPRD 4JJ5A 5HIKA 3NNSA 1U30A 1Z0JA 3DJ9A 3H4VA 3NDZE 4I1VA 3T0DA 2YTZA 4L76A 1HTYA 1N32B 4ENQA 1CPYA 3HYCA 4JJKA 3HE6D 3ETJA 4PG4A 2C5AA 4TMTA 3BSWA 4G1UC 4BKTC 2EC5A 2AJUL 4ARZA 4NJMB 1GA2A 3GMMA 3VJLA 4GXUM 1BD2B 1Y6FA 2J20A 4FZRA 4UTAL 2D8MA 5FYKL 4EEEA 1R0BA 3DZJA 4F71A 3U2SB 3CVOA 4PI2A 1XH2A 4DSZA 2W0PA 2EZ4A 5ILTL 4Z0NA 1IGTB 2WXGA 1CTQA 2G9NA 1QSGA 3LYUA 4G63A 1WEJL 2V6BA 1W8NA 43CAB 1GDHA 5FA4B 3WR5A 3EXLA 1JNJA 1P4IL 3W37A 2JJUA 3TBWA 2ODNA 4N3BA 3K1DA 3BWSA 1M6YA 3GUCA 1NPJA 3LHFA 3UYLA 5BV7B 5GGTA 3GU3A 1HNFA 3MLSH 4ROTA 4MJHA 2AQRA 4JGJA 4E9QA 2B8JA 1E18A 1G3IA 3PWTA 1UFVA 5LWYH 3ZCVA 2NCMA 3ONVA 3NOIA 4IWXA 5IAJA 1GS7A 1IL0A 5J6HA 4ZT2A 2Y7SA 5LZ4A 5A2QA 3TD2A 3V6ZB 5NULA 1EM6A 4KJWC 2AC7A 4GE0A 5J11B 4JDEA 3C5ZB 3WD5L 1KL7A 2CMRL 3AW8A 4Z7WF 5GAJA 4CVWA 3W0WA 2AJXH 1E6CA 3UXHA 4UEWA 4DEWA 3MBEB 3PPVA 2RGCA 2YZ1A 1U3GA 3ARGD 2CLLB 1ZC3A 4CDNA 5I1KH 1IY9A 1R12A 1N0IA 1A88A 3LWDA 4QASA 3IDFA 3MRKA 1DCLA 5IFAL 4HDKB 5EKTA 2ZIEA 3RQSA 4I3GA 4MCHA 2BI7A 5D2LF 4DZRA 2HVJA 4HHGA 5DJAB 1H9VA 1MUJA 2I7OA 3ZDAA 3NGLA 3WAJA 2O20A 2J6EH 4RMWA 2ZCJA 2PUQT 1HZHH 3PITA 2TSAA 2L2QA 1E2NA 4R1LA 1JQ3A 1PJ9A 2BS9A 5GJTL 4AG4H