4UM9B

Crystal structure of alpha v beta 6 with peptide
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
470
structure length
448
Chain Sequence
b'GCALGGTCEDCLLIGPQCAWCRCDTPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVCPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQVNSSKCHNGNGSFQCGVCACHPGPRCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-V
publication title Structural Determinants of Integrin Beta-Subunit Specificity for Latent Tgf-Beta
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 110
structure length 448
sequence length 470
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4um9B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4um9B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4um9B03
1L5GB 4UM9B 2B2XA 1U0NA 4MMYB 1MQ9A 3PPXA 4HQFA 1IJBA 1ZONA 4BJ3A 3ZQKA 3EH2A 2VDOB 5KYXA 2ICAA 3HXQA 2NUTA 3NIDB 4MMXB 3ZDXB 2NUTB 5HJ2A 5KYWA 4NENA 4DMUB 3NIFB 1U8CB 1M10A 4K3JB 4O02A 1XDDA 4HQKA 3K6SA 3ZE2B 1ATZA 5KYUB 1YVRA 3EGDA 1JEQA 2VDQB 1RRKA 1TYEB 1IJKA 1DZIA 4WK2B 3AL8A 2I6SA 4PN7A 3IJEA 3AL9A 4FWWA 1YUKA 1UEXC 3NVQA 3BQNB 5E6SB 4GZ8A 4MMZA 3VI4B 1SHYB 5E6RB 4UM9D 1Q0PA 5KYYA 4Z7OB 2XGGA 3EFOA 1YVPA 4UM8B 3EGDB 1MJNA 1QCYA 1V7PC 1IDN1 3ZDYB 3ZE0B 1N3YA 1N9ZA 5KYNA 3OKWA 1M2VA 2ODQA 3V4PB 3E2MA 4HQOA 5KYXB 4C2BA 5HDBB 5ES4B 4F1JA 3RAGA 3GXBA 4NENB 5KYWB 3EG9A 1M2OA 2VDMB 1JLMA 1AO3A 2M32A 4O02B 3ZDZB 3K6SB 1PCXA 1RD4A 1DGQA 1JEQB 1MQAA 4WJKB 2UZYB 1PT6A 3AL8B 3K71A 1CK4A 3ZE1B 3K71B 4O3TB 4IHKA 1AUQA 1FNSA 1MQ8B 3IJEB 4CN9A 3V4VB 2VDKB 3FCSA 3OL2A 1JEYA 4MMZB 2VC2B 4JDUA 1SSLA 3HI6A 1ZOPA 3EGXA 1OLZA 5KYYB 2XWJI 1MF7A 2IUEA 3EFOB 4NEHB 2WINI 1XUOA 3BN3A 1U0OC 5E6UA 1PD1A 5BV8A 4G1MA 2NUPA 3F78A 3IBSA 4FX5A 2VDNB 4HQLA 1NA5A 4M76B 1JV2A 4WK4B 1M2VB 3M6FA 3PPWA 3TVYA 4F1KA 2XWBF 3K72A 2X5NA 2ADFA 3EG9B 4G1EA 4JX0A 2I91A 1XDGA 2P28A 1SHTX 1M1XA 3QA3E 4HQNA 3VI3B 3N2NA 3FCUB 1L5GA 3TW0A 4MMYA 4C2AA 1LFAA 1MHPA 4WFQA 3FCSB 1RS0A 4Z7NB 1RTKA 3OL2B 2WW8A 4XW2A 4CN8A 1JEYB 3EOAI 3Q3GE 1FE8A 3PPVA 4Z7QB 3EGXB 2P26A 4MMXA 2ODPA 1U8CA 5E6UB 4O3UB 1BHO1 4C29A 5KYUA 4G1MB 3T3PB 1BHQ1 2NUPB 1CQPA 3NIGB 1PD0A 1T0PA 4IXDA 3PPYA 1IDOA 1JV2B 3TCXB 2I6QA 2O7NA 3EOBI 1QC5A 3HXOA 3K72B 3OKYB 1OAKA 1QC5B 4A0QA 4IGIA 2VDLB 4G1EB 1SQ0A 3F74A 5LN1A 1AOXA 1T6BY 4WK0B 1ZOOA 2VDPB 3BQMB 5E6SA 3TXAA 5E6RA 1M1XB 1M1UA 2NVOA 2QTVA 3T3MB 2VDRB 1SHUX 4CNBA 3EH1A 3AFCA 5HGJA
chains in the Genus database with same CATH superfamily
2HJSA 1FJXA 3RWEB 1YEIH 3LW7A 4Y9CA 2FVYA 3OURA 5E51A 3HY6A 4NERA 3NIDB 2D1TA 1Z4JA 3KHKA 2FWSA 4GKLA 1KA9H 1ZLVH 4QDGA 5FA4B 3DOUA 3DOFA 5AW4B 2NT0A 4EITA 3GLGA 3FAKA 3MJ9H 4JG1L 5LQBL 3QEQE 4B45A 1T9BA 4MCZA 1L5MA 1IAIM 1NVAA 3DSNB 4OLVH 4IJ6A 1MNUL 1D6JA 1FY2A 4NMWA 5DCUA 4GO1A 1R9GA 3W3ZB 3WKEA 4CEHA 1L4BA 5DK2A 1Q14A 4JFED 5JCZA 1YZUA 2C42A 2MWCA 2R66A 5CSBA 5DJ0A 1H15A 1OAXH 3PL6B 4XP4L 4V33A 3NFNB 3VE0B 4G8GE 1CQZA 3L6RA 1QKKA 2OLJA 2IBBA 2OYLA 3UANA 5HGHA 1RSYA 4KXUA 4IFIA 3K7UA 3DETC 2CL5A 5EFZA 1FJ1A 3RF7A 4C7MA 5F6IB 2R7EB 4WUTA 1IKNC 4P46B 2AT1A 4IU2A 4DV5B 5BNZA 1HEUA 1G5HA 4TZ6A 5CJBA 3G6DH 1CP2A 3VR6D 1L5NA 4C58B 3A2MA 3ZIAA 1EP2B 1X6LA 2V6HA 1Q15A 2PRKA 4MA3B 4ZAKB 1QO3B 3HFML 2D00A 1YB5A 1NXTA 2X7XA 4QUHA 4E33A 2Z31A 5BXQC 5LAXA 4F7DA 3SDCC 4Y1AD 3LHKA 4FD2A 3LIUA 4PJ5A 4OCXH 4U5XA 5CGYC 2YPLB 2QPTA 2Z2KA 1WTGT 3VGHA 4MKRA 1FFBA 5A4KA 3PFBA 1RWOA 3ELQA 1WCYA 2R8RA 4G23A 1YNTF 3TBSB 4KWEA 1RZKL 1NJGA 3EQ8A 1EGMB 3PUYA 2CJPA 2I66A 4IIJB 1IUKA 2Q7OE 3SMQA 2Z5LA 4X9XA 4AQ1C 3W0WA 4J6EA 2PXYA 4MI3A 2FLWA 1PNVA 5IOPA 5KTEL 5C0EB 1CFBA 1I3VA 1ZGLM 4N2KA 4AK1A 1RQXA 4FFZL 4C01A 1TU0A 4MUJA 1I8IB 4M5YL 3HJNA 3VFMB 1T3LA 4NX2A 4BQQA 4B3JA 4HDKB 4O58H 4E9XA 3VYWA 1A69A 2GTQA 1AQKH 1F56A 2QK4A 3HC7A 5SY6A 1E2MA 1UXHA 1HZHL 4OFKA 1J0AA 4FC3E 2QPDB 5CGBA 4HIIB 3MINB 2YO3A 4HWBA 1MB9A 4MVBC 4F56A 5JAUA 1YRBA 3MYZA 2JV6A 4KBPA 4GWLA 1CLZL 1U63A 3C6EA 2F43B 4NWIA 5AZUA 5DUBB 2JFQA 3FNEA 4EB6A 1QRTA 1V35A 1KF9B 5KZMB 1ACZA 4MAUH 2EYUA 1QKIA 4RMJA 1CSEE 1LQUA 1QO7A 3PQCA 5P21A 5C8JA 2WZ5A 1PYWB 4MQ7B 1ZOLA 5AIAA 5GS1B 2BC4A 4WO4B 1QE5A 4MXVF 1BKDR 4JQIA 1B8NA 2RG7A 5CEXA 2XLBA 4BNGA 3Q2WA 1FFAA 4RZCA 1UWEH 3CU5A 1OGIA 3DMGA 4NUGL 5L2JB 3U1SH 4Y6LA 3T2LA 2GHIA 4ND7A 3LECA 1HILB 3DQPA 3KBPA 1XC7A 3IEXA 1U2HA 4XI9A 1W72A 3CFMA 4DDKA 1XL1A 1P4BL 4X6LA 4LDAA 2XA8L 3BO8B 4N2GA 2EQDA 1Z06A 3V10A 4GG8A 2EO9A 3BT2L 4FFPA 4Y9FA 2WQVA 2W71A 3LQZA 2UYCA 3GB7B 1P4HA 1XEWX 3RKUA 1KYFA 4Q7QA 4ZSOB 3LXRA 4OHXA 3UMCA 4DBZA 3OSZA 5DS1A 1YDGA 4P2OA 1OZAA 1NEPA 4YAQA 3CHQA 1MKFA 1Y4SA 2W38A 2NPFA 1E2JA 1NDHA 4OP2A 4RMIA 2KERA 3X13A 4EG8A 4ODXA 2OJ1A 2DWSA 4IX1A 1HHKB 1MDFA 2DWPA 1MHHB 2EDKA 3Q3GB 1L1EA 3NXSA 1OJLA 5KCMA 3N70A 1P7KB 1JIBA 4I18A 2PL9A 4E41A 4DJJA 1J5DA 2V9RA 2V7NA 3B7YA 3LRMA 1FG2B 1KSHA 1U9ZA 2WDZA 1RI1A 3DF9A 2CNBA 3A6KA 3AF4A 1EAPB 3NIDE 2JJSC 4QXUL 2HB0A 1WDMA 1JQEA 1COBA 3STTA 2WB2A 4FL4C 2H2WA 4BVBA 4M5ZH 4OHBA 1U8TA 1O2DA 3L3IB 3LPWA 2W6JD 4MB4A 2QRHA 3V6FA 4CIYA 3O6LL 3MYJA 2HWWA 2VITA 2XWTA 1U3VA 5JQIB 3CLUC 4KDWA 4MJIB 1U2GA 2YDYA 1V9CA 4A7GF 4MMZC 3DZHA 1PQZA 3IUBA 3EYWA 2OSYA 2M6LA 3T6VA 2C03A 4U33A 3ULUH 1M7BA 1IB5A 2XX1A 1E2UA 1T03L 3KYDA 1P60A 4YNBA 4WHYH 4HWSA 1EVKA 2E75C 5IV2A 2YGNA 5GPBA 3RIYA 3QIBB 4LF3B 2LLGA 4W8OA 2ORVA 3B6MA 4GRLC 2E1PA 1FS4A 3WXVH 4FEYA 3OLXA 3BFPA 2W2PA 3PJGA 3KGTA 4K6HA 4FLHA 2PQ0A 1ABEA 4ISBA 4G1EA 4NWTL 3E3QC 2XNJA 1SHTX 5HHOA 1OGAE 2P5TB 5I48A 3GJFB 4WFED 4OQTH 4JN1H 2M2DA 2CM5A 2L0XA 1V96A 4IYRA 3R0VA 4OBXA 3IEVA 4ZVLA 3KTAB 1KIPB 4HDIB 4NH4A 3BN9D 4TVPE 1PR5A 1R4AA 5EG5A 3V5DB 2RH8A 4YP7A 2JH3A 4ODVL 2D31B 4XPAH 3KT6A 4O29A 3B7WA 4CQLA 1XSIA 5CDYA 4ERXA 1TLLA 3E6HA 1IATA 2CFRA 3Q8MA 4EVSA 4M7KL 5EE3A 2NNLD 2RKWA 3T0XA 2YPLE 3A0UA 4NF2A 4NYMR 2HMWA 1HXYB 4AD8A 4TV9F 1CD1A 3C5ZA 3VNAA 5CH5A 2UYYA 1FLRH 5D72H 3CXDL 4NO3B 1YF3A 1SOUA 2J0UB 1P72A 2HSDA 2GTZA 3VB8A 3PJNA 1P1ZA 1X13A 2DJMA 3C45A 3O4LA 1TA0A 3KR2A 3GVIA 1OAQH 1PKQB 4X4YB 2ZONA 2IDUA 3GUCA 4XCYB 2APVA 5EEGA 2HCZX 3AXLB 3BUQA 5IMBA 4M43L 3OFKA 3AVXA 5F0LB 3FBWA 3FT0A 4HFJA 1PRYA 1Y18A 1SB8A 1Y1UA 3A28A 2HJWA 3O2JA 4X8CA 2QJTA 3FHJA 3U5ZB 1F8UA 2AP2A 3S2GA 1VSVA 4AZVA 1J25A 1E7YA 2W9DL 4MINA 3JWGA 1UB6A 2LTQC 2MPVA 1K5HA 1IGTB 4WW2F 1XHFA 5CLIA 2JGEA 2NY6B 1LNUB 4INJA 2P9CA 4A2DA 1GNPA 2QADC 1LQBC 4R5TA 3U26A 4F9FA 1RFDL 1HOCA 1XQ6A 5AVWA 5KX5B 4PEVA 5HKKD 3JWNC 3WE7A 3I3OA 1C8BA 4G7VH 3A6CH 4LU5L 5HVWA 3M70A 1HI6A 3BP6A 2YH2A 1O75A 3P4LA 1RXIA 4TSRA 3RKSA 3NOXA 3M6XA 3W9YA 4KMLB 4LI0A 3NFYA 1B0UA 2XY4A 2XA3A 4RSHA 1K6EA 3KETA 3IMGA 5FKJA 1TZBA 4OTZA 3MREA 4ONHA 2WLLB 4OCRH 5EIVA 1QYRA 1U8HA 3HCCA 4GT0A 4WRRA 1HTYA 3FWZA 4JJAA 2XY2A 5TF1H 1TTRA 4KR3A 4X5LA 2VNIA 4NO0B 5AQ0A 1MRCL 2WYOA 3Q2LA 1KE2A 3U7YL 1BXKA 2FPIB 4B4OA 1T0PB 2V17H 5HD8D 4BAZA 3BP4B 2P4AB 1VLZA 5BS0A 3Q7PA 5L40A 3QHFL 3ZJUA 2WVHA 3TQCA 1E6MA 1T5OA 5FW8A 3HSYA 5MN4A 4PP1D 1L5YA 1G7IA 1MFBL 3UICA 4LOHA 5JHHB 1AMUA 6REQB 3JQAD 1G66A 1Y0LB 1N5RA 1NURA 4MNTA 1O89A 1QEWB 3L9EA 2BBOA 2XICA 3HN5A 1U5BB 4DOMA 5KSAB 2PWZA 3QJQB 3BUBA 5LO7A 3NBAA 3N75A 1XB3A 2E37A 5CN1A 4L73A 5H80A 1WPCA 3QR2A 4H0HB 2H5LA 1LS1A 1LO0H 1HC7A 1IAKA 2FPPB 4LCVA 5ETJA 1I9RH 3MC1A 4QRQB 4PJAE 3KWMA 4FKEA 5BUGA 3QUMH 1IY2A 1WZNA 4QTFA 2ZYDA 2L4OA 5EJ7A 4YRPA 5FK9A 2FSHA 3LGAA 4NMHA 1J7VR 4PWZA 3PR3A 4K5MA 3GNTA 4OZHF 3F85A 4KKAD 2EBUA 1JAXA 3Q3GE 1AQDA 1NSNH 4J90A 5CVVA 3HCFA 4LSGA 3C5WP 1A3RL 2IYZA 2AF3C 4JE0A 3WLPA 5BUQA 1GQFA 1R9MA 3PF9A 3UAFA 1MFDL 4TX1A 2E27L 3O03A 4MROA 5LOVB 4UTAA 3WENA 2XX3A 3UTQB 4ADGA 2A67A 4DKXA 3SDCA 3D1MC 1Z22A 1M8JA 5LB1A 2Y1OA 4MJIE 4S1OA 4ZAFA 2YMXH 5JXAH 5PAZA 3ZCXA 2YCLA 3AU0A 5DJ2B 1FL5B 2HQRA 4FMDB 4BQIA 3BEVA 5EJFA 3ZOKA 1RI2A 3PIQA 3S96A 3BYYA 3SJZA 4JPKL 1JYFA 4B4WA 5IOKA 3SQRA 3GFFA 1LE9B 4MGYR 4YSSA 3OKEA 1Z2AA 4XHJC 1Y7IA 2G76A 5FHBH 4MUIA 1LLFA 1T7XA 3LKDA 1NOJA 1D8TA 1SOXA 2VDRH 5BT9A 2NSMA 4AQ1A 1LK2A 2XW6A 3SQXA 4K7FA 2JASA 3R7LA 3NHAA 4IEEA 1HDXA 4R8VA 1R4NB 2VHWA 4DB2A 4NQDA 4HK0B 4KVCH 4B3VA 4LBWA 4LPSA 4F7WA 5CKAA 3TZHA 3RI5K 1U2TA 1BX1A 2Z93B 1K2DB 1BD2B 1ESEA 1QG4A 1DVFC 5D1QC 5EUKB 4R0VA 2D5BA 4XPIB 2OSVA 4DETA 2EFEB 5EGSA 1AKJD 3BH9B 4P5KA 1OFUX 5D6OA 3RARA 5M29A 1BNCA 4G8IA 1VGVA 1KZ6A 2WDPA 2YFHA 3GS7A 1AKEA 3GA0A 3I2FA 4Z0TA 1V8FA 2J3DA 1Z37A 4ABUA 2AG1A 1A22B 3WDKA 4DIEA 5EWJA 2BE9A 1UP4A 1KEUA 4MQ5A 5B1EA 5BUSA 3PU6A 3UCFA 2VJMB 2JTDA 1CUUA 4BKTC 4CGUB 3LX8A 4F7CA 2FZCA 3EXG2 1WUYA 4KROD 1BFOB 5FV7A 4DLXA 3S3TA 3AZOA 5EMNA 1JR3A 2ARWA 2C8JA 4WUKL 3QF4B 5C2JB 1UVQB 1CK0L 4ZTUB 5HF8A 2EE6A 2YS6A 4J0FA 3E1F1 3K9BA 1YSOA 1JJ7A 3BKCH 2DD8L 2B1GA 3MV9A 3PHLA 2DH6A 1PKQE 4EY5A 1RLJA 5HF9A 2UYQA 4UU9B 2IADA 4M49A 4DZRA 2J0EA 4MXQC 4TSAH 4ZYYA 1JZSA 4J8RA 5CIYA 3K8MA 3LKOB 2FGWL 1CULC 2FD6H 3UO1H 4TS6A 3WEBA 2V1XA 5J6HB 5I8WA 2MIIA 3PRYA 5JW5A 3MTGA 1X87A 3OMNB 2R27A 3X1KA 3R7WA 4J1TA 1ZX1A 1Z2DA 2FFJA 1MD9A 1OUMA 3C3JA 1XOIA 5HQ3B 3B2UD 3NCYS 5I1JH 4PFSA 1U28C 3BHBA 1JK9A 5J3HC 1VKOA 3U7JA 3F00A 2Z3ZA 2CDGA 4U3SA 4A6YH 4K1LA 4GOJA 3ALPA 3VXNB 4FG4A 3MLUL 1DQJA 2QPOA 3S1AB 3LE8A 4FYVA 1HM5A 3D3VA 2WR8A 5DYNA 4AMZA 3AXSA 4IKNA 2FEOA 4TWRA 3LH9A 3ZWXA 1FI8C 2NPLX 1CLUA 3GARA 4F7TB 1O6FA 3L5KA 5EEVA 1UA6L 3L8GA 4A0FA 4URXR 2HR1A 5FM8A 2RONA 2CR3A 3VX4A 1CQKA 3THXB 2R15A 1Z5WA 2AOUB 3BD5A 3QNYA 1N2OA 5T4BA 1MF2L 1TD9A 3B6EA 1T66C 3AF5A 4U9IS 1JA9A 1COZA 3FTSA 1X5XA 1KLGA 2YR3A 1QGDA 4L8FA 1ISFA 1XNRB 4OAWB 1B8VA 4MS4B 3GRYA 4MMZA 4FP9A 3GFVA 3FSZA 3UROR 3O90A 4PR5B 3UC9A 2F00A 4Q1AA 5DBIA 2A0FA 3VX3A 4WKNA 2VWHA 3NAAL 1SR8A 1AQUA 2RD2A 4KSYA 3MBEB 3B5GA 1T0MB 3IBGA 4DGSA 2B30A 4K9PA 4ZT2A 4FTDA 3ZWDA 2R59A 3WLFA 2VMJA 3BT0A 4L8SA 1FDOA 3P77A 4XDHA 4LPUA 4R26L 3IAM6 3V79C 3HI6A 2IVFC 4NQSA 1E27A 1I7TB 2B2CA 2O7VA 1MVOA 1B2WH 1KIRB 4H8WC 3A6EA 1KI9A 3GCDA 1KN2H 3HG3A 1UD5A 1P4IL 1GPH1 5TGZA 3EPLA 3SDDB 1WSWA 2WV7A 4FGSA 1CFQA 3FZUD 1LO2L 1N3LA 3NRQA 2X4RB 3UTSB 3BH6A 3ZJAA 2OFWA 3LQAC 4P0PB 1LO4H 2Q3DA 1QE3A 3OQPA 3CKYA 4GZ5A 3VFNA 3MAAC 2HDWA 4DNFA 5MDHA 1WPQA 3F6SA 4D0NA 1ND0B 2HJRA 4J0CA 3HLTA 4G9FA 1Y1QA 1J4AA 4V24A 1D9KD 3UOAB 4A04A 1BHGA 5DSCA 3IDFA 1C1EL 4MLPA 3RWJA 3VSTA 1X80A 3WB1A 1WKBA 4BIKA 3CN3A 3U36A 3GBLA 4JOSA 1I4WA 3EK2A 2DWCA 3U6BA 4I5BB 3EXHB 5EUQB 2ANCA 3AU1B 1VZHA 4C0HA 4ABTA 2B8NA 2IMMA 3RI5F 4PJ9A 3A4AA 2B1HL 2K6WA 3IJ9A 4PU2A 1IC5H 1AHHA 1ODSA 4CIDA 1HVXA 1FNMA 3O0TA 3F7YB 3HBJA 2PN1A 1WCBB 1WB6A 3OJCA 2QBYB 1J1UA 3A27A 2GJ4A 1BH6A 1XA4A 4EI2A 1T1YB 4WBNA 3AQ4A 5BQ5A 2BWJA 3NIGF 3GOHA 3QQXA 2ZKHL 3HDTA 4M61B 2QQLL 3US9A 2WYUA 3ORJA 4F46A 3N87A 3E3NA 5D1XC 3QQNA 3VYUB 4JRYA 4APQC 2D54A 2YOAA 4HH9B 4PJHA 1EX1A 2DWDA 4P57A 1YCGA 4QRSA 4FGZA 1B76A 1VGEH 3T8YA 2CNYA 1QZ3A 2DLEA 4LMPA 1A9TA 3MGCA 1VIAA 4ADIA 2Q4BA 5D1NA 4X20A 5AVUB 1B16A 3IKKA 2CV1A 4N01A 2F18A 1KCUH 4NKDB 1ITZA 1N6KA 3CVDA 4YJ3F 4X44A 4ZXPA 4DK3A 1WM1A 2GDJA 3SSOA 3BWUC 5AKRA 3U2IA 8OHMA 3U44A 5CAEA 3EXG1 3MJ7B 1YQEA 5CCEA 2EEXA 2FL5A 2VYVA 3VI3F 3R18A 3D9AH 3EYQD 1NQUA 1FH5L 2C8LA 2Y0SA 1FL3A 4WK6A 5IC4A 4PRPD 3GGDA 1KNXA 4KV5F 1S9WA 2JAXA 3A9WA 1CU4L 1QHNA 2FPKA 3QW2A 4PLGA 2BNUB 4DIFA 4TPRH 5JUEL 4CEJA 3QCVL 2FAUA 4QRPB 3FAXA 4RJKA 1IU1A 3HNTL 4IGFA 5EHGA 5IARA 1JAZA 1BWQA 3JVUA 3FGOA 4P5RA 1LSUA 3BSZA 3QLTA 3C3MA 1I3RA 2ZWNA 3RAGA 2E8ZA 1WV1A 4NKIH 2QT6A 4H6VA 3OGOE 1X7QA 3WO1A 1Y6JA 2YWBA 1R18A 5CT8A 1ERNA 4JO4L 5KTOA 4LSQL 2AQ8A 2BM1A 1CFVH 4B3XA 2BZCA 3LQKA 2VTBA 1Z38A 4X7CC 1NUUA 2GN4A 5FO0A 1N70A 1I7PA 3FJOA 3G88A 4NPYB 2Q4TA 3MS2A 2OLKA 1P1HA 2VC2L 3AXHA 3H1FA 5DMHA 1BAPA 3B9BA 1UDXA 5ERXA 2IBGA 1GOTA 3P0RA 1KOJA 2FZWA 2CNNA 5BP7A 1GO2A 2BOVA 2P9ZA 2EKSB 3V2HA 4MDIB 4BRJA 4QRAA 4JLAA 1R3KA 3V52L 1WR8A 3GGCA 3QDAA 3KR0A 3L13A 2BDTA 2X2IA 1SM3H 5DHYA 3KLAA 4RX4A 3IELA 3TA3C 4IMIB 2J6CA 5IW6A 1RJDA 1GTL1 3U7FB 3U9UA 1K8IA 5AW7B 3HKZA 4FQHA 1F0KA 2H52A 4FQXC 1CGXA 1F4HA 4DMHA 4C56A 2A2ZA 5DYGA 1L5OA 2PBLA 1N12A 2Q3LA 3EVAA 4A8JB 4OIBA 5LDSA 3UYRH 3CPJB 2WUFA 3BXZA 1D3CA 1CCZA 2AJCA 3I53A 5EU7C 2C1OB 4LNHA 1Z0SA 1KEEB 4XCVA 5LDUA 4F84A 3ZZQA 4N2EA 2X89D 1AU9A 3JQEA 1XTVA 3UYLA 2ZXQA 3FE2A 3VHXA 4OYHA 3QR1A 1T8UA 1Q0ZA 4DDUA 1UA3A 3FUTA 5KSBE 5FWAA 2I9LB 4E41E 3QXAA 1UWXH 1YACA 4QXOA 2X4PA 5DTJA 3GMRB 1Z4LA 3C7CB 1A97A 4Z7AA 2HFEB 1ARZA 3UGJA 1KI3A 3L4KA 4E0RB 10MHA 1GYCA 5REQA 2Z64C 3GS4A 5EOTA 3REQA 4KH9A 2V5MA 2G4GA 4CV1A 5I7EA 1DVFA 1HZZC 4F7EB 2B4CH 4XN5A 2W07B 1DQML 3CE1A 5ENDA 3GA7A 5IQ7H 3OJLA 1B0ZA 3GPEA 4MGIR 3OCJA 4ZOLA 4DSAA 3D85A 3R9XB 4JFDD 5ICYA 2BFCB 4NJMA 3P2IA 1KDPA 4GI9A 3NV9A 2AZDA 4HZLA 3ACBA 2JMRA 3TT1L 4JYBA 5MF6A 5AKIA 1AACA 4HV8A 2BEWB 2FN8A 2PGDA 4M1YA 3QXVA 3FQXA 1ILSA 3IJPA 4U1MB 3T3MB 1CTNA 3PNOA 3TO5A 3LWNA 5HZKA 3NP9A 3DGFC 4RD6A 4FDMA 4EI7A 3VSCA 4LOFA 4U4AA 3BH8A 1I8KA 3SBWC 3KWVA 1SXPA 1SJEB 5HHOE 1QPGA 5HS4A 3N0PB 5E0QA 4OBEA 4GS7C 4J75A 1JMYA 5ERWA 3SE8L 5JOEA 2Q9CA 2QZQA 4XWAA 1KEML 3TO4B 4FP8L 3J7TA 4ZFZB 4RF2A 5T4HA 3UT5A 2QGZA 3OX1A 3WJMB 1G5PA 4G3YH 1MI5D 3ZDRA 2BFMA 3P02A 2JA2A 2GM4A 4QGFA 4EKEA 4CU8A 1V5JA 3EDMA 2QLBA 3T99A 1IHOA 2P79A 4ZUSB 4G8CA 5K4HA 4KQWA 1U28A 4HVAA 1Y33E 1FRGH 1I1AA 2DL2A 5I2IA 4UI2A 1JDZA 1VHWA 4RCZA 5I16B 3DFUA 1F7UA 2BIOA 3IRZA 3V8MA 3WMXA 1DBRA 1EG2A 1EVZA 1X1AA 4QGSA 3O4LE 1RCUA 4UOJA 5DTIA 1VCOA 5C0JB 3JRXA 4PCVA 4XD2A 1GGCH 1KJ9A 1O5OA 1B88A 3ZGVA 3KSDO 3DXZA 3QXDB 1X4YA 3O3CA 4XNUL 4RIIA 1POXA 1WBYB 2Q5BA 3HHRB 4XCFL 3V97A 2GB4A 4KAXA 3IAEA 4AYXA 5CLYA 3HYCA 2OFPA 3DUHA 5JHLH 3NBYC 3HR6A 1Q19A 1WVIA 3OHXC 4EB8A 3TFKC 4L4ZA 2BSCA 1E3WA 2WJHA 2B99A 3PWNB 3AXTA 2D3TA 4XNBA 1GU1A 2MYNA 5BRNA 1L4YA 4WXMA 3BM5A 5EYPA 1XA0A 2M98A 4MRAA 2ZZUT 2DCMA 1OSPH 2CE2X 4U2BA 5H82A 3WWOA 2DICA 3RE0A 3RPIB 2JKWA 5FUOL 3QUZB 1YQUA 2DMKA 3OLZA 3L7JA 2NVWA 3JZDA 4DMFA 3U13A 5BN3B 1ZXLA 2EJWA 2BOBB 1UEIA 4DUVA 1Y6MR 1MV8A 3A6BH 4IBUA 2R1TB 5FWNA 2JI2A 3KYKL 1ZBQA 4GXQA 1SY6L 3BZBA 1R66A 3CZLA 1WUZA 2JAUA 4LTMA 3OXSA 1MC8A 2VISA 3ARGA 2IZ0A 2NXNA 2D7NA 2DOKA 2HMVA 4MEAA 1BCSB 3EHBB 2IVFA 3ESRA 4C21A 4WTZA 2HBRA 3BIJA 1NNUA 5I4BA 3SY6A 5LYJA 5BSRA 2MOKA 3RS3A 4U3XA 5E9DA 1HWGB 2BP3A 1JDTA 1A8SA 3OAYK 1WJ3A 2J12B 4U3HA 3ILVA 2GUWA 5SY9A 3NZSA 1O7SA 3BJIC 4W82A 4NCIA 2ZAOA 2I3AA 3IOCA 5ALLA 4P4KA 3CFEB 5K0ZA 5T3XD 1RPUA 4M7JH 4DFIA 3D8NA 2G04A 4NIYE 5BSHA 1N77A 3A05A 1TMYA 4L5CA 3OZRA 5E9AA 4YFLI 32C2B 4M53A 4PPYA 4KBFA 1ZV2A 3O31A 5DXWA 5IM7B 1XYYA 4K81B 1EE9A 2B1IA 1SVNA 2E89A 4YVUA 5AW8A 4QWMA 1EHLL 3I6GA 4LYFA 4YMVA 2FQGA 3FTNA 1X1BA 4L8DB 4DCOA 3VNUA 1JF1A 1NW7A 1OB0A 6PFKA 5IS2A 2MQ3A 3ME5A 3NVAA 5F2KA 1TTPB 1RZ7H 3L0CA 4JKWA 4XP6L 3IP8A 1JWMB 4MJ2A 3WIIH 2XNCA 1M7DB 2VLIA 3UXYA 1QH8A 2FW0A 1YHNA 2WHXA 3DJYA 3O4OB 4IIXA 3FU9A 5TE6H 4BLSA 3ARFB 1AKUA 4YAJA 4LLUA 3OJVC 3WLJA 4R97C 3H8SA 1XF2A 4LYAA 4S2UA 3F6LA 3KUDA 1Y1KE 4QLAA 5D1XA 2C8KA 4IO1A 1LEKA 1QANA 1VJSA 4EFDA 4APQA 3CH1A 3X3FH 5F7JA 3ZRCC 2IXBA 3AH8A 5KDLA 3ND9A 4KK9C 1YA5A 5BVGB 1EEUA 3AL2A 3ITDA 1WD7A 2HX8A 2DLHA 1ZK9A 4PONA 3IMSA 1IXZA 1Z5GA 3GHBH 4AY3A 1USZA 2BIMA 3C6LB 3HE7D 4ANKA 4LV8B 3DULA 2O2HA 4GG6B 3DMDA 3ZLJA 2FAXA 3VO9A 1R00A 2G28A 4QEZA 5J4LA 1EVUA 5KOJB 1JZIA 3T3ME 4TLUA 5L51A 1CJKC 1UM6L 4NQDE 2QRPA 1LPSA 4HWZB 2GKIA 5F1OA 3PNRB 1Q12A 4URZR 2ZCKH 4JPIA 1FDUA 4BGDA 1EFCA 1Q84A 1AQMA 2VLRB 3L79A 1IULA 1RZVA 5DWQA 4XQEA 3KVRA 2Q46A 4F6RB 4MKHA 1HSBA 5IGXL 2K4AA 1NL0H 3DX7B 3ROTA 1DAOA 1TOXA 3GDBA 3RZCB 5GJSL 3RFTA 4C2TA 5AVSA 1KQOA 1N5AB 1IG0A 3DYBA 1T0JB 4Y1FA 1E3SA 1KPRA 2NXEA 1XRJA 4DVGA 4D44A 3GT7A 1JF8A 3FTDA 3V6OA 2O8VA 2PMWB 1CDEA 5CTJA 4MAZA 1HR0B 3AM4A 4DGIL 1UXMA 5IVHA 2HRLA 2LU5A 2PLFA 4KE8A 1EKXA 3T7SA 2YGOA 3TRKA 3BE1H 1Z35A 1CUGA 1YHPA 3V95A 2C9XA 521PA 1YXMA 3H1PA 1EX0A 3CEHA 3FRJA 3BX7C 1NIAA 5DLML 3GZNB 3MMEB 2FETA 2XJKA 1GUAA 3MV9E 2DRIA 3VFPA 3QORD 1NKVA 1E1QD 3WAKA 1JEYB 3QEUA 3AQDA 3RX8A 4ABQA 3CVCA 1FVCA 3KD3A 3N1PC 3CUWA 4PREB 4LZAA 2BTOA 3PUHA 3EJQA 4DV1B 5HY9A 4JREC 4MA1C 1FRNA 1B6UA 5JSYA 4GRMB 4QHLB 3MA7B 3N2GB 4M1DH 5K0SA 3TA3A 1E98A 2PGAA 4RMNA 4ZPXA 2PXCA 4K3EH 5TQ0H 4FQXA 4B76A 1YQWA 2DYPD 4YC2B 4IHJA 1FIEA 2QVCA 4K2UL 1AD2A 2B3RA 1BN7A 4DRXB 3BSWA 5I73B 2O23A 5FW7A 4F2MA 2J1ZA 2EKPA 1KO7A 1T7WA 4AYSA 5K0EA 4Y4HD 4WD3A 4X6UA 2SBTA 3N2KA 3CYFA 2ZTVA 4RIRA 5ELLA 1GSHA 5B7QA 4U1KB 4OQPA 4CC1A 4M1ZA 2W4QA 5ETUB 4BNDB 2ENPA 1YBAA 3HZMA 1MRFH 2HUNA 4IHKA 4TYYA 3KPQB 5J4YA 4RC9A 1WFNA 2QMUA 5LBSL 3MOAL 4YHZH 4PZ0A 3E58A 5E99H 5JAZA 2JGKA 3TN0C 2SKEA 3OEEA 1KEVA 5K51A 1HZZA 4BCZA 1RVDA 4IHOA 2QNIA 4DOHE 5JNSA 3TUIC 5JHMA 3DC7A 2WK2A 4JRFA 5BOJA 4PJDF 5GXBB 4GH5A 2ZUQC 1O8BA 1FIGH 2IY8A 3W2EA 3GFGA 3D4BA 1VTKA 1HHHA 6NULA 1MCDA 3VRLE 4OLJA 4XB7A 1ZKMA 1LNQA 5C7YA 5ESAA 1CB0A 3C7TA 5AI8A 3SCMD 4QGHA 3RB5A 4KKXB 1RW4A 3AY7A 1IK6A 3S29A 3KG2A 2IAMB 3AW9A 3VRHA 1QFPA 3RUGE 2I6TA 2AN1A 2ZGVA 2L7UA 1TO2E 3LLUA 1MABB 3BKYL 3V9AA 2P5WD 5CJQL 3SLKA 3T6QC 1EI9A 1G7JA 2QW8A 4OIMA 1ZEAH 3GMNB 5HSGA 3OKOB 5GJVC 4J23A 5GISH 2RCSL 1OGPA 1V8PA 1A2YB 3LYHA 3SPIA 4NOLA 5AJWA 3T0GA 2DQUH 1HEJC 3G6KA 3Q01A 2QZZA 3PNYA 5GM1A 4ZGGA 3A7EA 3VWKB 1PGOA 4MCNA 1KPUB 4LRIC 1KMGA 4X6YA 4RVFA 1QSVA 2XI9A 1A7JA 3FZQA 4L6AA 1PTKA 6ADHA 4G9FE 1JFTA 4GZ3A 3SE3A 4H31A 3HE6B 1FZJA 1MX9A 1T5BA 4JUFA 2VR3A 2WAOA 5U1PA 4TTAA 1ZUWA 5DFVD 4XVSL 2R87A 1KY3A 5LQDA 3QK7A 1KIMA 4MRPA 2JB6B 4OJFH 3E9EA 1QO9A 2WUEA 3RAEC 3P1VA 3SQBB 4YXWA 2VUIB 4MD0A 3QDGD 3B13B 4V0KA 3WO4B 2EDLA 1RPQA 2WBXA 5ACLA 4XYLA 1UBCA 3MGOA 1N2RA 5JR1L 2H1CA 3KHSA 3IYLW 3V48A 1QTYT 1MJHA 3Q40A 2AN4A 3R1IA 4JFTA 4AEIL 4AIZB 4GG6E 1OFIA 2ODPA 2L19A 4K87A 4ETQA 2J88L 5J7CC 1ORHA 1XMJA 4DW2L 3LRHA 2OO7A 1GRCA 4Q9HA 4RQBA 1T6BY 3PYMA 4WF7A 2VWEE 3EJTA 2UZ4A 5IXYA 1P8JA 4QHMA 4JRYE 1INDH 4WI9A 1KY6A 4PJHE 3TVMD 2Y9MB 1AB5A 4AQDA 3Q72A 2PA3A 3NT5A 4NOKA 3FPYA 5DN6A 2B9AA 4FQLL 4GOXA 4Q1VA 1UHVA 1T3ZA 3X1DA 1IY0A 3QULA 4MS6A 1FP6A 2FHBA 1CFZA 1XALA 2AQ3A 2DIBA 1G4HA 4RYLA 3TTVA 1U2RA 5JHGB 4XP1L 2L2QA 4K88A 2IUTA 3QPVA 2OOSA 5DSZA 4ZALA 5BW7C 2JFWA 2RGUA 2F90A 3WGUA 4E2WA 4QT5B 4ODWB 1KAHA 4NKMA 1EHIA 3KAJA 3T9WA 2H2PD 4PLNC 3KX2A 4ZQGA 2GYWA 1RI4A 4I0KA 3BXPA 4HDNB 4LXIA 1FFRA 4BKQA 2W0FA 4PLVA 1X7HA 2EIKB 5EU5B 5ILTL 5JS7A 2EADA 5AK0A 5TQ2A 1LO5B 1JHOA 3PUCA 4AP5A 4HDRA 5LWQA 1BECA 4D9RD 2XN9B 3I5MA 1VL2A 2VJ0A 1KQGA 1R24B 3KYOA 4XUCA 1IB6A 4ZYUA 2QJOA 4XYMA 2R1WB 4FFYH 2FO1A 1V25A 3V8EA 1EFVB 3NHJA 1QBML 1B0GB 2ZSFA 5KUTA 2QNBA 4RPKA 2AVNA 1GZ3A 3VFRB 3H1ZA 3LF2A 2A0WA 3DK2A 3O3BA 1B4RA 7PCYA 3JTTB 4QY8A 4N2DA 4P36A 4Y1EA 2Y1ZA 1SUCA 2OCYC 1GZ5A 4MXDA 5BSMA 5TDOA 1YQGA 3W5UA 1X44A 4RHTA 5H59A 3QRFM 3CVJA 1H2HA 1IUOA 5EWLA 2GHTA 1JXGA 2GUGA 5AJUA 4ZT7A 3PWLB 4D4LA 3FKJA 5A7HA 3DBLA 4D4KA 3PABA 1VXOA 2ZPUA 2C78A 2GZDA 4HGWA 2IHNA 1YR7A 4K9EH 2BSRA 1GLNA 1A7OH 3DMHA 2VJKA 3FOLB 3HDVA 5DLEA 2R2GA 1BQSA 4J8QA 1A02N 1OOWA 4CILA 1EWRA 4CMEA 3L4BC 3H4VA 2PH7A 1CUXA 5FDWB 4RDQF 1KMCA 5TMEA 2CGRL 4OJAA 1DXOA 5BPHA 3GFSA 1Z5LB 4NJEB 1WWKA 5GP1A 1SMOA 3CC1A 1OLLA 3V5KB 2WMPB 3VAZA 3FCCA 2GUOB 4AMBA 3TCXA 3L1OL 4XNAA 1FYDA 5SZJA 2Q4RA 4FYSA 3L3DB 2QR5A 1QR1B 3JWNG 3PWSA 5EIAA 1NCCH 5JMOA 4RM3A 2OQRA 2XSZD 4PS3A 1EIZA 1NDMB 1S9XA 3RSFA 4MB6A 3H6JA 1IZKA 2N3JA 2HPHA 2FLBT 4QPNA 4XBPB 2ICWI 2QSUA 5K8JB 3IGLA 2GEDA 3IP3A 5IB5B 1DJQA 4S0ZA 4Q93A 4RZ2A 2PK3A 5CA1B 5IK3B 3GKWL 1KOFA 4QAJA 5AP9A 2R39A 1JBEA 3QVLA 5J9FA 3SOPA 5HM8A 3E9TA 2CXHA 4PS1A 1ZMRA 1U8IA 1TQBB 4ZWNA 3VO1A 5SZIA 1SLXA 4I3RH 1CQIB 2VLJB 4AEHL 4CU2A 3NHKA 4IDOA 3IQIX 3G8AA 4JI6B 4ODSH 3WQSB 4ZMRA 1PX2A 4G5AA 2EE3A 2XLLA 3GIWA 2JLVA 4U0JA 3I6LE 5AALA 5KJFA 5IHUH 1FS6A 1M2GA 1E7UA 2Q6WA 1GSIA 1AMYA 3MCLH 3PVZA 2JRCA 5C0BD 2EDHA 1NATA 1QFUL 4YASA 3RCBA 2IPNA 2X13A 3MB5A 3JTMA 4AW4A 4P3CL 1JRHH 1FSFA 3VG9B 5E1BA 1GSOA 2WVVA 5DCYA 3SGEH 1GZQA 2UZPA 2OMWB 1JHKH 4U1HB 2FPWA 3OKDB 4XLLA 1SK8A 4KZ0A 4N8EA 1MB4A 5JIDA 4B2IA 4EOWL 2RAVA 3CF2A 4AMKL 5ACMA 3TZVB 1CQPA 4KI7A 2XCRB 3V8CA 4QEGA 2AEPL 3THOA 5J2UA 2XCLA 2DY2A 3FPFA 3NBXX 1NFIA 1WB4A 5C1PA 3QWHA 3QJZA 1PK9A 1Y6ZA 5EWIL 3QUKB 3HC0B 3WE1A 3MG9A 3P5SA 2M1KA 3MRIA 4TLMB 3OXRB 2Q28A 3DWFA 5GADl 3ARED 3VPGA 1F45A 1FZOB 5KVQA 4LXFA 3ROGA 3EJSA 1GVHA 3UG5A 2XWZA 4UQOA 5G55A 1Z7EA 4D99A 1FCGA 1HHIA 1XZJA 2Q41A 4Q9QH 4N5MA 2IS4A 2XIJA 4KZDH 4C2BA 4WKOA 3ZUPA 5DK0B 3P11H 1MO6A 1R5NA 3IDAA 1ZIPA 3E48A 1FYHB 1BMFA 2POQX 1NM5A 1AUQA 4TULL 2W2KA 3LS2A 2OXIA 3OL2A 3WNLA 4CEIA 4XM1A 3A9UA 4O9HH 3TN0A 3WEAA 1RWPA 3ZY2A 1D7FA 4M1GL 5TJHA 2N75A 1Q0UA 2WA1A 3S5ZA 4DN6A 2XUGA 4G36A 3UAZA 4JB9H 4D42A 5K93A 7AT1A 5FDFA 1A9BB 4KFSA 3C5XA 3CKMA 3TUZC 1K3FA 3ONNA 4QNPF 3B2EA 1Z63A 3ESBA 3HCNA 2J3IA 1NMCB 2APTA 5DI3A 3OO1A 1PDKB 3V46A 4MS1A 2NCEA 5DEGB 3F83A 1XU7A 1HF3A 3ZQXA 5F7XA 4JFZL 3V2GA 2DJSA 4NP4L 3MACL 3C48A 3AJEA 4HTFB 4FGUA 3K9FC 1D7BA 4GECA 1MJUH 4BC1A 4DCTA 1URLA 4G5YA 4YP9A 1JERA 1RKRA 2WTUA 2WLHA 3GG2A 5LR6A 3ZKXB 4KQ1A 1N68A 1N7JA 5JBQA 4JLWA 1U3YA 5G3ZA 4NZ8A 3AV0B 4P2RB 4HD9A 3K0FA 2OSXA 3ZE0B 5KOMC 1KJ3L 4LRIA 1PJ3A 2P5EA 2AN9A 3ZNQA 4P3OA 2GSIA 1QU2A 2BFBB 4S2SA 4Y7DA 2Y4SA 3YASA 3WP0A 4NABA 1F2VA 2GJRA 1QUFA 3VR2D 3DPBB 2EC9U 3THWB 4RSGA 1XK6A 3BVNA 1WIWA 4M88A 2HU8A 3BAFA 1OXBB 4GD3Q 1FXWA 3DHPA 1B6RA 2PUDA 4XJXA 3FYDA 3GSUA 3T0EC 1ZH0A 5E00A 5FYKD 3JQFA 3LNHA 3ORSA 5AM0A 1XKQA 5DJDA 2D4AA 4YLEA 2LU7A 2QQ5A 3HM9A 2GEKA 5M04A 1ZU4A 4U49A 3N7TA 4ID9A 2HVKA 3OJ2C 3C9NA 4AWBA 1DEEB 1H6BA 3H1GA 5B5SA 3QVXA 3NSFA 5DU2A 4PSVA 3CPLA 4B9GA 2DPHA 2CNDA 1XLVA 5FUCE 1UMCB 3K4HA 3WIHL 4H7PA 2ODNA 5AK5A 5ESRA 2FGKA 3SF0A 3VA2C 2G60L 1AOZA 4JLVA 4A2HA 4QM7A 5DV9A 3QC5X 2YA0A 2EKZA 4CE6A 3SQWA 4MAAA 1DZIA 1CE8B 1P9RA 5IHZA 1DVUA 4YY3B 5G41A 4QJ4B 4OZIF 5C18A 5CILL 3QV1A 3SLRA 1BM3H 1GARA 4DFDA 5SV4A 2HFJA 2AL7A 3GWJA 4MDJB 5JC8A 2F15A 3SO5A 3UXHA 1HDRA 5JSFA 4PHFA 4ZVTA 4UINH 5BRPA 4EG1A 1NT4A 5MHSE 3GUVA 5BW7A 2F9FA 4XPHL 3LXBA 4HSCX 4FINA 3CWCA 4NBXB 1JZTA 5C09B 3CRMA 4Y5XC 1C1XA 1GCOA 2GJ6B 2DE0X 3B3FA 5FEBA 4UXHA 3ZHFA 3IXAB 3IQWA 4NM8L 4UMSA 1QYGH 3Q6MA 4HNAA 2EINB 2J3SA 2UV8A 1IV8A 1KIUA 4QHNB 5F1KC 3T3OA 3H9QA 1D2CA 3FC8A 1SXCA 4MV6A 4BKLA 2XKSA 4WBSA 4I48B 1TM2A 4HH0A 4ZPJA 4POUB 3TGLA 3QWOB 3GLFA 3NJ4A 4YBQD 1TT6A 5CIPH 4EQ6A 4NNXB 2O2SA 4UDUA 1RZIA 4G7SB 4IOJA 2CO3A 3CFKA 3EXAA 4YRTA 2OHGA 3V6OE 4X71A 2O5YH 2OCBA 4M22A 5HW0A 5DUML 2JD2A 3FLEA 1L8OA 4FN5A 5AB0A 3A3OA 4ESEA 4ZXFA 3SPHA 2E9BA 5AHOA 1W8OA 4AJ2A 3L06A 5TK2A 5BORA 4LXTA 1IGML 5DWPA 4TV8F 1SU6A 2WSSD 3KWWB 4AJHA 2AJUL 4RSRA 3M7FB 4NC1E 1R0ZA 4KV7A 3EUUA 5FLUA 2F8TA 4K3JB 2ZSVB 3MRPB 4ABYA 3CH8A 4S1SL 3KE9A 1KO5A 5HRCA 5IBCA 2PP8A 1P7BA 3V3KA 4AQOA 2OCPA 5F2FA 4FFSA 3JY6A 2R2BA 5LQAA 4L5FE 3X17A 2XECA 4FJ1A 4G8GB 4YAEA 2YBRB 2WIJA 3R20A 4Y2DC 1TADA 1G17A 2AG6A 4MI6A 2CLVA 1N7MH 4R96B 3TBWB 4HXGA 4TVSa 3VHRA 4L8CB 3W8RA 4F8EA 5PGMA 3O6FB 3LAWA 2DETA 2J45A 5C8YA 4ES6A 5AHWA 3CDGB 2JFVA 4GSLA 1WF5A 3EZ7A 4EJ2A 2NY4D 2ZI4A 3LYRA 1PJAA 3QELA 1A71A 3KSMA 4ZZ1A 1ZD6A 3Q5OA 5EESA 5B57C 5AEAA 2AW5A 2I2CA 4E5XA 3TL6A 3TUJC 4M3JA 4HHWA 4H5SB 1R6AA 3O7WA 4F9GA 1FSKC 4JY6A 4BM7A 3FPAA 5C97A 3FUDA 3V1UA 4X7RA 1QNIA 4TQAA 1LNSA 1FZKB 5FKPA 5JA8B 3VYOA 1I7RB 3OV6A 3GEFA 4BYMA 4BDVA 3M9LA 2VQDA 4DMUB 4FLRA 1ZKDA 1ZK4A 2DPLA 3TF5A 1JD9A 4KRYA 4P2RE 4KXVA 3JV4B 3VR1A 1QOQB 4F4HA 5B55A 1KAEA 2AH5A 4XRRA 4WI0B 3ETBF 3D2UB 3E80A 5CEZE 1O03A 3UAEA 3SODB 2M1ZA 4GFDA 1IGJA 2CDBA 3B7RL 4RELA 2P80D 4FDAA 1XF1A 1YEHH 4CNIB 5BVHA 3MRNB 3JSXA 2EEZA 3BAEL 1GAWA 2XBDA 5KI6A 1FLNA 5F9OL 1V1MA 1RI3A 3HG7A 4ACAA 3K7EA 4V03A 1BW9A 2BKXA 4OLXH 1G3MA 2CJ3A 2H31A 4A2MA 3U1QA 3QFSA 3SYKA 5LN8A 2V2WB 1UH3A 1Z16A 5EB9A 1PZBA 4J7AA 1ZU5A 3E5RA 3CQFA 1WFUA 2Q5JA 5CA0F 4Q7KA 1VZ2A 4G42A 2ZIAA 2HMIC 3MJFA 1GYPA 4FR0A 5EKTA 3M5CA 1DXQA 4J4TA 3IE9A 6YASA 4IBOA 3OVUB 1C3EA 2Q1SA 2Q4OA 3IKVA 3Q8KA 1OVZA 2O1XA 2CLCX 1A21A 1KU6A 1S4QA 3OC5A 2VTEA 5H0IA 3IRPX 4NLHA 5IEKB 2FUCA 4FE4A 1EX6A 1NW9B 4NNOA 1Q3HA 4FUTA 2QJWA 4P9ML 1NUHA 4PYQA 5JZOA 4NENA 3DIVA 2XTSA 2QLJA 1E7QA 5JXIA 2N3ZA 3DC2A 1IFGA 3F1KA 1CEEA 2IH1A 3HB1A 2FDCA 1OP5H 1HDEA 3B2NA 3FHLA 2Y5EA 5IREA 1IC0A 4TOYL 5EZIL 4ZX3A 3FGPA 1DN2A 2GFQA 4RADA 2CG9X 2VQEB 5B36A 2FK9A 3LOWA 3HWRA 3HNVL 2DQ6A 5A43C 1Q1JL 3KEFA 1R8XA 2Q1WA 4ZK8A 2B35A 2HZHA 1ACCA 1XCPA 4JFFB 4S1RL 1RWVA 2WO3B 2GJ6E 5H5JA 1Y37A 4I4TF 1ZRMA 1RU3A 2C9MA 1U4OA 4H35A 3WLRA 3B6IA 4WEOA 5AB2A 2ESVA 1G8AA 1MFCL 2ZZKA 1Q9OA 1LU9A 1WXWA 4LKXA 3GEBA 5GSVB 4EI5A 3H7AA 1UXSB 2VLKD 5L2KD 3GMOA 5DP2A 2E9SA 1E4EA 3SZRA 3TL2A 4MW1A 4JHBA 5JORB 3KPRD 5HJDA 3BCFA 4HKZB 2KW5A 3Q5EA 1YJ8A 4LLAA 1TJGL 3IRCA 5TT0A 1X1DA 4NPHA 1T9CA 5L6YL 3B34A 3GRZA 4S35A 3HG5A 3ZXSA 3ARBC 2F1OA 3R9IA 5CCXA 1JXAA 3QI9B 2F7SA 4Y9BA 3S99A 4CVXB 3H42L 3A24A 1IQWL 4M1WA 2WY2D 2JELH 1UXJA 1MCNA 4XM0A 2J7PD 3QM1A 1B0RA 3RYTC 5D70H 2GJ9A 1PZXA 4Z1PA 2VJLA 3LYUA 1L5SA 4JUTA 1YZGA 5F52A 2REOA 3FMGH 1DTEA 3HVHA 3MRHA 1V71A 2OSLA 5BPFA 2CK3D 3UX9B 5D6CB 4UWQB 1NYLA 2B83A 5ES4B 3IPCA 1E20A 2P46B 3K91A 1L5HB 4UZFA 1VL6A 2HVJA 3BVWA 3WO3B 1OB1A 1NM9A 3NCTA 1BVKA 3REWB 3JR7A 1OGAB 4GPTA 2IXQB 2RACA 2DFTA 5AFSA 2KS0A 2UYGA 4QXGH 4YJHA 3AHGA 3ALWA 1J33A 1KPIA 3TVYA 2H8PA 2XX0A 2YNMC 4UUMA 4RWYH 4Y5YA 3LCRA 35C8L 1J1PH 1U7XA 5DHFA 4ZOCA 4OLZL 5DEFB 4E9WA 3HYTA 3U2QA 2H63A 1R6BX 2VUSA 3X44A 3SC2B 4TUYA 4GOMD 3FQNB 2QDKA 4G2TA 5T5FH 5ALRA 4OLWH 4YHIA 2HJKB 2PQ6A 2F48A 4G6AD 2WJYA 1LLAA 2YQ4A 1XDSA 5CH8A 2EW2A 5LBUA 3ORFA 2SHKA 4Q56A 5FWRA 4P9HH 4YRNA 5TMDA 1ULAA 4BKPA 3G08B 3Q0IA 5F97E 5CP3H 1Z4IA 2R0LH 5I7UA 5MEPA 4U1GB 1UKVY 3KLMX 1MEOA 2VK1A 1UDWA 1VJ1A 5AM1A 5LNDA 2JKTM 1F1GA 3E35A 2ZSBA 1HKLL 2OMYA 1D6MA 1E4VA 3O83A 1BREA 1Z5UA 4U1NA 3GS0A 3QVTA 1MCOL 3VTFA 3AT8A 4XYEA 4HR7A 3BE5A 5LGJB 1QNFA 2B1OA 2M6KA 4LRSB 4Y5XA 2QTZA 1AZBA 5TPZA 1E8WA 4RNRA 1FF9A 3B9KD 4DLWA 4ENZA 3ZWAA 4OQEA 2BGMA 1CUWA 5F1KA 4JHLA 2JB5L 2QEQA 3OQIB 4KH2A 2C3HA 1ZS8B 5CCHE 1UKZA 1G9ML 2A3NA 4X84A 1Z7YA 1A3CA 4HDCA 3EYFB 3QQ3A 1KCWA 3B6SA 1LLCA 1Z13A 2EF1A 4JDZA 2P8LA 3W38A 2EYTB 1W6WA 1WMDA 4N0YH 5DNAA 2F7IA 3L3HA 1MCKA 4W5JA 3QQ9C 1G19A 3ORYA 2MCG1 2I07B 2Y36L 4UHCA 4CNBA 4MVJI 1NVFA 3OF5A 1C0KA 1P5ZB 4I36A 5LHDA 2E86A 4ND6A 3GRWL 4JEHA 2D03H 3GGJA 4KDRA 3JZAA 3SPXA 4EOGA 3AM5A 1ETB1 4KKRA 5B4VA 5JSUA 1T83C 1NIFA 1XBRA 1IXRC 4BQ6A 1QW9A 3BP7A 2O8EA 2E5EA 4G4SP 1EAMA 2X0NA 3RTQD 4LVHC 1JTFA 1TJMA 4M6MH 5LUBA 4NOBA 5D3MA 4U1RA 1JPST 3CVHL 5FWQA 5IVZA 3SLGA 4Z3JA 1LO3L 4UU1A 2O5EA 3OB0H 4X85A 4JFFE 4PJAB 2DQCL 4XPGL 4OKNA 1U7UA 1OE2A 2XIIA 4Q97A 5EJ2A 2HRZA 3A1UA 4CCAA 3OH8A 3P9MB 4QUOA 4HLDA 4LDRA 4ECEA 2ZQYA 3BPCA 3UKJA 3M6VA 1KMQA 4R4ND 2RGXA 3TA4D 2PX5A 3NDPA 1ECCA 3I1IA 4YCCA 4MVJD 5E7IA 5IDYA 3BAYA 2MYTA 4W1QA 3VMPA 3I1YA 2IEPA 1TIBA 3MWDB 2BGKA 1ODJA 3KT0A 1Y5LA 2ZIZA 4I66A 5AOBA 2YAFA 2CLZB 3MRVA 1W93A 5AQ1A 4D9LL 1UAYA 1DSFL 2O14A 3MRJA 3LEYH 1X9IA 5LZ5A 4RY2A 3N2JA 1Z28A 3KCPA 2CDEB 3DO6A 1SUJA 3QPAA 2LE9A 3QQDA 1CJYA 1XLWA 4RULA 2ATXA 3N43B 1Z4KA 4ITUA 3NVMB 1N6RA 4IOFC 4TL6A 4K9OA 3G9ZA 4EYKA 5AI4A 2C5SA 3IFLL 1JTTA 5KREA 1SHZA 5TFSH 2FUG1 4K7PX 5KW9H 3E18A 4K94C 4XMKL 1K3IA 2EDOA 3OZ7A 3CEPB 2O0KA 4R1QA 3CZSA 4DKFL 3KVVA 5CINH 3EGXA 4JBHA 2FSFA 1EBFA 1R0AH 5B58T 5MI0C 1QG6A 5F93C 4JEIA 1Z66A 2B59B 4KVNH 4XAKE 1J09A 1QDLB 3M6FA 2B0CA 2WB4A 4TUUA 4YMLA 4HLZH 4P7BA 2AABL 2E74C 5KAQG 4CGTA 5EE1A 2XYVA 4JG0H 1ZD1A 3CX3A 5JIQA 3RKPA 1CF4A 4RDHA 5CEYA 2GEUA 4HGNA 1JDDA 1XRPA 2Z83A 4M1TA 1SXGA 3LCVB 4LF4B 1RK1A 3QMWA 3V4VH 5DBFA 2WT9A 3KLHC 2CGYA 3V0FA 1H8HD 1DUZA 3CEAA 3IKLA 3MRGA 4HDQB 3L01A 1I0LA 1II0A 2KLBA 4F1ZA 2XB6A 3VGAC 2XE7A 4CV2A 4XR4A 3ZK8A 3OP1A 4UTBH 4MWGA 4RA6A 2QOEA 2ZSWB 3GMLA 2FR4A 1MJ8L 3P4UA 1CG9A 1KKMA 5DUPL 1HE8B 3LI2A 1YYMH 2UDPA 4NV0A 4YUXA 4PLHA 4K9QA 1RJFA 3OJWA 4M0UA 3HL4A 3S88L 3DGEC 1SOMA 5C0AA 3EADA 2OUIA 3B1VA 1DV2A 4PCTA 1G5IA 4FNLH 3TFBA 5GV8A 3A6DA 3GSNA 3MTBA 1GCIA 5CFOA 1KDZA 4EA8A 3ELUA 3H05A 3QUYB 3INGA 2Q2EB 3FUFA 1U93B 1BOGB 4H15A 1UH2A 3U3KA 4YHKH 2HA7A 3IDJA 3MPUA 2AMVA 3ETHA 5FTJA 2OMXB 2RR3A 5FUYA 2TRYA 1S7TB 4RSMA 1U2QA 3WLQA 1ZH8A 4D8XA 2CXRA 2P6MA 1MFUA 1DMSA 2X42A 5KVDL 2Z1DA 4DZBB 1T36B 4N3BA 6CHYA 3MGKA 5DNWA 3LEVH 4UUNA 1QMPA 1O6SB 2BSSA 1KC3A 3HG1A 2OP4H 4FJYA 4IJVA 3D0OA 1NFFA 3L7EA 3CWGA 2NGRA 5H94A 3RVWC 2YHGA 5HHXL 5CDFE 3ARBA 2FSSA 3MT0A 3PXAA 2F7QA 2ZYHA 4N5HX 3OLYA 3MTIA 1ADQA 2JTYA 4UT7L 3PX2A 3NABH 1OOEA 4EY3A 2G75A 4RK0A 1Q7GA 3AR5A 3LK7A 3ELBA 4BO4A 2ENWA 2GEEA 1DN0A 5IQOA 3PHOA 5IZCC 5KX5F 3AUTA 3GLFE 2IYWA 4IIGA 1RZRD 5KYYA 3VD4A 2WWMD 1BROA 1NCIA 1ZJ6A 4MA8L 3KL3A 1NGZA 1YBVA 1XD0A 3G9VA 1DINA 3L0DA 4O33A 5F78A 4F8TA 4KIWA 2Z0UA 1TNDA 3ZUGA 2NTYC 1CF1A 3DSFH 3PXUA 1P2BA 2ZQZA 3R6WA 4HIHA 1AH2A 4IRZA 2RKBA 1IKNA 1NDTA 3JRWA 4MCZB 4CVWA 1TL7C 1F41A 1BXGA 4NGHH 4LDCA 5B3JF 4HNRA 2P9JA 4YDRA 3U7HB 3EUEA 4WZ9A 3MLPA 4WZ6A 2YNMA 4OD3L 4CEHB 5DK2B 3ZH9B 1PCSA 5BV1A 4AROA 4LJ4A 2GLUA 3B5TA 5DJ0B 1H15B 4MMXC 2OAQ1 3K2QA 1CE6B 4OKIA 5IW8A 4MWCA 5HGHB 5GIRA 3VFTA 3ZTJH 2R0ZL 2OJZL 1SD2A 2GTPA 1FJ1B 4HLEA 1V54B 4HFUL 1T9AA 1XCGB 2OGTA 3AYXB 2CJUH 2VL4A 3DNPA 2Q8QA 5ER9A 4IU2B 4AZUA 4ATTA 3DI3B 3F0TA 3NXKA 4ZVPA 4UT6A 5H9VA 4P32A 3TOXA 1P5UC 1ZMXA 5T4EA 5BQXA 4QPEA 5A6LA 3PHJA 3CRZA 1GAQA 4PRKA 2IUUA 1R4ZA 3TPKA 1PMYA 3S7TA 2Z31B 2Q1YA 3EIWA 4RVGA 5LAXB 1M4KA 4PWKA 4RHEA 4DUZB 2R29H 1E5YA 4DR7B 4PJ5B 3I6QA 3D4PA 4G6FB 2WIBA 1K98A 1MFAL 4JG1H 3TZCA 4Q14A 2HSGA 2H0PA 4B8ZA 5EJ6A 1C5BL 1A98A 3MWGA 2Y7LA 4LCWD 1MNUH 2APSA 3PEFA 4DFHA 3MN8A 2Q3ZA 3SS7X 5E4AA 1TEXA 1DQYA 4G25A 3V1LA 3FMFA 1AQHA 1XUOA 3CSFA 3KPJA 5LOVF 2J3MA 3LX6A 4BELD 3N1UA 4RFEA 3W0WB 5CCJA 4XP4H 4MZIA 2PXYB 2NT1A 4CLRA 2YL2A 4Q7LA 1FC2D 2VQUA 3Q2CA 5IOPB 2Q87A 3QXTA 5T5NF 3GRUA 3Q3VA 4B79A 5DGRA 4KTVE 4ERNA 3UUEA 4JD5A 3KLQA 3OJMB 3VRIA 4NBRA 5KANI 3PQYE 2Y22A 1DUSA 3RY5A 5F9JA 5T6MA 5K20A 3VJMA 1MAWA 3ROZA 4PU0A 1J07A 4OQYA 4YBRA 2WZBA 1ODCA 4WCDA 2IS2A 2YTZA 4PGHA 2H1WA 5AYUL 4WFKA 5DHDA 1WCIB 1HFEL 4X42A 5DM2A 1U7ZA 4U5QA 1RFGE 1E1RD 1DIHA 1TUBA 2JBWA 4EB6B 5JXGA 2ATKA 3RHWK 3CLRC 1RADA 3B36A 3STBA 5FBZA 3DTVD 5A7FA 3GIVA 4GOND 5C8JB 2BBTA 3L9YA 1DPFA 1LK5A 2BC4B 1RZKH 1TD1A 1FOEB 1HAUA 5EC2B 1IBKB 1H3PH 3H0TA 5CEXB 3AKZA 1U9YA 3L49A 4JHAH 1U3DA 4RZCB 2ITFA 1T1WA 3TFOA 3K70B 4XB8A 1T5HX 3HIZA 1BE6A 2FO4B 3KHQA 3ZT7A 3LDFA 3K5WA 5KTEH 3P19A 2CDAA 4F5DA 3BQ9A 4FFZH 4HNQA 1QTSA 4GP7A 2P3SA 4L9SA 3GB9A 1W72B 1T2UA 1KHHA 4KI5F 1H6FA 5ILQA 1EJ0A 2EATA 2JJSA 4URWR 2DBZA 4ODHL 4E5XG 4OQNA 4GG8B 1ZM3A 1HZHH 1L3IA 3KE0A 2JK0A 5ELIA 2WXMA 4KKQA 3LQZB 4X0EA 3RC7A 1UBLS 1GNQA 1XVIA 1AE6L 4HETA 3QFTA 5SWZD 4QHSA 3LPPA 1IAIH 2HPVA 2XKNA 5SYAA 4KMTL 2AYYA 3GO1L 1E1KA 2A1TR 4P2OB 4YAQB 1CLZH 3K15A 4NFHA 5JQ6H 3X13B 3Q9PA 4ODXB 3D1VA 3UVEA 4ARVA 2CT8A 3BD6A 3P2OA 3NPMA 2ESVE 1BHSA 2H57A 3HUDA 2NXZC 3WL9A 5CEJA 1E4YA 1MPAL 2W43A 5KSBB 3LTNC 3O3DA 4I18B 3MNVA 2PFSA 3N5CA 4E41B 4XCCL 3HFFA 2YW9A 3MCAA 2V7NB 1ORWA 1U42A 3GSWA 1LFDB 2LRHA 4GRLA 1SVMA 4UE3S 4RPHA 1N0XL 3CKKA 1L7QA 3HS9A 1RPNA 3ZJ4A 3FT2A 1FNLA 4LFHG 4GEIA 3ROXA 1I94B 4ZPTA 4X6CF 3GLGE 2XWTB 3PAYA 2WE7A 3PA6A 1PQZB 1GGTA 4N0UA 1PG7L 4AJVA 1NLFA 4W9FC 2AZTA 3Q8CA 4P2YA 1MXGA 3WDJA 2XA8H 2GHRA 3KYDB 1A2BA 4NNPA 1DKRA 4YEEA 1CR2A 3HXMA 1GT6A 4H3SA 4HEA6 3Q8EA 4EEXA 5IV2B 4RIHA 2BR3A 4JKMA 1B0IA 5I17A 5CP8A 1D7OA 3JX9A 4B97A 3DNFA 3AHCA 4L29A 8ABPA 5CM9C 4ZJ9A 4RXTA 3ROFA 1GG2A 1L4FA 4YSQA 3LPOA 3L4CA 2VMEA 2KWIA 3SFTA 1QP4A 1OU0A 3UV7A 1OGTA 3CN7A 4G1EB 5HHOB 2YRWA 2ZKLA 3NC4A 2KQNA 1U94A 1OXUA 3NBUA 3RVTD 4LOIA 1PG5A 3FRHA 4AF8A 3AS1A 2NQDA 1QBKC 1YEKH 1OAJA 2NYAA 1V3JA 3G7TA 1JI3A 4MQTB 1U8OA 3FZEA 3O4JA 4Q6IC 3FRUA 1M8FA 1JIUA 1VDGA 4CQLB 3BZ4A 4FYIA 4NSKA 1NQVA 3GTTA 3E6HB 1V8HA 3IP9A 3BICA 1ZIDA 1I4LD 3EYVA 3O6LH 1ZL0A 4UXIA 4PJ5E 2Y0EA 4CLEA 4GW5A 5D7JD 1ZLWK 1U8NA 2AQ1A 4CC0A 1CD1B 1R5IA 3C5ZB 1WA5A 3GNLA 3A6FA 2BBWA 2GTZB 3KWTA 2EDJA 2WP0A 1P1ZB 2NU6A 1T03H 1CDDA 3W8NA 1KAMA 3C5EA 3O4LB 4YK4B 1B93A 1ISGA 4HCRL 3W0WE 2GPNA 1BVNP 3L84A 1BZ8A 3H5LA 4CMAA 3OD5A 1N9PA 4B8WA 1Y18B 5D2NC 4WKXA 3MWLA 2RGYA 3FCBA 3WNOA 5IT2L 4PNHA 3ZCSA 1XCXA 5E4OA 2YKGA 5DRTA 3TIFA 1O6ZA 1EZUA 3D06A 3F58L 1UB6B 5HHMD 2WAXA 1NJ8A 3RHWF 5LQCA 4LEEA 2O7SA 2RTTA 1SC6A 3W4IA 4X1IA 1HOCB 5AVWB 2NO7A 1FFOA 3KYNA 3ROEA 1W2GA 1EAQA 3BMWA 1NHWA 4ODVH 3UK1A 4E7PA 2I3BA 4JAVC 5KWSA 5AAWC 3PRKE 1HI6B 3O4IA 1Z9SA 2BSBA 5I82A 3WS6C 1QUNA 3PTAA 5FEMA 5I45A 4MWZA 4GO8A 3R76A 2V7EA 2Q3CA 2WABA 1RI8A 3NALA 1E4OA 1P5VA 1C3OA 4ONHB 4AC4A 2WJ3A 2I22A 3R0IA 5IZCA 3MRQA 3EDYA 2ZRPA 4Q3LA 1U8HB 3FH5A 5KVEE 4UUJA 1H9AA 5TK4A 3CXDH 4NTZA 3K8LA 2MSNA 1GN8A 5I5MA 2AWNA 3NDIA 3C24A 4X6BA 1MHEA 1VIDA 1JLSA 3PHIA 2HK7A 1AGXA 4EAQA 4Z3EA 3DBIA 1EZVY 3QU5A 4AMUA 5C9ZA 1JD7A 2P8JA 4KSBA 5BS0B 2R6GA 3LQQA 3RDTD 1WCWA 1EWKA 4AY6A 2Q20A 4NONA 4KXFB 1G7IB 4C14A 2BRQA 2NZIA 4GRWE 1J21A 4FWBA 2VYCA 4UXJA 3PX7A 2G2PA 5JWRA 4IKIA 1XZWA 2QVFB 3CG0A 4IBQA 4Z23A 5ILOA 1HG1A 1MAVA 3CNQS 3FO2A 4JN2A 1RFDH 1WXDA 1DJXA 4MMXA 1DP4A 1IAKB 3O9WC 4JXKA 4LU5H 2Y25A 1ECJA 3U1BA 2W5UA 3AEXA 5FK9B 2D7JA 1ZCZA 4D9JA 1ASQA 2NYYC 1AQDB 2YD4A 3UH1A 3FTFA 4OQZA 3QHQA 3ASUA 3D7KA 3TEYA 3M4JA 3QZBA 2QKSA 3HFJA 1P5UA 1X9UA 1MRCH 1MC1A 3M5DA 1MUUA 1N59A 2A5UA 3PFGA 4PMEA 4BU1A 3PL1A 3R3UA 3KTOA 4YBLC 4TYPA 3TIEA 3B9QA 5FUZL 2JJMA 4TXVB 1I3UA 5D1QA 3SDCB 4ALKA 4UE6A 3QHFH 3D30A 3DHJA 3WXBA 1UT9A 3FNGA 5E2IA 2C5AA 3FHTA 5CRIA 1UGKA 1L4HA 3ICQB 4RLSA 1MFBH 3TQOA 2UXDB 4D45A 4J3BA 4LLMA 4CUJA 5L88L 2CKBL 3BEVB 3K2IA 1FYVA 3PIQB 3S96B 2W22A 1VCIA 4DLTA 1CMOA 3OKEB 3QUAA 4MV4A 3WG7B 3MK31 3P4MA 4AQ1B 1LK2B 4ZW5A 4QUDA 2FK7A 3WL8A 4MUFA 2ADJA 4K7FB 2WM0A 2Z57A 2DKFA 4ZZ3A 3C60D 2Y99A 1FVDA 4XE0A 1OI3A 3D43A 2XUWA 1FVEA 3DWGA 3H9EO 2XEXA 4AG4L 2KBEA 5C0IA 1WC7A 4NQDB 3BCDA 2O5RA 3LRXA 3OZAA 3KPSD 4PHGA 1OWMA 4N87A 2J6WA 3O82A 4HMCA 5JS2A 2DQDL 2P8PA 2JIZA 2XYHA 3M6UA 4U63A 2HZBA 4UNPA 3LNCA 4LMBA 1YB1A 4MLDA 4GBED 4QTZA 1G6OA 3IAUA 4P5KB 4PJGA 4KOCA 2QL6A 3UHOA 4G8IB 3OLIA 1FRZA 1H2AS 1Z47A 3DD5A 4WFHD 1UJBA 3VZQA 2Z2ZA 3KXFA 3D6JA 2ICAA 2WNXA 5IDVA 1MFDH 1QNZL 4J0GA 4XGZA 2YPVL 4W4OC 2E27H 2IXDA 2PO5A 5EWJB 1JKXA 1UBEA 4Z0NA 5BV0A 2I3DA 5F33A 5GSRB 3VW3L 1TT5B 1SVSA 3U1VA 4A0SA 5LZ8A 3UAYA 1G1MA 5JNTA 3AOGA 4NBZB 2CNOA 4JA2A 1TTGA 3LC1O 2IUSA 5JD4A 3ZL2A 1GKEA 2G71A 5LCVL 1VSQA 4JPKH 4V38A 1JG6A 3JZIA 5JNUA 1X9GA 2X1XR 2VAVA 2JIBA 2YZ2A 3V8QA 1F8GA 4BFZA 4IDEA 5IWLC 4B0MM 1WKVA 3REVA 3VSQA 3MV9B 4OI9A 1U41A 3U49A 4DWWA 4OZFA 3PVSA 4IKPA 1FMCA 3L77A 4NQCD 3D2TA 3MJTA 5LLSA 3O38A 2GLXA 4RAOA 1C7RA 3IRVA 3DDFA 5JYMA 2J4CA 2G9UA 4OOEA 4EFNA 3O5AA 2X0FA 2H2FA 4C6HA 1ZMOA 2UYLA 5CO1A 5JW5B 4AUJA 1Y98A 3R7WB 1D04A 5F70A 2IV7A 4Y1RA 4QAWA 1KGJA 1E2WA 5EL0A 5B30A 2EVJA 1J22A 3BHBB 2W9XA 1JK9B 4B87A 3DVQX 1A7RL 2CDGB 4CT0A 3LQ4A 4U3SB 4FNPA 1Z12A 3Q7RA 4FMCB 3K5IA 4B3TB 3LH5A 2NU7A 1DQJB 4R84A 4PJ7F 5EN2A 1E5ZA 3NCHA 1N32B 3UATA 1V26A 1JRHI 4KNTA 1Y4DE 5D3KA 1BQ4A 2AC7A 1ESCA 2M2IA 3SGEI 3DOHA 2YXWA 3TAHA 3GSVA 1F6WA 2XG5A 3ESUF 4WUKH 3PKJA 4MAYC 1PQPA 4OI7A 2APXA 2NCMA 4IMJB 1CCWA 2A5FA 2G3MA 1JYWA 2D0OB 3HG1E 4PZ9A 2YUXA 3W5CA 3QNYB 4FL4B 4YEDA 1L9OA 1M6VA 4JY5H 1S8NA 3OIUA 1H8ED 4NP6A 1HFUA 4DOHB 1KLGB 5BS0E 4OSEA 3HADA 2IDFA 2IXTA 4QTYA 3VSAA 2FGWH 1TK2A 2H7VA 3FN3A 4MMZB 3LV8A 4CRPA 5J11C 1XEUA 1P7YA 1DL5A 3HUTA 2SICE 1RACA 5EJ5A 3ROOA 5BV7L 1H0HA 2K7PA 3CW8X 2BZ1A 5CAYB 5DIZA 2XT1B 3SGLA 3A1VA 4OGLA 1SCBA 4DXHA 2HA0A 1K7CA 4U1LA 2FRVA 3TJEL 3RA7L 3H85A 1FUKA 4L8SB 3OLCX 5CJ2A 3P77B 1AV7A 1KVSA 4GR9A 5DK6A 1JBKA 1ZIAA 4NQSB 1E27B 4AG6A 3RUGB 4YRGA 3NGBC 3H2YA 3ZXXA 1XR8A 3MLUH 2VJXA 4B3EA 1VRCA 3M88A 1OIXA 3DX4A 2Y76A 1SQ0A 4FYWA 5JCXA 4BYHA 3L5HA 1CFQB 3GCZA 2Q3MA 4OZGA 4UM8A 3M07A 1VL8A 4G7QB 4P1ZA 1UA6H 4LNRA 4ABVA 5LXGL 4WASA 2H32H 1LD3A 4Z53A 2DT5A 5ENVA 1UC4B 4O4YL 4TS4A 5HHPA 3VFNB 1A5AB 4G9FB 1RRPA 5CLQA 1J0BA 3BQNB 2N1BA 3F6EX 2I78A 1XPUA 3TZBA 2CHEA 5J43A 4V2CB 2R7KA 3RWJB 4RPGA 1TQVA 5KVFL 1V10A 1X80B 1XF5A 3RIHA 1RRCA 1FP7A 1K4KA 1JPVA 2XZCL 2MNJB 3U36B 2ZFUA 4XMLL 3I45A 3FWHA 1YQXA 4KAJA 4P4TA 3AHJA 4KWUA 4DQOL 1UWVA 4HK4A 3U6XS 3NAAH 2PXAA 4PJ9B 1QZ1A 1U7WA 2WT4A 3L8MA 3NHRA 4LARL 3HS0C 1DIAA 4UV4L 2XNKA 4QFCA 5EA0L 4A2QA 2KLSA 1M2WA 2DQJL 4B6ZA 5A2AA 2YKKA 3GF8A 3P9SA 3OKYA 4B6PA 1E8YA 1D03A 3FSGD 4FG6C 4WBNB 2IANA 3JYQA 4ZVMA 1J1OL 2GYVA 1KNQA 2E5FA 3BWDD 4J91A 3I72A 4Z7WF 3IPEA 1Q1QA 1AXIB 1MCIA 2AE2A 4JCOA 3BL5A 4MJJA 2BHLA 3C6YA 3QHPA 4ZEOA 1LX7A 4FMBB 1LO2H 4P38A 3EZ9A 2NTFA 3U19A 1RM4A 2LTQB 4XXCC 5DK3A 4FFLA 2OPHA 4JRYB 2O3RA 5F7LB 1G6VK 3NWBA 4PJHB 1UBHS 1KCVL 2BW5A 2Y07L 2AXPA 1MFMA 2DWDB 1OK8A 3WGTA 3D5EA 4P57B 4ALNA 4QRSB 3C3KA 2BFDA 2NUAA 4L8GA 1CUJA 2IDKA 2IPAB 4X20B 5KYWA 3WS6A 4DDWA 5EJIA 2O6EA 2LIPA 3BRDA 2A6JA 4KTEL 2WKOF 1QQ7A 4XNYL 4DB4A 1GGNA 4ZFGL 5TPWA 5CAEB 5E94A 4LT7A 2D0IA 4YRBA 3FMIA 2YAHA 2FL5B 4DP4X 2G1KA 1JR3E 3AESA 2YJ3A 3IMCA 2DFVA 2HFTA 1OM3L 1E9FA 1FL3B 1XD1A 1ZDQA 3BUYB 3PP8A 4N5ED 2PLTA 4QL3A 1C9MA 4ZUVA 2ZUBA 1FFGA 1AZUA 3H1TA 2WINA 3LUGA 2H4HA 4ILEA 3X0DA 3HRKA 4LOUD 2I7CA 2K8MA 2AQIA 2MCPL 4WI5A 3U0BA 4CEJB 4DIKA 5DB4A 4PC2A 3K5HA 1NN3A 3BJEA 4XVTL 1FXSA 2ZKHH 3VFOA 2PBZA 1I3RB 4G5ZL 3WHLA 4DDVA 4LCYA 1Z2OX 2DHDA 4OLEA 2XFGB 4N0RA 2ZBRA 2JJUA 2PZEA 1U58A 1RIFA 1X7QB 4UM9A 3R44A 1CUYA 1I7ZA 1JI0A 1ZVSB 3ED5A 2OCIA 1M71A 5AKJA 3FXAA 4C5CA 3R9WA 4PINA 2VTBB 1GLVA 2EFJA 4HMOA 1CNMA 4IQ8A 1ZOOA 2BY1A 2ZB8A 2HHAA 3V4SA 1NFDA 1DX4A 4GM0A 3UXMA 1IC1A 2JJ1A 1LLUA 1BDHA 3D3VE 1HHJA 5EFIA 1NKSA 3BGVA 5HSFA 4JFOA 4OF8A 4F1SA 1KEZA 2ZBGA 5FRDA 2YIVX 3SDSA 4L6IA 1R3KB 3OB8A 1FH5H 1Q77A 2ZWSA 2W6ID 2IPTL 4TLCA 3WDIA 2BM9A 2NYVA 3DEFA 3G9QA 4BKMA 3TX2A 4K2AA 6PAZA 3KLAB 3NNNA 1CU4H 5IW6B 1G9HA 1RUPL 3U9UB 1K8IB 3UUFA 2LKCA 1SKMA 2EKLA 3H7BA 5DASA 4C56B 4U0RC 1RXWA 5JARA 3HNTH 3VYVA 1TF7A 3OI7A 2QRQA 1AGCA 1ZLSL 5B2ZA 1U8AA 4IG9A 5JCJD 1W36D 1GKLA 1T4KA 4LEXH 1WVZA 1AKWA 3ERCA 5KSWB 3FVTA 2WJIA 4LSUL 1CXHA 5DMYA 2FJFA 4RKQA 3VHXB 1QG3A 5I7HA 2AR7A 4JO4H 4KHZA 4RKFA 1UPAA 5GZND 4X2UA 1JNHA 3ILQC 5F3BA 1JQ5A 1FNEA 3QXAB 3FO1A 4NM4L 1AC0A 3RODA 2VDKL 1IG3A 4RKEA 2X4PB 4X0NA 5EOCL 4OJMX 4HN9A 4LFCB 2ZF9A 3TBBA 1L4IA 2Q6VA 2NXCA 1TIUA 5KO2A 3QH4A 2DKNA 4TS3A 1J86A 5SX5H 5REQB 5EOTB 1DB3A 3SBWA 3REQB 2VLLA 1DVFB 1VENA 2VC2H 4L5JA 3E3QE 3ZZ1A 2FEEI 1PW7A 4KXMA 4EABA 4ZC8A 1E6CA 4EH1A 4ZOLB 1EA9C 3D85B 4XC3L 2W2VA 2WA2A 2DBRA 1FQJA 5ICYB 4EO4A 3FDWA 1U8UA 4NJMB 4Z4CA 1JR2A 4XO3A 4G1VA 3W04A 3BVVA 1TRHA 2BGJA 1E5VA 4N2HA 1H1TA 3IS3A 4WNYA 2W6ZA 1J5EB 2R5WA 1NZRA 2BVUA 5JOQA 4ZYTA 1A4JA 4HV8B 5D4IA 4Y2RA 4YAUA 1RHUA 1IL1A 3FQXB 3M5WA 1T4CA 2AZ4A 2VK4A 1HE1C 5D86A 5BSUA 4Y2NA 1TITA 1GPBA 4J3FA 4J94A 2FEDD 3HJUA 3GI8L 3T35A 2AK2A 1E9AA 4FILA 3BH8B 3BSHA 3A26A 3JAMA 2OW7A 1I8KB 1P6XA 1VA5A 1JDUA 3COJA 1EJFA 4I9GA 2FPOA 2P1YA 4B95C 1UADC 3K0YA 1A3QA 2NTEA 5EKUA 1Y6RA 3EBHA 4WKPA 3I9IA 1Y5MA 5ERWB 1FFPA 1Y5IA 1SD1A 3TEFA 1JJBA 2Z6AA 4OFWA 2PZFA 1ZLDA 4U7JA 4BCYA 1BEUB 3KYIB 4X95A 3UT5B 1OZHA 2CL6X 3VGBA 2CXNA 4NKRA 1AANA 1ZJZA 3KZMA 4ENQA 1Y7TA 3CA8A 3OHXA 2Z9CA 4I4NA 3N55A 4M21A 3M86A 1M83A 1QM5A 4CIAA 3MUHL 4K8RC 2NO6A 3VTTA 3UHFA 2ZIEA 4BEBA 4F2HA 1ZJ5A 4FG2A 2J8UF 2ZQ5A 5D85A 1I1AB 5I2IB 2AXFA 2BT4A 3JWNE 1UM9A 5DM4A 2R47A 1FNAA 1QV6A 2EIJB 4CN4A 2AXEA 1K3TA 4K5QA 3TT1H 2PKQO 2CB0A 3KSRA 2ITEA 3WLNA 1ETZA 2JFUA 1YIOA 3SFZA 1T1EA 1CUOA 4O02A 2WQZA 2HA2A 3MSCA 4B7IA 4LFBB 4D7BA 4RACA 4K23L 2E4FA 1AIFA 4MAYA 2ZUEA 3ILDA 4JDVA 4F60A 1ENOA 1NLDL 2AQ2A 1UP6A 1A1NA 1J06A 3CRNA 3RBSA 2EFHB 2NO9A 2XUKA 1E3WB 3KUKA 3UTTD 4V1DD 4NZOA 3SE8H 1QH0A 1NQOA 1KEMH 4MRMA 1FUYB 5EYPB 4FP8H 2B36A 1HQCA 2NMVA 2NX5A 2PYEA 3A6LA 4X64B 1OV4A 1KR5A 3NU1A 5FPKA 4EELA 4GHWA 3RWBA 3HI1A 5KOHA 2H1SA 5F7HA 5HVHB 2SECE 2IHKA 4LYHA 4DQAA 2BNRA 1RZGA 5E4TA 3RH0A 5FO8A 4NI3A 1A77A 2WMNB 5HBGA 2V03A 3PWTA 1MVUA 3E3OA 4EFLA 5HJ7A 2CHGA 3AR8A 4M99A 1AS2A 1DVQA 3OXSB 2VISB 3ARGB 4NFDA 3D08A 4O4LA 1J39A 1KKUA 1BA9A 1UEYA 1WG3A 1EZ1A 4JUDX 5LYJB 4MV5A 2FPGA 1M1SA 2EJ1A 5E9DB 1ZXQA 2F61A 1OTSC 1QJCA 3UZQA 4CJXA 2HAEA 1X5JA 2VDLB 3NBKA 5C8VA 3W5MA 2GD1O 4F1JA 2QTCA 9LDBA 4P4KB 4UB0H 3T3IA 2ZNXA 1E4KC 1NC4A 4K71C 1EGJA 1JGDA 2VAMA 1C81A 4GQBA 1J6UA 3T9DA 4IRJC 1YJBA 1QD0A 1ZW6A 3OHSX 1MHPL 3ANYB 1KQNA 2X6QA 2VERN 1P2TA 4C56E 2IYLD 3M1CA 2NSLA 2C4FT 2XJ4A 5D6NA 1JYEA 3WKNA 2IH4A 2RGRA 3UMVA 5AW8B 4QFBA 1F4VA 2W98A 1I4FA 4LYJA 3I6GB 2BFAA 4CDNA 5I8OL 1QX3A 3QE2A 1Z7JA 1JF1B 4MYHA 1PX4A 4HSQA 1Z15A 3HS0A 1HEYA 2WOBA 2H3NA 4NQQA 2B9EA 1RBMA 2JLSA 1SY6H 2CD9A 1CW2B 4NQXA 1PZ5A 3VXOA 1QH8B 2IDZA 4FEGA 4LSZA 5L6MB 4TMZA 3O8XD 5DYWA 4Q1DA 4LLUB 2Z3WA 2Y24A 1XF2B 3KV3O 4Q74A 5AOMA 4CKBA 5D1XB 4FXKC 5D1QE 3WSQL 3GMMA 4YGXB 1LEKB 5INCA 5EULV 4APQB 3CH1B 1LDNA 4DQVA 2RGCA 5BOZG 1VFAA 2YJTD 2Z0MA 4LSPL 1YT5A 3LIZA 4ZFNA 1E5CA 1PN3A 2NNCA 2HWYA 4GP4B 1OY1A 5CZXC 4B9CA 2NV2B 2O8DA 1TLFA 4FM9A 2W83A 3H65A 3OJ0A 4RJIA 1A3LL 2QE7A 5ISMA 2IYSA 2Q5CA 5K6AC 1G9NL 1F6BA 1ZESA 3L1GA 1F0NA 1HIMH 4EIZC 3G0CA