4UM9B

Crystal structure of alpha v beta 6 with peptide
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
470
structure length
448
Chain Sequence
GCALGGTCEDCLLIGPQCAWCRCDTPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVCPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQVNSSKCHNGNGSFQCGVCACHPGPRCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of Integrin Beta-Subunit Specificity for Latent Tgf-Beta
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords INTEGRIN ALPHA-V
total genus 110
structure length 448
sequence length 470
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4um9B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4um9B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4um9B03
3PPYA 2VDRB 1M1UA 2ICAA 1JEQA 1U8CA 3M6FA 3AL9A 1PT6A 3K71A 1JV2A 2NUTA 4O02B 1JEYA 3EFOA 4MMZA 3EGDB 2VDPB 1SSLA 4CN9A 2NUPA 1T0PA 1ZONA 1XUOA 1SHYB 3NIFB 2O7NA 5KYXB 3NIGB 4MMYB 1U0OC 3BN3A 4WK4B 2VDQB 2WINI 1U8CB 2VDOB 2QTVA 3F78A 5KYXA 3PPVA 4PN7A 1IJBA 1RRKA 4DMUB 5KYYA 1T6BY 5KYWA 1YVPA 5E6SA 5E6RA 3OKWA 2NUTB 5HDBB 4HQOA 3FCSA 2ODPA 5KYUA 3HI6A 1M2OA 3EGXA 4M76B 3ZE2B 4C2AA 4NENB 3AFCA 1U0NA 3EH2A 1AO3A 4IXDA 3ZDYB 1BHQ1 3ZE0B 2UZYB 1AOXA 3PPXA 1OLZA 3OL2B 2ADFA 4JX0A 3K6SA 1IDOA 3HXQA 2VDNB 1BHO1 1PCXA 3EOBI 1DGQA 2IUEA 3EGXB 1JEYB 1SHUX 1XDDA 4FX5A 5E6RB 3ZDXB 5E6UA 1ZOPA 5KYYB 3K72B 1QCYA 2X5NA 1L5GA 3QA3E 2M32A 4NEHB 1ATZA 3FCSB 1V7PC 4WJKB 4MMYA 5BV8A 3EOAI 1IJKA 5HGJA 1UEXC 3ZQKA 4WK0B 4MMZB 3VI4B 1CQPA 3EFOB 3EGDA 4UM8B 1M10A 3GXBA 5KYNA 2I91A 2P26A 1SQ0A 1IDN1 3F74A 3OKYB 2B2XA 3RAGA 1MQ9A 1JEQB 1CK4A 4HQFA 4O3TB 2XWBF 3NIDB 1FNSA 1RD4A 2WW8A 3VI3B 3BQNB 4F1JA 1XDGA 2NVOA 3K6SB 4JDUA 3IJEB 3TVYA 4CNBA 2VDMB 4HQNA 3TCXB 3K72A 3BQMB 4F1KA 1M1XB 3T3MB 1M1XA 1FE8A 1OAKA 1M2VB 4IHKA 1MQAA 4UM9D 4C2BA 1MF7A 1N3YA 3NVQA 3AL8A 1RS0A 1PD0A 2VDKB 3Q3GE 3IJEA 4Z7QB 2P28A 1JLMA 3V4VB 3ZE1B 4CN8A 4HQKA 4GZ8A 5KYWB 2XGGA 4G1EA 4MMXA 3EH1A 4C29A 2I6SA 1JV2B 3N2NA 3AL8B 3V4PB 4WFQA 4Z7OB 4G1MB 5HJ2A 5LN1A 1L5GB 4NENA 2VDLB 2VC2B 2NUPB 3E2MA 2ODQA 1QC5B 4G1MA 3PPWA 1AUQA 1TYEB 4G1EB 4MMXB 4K3JB 1QC5A 3IBSA 4IGIA 3TXAA 1DZIA 3FCUB 2I6QA 3EG9B 1MHPA 5ES4B 5E6UB 3OL2A 4FWWA 1MJNA 1MQ8B 1N9ZA 1NA5A 4UM9B 4WK2B 1M2VA 3HXOA 4Z7NB 4HQLA 1ZOOA 1PD1A 4O02A 1RTKA 3TW0A 1Q0PA 3K71B 1SHTX 1YVRA 1LFAA 1YUKA 4O3UB 3T3PB 5KYUB 4A0QA 3ZDZB 5E6SB 3EG9A 4XW2A 2XWJI 4BJ3A
chains in the Genus database with same CATH superfamily
4LK3A 3Q87B 4TL6A 2KLSA 1XTKA 3KELA 4J0JA 3EHBD 4I48A 2XMBA 1E65A 2F1IA 2FX9H 4H35A 3QYCA 5D96C 4F58H 3ZQ9A 4OYRA 1FFYA 3EFHA 4HCFA 2ZAOA 4C06A 4AKPA 4DM3A 5GSVA 1EFXB 4BFIA 4LNRB 1KMCA 4KK9C 3PNSA 3EAGA 3BUPA 5ICSA 1EBAA 3IL2A 4ZT6A 3BP5A 3CR7A 1D0VA 3W8EA 5F1OB 4RACA 2NY4D 2FLKA 3RWBA 1J39A 4INJA 1IOWA 3KVRA 4J3OG 2ZI5A 4BIMA 2ICWJ 2G9NA 5FX2A 2WKPA 3GP3A 1KE2A 4XNQA 5FWYB 4DIMA 4OSUH 2UXBB 5DZVA 2C4FU 2OZ4A 3MINA 1CQIB 5EU5A 2N0MA 1ZC3A 1NDHA 2F3QA 1ESZA 2CHFA 1MNUL 3X2FA 3AG2B 1RAIA 1B6SA 2ZSWA 1CQYA 2R0KL 3RAFC 1U3HB 1EAOA 4WTQA 1R3KA 1RK0A 2W2LA 3IOCA 5BNFA 4PYRA 3PXGA 5IW1B 2Q62A 2QM8A 3B2UC 1CDDA 1X2EA 1OXTA 2O50A 4BKLA 3KQKA 4WGKA 4KQGA 1ONSA 4LOUD 4HSGA 2XMGA 2IZ7A 5G3YA 2M1KA 3V4SA 4MZDA 4ZTZB 2NNAA 4YRSA 3EBHA 5LQBH 1MG2C 1E2JA 1IUPA 5D7SL 1SN0A 4WGFA 5BS0D 1C7QA 4U00A 4OBEA 5TPWH 4B3RB 3B6SB 2FTAA 3KEOA 1A9XA 3X1XA 3ZJ4A 3D0OA 2CMHA 4I08A 5IHLB 2CH8A 2B99A 1G2IA 1H9CA 4GI9A 3CNEA 3NWEA 4HEPG 4ABYA 5F6IB 2IEZA 4HCJA 3EZLA 3O4RA 1I7PA 3PFFA 2CNBA 5KSOA 4HIIB 4NO5B 2VI5A 4JBYA 4Z7JA 3VGDA 3WAGA 4H7FA 1MH1A 4PPNA 4QRQB 3QPXH 3ESZA 1P2CA 2YRPA 1KJVB 5IW8A 2P8MA 5JZSA 4G9DB 5HGAB 4FQ7A 3I75A 1EWVA 1FTWA 2FJGB 1PV1A 4Z0TA 1R3HB 2CLKB 3S88H 1X6VA 3H2ZA 2Z56A 4JHAH 3RBSA 3MRGA 1CC3A 5MN6A 1NJSA 2ZOOA 1E3EA 3FCSB 4WNQB 2GSGA 4YJGB 2D62A 3V5HA 3FPJA 4L5FL 2AQQA 1WSWA 4XTRD 2NW3B 4BJ5A 1LFDB 2NRDA 1C5DA 2WN3A 3ST7A 4B8YA 1XTUA 1V1MB 2VYVA 4N01A 2ISCA 2P40A 4I48B 3L3OA 4MR8B 5CEYB 3PL5A 4CKWB 5A3ID 3QFTA 1G6RB 1NMEA 1AX9A 3LN4A 3PABA 3NBAA 5T3ZE 3PWPE 2H8KA 4HLDA 3MJ9H 3VOTA 3EGIA 3L6UA 2N1KA 2ZTSA 3J27A 3K4HA 5DNUA 1E4XL 2GJZB 2I22A 4LSUH 4EKEA 4OFDA 3FYIB 2O57A 3W39A 5EZJB 4EI5B 4XE0A 5JSYA 1XG5A 3FR8A 2WU8A 1GPLA 4P9MH 3M82A 1TEXA 4MWZA 3M45A 1AD2A 3RS0A 4LLDA 4XD2A 1JE6A 3EZGA 2O52A 2WWNA 3GMOA 4D9NA 3Q8FA 1DT5A 2I07A 4MVXA 4FPXA 4YPGA 1SSLA 1GZHA 4CCWA 4MI6A 2V7HA 2QU8A 1ZUNB 1CR9L 1W36B 3MTBA 1DQIA 3ER9A 1FVXA 1VDZA 3RWMB 4JC4A 5CJ5A 1DU4A 4DCVA 5F7LB 1BFTA 3UTQA 1G7QB 5KTRA 1UA6L 4A66A 1SC9A 2XB2A 1OBCA 5TEVA 4GOMD 4M1CC 4WXMA 1R0RE 2J7LA 1PT7A 4M1GH 3GLAA 4NYLA 5EF2A 4AZTA 1DOAA 5COQA 2RBEA 3M3HA 3PNWA 3HIZA 1CB4A 1TFUA 4WDIB 2GK3A 3FROA 3H5LA 3U9WA 3AESA 4P0TA 1PYOA 3D81A 2Z4RA 3DOHA 3IXAB 3TLCA 1ACLA 3FT2B 1DX4A 4Y2NA 4UIMA 4FLSA 1M1XB 1QVOA 3EW9A 4E1BA 4L6CA 1V5JA 3FRUB 1J5HA 2UUDH 5CUSH 3NIDE 5HUHA 4YCDA 2D5CA 4ODXB 1HX0A 3VH1A 5B5SA 1EINA 3DWFA 4QXMA 2W65A 1QNZL 4RTRA 2PUDA 4IXMA 4XPBL 4WEMB 1X3LA 2VMEA 4K7PY 2DKNA 4KFSA 2DU8A 4N7MA 1U2YA 1OAOA 3RD5A 4QXRA 1JG7A 2AN9A 4NN7C 2E4ZA 3ELAT 3DO7B 3K71B 3SZ3A 1YUKA 2DIJA 1H8ED 4A38A 1TTUA 1F58H 3O6FC 3BFPA 2LNDA 4B75A 4CLHA 4WNIA 3QBEA 4UDYX 3FU9A 3PDDA 1DBJH 4IHJA 5DV9A 2VDRL 1AK9A 4PRIB 4BLTA 3W4JA 1D4OA 4FDAA 5EP1A 3G5VA 1KFKB 1RLWA 3D5TA 3IT2A 3I39X 4Y5YA 5G0UA 2Z7UA 1MBZA 5DMIL 4JX0A 4RWYL 1CZ8L 3TCLA 4GAFB 1SOMA 3HAEG 5K3FB 5C8XA 3O9WD 4ACTA 3VYSB 4AGNA 2J85A 5BNTA 4E11A 1AHWB 2G67A 4NZTL 1NLDL 5JCOA 1NUNB 5TFSL 3SJCA 3JATA 3FZUD 3ENQA 4K9EH 1WUYA 4M22A 3EIXA 1K8RA 3SZUA 4D4LA 3IAS1 2B94A 4OU3A 1O6SA 1CO1A 4UTZA 1LILA 2XYCA 1FJXA 5L0QB 3VW3L 4O02H 1ATIA 5FOBB 2GA9A 4YASA 4WI6A 5D72H 4ALNA 2UVEA 4UAOC 1E3QA 2FWJA 5DO2D 1QYGL 4XLZA 2Z4TA 1DSFL 1QRDA 5GGVY 3OQIB 4F8JA 3SVTA 2EZ9A 5AAWA 1DKOA 1JH8A 2C3PA 2CL6X 1J6UA 4D8UA 1KRXA 3C16C 4HHEA 3W78A 4ZCMA 4M7JH 4CVUA 3GFRA 2BJMH 1T8WA 4BM7A 3IRCA 4XWWA 5DXAA 2H1VA 2B7DT 1SVLA 2POCA 3D0QA 4YHPB 2A33A 1F11A 1JKXA 4LKCB 3D3JA 3H17A 3UWOA 4E4TA 1S96A 1Z35A 2F7QA 4DQKA 4BN4A 4OHMA 1T9CA 3OKWA 4HKBA 1W2WB 5FYLL 4NZUL 1QHPA 1XZ0B 2ZXQA 4DGWC 2IEGA 5F7BA 3KQQA 4CKEA 3AOGA 3OZKA 2VGLM 3WRXC 4DGIL 1NHGA 2YWDA 3H9JA 2ODIA 2FYTA 2H65A 2CKBH 4ZDWA 1EQUA 2M83A 4JFPA 3FQTA 1NN3A 5TE4L 1NCBL 2ZUVA 4GSDH 3KX2A 4Q97A 4ZFOA 2MYNA 1TLTA 2JCWA 1UATA 1XDBA 3DBSA 1U93B 4JG0L 5J57B 4QDOA 4ITVA 4LHSA 1RWVA 2ZTMA 4X97A 5I8PA 1DWQA 4KK9D 3IS1X 2R68A 4XUDA 1ZDQA 1R5OA 2NO4A 3DFIA 2Z4QA 2DERA 4BPRA 3VR1A 2A6IA 1CYXA 3QFDB 2J4WL 1GXSA 1I30A 1EA7A 2P3LA 2QR2A 4BU1A 4YHMH 2FZVA 5HM8A 2PV0A 3GU3A 3WNCA 4KZPA 1EKXA 5AB2A 2DI8A 5DM60 4LTNA 1LE5A 3MV01 4ZZIA 1PSZA 3QLVC 3KJIA 4AEIH 3KKQA 3MTXA 4WK6A 1CICC 3P9MA 3QZWA 4LRNL 2G80A 4H1WA 3B2UD 2X42A 2XWTA 2IP1A 3CH4B 4OVVA 1KLUB 4RY2A 1V7CA 5JRZA 4LAJH 5E8PA 5HKBA 3KXFE 4U1HA 1JDVA 1EUYA 3QXWA 3DTXB 5DJ6B 4NQZA 3EOZA 3IU3A 2FIKA 4BV3A 3EMVA 4O02L 1JLLB 2JC3A 1PZNA 2XTNA 4GOLD 4LQDA 3PFNA 3MX0B 4AGOA 1OW3B 1TX4B 3DECA 1FVDA 3QP3A 3D4NA 2I6UA 4K9EL 2Q45A 3KR9A 4UF7C 3KOUA 4GI3A 4OW6A 2FW6A 4HUQB 3CWCA 4JQIL 3WYBA 3MFGB 4DSYA 3MJGX 4LDNA 1T2VA 2OWDA 4GAGH 2DG2A 5EP2A 2NPLX 3GRPA 3KVNA 1UM9B 1ONQA 4QE3A 3IUNA 4MR8A 1FBIH 4AJ9A 4ISVB 3ZDYF 1OBHA 4GW4B 2HQ1A 3QVUA 2UYLB 1XH2A 1A4AA 4NN5C 1PVOA 3F58H 2J88H 5C0AD 2G0TA 3QFCA 5BWCA 3Q15C 1ULZA 4ZDHA 4PREA 1JJ7A 3GY0A 2QLTA 3LLCA 3EG5A 2OK8A 4IJWA 3QJ5A 2EP5A 5E24E 1PDKB 2ID5A 2XCMC 4AJYV 5GY7A 3WVNA 1NCCH 5FPIA 4NESA 2UWEE 1ETB1 4R5HA 1NVMB 5IK3A 1HFUA 1MTZA 3WKEA 3I4FA 1CUJA 2C4HA 3CFCH 3H5VA 2Z2ZA 2G9QA 2DE0X 3O41B 2PDAA 2WVVB 1I2CA 1AQHA 2DMBA 5EPUA 3T3DA 2N1TE 2VWPA 3KPSE 2MOGA 4C3VA 1HXKA 4EG6A 3FC8A 3KWXA 1UM4L 1NBEA 5I5IA 5K8IA 4WEEA 4U1LB 1U0FA 3JQ8A 4F38A 2REQB 5KQGA 3MA9L 2NP6A 2W2KA 4FNPA 3DV4A 4PJIA 3GFQA 2GLXA 1XGRA 4R2XA 4MUBA 4NQUA 3LV3B 3FKQA 7FABL 5B4MC 4ZVVA 3UPDA 5DK0A 1A3RL 4PGCB 2QVZX 2J41A 1ZCZA 3VPSA 3U4EA 1KNQA 4DP4X 1NWHA 2VRCA 3Q8MA 1WDMA 2VKXA 1BA2A 3QPXL 5D4JA 4MR9B 5T3XH 4MPJA 3DNPA 4RA9B 3DMMB 1GPOH 4JDVA 1R17A 1PJ8A 4PZPA 2WKGA 1NGQH 1DVZA 2QXTA 3SDCB 1VESA 1DQML 3C60D 2G08A 1TJ5A 1SNRA 2EKLA 3AEUA 3F3HA 1UCFA 3FRJA 4V3CA 5DJYB 1PNOA 3N53A 4RK7A 2QX6A 3WNLA 4F56A 2X5OA 4BUCA 4AKEA 3EXHB 4HAVA 1JS1X 2NPFA 5JOFB 4JGIA 4TLEA 4DNLA 1WPCA 1BVHA 4MCZA 4XVQA 3TFKD 2CXRA 5TDPA 3DCJA 3T8XA 2XYPA 5FYKD 2H2HA 1ZS8B 1A47A 4PFQA 1HZZC 4V0MA 3GLFE 3HZVB 2ZVPX 1PGNA 1NMBL 1CC1S 4EX6A 3HZHA 4PG8A 1BZEA 5DTMA 3E5HA 3ZWQA 4EGSA 3IDZA 1TZGL 4N03A 1XMOB 1Z1WA 2QTNA 3WZ2A 1MN6A 3ZYCA 2PO6C 1E58A 4XB1A 2F15A 5ACZA 4Q9AA 1RU3A 2BP0B 3QLJA 3C6LA 5C8JA 3V7AG 1PO7A 4GICA 4F84A 3ILYA 3A23A 3TIXB 5DNDA 1IAVA 1VL0A 1C9YA 1SVMA 3GB7B 2ATPA 3VDMA 3DGCR 2Q2QA 1IEBB 1KXJA 4WFED 3TWYA 3PFWO 4G89A 2D1RA 1CIPA 4O2FA 1BS1A 1ZA3A 2E5LB 1REQB 3APNA 3KXIA 5KN5B 1MH9A 4NNPL 2EFEB 3V4VA 4CQJA 1NLFA 1KJ9A 2JLQA 5JAZA 4OD1L 4XX5A 5AW8B 3WQSB 1Z28A 5I8CB 1QYDA 4LZAA 4EK9A 3PDHA 2FBJH 3SQOA 5BYJA 1Y4UA 5FGSA 3BGMA 3X14B 4PJBB 1THMA 1AR1B 4CADB 1EGMB 2OV4A 4NECA 2XEDA 3AI2A 1T5SA 3AUVA 1DJXA 4D8TA 4KRYA 5FFLA 3LT4A 2H2SC 4HJ1A 3TDNA 1UC9A 5EFIA 4GMTH 4JZJC 4O58H 4FYHA 3PVSA 1Z2CA 4WNJA 4TV9F 4JHWL 1WPXA 2IHZA 3B2DC 2CLVB 5DO2C 3ZRSA 5L9DH 1RQ2A 3A6HA 4OYHA 1R3DA 2VAJA 3NWBA 3NT2A 4NCJA 5FADA 4QDZA 5JCJD 1UOWA 3NA4A 2I0FA 1I9IL 3T99A 1IGJB 2C4NA 3LDAA 2X53A 1J2RA 1LP9A 2OCIA 4IJUA 3KJGA 5DDHA 3TCTA 3AKEA 1K3ZA 3DEFA 2H26A 3HU5A 2XT9A 3G79A 1JF1B 3CSTA 1ZQ1A 4YPFA 4ER6A 2XPYA 4YUWA 3T2NH 5DLLA 2VF5X 2WMOB 2XVYA 2X0FA 1WOYA 2EZ8A 3KWFA 1JBKA 3BMWA 2DFNA 4DP2X 3O21A 2C5HA 1RQGA 1CQPA 2R60A 3KS0J 2B4RO 3MSCA 2P26A 5HF8A 3D06A 5KAQF 3HZOA 2ORBH 5FX3A 3S48A 1SF3A 1F12A 1U2SA 2IEAA 5K99A 3ZOKA 1FE8L 1JPSH 2AZTA 1N3NA 3BQMB 1QJ4A 1TU4A 1BZDA 4M60A 2YWCA 3UUFA 5GJWC 1PNQA 4EGAA 4D9GA 4MZRA 5E23A 4JM2F 4XB6B 2BEWA 1ELOA 4NO2B 3W0LB 1RZQA 5I6PA 4ECAA 2V8LA 2WD0A 1QIGA 2CUTA 3AROA 4IZOA 1PZ5A 1LS1A 4E08A 2G4LA 1TMKA 1Y3HA 1ZPLA 2P5TB 3IDYB 1GRRA 3JAWB 1XX9C 1URLA 2VDJA 3UQYS 4P1ZA 3T15A 3M1YA 3AM3A 2XODA 3FPYA 1DP4A 2DQ4A 1REQA 3N1QC 2AB0A 1H4VB 1NEZB 3GLFA 4NVRA 4K15A 3RS3A 2CXOA 5KNCH 5FO1A 5AUOB 2BGTA 2WE8A 2PCYA 5ED0A 2XUIA 2XJLA 1HQRA 3RVJA 4G0MA 3T3PE 3RSQA 1DRWA 1SLXA 4YBLC 5DHVA 4OZGF 3RGVD 5JZ7D 1DQYA 1MI5B 4GX0A 3T09A 4HKXA 4JFHD 3DD1A 3B7GA 1Z9OA 4PU2A 1XU9A 2QSZA 2QDVA 3L3OB 4GH5A 1HNNA 2QTBA 3AF6A 2AN1A 2XZPA 2VUOA 1PYDA 3LLSA 1K3UB 4KRFA 3WDSA 3L92A 4QD2E 2J45A 4ONHA 2Z09A 3PHHA 2JEZA 3A24A 4RGNC 3O2JA 5KSUB 1Z7JA 4KKRA 1PJ2A 3CIQA 3PSAA 1OJLA 3OEHA 2H1LM 1EERB 3CZAA 2VIIA 3MAAC 1G6RL 1TYJA 4ROSA 3B8SA 3UBXA 2Z5LA 3FZYA 3V0WH 1LGYA 2NY0C 2EZTA 3TJPA 3RTBA 2A9OA 4LARH 4NWIA 3D0VA 1Z8DA 4OGLA 4G9GA 1EBFA 5DMXA 3BKML 4KO7A 1SIUA 3QZPA 3WFBH 4I77L 4I77H 1XLVA 3R3XA 3AGPA 5GV8A 3ISRA 3X1JA 3FE2A 5JZBA 3FVTA 5ELMA 5IB4B 3NYQA 3CBGA 2HT3D 2WZAA 1CG9A 2ZG2A 1Y1LA 4KFMA 4XMLH 1A3CA 1MEXH 4BIIA 3SD7A 2NXWA 4DLUA 4XODA 3V0WL 3VKFA 1WA0X 4IO1A 4V0ME 5IFKA 6FABL 1XGRB 2IPTL 3AUWB 2O8NA 4J8RB 1C5DB 4IKOA 3RUHA 5A1JA 2GERA 1FL5B 4E3WA 4DKEL 3FOBA 2Q5HA 4IQGA 3FNBA 5KDOA 1UH2A 4N68A 1UBKS 3QO0A 1OSZA 3CXDL 5AHXA 3LRXA 1RIVH 4AYBA 4MCZB 4H1TA 4K6OA 2E5FA 4JLDA 1HT0A 5K9ZA 5K0EA 4UT9L 4RY8A 2DRIA 2J0EA 4JT9A 4YRTA 2D2OA 4X24A 2RJ3A 1IY2A 1MI5E 2YJGA 3KQYA 3MWEA 1NCTA 2C9BA 3H4VA 4BVBA 1A1VA 2A1TR 4Z7QE 4D6YA 1FZOB 4QHKJ 1RRFA 1FHGA 1YMHA 3B9VA 3OGOE 2QVIA 3MRKA 4RABA 2OYRA 2FH6A 3P97A 1OCEA 1JHLL 4BQ6A 1Z37A 3IOMA 2R25B 1HA3A 3WN5A 1VPVA 3FNRA 3CXDH 2YCLA 1UD2A 4G5FA 9LDBA 3KSBC 1FSZA 4MX7B 3D3VA 4CPDA 5BOSA 1KK1A 1V6AA 4IRSA 2GCEA 1E4WH 2NSYA 4PR5B 3TW8B 4QR7A 4LLYB 3DGGA 1JZDC 1YAHA 2CJYA 4LDQA 1DN0A 1D6MA 4FS0A 5LXVA 4R90L 4KWIA 3O8XC 2WHEA 2BVOA 4FQIH 2FPMA 3D4GA 4H6WA 3K0SA 3FTSA 1GNPA 3JV5A 5EC1A 4YJFA 4LZWA 2Q1WA 3LXCA 4LKRA 3H75A 2HNBA 5D8DA 3U4IA 4NHCL 3F7QA 1FYFA 5AD0A 3O3AA 4BO6A 4PTYA 4QU8A 3TO4C 1U8MA 3Q8WA 1MVUA 1PLAA 1PG5A 3VR2D 3NJFA 3RIFF 1GCGA 3QIWA 3KNBB 4BNWA 1MVNA 2H4WA 1G2PA 2ZRAA 4L2IA 5GGQL 3LY5A 2M6KA 5AW6A 3ZX5A 5AAMA 1NDGB 1LO3H 3ECCA 1DVUA 3UC0L 2Q7YB 1ZM7A 2AC7A 2QGCA 2H29A 1ZHBB 4X4YB 4L4TB 1RUQL 2FPIB 1A82A 2PJZA 5K9QG 1U2GA 2H07A 2A3NA 4U6VL 4J4HA 4M0KA 2NQ2C 4LLYA 2D5IA 4G80A 2HKIA 5EL0A 1U91A 5IOPA 1AA9A 3MGKA 2QIOA 3UGQA 4Q4JB 1RKQA 2Y06L 2DQGL 1S1CA 4HZGA 5CD5D 2OK7A 4JLOA 4ZPVA 4YRMA 3QEQA 2J0QA 2DQIL 4DF3A 3N43F 4NQSB 3HE6A 3NETA 4Q3AA 2SECE 3ZUCA 2VR5A 3GELA 1DUZB 1ZA2A 4FXTA 3LTNC 3VO9A 4JNXA 1VM6A 2GZSA 4HP8A 4X5OA 2I5PO 1L4GA 2RKOA 5F2KA 3WLFA 2R0ZL 2ZWKA 1SHTX 3MWEB 1P7KA 5DTQA 3VFRB 4GZLA 1KACB 4GSUA 4HS6B 5FFOA 4GI1A 2OM2A 4B5LA 4MKIA 4RDBA 4JFPB 2I78A 3U4EB 2PH3A 3DUUA 2G1KA 2P2SA 3QR2A 3LUKA 3L48A 3UTTD 2FVXA 1DCMA 2GBFA 3WNIA 5F9WC 5EIQA 2GBVA 1W73A 1X1DA 1IBHA 1JPUA 3O3NB 4IKEA 5CG1A 1IY0A 2AZ4A 2BTOA 2WBXA 2UZYB 4PQGA 2F58L 2J6CA 4AMYA 3ER6A 3OQ6A 1NC2A 4AMWA 2BFVH 1QP8A 2VAAB 2W2LD 3CJRA 1PF3A 4L74A 4QSMA 3QXHA 4YC2C 4R2GB 3I2GA 5IEKA 1Z4KA 3ELUA 2G5PA 3GDBA 3UBMA 1ZANH 2X4UB 3U1BA 2G1UA 3LKBA 4Y2UA 1BJRE 4ODBD 1XHLA 2WXIA 3Q3IA 1SHMA 1YEHL 1QGUB 2ZGVA 3ZWPA 4C7VA 2IYPA 4PJAA 1CF8H 3BKCH 3W9YA 3PYMA 1BF5A 4ZQTA 3E48A 2E6JA 5LYJB 1HSZA 4WXYB 2O6DA 3PX3A 4X8XA 2ZRPA 1FG2B 4IMPA 3RS7A 3LKOB 1PFQA 1KGCD 5CSGA 2JK1A 3UAGA 3AJRA 3G2MA 1OX4B 2YC4C 4JR9L 1BQ4A 4TQEL 5KNBA 1Z6XA 1PIWA 1ZEAH 1TG8A 3RI5K 1SIBE 4JANA 1XD1A 2ZE0A 1EEQA 5ABZA 4Y2SA 3SPCA 1SZJG 5L3RA 4JHWH 3SKOA 2ZXWB 4TVOA 4O9HH 5J8OA 2R39A 3HC7A 3AETB 1Y3AA 4RH4A 4JJZA 3WIIH 2H8GA 1ZM3A 1BFOB 1EBBA 4Y9CA 1S9VA 1V4BA 1NOIA 2JHAA 1G5TA 3H5NA 3BL6A 1Q7GA 4YFVA 4WKZB 5EBMB 3ODPA 4CIBA 2LCIA 2QA5A 1CU4L 4A2CA 2AAAA 6CHYA 3J81A 4U7PB 1Z9SB 3SSMA 4N18A 1GQSA 4G0XA 3ZDWA 1B4JH 1OFTA 4L75A 5AKZA 3P9KA 5BR1A 2HYDA 5E03A 4M8QA 3V6LA 1VJ1A 1A4JB 2RHDA 2ZUUA 4I19A 1ZRNA 2IIBA 3L9XA 4JRXD 3R2JA 5KJCA 1IBKB 1HSBA 2HTLC 4V0OA 4FQ2H 3M2TA 1NFAA 2N46A 4CG0A 4ESOA 1RYMA 3TPFA 4XCCL 1A4CA 4BQCA 5GRUH 1XO1A 3CDGB 4J0FA 1L9RA 3OZIA 4UQEA 4PC2A 2MTAA 2CVQA 3N40P 1PX0A 4UTVA 3U62A 4DV7B 3I5UA 3GLHE 5KDLA 4AKTA 4N48A 3WWYA 2XGSA 5DRNB 2QZ4A 2CXQA 3BXNA 4Q4CA 1GR7A 4D9RD 3UTZB 1ZPDA 3PPWA 3OZXA 1DEAA 4CFYA 4BQBA 1A9EB 2BW4A 1BE1A 3BD4A 3NSXA 2CXUA 5AR1A 5F96L 4JZNA 2WI8A 2RK4A 4HZ1A 5CLWA 3D2AA 4NZ8A 4YGVA 1QMUA 1I9GA 2O8EA 2LV4A 1Q8MA 2UYLA 3IJHA 4LVHC 1NGYB 2C1PB 1CIDA 1L1RA 3L6EA 4JYZA 3HXKA 4XNYH 1C1XA 3KCNA 4D41A 3DXAE 2F8OA 3A31A 4WFJA 2CGRH 3T1QA 4B09A 5HHTA 5G2NA 3HFML 2I4LA 1BQEA 2IFFH 2G2RA 3F78A 2Y2TA 5EHXA 4TUYA 4LXFA 2DOCA 4XRCA 2NY5H 5DJ8B 4WXEA 3TLGB 1X7WB 3EO1A 1ZD8A 5FWDA 3AR3A 3O9WC 4UIMB 3DAGA 3CX6A 2EZ0C 4ZS6D 4Q8BA 2HT3C 5JZOA 1HNXB 5DI8A 3HFSA 3PIQB 5ILTL 4TKWA 5AZEH 4YMTA 2MTPA 2R56H 3P4MA 5F21B 2QR0A 2NXNA 3P0IA 5IHHA 3ZYJA 4ECNA 3LBFA 2K3TA 2IANA 1BCSB 1V25A 5H3HA 4LL9A 2JXMB 1TQBB 4LPVA 2KLBA 1QVOB 4IJTA 5AUMA 2X4IA 2D9QB 5FBHA 4XN7A 1S8DB 2JWHA 1RYZA 3EC1A 4AVKA 5G53C 3Q7RA 2I66A 1A9BB 2DM7A 2R23A 3SBWA 2A5YB 1RP8A 4N7RA 2J5LC 3MV9A 1KTDA 2AWOA 5D9SB 1JHKH 2ZVQX 2JKTM 1E62A 5HY9A 4YXWA 2QGEA 5BPFA 2QUIA 2LIVA 3H8NA 3KWTA 5PGMA 3HNTH 2Y1WA 2A0YA 4JGBA 3SN6N 2EGHA 2B6HA 2C1XA 1V2GA 1CNFA 3DZHA 1VZ2A 1KPHA 1U9ZA 3PPYA 2YARA 2ZOUA 3T2PA 1EHIA 1U8YA 3ETTA 4M6MH 5IJCC 2OCLA 4AENB 3QORA 2CBTA 1RLOA 1KYXA 1FH5H 2XNDA 1JK9B 2GXSA 2NIPA 4EO5A 1BAPA 4LLDB 4QSHA 3SDAC 1GDHA 1YHPA 1KVSA 2AJZB 1OGTB 5FM5M 1V4NA 5ITZB 2FI1A 1QW9A 1SKBA 4IV0A 3ABQB 4PY7A 1H3WM 3NW9A 3IJ7A 1QWHA 1QIMA 3T7RA 8MHTA 3A3YB 1OGSA 1DI0A 3UYRL 4ANXA 1A5AB 1WDKA 3CPSA 1TNDA 3HAEH 2X1QA 3QH3A 5AUQA 3C3EA 2VZ3A 3D5OF 1XEDA 2RIPA 2WP3T 4MJIA 3I1IA 1RYEA 3SJUA 4ZVRA 3K0HA 2PYIA 2W42A 3W1EA 2FL5A 5C09A 4GQAA 1SELA 2IMMA 3NZHL 3OSZA 1SYVB 3ZQWA 3FK3A 3I5MA 4BVEA 3DM9B 4AITA 4EY4A 5LMUB 1CUIA 2H2AA 3DIVA 3T8MA 4BXVA 4UDUA 4NM4H 3UAJA 1U5AA 4JYBA 1H22A 1ES0A 4FOTA 4PZYA 3R8QA 5E8DL 1M7HA 3S7ZA 4G8AC 3PFUA 5EHNA 4DH2A 1PEDA 1KGIA 3I42A 3II1A 3FMOB 1JN6A 1L2TA 1X4XA 4M8LA 3LEXB 4UVIA 4LRNH 5LUMA 5KWSA 1PYGA 1SN2A 2BZSA 4FFWC 1JK8B 4D9QD 2QSJA 2P62A 4N85A 2EBHX 4L07A 1V7NL 1J8YF 1S8NA 1D3AA 2EJVA 3ASWA 1CY2A 3LVEA 4MWSA 5TDOB 3HAEB 3JATB 2CHZA 5DJ5A 1RZGA 3VPXA 4MS4B 1TLLA 4LXIA 3TBTA 2B4CH 1HO3A 2QTGA 2CKBB 2WOJA 1SZDA 1GZQA 5AVJA 1JXKA 5ALBH 3SF8B 1ULAA 1S2OA 3GGGA 5GQSA 2ZUEA 3F6JA 6LDHA 1B2WH 4YLBA 2XUQA 3CLTC 2KZKA 4Y2GA 3WQHA 2JFCA 3KBPA 3CMOL 1N0VC 1A7NH 4FCAA 2VDWA 1GSHA 1E2HA 2VPYA 2NYAA 4QAJA 4MV1A 2Q9OA 3GMDA 4FKKA 5IHUL 3KXLA 5JAUA 1D09A 3QUMA 1JAEA 3MA7B 1YCFA 5I1LA 2C9AA 1UZ8A 3NK3A 4ZFNA 1NGZB 2VLKB 2BM0A 2N01B 4P7FA 1VENA 3FTDA 3H0TA 3S4SG 5FDYA 1O95A 4K7FA 5DUBB 3NAQA 3TIIA 1LNUB 3WKMH 3ZK9A 4UDUB 1M0SA 4G4GA 1A7AA 3N76A 4NZUH 4MCJA 2W98A 4J2OA 1G8YA 4BUHA 3DOCA 4MINA 4ELMF 5KVVA 5IT0A 4PZAA 3LMJL 3VNVA 4R51A 1RABA 3C6SB 2V7WA 1TC2A 3GWZA 1QO3B 3JV6A 4LKXA 3WY3A 1E9OB 1WS6A 1ZH8A 3O8BA 3SPIA 3US9A 5AM3A 3RHFA 1FMCA 1JPFA 3DLQR 2XOEA 5KOYA 4XPBH 9PCYA 1CLZH 5A2FA 4JR1A 2PBZA 1FZQA 2GBCA 4OTXH 1H85A 4QRHA 1V7QA 3EJPA 4O3FA 3AP3A 5J6HA 3OD5A 1VIVA 4P9HH 2BGKA 1G7CA 3TAHA 3L3KA 1SCIA 4BNJA 5JPMA 1U9KA 4IDJH 3D4BA 4UEOA 3EH4B 1WMEA 3RVUD 4DJEC 3SLKA 4NZZA 3IAAA 5DI3B 1Z2EA 4HY3A 2KH2B 3RFZB 2VNJA 5GHWH 1AXTL 2AG6A 2X09A 2WHYA 2H41A 2ZUCA 4W9ZA 1I7RB 3HDTA 4NO5A 1NAML 2BIHA 2E4UA 1UA7A 3QHQA 4QYWA 5FNVF 3WYRA 5JFOA 2Z9BA 3VI4B 5E3IA 4BNIA 3GHYA 1HT1E 3V52H 4PY8I 4HBQA 1QFUH 5DZOA 3G5LA 2ZYWX 1A9XB 1DQVA 2J09A 5E8EB 1BE6A 4GW5A 1Z9NA 5C3MA 3LQRA 3TCXB 5KVFL 4HDNB 1A7QH 1KYOK 4IIUA 4YJKA 3TQFA 2WZBA 2YVKA 4DPLA 1HEHC 4IR7A 2BEUA 3NRJA 4Y1GA 2ZETA 1RFLA 3DHMA 4MQ7A 3JARA 4AJVA 1I85A 1RULL 1BGXL 4ABWA 1TD9A 5GJCA 4P9ML 4FGKA 2SHKA 5J23A 4B4WA 1YVLA 3QHZH 4OLYL 2QN2A 4CTNA 3QWOA 3D4LA 2VW7A 1PZSA 2XTJB 3PABB 5C1MB 2V5RA 1F51E 4MYCA 3FZQA 4AJLA 4F06A 3BC1A 3OE4A 5DU7A 4EBFA 1QR4A 4A0SA 3Q3VA 1E1QA 4J07A 3U0PB 1L7OA 4Z5XA 3HS0B 2POQX 4ZAKD 1WZAA 2I33A 4AH2B 2QFPA 2JAOA 3DEIA 5F1OA 1T7WA 4LPYA 3WBDA 1TVHB 4IGAA 3SDDD 2Y6TE 3RU9A 1C7EA 2FSVC 1V48A 2P28B 1XVLA 4F8YA 1IM3D 4EZMA 1IWBB 4XCFH 4M0CA 1CZUA 1SJXA 4QBHA 5F71A 3M5PA 1EFXA 5FLYA 1EGAA 2EXSA 4LQLA 4LYGA 1MXDA 3D33A 3STLA 3DLTA 5EULV 1L9KA 3ZD8A 3OGCA 3H9SA 4NCHA 2ECPA 5I1EL 1EFPA 3UEOA 2ZIUB 2EEFA 2JTYA 3V4PH 1E63A 1C08A 2AVFA 3B5JA 3N2IA 2O3UA 4DC9A 2O5XH 2VQDA 2W95A 1ZSDA 4FA6A 1R00A 2AHOA 3VI4E 1KRWA 4MVJG 4YHYB 1BVRA 2YJTD 4K3HA 3LNHA 4HMOA 3T06B 5JOFA 3ASUA 3U7EB 1PGJA 3LH2H 3VR2A 4EUFA 2NO5A 3BAFA 4FNSA 1CIJA 1GGJA 4HGWA 2W2PA 5FPPA 3O6FB 5F7HA 3MRDB 5G4LA 4NWTL 3VR5H 3GA0A 3OZFA 5HDOA 4XPFL 2XWJI 1IUNA 3SICE 2P9QA 3X12A 3PFBA 4FIZA 2QUKA 2P2DA 3LZLA 5F9AC 5K3FA 4KMMA 3PDUA 2C7FA 1G16A 3HE3A 4OK6A 1ISHA 5IHWA 2O1SA 5EINA 4WSKA 1VP3A 3KP1A 3T7DA 4M6OL 2KBEA 1AOXA 4DW8A 1E42A 1ZI6A 1E6CA 1URIA 2D9CA 2JIXB 3ILDA 3UMBA 4WKZA 4PJIB 3ISYA 3GKZA 4YH1A 3MLXH 3QG6B 4JS0A 7AT1A 4CCYA 5TEWA 4ZI3A 3LTEA 1QAWA 2EDDA 1Z66A 1FLNA 4NUPA 3QDAA 3CZ4A 5CVUA 4R98A 3QEAZ 4FNUA 2VJLA 1SOSA 1BG6A 1OSPH 1MW8X 4OXXA 3T9FA 4BCYA 4RIHA 4ZXBB 1Q22A 5HRUA 3TC9A 1V16B 3W8DA 4F58L 2XB9A 1YEGL 1UZAA 5JNVA 2CJ3A 3ULAB 5GVSA 4PLOB 5DMGC 3GEIA 1ONPA 3CW9A 1NCJA 4LJLA 2NTSP 1EFVB 3IEUA 3AF5A 2C7PA 3B4NA 1W91A 2PAAA 1YR7A 1P9OA 3ZGIA 3U61B 3B1FA 2P8SA 2IH3B 2OMTB 2H2PC 5B38G 4EVIA 3T1YB 3R3YA 2ILTA 4WUUE 5AWNH 1GS6X 5F7EH 2VZOA 4DKFL 3TEFA 2UXFA 3THYA 3D85D 3LDHA 3QF7A 1IEXA 2D4FA 4PXYA 2KE5A 1ZU4A 3FB7B 1UFOA 2C9YA 3GTNA 4KN6A 5CW1A 2RG1A 1J1PH 4ZAVA 1IM9D 4KO2S 3ZU2A 3CEJA 5DRWA 3ESMA 2FX7L 4L76A 4H8HA 1XAIA 4P2YA 4OHOA 4PLPA 4JFSA 3UIZA 3DE2X 4OUUA 1W6WA 1BD4A 4FMFA 4JB3A 3DB1A 4KOBA 4QAMB 5AICA 1CEQA 5K3SA 1AQIA 4K81B 3I9NA 1EK1A 4I2NA 1HG0A 2A9FA 1BXGA 1ZKDA 2BY4A 1QG4A 3SU8A 3OM0A 3GFVA 2EYQA 4LJ6A 5JCZA 5DHMC 2XOKD 5LJYH 4HFMA 4JQXC 1R6UA 4OGKA 3RODA 5JG7A 1XDUA 2D3NA 1JT9A 1H9DA 3VXKA 1Z68A 4HVLA 1L5SA 4QRUB 4ITRC 4HEA1 4QM7A 5C07E 5AHOA 2NACA 2J8UE 4YDKL 1DAHA 1JMVA 1U28A 2H11A 2Y9RT 4MMXA 1CERA 3EC2A 3AHJA 4AYGA 4DVBB 4X0KB 3M6AA 5K20A 5CIPB 2C5GA 5J56B 5J11B 3T04D 4N47A 1ZV9A 2VQTA 5HDQA 3SGKA 1NBCA 2Y0EA 3Q1KA 5CRIA 5F7MC 1ILEA 3RDTB 2EDCA 4KLCA 3RL1B 1PVDA 1ZONA 5HQ3B 1R88A 5DTRA 1JR3D 4PLWA 3FQWA 4NZYA 3QG5A 3AG5A 4Y2VA 4EN3C 2AZXA 4WW2A 5IUNC 2O5ZL 2XKNA 4Y1RB 4FI7A 1LTHR 4TQUS 1YPZA 2XI9A 3UK0A 3VO2A 4PQEA 1H5BC 2W9XA 5FM5O 4PN6A 4HETA 4JWKA 3BEWB 3Q6FB 4OJEH 1TKCA 4QOHA 2D7TL 3DBHA 3QPUA 4EP1A 1D8AA 1WM1A 3U30C 4YQFA 1IHDA 4M1CD 4HWSA 3OLYA 5AT1A 1XFPA 2WGNB 1GEEA 2EC5A 5JDIA 3V00A 4NEGA 2GEDA 1MHPL 5SZHB 4K0OA 1VRCA 5CU9A 1YTLA 4JO1H 2VT7A 5IPFA 3GP8A 2R6JA 4JFFE 3PJNA 2X4GA 1O0CA 3HN5A 2YOFA 2ED9A 5BY2A 1WZMA 4OCLC 3GFBA 4JO2H 2RK6A 4KE8A 4GKNB 3TJZA 4OJYA 1BKSB 2OMNA 1VSVA 2F6AA 4Q24A 2YWXA 2LW7A 2JI6A 3HBAA 3LHPH 4FG4A 1QFUL 2IGFH 4M3KB 1KIAA 1UPAA 1OO2A 3JQEA 5FBVB 4F5CA 4AG4H 4WJ5A 4KO8A 4FEAA 1W1UA 1SPBS 3KCPB 2I26N 3CDZA 5KVDH 4QRFA 3AO0B 4QOKE 3H5AA 3FYEB 1HQ4B 1NFDE 3TO4D 1M3SA 1L5WA 5K69A 1WC7B 3UYKA 5C0AB 2HRZA 4GBXD 5LDGA 2AVDA 1E67A 4MQ4A 4LLMB 1Y1RA 1EAQA 3ATBA 4PJ7E 3VRIA 2BCEA 1KFEB 2H6EA 2MFNA 4QNMA 2WT8A 4YT4A 5GZOA 3INTA 2FW7A 3PKIA 4ZVLA 3ZU5A 1SXQA 3JVGA 2DWCA 1UK6A 4AYFA 2O6CA 4UDXX 3AR2A 1TO4A 4MROA 3ICOA 5F4BA 4PAQA 5DYFA 3TU6A 3N5AA 3AY7A 5ISMA 4XNUH 3MRPB 2AMLA 3HW7A 4BNDB 1C1DA 2OMZB 2BOLA 5IEHA 2FSHA 2MCPH 2VJOA 3CJJA 1XCTA 3KD2A 1KE1A 1OM3H 1T8YA 4BLSA 5L88H 4BRSA 3MRMB 1ECPA 1CDOA 2I4RA 3KZVA 3BH6A 2IKQA 3PSHA 4UAHA 3QZMA 1C2TA 4LTDA 3NC0C 2LGNA 1QRUA 1DJYA 3CCCA 1SN7A 3K6RA 5I3ZA 1RJYA 4I66A 4XM0A 4EI2A 4CHTA 1NEZG 5DQDH 4B7LA 4HMQA 4I7EA 5JVDB 2E4TA 3KDPA 5AVRA 4ZW8A 4L1LA 4Y9EA 3EBGA 2ZX5A 1K5PA 4QEZA 2Z93B 1UWEH 2VYVD 2P0EA 4N0CD 3NIGF 4KXYA 5L7TA 5CW2A 1EVTC 1OAQL 1R0WA 1MO6A 3DXYA 1XCOA 2IDTA 1C8QA 1E64A 1NCBH 4F2HA 1U9IC 4AGLA 3MXWL 3X2SA 4UCXA 2XW6A 4H1LB 1L5OA 3G68A 5JHHB 4N0UB 3LF1A 4GBJA 4O4JB 3HA5A 3LX5A 3M33A 1Z6GA 3N70A 1TCUA 2V1XA 1Q38A 1S9WA 4F8QA 1IN4A 1DAKA 4P98A 3I3BA 4EGCB 5T4BA 2IT1A 1XNHA 1YZVA 4MAUH 1KO5A 3A25A 2X2UA 3PNMA 3W5UA 1DTWA 1C7SA 1QI4A 2F53E 1ND5A 5IQMA 4GR9A 2EDNA 2QG9A 3H2IA 1XPJA 3OAUH 1KHTA 3JARB 5IHXA 4JGMA 4P23A 2QVFB 4D0DA 1S7UB 4PJ7B 1P0PA 2H92A 2Q7AA 3VX0A 4PGDA 3VJKA 5LAPA 2ZIGA 5I1IH 1UURA 5IVNA 2R0WL 4XGKA 2B34A 1DWOA 4UHFA 1Y7LA 2HPAA 4RPJA 3RG1C 1ZLXA 5HIIA 2PYDA 4TV3A 5BRPA 4LP8A 4NKRA 3D6MA 1AKWA 3F0TA 4FEEA 3AU1B 3B78A 4G6JH 1O77A 4ZTEA 1PVHA 4TWIA 1JV2B 3FTUA 1FC0A 4ZFQA 4WOJA 3SS8A 4TTDC 4B7AA 5CT9A 5FHRA 3KPQB 2IXEA 3E5MA 3D9QX 2APJA 3DX2A 4NP4L 4LJYA 4M1MA 3LLMA 1UJ4A 3WHE1 1FRGL 4HDKB 1I5RA 1K5NA 2WF6A 1KF9B 2PNDA 4NZJA 5FF6B 1UKSA 5GGRA 3WY9A 1ZJBA 5JNWA 3EAFA 2BSSA 5IW6B 1WUHS 4NU0A 4RWYH 4OFVA 3PHJA 1DP0A 4I88A 2QQGA 4M5ZL 3J81k 3BUIA 1K97A 3G6DH 2CLZA 1A7KA 5E2IA 2NSJA 4NC9A 3ZDXE 3EEIA 1KJ3H 5CG2A 5SX5K 2TAAA 3PUCA 2I7DA 2NVUB 5HYEA 1MUUA 3DAYA 1XKXA 3U7QB 3U83A 1E5UI 3LCUA 2XN1A 3MSPA 4EUSA 4MDJA 3NJNA 3KVVA 4K4KA 3NAZA 1Z0IA 3EJJX 3WO1A 3F7VA 5D1XB 2QMYA 4RQUA 4NQXA 3UOAB 1WE5A 4YJHB 4DKDC 2YMMA 3KZXA 2X4OA 4IPTA 5IROC 3ZTEA 5L45A 2GAOA 1B2YA 3CZFA 3VZDA 5DLQC 3ESBA 2A2ZA 1PX3A 1QU3A 3CUKA 4BRJA 3IUYA 5KW9L 4LIQE 1JDNA 1OAOC 1UADC 1LQUA 2RA1A 4UM9D 4XVOA 1HDZA 3UJ8A 1DQDL 2V9TA 2JFQA 3WL9A 2Q1TA 5GPBA 3EARA 4YSDA 4H2AA 2EDTA 3LECA 4P4SB 1D5IL 1F4YH 3R7NA 4ANUA 4QTHB 4B83A 1U7WA 3L7EB 1YZFA 3P69A 1B3JA 5FOVA 1KJNA 3S5LB 4BMSA 4HGQA 4NI5A 3GSNL 3H42L 2E9BA 1D7FA 1U3GA 1M2VA 3ORYA 1T43A 4FFVC 3OJ0A 1PR0A 1UEIA 4MQLA 2F2TA 3I9V6 1O9VA 3P0FA 5DM4A 4NHEA 2VZ9A 2MSNA 3BIJA 3UADA 5F44A 5D1ZD 1OLLA 4RZQA 4CVWA 1P7VA 1ZD6A 4CTKA 4FT4A 2LVBA 4PYKA 2QN3A 4ZV7A 3KPLA 5FBKA 4N8PA 4HAUA 3K0FA 4HBCH 4WW2B 1YSCA 1MDTA 4HLZH 3HJEA 2I6XA 4MDEA 4CU6A 4PBXA 1SEBB 4NN6B 1ZIAA 4MLIA 8FABA 1QZUA 1T10A 2KLHA 2OR3A 4ISCA 2Q9UA 3RTEA 2DJ4A 3QUXA 1JIVA 3HH8A 4UNTA 1XMPA 2BP8A 5DI9A 1M9SA 1XAKA 3RFUA 2IPUK 5A0VA 3WLEA 2BVUA 5B55A 3DYPA 4C05A 1OWPA 4QOKA 4U0RC 4MDYA 5IQLA 5I24A 4ZI7A 5D1XE 3K7EA 3H53A 1IAOB 1FIEA 3VPFA 2OJZL 1HQKA 4ICIA 4CKQA 4ND2A 1E6OH 5IN5A 4HWEH 3ZG6A 2OMXA 5I71B 1XR3A 4MJ4A 3NT5A 2HQRA 3L1VA 3V0VB 5JHLL 3FKUS 3Q8BA 4EHDA 5IK2D 1Q1GA 4POZD 3QI9A 3VXSE 1Z7YA 4IRJC 4I50A 2XMDA 2FPGB 2QZZA 4D26A 2EYRA 2ZWMA 4F2FA 4KH1A 4LDRA 1AC6A 1HLDA 5I66B 1LNSA 4BMVA 4YWGH 2PKYX 2FQFA 4FYRA 4NHOA 4TNEA 1IC7H 3F5FA 3KKZA 3RLIA 1M57B 1UWLA 5J4HA 4XX1E 4XN4A 3D2CA 3D85A 2BFDB 4EIWA 3TFQA 2D2CC 2GZ3A 1N5MA 3MRNB 4A6YL 1L7DA 3RYHA 3PWLA 1EFHA 1NU6A 2V0AA 4ITUA 4LHUG 3BTSA 4DM7A 2BDNL 3BMVA 4PF1A 1YS4A 5I7OA 4ZFZA 1OUMA 4JHLA 4ZEWA 4CM8A 2QZQA 2Q0SA 1FFDA 3JTMA 5IBQA 1A5TA 2BUBA 5IJ0B 3CU1A 4WFEE 1QBGA 1F02I 3K0EA 2LDBA 2R1YB 1MHEB 4QRRB 4OCXL 3EZYA 2XXBA 3K0AB 4UIKH 2Q86A 4G3XA 4QXGH 4ETNA 4OB7A 3WDJA 4I0PC 2AZUA 2D7CA 3D3WB 4BZ1H 5E70A 2J4FA 5K9JL 2MMCA 4M99A 4XZUB 1PLCA 5ECJE 3FOCA 4JUBA 4FJ0A 4KR2A 3CUPA 2FN8A 5GRYA 3KPPB 1UXWA 3CYFA 4MXQC 1MWAA 3ZY2A 4Z0XA 2R1TB 1NUSA 2BEVB 4U6TA 5HDQH 1U80A 3D1MC 4CRWB 1I4FA 1CTMA 4N5UA 3ROGA 1E92A 2XY2A 2EJCA 3PCXA 1X5YA 3PEEA 3STHA 2WVTA 4GW4A 4TV9B 3FPSA 3UAEA 5DNYB 4Z3TA 1JHYA 4ZJ9A 3HZYB 5MFPA 3K4DA 3TTYA 4AVJA 5BOPA 1SRQA 1U8OB 4J0KA 2BEWB 3GPIA 3PJSA 3TLEA 3SYKA 4JLRB 5KYUB 3SSGA 4DP9X 3RJTA 2GT9B 1VFAB 3ULVF 2XPZA 1UR5A 1WPRA 5HR5A 4ZUSA 4OAWA 3LTVA 5DJYA 3VXSB 4MW1A 1E98A 3UICA 5DD0H 2VDPB 1JGVL 1J1XL 5M04A 4EKYA 1T5XB 1BQSA 4HDSA 4IIJB 3QYJA 4PYOA 2WG2A 4J6EA 3KBFA 2BCMA 4AK1A 2PH1A 5HYJD 3M1AA 2XA8H 4AZWA 5DCYA 1TNNA 5LGHL 3KYBA 3AFCA 2H47C 2W0MA 2DICA 4I1VA 4F3TA 3GZOA 1NMQA 3X1FA 5E2TL 1QLFB 2A9PA 1Y6RA 3FB1A 4WLCA 4LJ4A 2Q21A 1HNZB 1FYWA 1WCV1 1HINL 3UDWC 4YAEA 4TUJA 1ZGLM 2XMSA 3IPEA 3NORA 4XR4A 2W4QA 1J23A 3ADDA 5LN4A 3WKPA 1I4DD 4EKJA 3F2VA 3IJEB 1OLOA 3KB6A 4BEWA 4PCTA 3K5HA 5ICYA 3DHVA 1L6XA 3MBIA 2KDGA 4MVJP 4HALA 4QOEA 5I15L 1QQAA 2HWWA 2AW2A 1R2QA 2CB0A 3PTAA 1D6VL 2VDLB 2OD2A 1QLWA 5EU4A 5K4HA 4W9MC 1I0ZA 5LCVA 1N9GB 3S1SA 5FYKU 4UV4L 3QHFL 4LMBA 2B0SH 3OL2A 3QO1A 3N40F 4F1WA 2V7NB 4KACA 2HJHA 3UPRB 3HI5H 1Y6KR 4Q9IA 4OZGB 1QFWH 1DBBL 2TECE 1KF0A 3KQOA 2OLDA 3BD5A 2QKYA 2XXGA 4KAAA 5LL6P 1GG8A 3SP1A 5JD6A 3PXJA 1BTOA 1UFQA 1EXDA 5DD1L 3HNOA 5FHAH 3W7BA 3IDNB 1P1IA 1HQCA 1VG9B 4IIGA 5J3HC 5C8ZA 2OL3B 5BXFB 1RJGA 4P23C 1LBQA 4KI5E 4C76A 5BV7H 1R15A 3H9ZA 2DI7A 5ERWA 5J2UA 3HR6A 4XOEA 4HUUA 3EODA 4HIXL 3K46A 5EXDA 2C5AA 2VJDA 3ABKB 3MCWA 1A6WH 1MKFA 1UG9A 4NXKA 4YHPA 1N36B 2BIPA 2ITEA 2R84A 4QXTA 1A4KA 3T41A 3UT0A 3RWHB 4OF5A 4GH7B 5IC5A 4ZRDA 5DRYA 1OP3K 3SR3A 5C70A 3UMSA 3O6LH 1KXQE 1LP9F 3USCS 4EI8A 1U8KA 2BGRA 4IIDA 3L9RA 4QRPD 3IR6A 4X91A 3FX2A 4ID3A 5DJ6A 3VA6A 4DR5B 1QUPA 1NUFA 3SR0A 1WMBA 1OV6A 2YVAA 3TM5A 5E99H 1TJIH 1ZPUA 2XWBA 3FQ4A 2X44D 1KIUA 4P4UA 4YLGA 1WEKA 5CA0F 3V8MA 2Z30A 3P9MB 2V55B 5ES4B 5E6UB 1I3GL 1NW7A 3OPYA 2ZAIA 2F1RA 3WQBA 1SR8A 3H1EA 1NVWQ 3CEPB 4MAYA 3UHAA 4Y18A 4JUAA 2VXQL 3V7UA 1RAAA 1PX2A 4QHKI 3UJHA 4D02A 3GMTA 2WIAA 3FKJA 3FNIA 1BW9B 4EYQA 4LCWE 2J32A 3DX0A 1UDCA 3LVRE 4OU4A 1B2RA 1ZUD1 1KVRA 1ZJ5A 3DO3A 1DXOA 4P4KD 3W0WE 1V7ZA 2YS4A 3BH9A 2Y72A 1HE1C 1MFAL 3L9RB 5FQOA 4EYSA 1MG3C 5IGXH 4G0UA 2Y2YA 4RA3A 1QHQA 2J7KA 1JU3A 3LEYH 3OEWA 2XQBL 1AGYA 4TRPL 4P86A 1OVZA 2FZ3A 4H8WH 3TVMA 1OA1A 1Q0HA 4RTOA 3MUOA 4DMCA 3CFJB 2OR9L 2CD0A 4NS1A 4GSRA 4N6QA 2X8JB 5D3MA 5J3JA 3K80A 5IXSA 2PX5A 4MAYB 1JG2A 4MXWH 4P7JA 1H8EA 1TKWB 3Q2KA 4ONEA 2QELA 2NTFB 5DIFA 5IFAH 3TUJC 3JTTA 4MX7A 1LSSA 3KAAA 3CBJB 3N2KB 3IQFA 5KTEL 2AFRA 4G83A 2BK8A 2CUAA 1XF3A 5I82A 4G0OA 1NIEA 3L3HB 2JH3A 5CT5A 2HDNB 2WVHA 4WLOA 4YJDA 1M7IA 1AKNA 2JFWA 1SQ2N 4IQ4A 3W9DB 1CG6A 2X89A 4OHBA 2LFGA 1T5IA 1DN0B 4H8PA 4GO8A 5JR3A 1D7BA 4PVDA 2VXCA 3ICCA 3L4BC 3KR3H 3WNOA 3K0AA 3UGUA 4CNQA 3W5CA 1OH8A 2ZCKL 4BVGA 4TMWA 4OI2A 4DSAA 2A6DA 4RGNE 3WADA 2DL2A 3CKLA 4RVOA 3QMVA 2CO7B 5F8QC 2YH2A 2ZBDA 1ADGA 2W2NA 1YNLH 1JNJA 2TMDA 2RR3A 1T7VA 4ELKB 4D0BB 2CMRL 2OAP1 4X6DB 5IXYA 4Y6QA 3EF4A 3LS5L 1DFHA 2QJWA 1W44A 1IBSA 2BFEB 2QQKL 1BM3H 2D2EA 3M5CA 1ED3A 3DTXA 521PA 1DBSA 2LR4A 1X7SA 3ZW8A 5DVMA 3D0LA 4OQTL 1G4AE 2BBSA 3IMFA 2J3DA 4OKVB 3F7OA 4HO1X 3UB4A 3AY3A 3BQ9A 1G7IA 2CEAA 4FZ3A 1BW9A 1NTOA 4DHWA 1MY5A 2O8CB 1CX9B 4BWYA 2OJ1A 5FDWA 3SDBA 5KU1A 3N2GB 4HC1L 4XGZB 4A39A 1OR8A 1IKOP 2PCJA 1ISJA 1OHZA 1W96A 5IVZA 3E27A 3KE8A 2R6DA 4FNTA 1MREL 2AEIT 4FHGA 1YEKH 2ADGA 3DDFA 1VGVA 3KPWA 2BHLA 2OBYA 3T4UA 1MENA 3BZBA 4Z53A 2A2QT 1XEXB 1I3KA 1RM3A 3U3ZA 3K6DA 4TWRA 1E66A 1H8OA 5LLDA 4YV0A 3GMRA 2XT0A 4JC5A 3DYBA 3LKRB 4DCMA 1PPIA 4PAMA 3EGDB 4RY9A 4C89A 1EEUA 5E2VH 2Y22A 4CQMD 2B30A 3RIXA 1YR1A 2OWEA 5D7KD 3SDXE 1ESCA 1UYWH 2OP0A 5AW2A 1KJVA 5LCVL 1YVPA 4QQRA 3ES6B 1CCWA 3NTUA 4O4LB 2VT3A 3DRTB 3LRPA 3B9DA 2OB2A 2VJQA 1QFWM 1KN4H 4X7SL 1A7OH 2CUIA 3RSOA 4ZXBA 3KJ4B 1A64A 4HWZB 1YF3A 1T7ZA 3ZV4A 2X9ZA 4RY0A 1F4XH 3QORB 1MC5A 4FFPA 4E2YA 3PDGA 1C9EA 1UQUA 1ZKAA 4UBLA 2W2QA 4OOFA 5FO7B 1KYIA 1E28B 4QYSA 2OKCA 4NNYA 2X6RA 2YXLA 4ENRA 4JS7A 1Z6YA 5IZ7A 1JVKA 2E8ZA 2OYMA 3KS0H 3OFKA 4MXQD 4GVLA 4LCEA 4DWWA 5DZ9A 2PETA 4JBIA 3S36H 5LNGA 2W0PA 5CXPA 4QMEA 5ESVA 4ZJPA 3FT4A 3BCUA 3RWOA 4A2DA 3ROKA 2FYVA 4NHUA 1WL8A 4J1NA 3UMCA 3FUEA 4KO3S 3TW8A 4OD1H 1P1RA 4F2DA 3GEDA 4PPGA 2P79A 2RTTA 3INUL 3DX7B 1FO0L 3DBVO 3CLEL 1P9WA 2YFQA 3PUYA 1KJ2L 3WFDL 2YWHA 4OD2B 4ZYZA 2ACVA 3U4QA 1GCFA 3VI3A 2PYEB 3D39B 1D4FA 3DO7A 1XGTB 4G36A 2CHUA 3O6FA 5COBA 1N5AB 3BK7A 2VKWA 4GEJA 1JHMA 3IMEA 4P5KB 3PWPD 2IZ1A 3CB4A 4OBXA 5HHMB 1XZPA 1GAFL 1YMQA 3VM5A 1D6EA 2GNOA 4EKGA 5I19H 1QPKA 1JVLA 2APSA 2Y2UA 2E59A 4IUCS 4OD0A 5FR1A 4Y2XA 4U1GC 2JFHA 5I0XA 4RDHA 3CUUA 2XNJA 2QRUA 2WNGA 3CH1B 3D8TA 3RPBA 4YRRA 1DQSA 3O6VA 2GJ6D 1K6EA 2XIDA 2J9FB 4YQZA 1SMOA 2DHCA 2F19H 4LOVA 3IKVA 1FUIA 1H1DA 2YWFA 2J07A 4EI5C 1VSTA 1ZNXA 3CMGA 2VHXA 2DWUA 3G0CA 3H0KA 1MRSA 1LS6A 1SPDA 4RSRA 1TJYA 1WOMA 2FZLA 1P9LA 4AROA 4LVOA 3CX5J 3LIZL 3NCXA 3IDXL 3K09A 2B39A 4E33A 1DYZA 1ERNA 1Z4OA 1JF1A 3GQFA 3GI8L 3BCSA 4CEIA 5HYFA 4N2FA 3QQ4A 5KBKA 4PRNB 4LRSB 1HT3A 5KSZA 1XL0A 4L27A 1M3IA 1VBFA 1BXZA 2YHIA 3IWVA 4WZBB 3JD4A 3ZO9A 1PV4A 4JU9A 4XUEA 2IPAB 2FUNB 3E2MA 3CQPA 3MT0A 5AKLA 5SX5H 2CXKA 1SVBA 3GGDA 4I5GA 4PLKD 1N5AA 2OXFA 3RVWD 1HORA 1N6PA 3D25B 1WT5A 2D2IA 3F62A 4OUDA 3HUJE 4KMLB 3IRVA 1RCTE 1CR4A 3GJ4A 2Z34A 2D4DA 3J7AC 3HWX1 1CBJA 2JHGA 3RUPA 5D5QA 4M7ZC 4X44A 1R0KA 1P7WA 1FX0B 4QTHA 1TVKB 3DPSA 3CLSD 1O5PA 3MA9H 5ELLA 2O7NA 3U6XA 1THCA 4S1SL 3T1NA 3GGOA 1ANKA 3C6LB 1I9EA 3UG3A 3PGMA 2ZSWB 4ZHSA 1R5WB 3FFBA 5C7XH 4P3OA 4H60A 3PL6D 4Y0AA 1I36A 3BILA 2MPVA 1SCDA 1TJHH 2C94A 3RIAF 2W6ID 1T2AA 1L7TH 5C08D 2IH2A 5IF0B 3ESUF 3JV0A 4KE9A 3VRJA 4PJBA 5HDBE 4NZRL 2IAMD 2YVQA 4CV3A 3KM0A 4KROD 4B9AA 1NCCL 4CL8A 4AY2A 3AETA 1CI3M 4J2XA 3F74A 5I1KH 3TG2A 3EO9L 5DC9B 2GZ1A 2EILB 3IFNH 4Z7OE 3AX6A 4R9NA 1HSOA 1USZA 5LNK1 1E9SA 4X3PA 1Q0UA 5E4IA 1Z3GL 4UFPA 4YAFA 2ILLA 4K55A 2X7JA 4YONB 3LNIA 5JW4M 1MFPA 3I04M 4H4EA 3NPSB 4JPWH 3BSSA 1KV7A 3WGZA 1FBIL 1VA5A 3DXZA 5EOCJ 2H7WA 1H66A 4C2TA 5IQ9A 2XWZA 4M0MA 2WM9B 2HAZA 1XEXA 4B2YA 4UKDA 2QDWA 3T0EE 2VHJA 2XUZA 3ATAA 5FYJH 1Z22A 1BX2B 4RRPA 3AL9A 3KAJA 2IS6A 3TTTA 2VXBA 3V34A 3C3CA 1PQYA 5C09E 2PO5A 5F98A 1BAGA 1U3FA 1MVOA 5B57C 1FCGA 3HCCA 2WYTA 4WUKL 4LRIC 1ONOA 1M5RA 2ZJAA 1RLBA 2Y76A 1AIFA 1Q1JL 3PA6A 3GNSA 3TR0A 3O2DL 2QLMA 4B3BA 2R29H 3HCRA 2G60L 2EWVA 2A9JA 3OOHA 3SGJA 5KQSA 4MDFA 1JWSB 4WUUD 3TO4A 4Y4KD 4Z0XB 5CCGE 1COWD 3VFNB 2DCMA 1K4CB 3MA7A 4G9EA 4YFYA 3BUDA 1DJGA 2R8SL 2J9YB 2J9XB 1N0LA 3FO0L 3SZGA 4B9ZA 3KR1A 5AFAA 1U9YA 3QPVA 3NFRA 3UJAA 4YDVA 3DK0A 1J0KA 1EFTA 4PPFA 3O38A 2EQBA 1TZ8A 2SKDA 3T3GA 2WB1A 1H6CA 4CR6A 1C7TA 3SI7A 4QICA 1XB8A 3RUDA 3NFSL 4ZN6A 1FSKB 5DTFA 3AR8A 2LV8A 4UFOA 3EW3B 5KS9F 2FDBP 4LFBB 4QEGA 4KHZA 3C7KA 1WHSA 3L8GA 3HCWA 3SQDA 1RPAA 4IYJA 1NPTO 1WMAA 1T4BA 3RYHB 3MXVL 3ZGLA 2UVPA 2OHOA 1UF9A 3DV0B 4QHMA 4MXDA 5CFZA 4KFZC 2R1VB 3L95A 1THAA 2IDCA 1CUZA 1HXYB 2ONZA 1A2OA 3VAYA 2JWYA 4XX1G 4GSDL 4F2WA 1A98A 2ZSBA 1WG8A 1MAAA 1X19A 3ONFA 2WZ5A 5IESH 3OG6B 2YBRB 2XIBA 3QY0A 2P80A 4H7PA 3T0EB 4RJKA 4OM0H 5IK3B 5KVGH 3COVA 2GFQA 2ODPA 3T7SA 1NP6A 1NINA 4B6EA 4LN1A 4OQXA 4WI2A 1OWWA 1VXOA 1G9EA 4C56D 5EC1B 4YJFB 5AJXA 1J0BA 3IMTA 4HN9A 1EVUA 4P4KA 3SJBA 5JISA 3NCJH 4D7PA 4A67A 4RO0A 3QZWB 5GIOE 4XPZA 3JUYA 4FNQA 4L5BA 2D2VA 3T3OA 1OLXA 4B47A 3L7JA 1U8JA 5GVRA 2XXMB 4EUPG 1MJ8L 1CY7A 2NY3C 2WP0A 1Z45A 3L5WB 4KNYA 4ZOBA 3PF8A 2ZEJA 2YUTA 2W5PA 5D72L 4Y8VA 3R23A 3KGUA 3ZE1B 1OTHA 2A3TA 3C15C 3O4JA 3FSOA 4DXAA 1QKZL 2VL7A 1AUOA 1MSPA 5BR8B 3REVB 3RT9A 4HADA 4M0PA 2CO6B 3AUUA 3QNZA 5BMOA 1U7PA 2VZEA 1AK2A 1VE9A 2AF3C 4R6XA 4DM4A 1RIUH 1XRQA 1WXGA 1ZLVK 4U7KA 3NO4A 4J7AA 4QOGA 3SE8L 2ZTLA 3CCFA 3PVCA 4LVUA 4B53A 3LCVB 3SJVB 4YYEA 3EDFA 1AKUA 5L4FA 3CCHA 5DBIA 4DWVA 1RM5A 3HKDB 4N54A 2HIMA 3D1VA 3LP5A 6GPBA 4PGDB 4B97A 5G2OA 5L6YL 3I61A 1UPCA 3AF1A 4JGNA 2VLRA 1YJDH 2GO1A 4R8MA 1NF9A 3ZDAA 1VMEA 4POOA 1N2CB 3E1F1 1Q19A 4HAFA 5AKKA 4YRPA 1ENYA 4ERSH 5B1YA 5JIHA 1R0CA 2F7IA 1K9VF 3VKVA 2CM6A 4HNAA 4AIZA 1HKLL 2HQBA 1QAOA 1H6DA 3RG2A 1MOPA 3E9ZA 3Q8CA 5CKGA 2OYSA 5C86A 3THYB 4M4RB 4JB9L 1MCRA 1XF5A 3EVFA 5AW5A 1LPMA 1B1AA 2QR3A 3Q7JA 4D3FA 4D99A 5BYAA 2CDFA 4MXVF 4W7SA 4JSTA 1TM2A 3GNLA 4GRMB 2ZXDA 3ECAA 5A7BA 5BWNA 2OCGA 2I2BA 4BELD 2NY2D 4KMQA 1YR3A 3X2EA 1RQ7A 1GXEA 3CLVA 1T8PA 5A16B 1AGFB 1IAIH 3GLTA 3IJ8A 4XBEL 1VJTA 1OAUH 5AG8A 3MNZA 4AKIA 3HOGA 1PW7A 5JXAH 1SYVA 2JKXA 4ZUWA 5MF6A 1AGCA 1VJGA 4AL8H 5EU6D 1E5DA 1QYVA 3VPDA 1P4GA 4JI1B 1R7RA 5GJSH 4TULH 2NOAA 5AZ2H 5D6OA 3BZFB 2V37A 4YJ3F 5GGTH 1T9GS 4RORA 2AMJA 5C7LO 3L3IB 4DIDA 1O58A 1AIPA 4CM4A 3MBED 1U6JA 2O6EA 3J7HA 4G6ML 1L6RA 3OX8B 1U3HD 4QPZA 4EELA 4HT1L 2RHLA 2CY0A 4CU5A 3S55A 1O4WA 4GRWE 1Z83A 3QU7A 3SYOA 3TB6A 5I7SA 1ZHKB 4EHNA 5CVVA 5CINL 4KY2A 5IDQA 1P2VA 1PL3A 3I0MA 1JAZA 2D8AA 3C7CB 3ZDRA 1YPZB 5CU5A 5FV2A 2ZCZA 2WV9A 1YECL 4DWHA 3GLGB 2XPCA 3PL6C 4W5RA 3GJEA 4RJIA 2XNKA 2LE9A 2XZDA 2J55A 2O61A 2NYYD 3D69A 4NCC2 4Y9RA 2RD2A 1YI0A 1K6QH 4NNXB 2R7EA 2IAMC 3EXFA 3WBKA 3HEMA 1OT1A 3MDJA 3VD4A 2IOMA 4HS3A 2AMYA 3M9WA 3CX5K 3I6KB 1NDTA 2YAMA 4ES8A 4N2BA 2BM3A 1YRWA 2FN9A 1TEFA 2D7NA 4JSRA 1KCKA 2BHNA 2IYNA 2NU7B 4GOND 4QECA 4HQQH 1DXQA 4Z4IA 3MNWA 5C92A 1NFQA 1X6LA 3MYJA 3U2IA 4HQRA 4WWPA 2DEUA 3H4FA 3U6BA 2VJAA 4Y9GA 5C08B 1JIJA 3GLIA 4TWAA 3DONA 4XO4A 1L6IA 1E2WA 1MMFB 3PHQA 1SXJE 1CL7L 1XNRB 2Z04A 2WUBH 2DYKA 4OAWB 4BD4A 3FFWA 1DCEA 1TM3E 3EF1A 5FWAA 2FGZA 1E9PB 3QOFA 3X3HA 2EIMB 1PZHA 1XGKA 4LV8B 4PQRA 5LNK6 2WLLB 4PRYA 3LT1A 3QFFA 2PY6A 2C9UA 2FT8A 1SCQA 1QNFA 3HP4A 2VNIA 1ID8A 3UK6A 5AW7B 1NPUA 1AQUA 5C97A 4RETA 1FL6A 2A7XA 5I1HL 3W2DL 3MBXL 2OXEA 1X14A 5LB4A 2GTWB 1JZSA 1OHQA 4BNDA 2A30A 3KV1A 3S3CB 1CK4A 1PKEA 4L1TA 4ELME 3E22A 3D69B 1QQ5A 4C22A 3WELA 5FEBA 2FEWB 5IYZA 1CXFA 1W8OA 4X6CF 4LPUA 2YJ5A 1YGPA 1H42A 1NCGA 1MF7A 2XRYA 4E3ZA 2VK4A 2V9QA 1G0XA 5JROA 1BECA 1GW6A 3NEOA 3A10A 1AKTA 5IAEA 1GRQA 5LN1A 1LO4H 1E2PA 2R0KH 2OCYC 4PAZA 4BO9A 1MXHA 3CFIC 1CD0A 2VMJA 4GSXA 3T7JA 1CJCA 2BGMA 1LH0A 4RTLA 2WWOA 5IAAA 1EQ2A 2QWXA 5FOBA 4RLSA 4YL4A 1L4FA 1TZOA 3CU5A 4WWKB 2UUDK 2Q2OA 4GT0A 3GLZA 1AOHA 3QKRA 4JBGA 2GSGB 3BK2A 5E1MA 4UTBL 3G5UA 4N3UA 4WJG3 2JRCA 1ZNQO 1QRNE 4GNKA 3P77A 3T1HB 3B60A 5JYMA 5LP6F 3OKYA 2FE1A 4XA8A 3GSXA 3NHYA 3HCAA 3HHPA 3RGVB 1L5HB 4PS0A 1CSEE 3ASNB 1MFBH 2UUBB 1L6ZA 3CW2A 4Q9JA 4RAUB 5HVWA 2VM9A 1W4ZA 3R06A 4D9HA 4BN0A 1G38A 1UACH 1Y34E 3C75A 1UPBA 1ITBB 2W8CA 5JCXA 4QHPA 1JKJA 5TTRA 1ZGBA 2WJYA 1UJ2A 2GCOA 1WSDA 4EYKA 1R74A 2ZVJA 1S5PA 4DZBB 4AW9A 4B9IA 2FBRA 3X44A 5B39B 4HVAA 1P4AA 5A43C 2JI4A 4J0QA 2X9WA 2OP4L 1QUNB 3NHRA 3ASOB 6REQA 4PRPA 5FUQA 3QIWB 3RYCB 3WXWL 4GMGA 1YDHA 3W2DH 4MLCA 4CDGA 4BINA 1XK7A 3DMTA 5FOJA 3HJHA 3O95A 1Q7TA 3HM9A 3HRZC 4QT5A 4HJTA 2JJ8A 4Z0BH 5SWSE 4TV9A 1T3GA 5HBRA 3M3PA 3ROMA 1XDWA 1HWYA 3H3BC 5AQEA 3TBKA 1M8KA 1WKVA 5SYMA 1NDUA 5J0BA 3QPQD 1L5QA 12E8H 4TMFA 5I1LB 4I4WB 5LWYL 1A21A 5DK0B 3DFUA 2ROYA 1NLZA 4IDQA 3KJ6H 4YL9A 4Q9NA 3WFEH 5I8KL 3X11B 5AYUH 3IJ5A 1J18A 2P7TA 2AOVA 4RS4A 1NUHA 4Y6LA 5D5MA 3MV9E 3IMGA 3NHBA 3GMQA 1Q11A 4O8CA 1KFAL 4UOW0 5FL3A 4P4KC 1K4KA 1VZHA 2QSCH 5FYQA 5KMGB 1J4AA 1WY7A 5A4MS 1R47A 2CT8A 1CGXA 1OFGA 3LSOA 2NZWA 1G5QA 1RMFH 3BWMA 2AQ8A 5I28A 2NTJA 2DYSB 5JA9A 3VFRA 4HX9A 4V24A 2XZQL 3EBPA 4GP7A 3N44F 1QFMA 1U8IA 1XQ4A 3C2AH 5DJXB 1N8SA 2JJWA 4GAJL 4IL5A 2MOVA 4KN8A 1S2GA 1NN5A 2BVNA 1USKA 1SY6A 3QM1A 1GAWA 1K9TA 2XV0A 4M7ZB 3INRA 4XIFA 2CCGA 1M10A 3UB2A 3MOAL 5CEZE 7TAAA 4IIHA 4PS7A 4RZXA 2XN2A 1AN0A 4NX2A 3VD7A 4ZTUB 3QITA 1N8KA 4Q2ZB 1N3BA 3ZC3A 2BPOA 5PCYA 1YDPA 2WLIA 5SYAA 2HJFA 2VLIA 1IAMA 2VH5R 3M9LA 4MCIA 2QG4A 2R79A 3RIHA 3QF4B 3C3WA 4ERXA 5L3SA 1T13A 1L4YA 4UVHA 4XNDA 1M1NA 1HDMA 4ISVA 4Z7WA 4R9VA 3WY4A 4HNTA 3DVFA 1NQVA 1FDLL 4FFLA 1TJGL 1SQFA 1U9IA 2ZPAA 1HU8A 3S3JA 4B6FA 3FONB 4RJJA 4YRFA 3QIUD 1F7UA 2GVZC 2UYCA 3HL4A 4DVGA 3F6BX 1WTGT 3QS3A 3QDGA 2MTBA 3QT2A 2B5OA 2C88A 4OZFA 3TXXA 1ZHOA 3NIFB 1UBTS 4DLYA 4MLPA 3HR8A 1P4BL 1ZK5A 1HURA 2JG3A 1IJNA 1OGTA 5T3ZL 4Q2ZA 4A3SA 2Z65C 5KYGA 4JVSB 5HW0A 4J6RH 2ZCLH 2P9FA 4Y2OB 1C8PA 1SUJA 5J58A 1F6DA 4FFTA 4A6PA 1JZFA 1AZNA 5J2UF 1K27A 5E5LA 1Z5UA 2FMFA 1VLZA 3RU8H 2C7BA 4IWXA 2O23A 4X85A 5B1HA 5IRCD 1Z7GA 3NQKA 3MV11 1G6KA 1OCCB 1E6WA 1X87A 1ZWLA 3R5FA 4YDZA 5DSZA 4O4YL 4TS9A 3DO4A 1RI1A 2NY7L 4TM7A 1G98A 3AWDA 5CX1A 4YPJA 1IT9L 3IB4A 2EE3A 1QFJA 2UV3A 2HU5A 3EPPA 3AM1A 1Y18A 3AADB 4WCDA 1V8DA 1ZA1A 1U94A 3TT3H 4B0MB 4ARBA 4DWJA 2WMDA 3K2EA 3B6KA 4MQEA 1O5TA 3HADA 3D2TA 3GPCA 2C95A 2CWWA 3DB2A 1JTTA 2ZIXB 2BSXA 4FHJA 2ADMA 4X1KB 4NMWA 4RVUA 2O8DB 3G8YA 4KHTH 3ROOA 2K7ZA 1RUAL 5AOKA 1XTIA 1QB8A 4TT3A 5A2LH 5H81A 4LXXA 4LW8A 4B6QA 3QEOA 1CFVH 3LFHA 2X89D 4H0LC 3QRWA 3QV1A 5FA6A 2I6FA 4CKEB 1RAMA 3UJTL 2WCSA 7GPBA 3RNOA 3QQ3B 3DV6B 4E68A 1WNTA 4R1OA 2BHZA 5DA4A 3Q1EA 3GN2A 2LCQA 1D5XA 1XA0A 1Y7TA 4MUHA 4Z1OA 3FTPA 1P1ZB 5FUOH 1RZKH 3PWNA 4MQFA 4AZSA 3N2ZB 4EOWL 3BVNB 4PS1A 3SCMA 3X3FH 4C4UA 2DJIA 3K53A 2ZJSL 5ANHA 4HHAA 1MJ8H 4YN3A 3Q3CA 2AEMA 3JYPA 1QZ3A 5A2JH 5HK9A 4U3SB 1AXSB 4GZ5A 3BULA 3GGPA 4JG1L 2MHAA 1WDTA 5C0FA 1JPGA 2C9OA 1L4MA 2X86A 1OILA 2CJFA 2CZCA 1YUBA 2E4YA 2RGAA 1Y1PA 3TINA 3AUFA 4RJLA 4Y2LA 3GF8A 3DKHA 1A76A 3ITNA 2MSDB 3I62A 4IGFA 3IWUA 1KDIA 3VXQB 4N2LA 2PTTA 5CB4B 1PK8A 2DF3A 3N8GA 4QLWA 2EJWA 3DS8A 1N57A 3LD8C 5KVGL 5JMOA 2ZRKA 3UBXB 3UMJA 4XOIA 2WJHA 3L4KA 4F7MB 1XMQB 1SXCA 1BX2A 5KVCA 2ESVD 4NJOA 5LZ4A 4LCCC 3NSDA 3KLSA 1S3GA 1WC7A 1P1CA 3TJRA 3HB1A 4S1OA 3I2YX 1IQDA 3S2YA 2GC4C 1NNLA 3U3DA 4RE6A 2KKQA 4OFYA 3PXEA 3PWSA 5JDJA 3BGMB 2ZX9A 2HDHA 2XQGA 2HL6A 3IF1B 3RL2B 2VDPH 3VFWA 4JKKA 1Z7EA 1QZXA 3UAAA 2H1IA 1C5CH 3KKOA 4DXDA 2Y3AA 1BAFH 3EUAA 3PIIA 3ZWWA 5T1MA 2JBAA 3DE4X 1YKFA 1SM3L 3SNKA 4MWBA 4Z23A 3GR6A 4LBEA 3PWZA 1YNTA 4AQ8C 4L5YA 3BWYA 3QW2A 2CNWD 1OPGH 3GYBA 3P8ZA 4I3HA 5DX0A 1YDEA 4X4ZA 2NVOA 3QA3A 5AYTA 4MNGA 3RS8A 3RAJL 2SKCA 4NPKA 5EB9A 3WS3B 1MQAA 2F7RA 3WNVA 4PRAA 3QUBA 2E21A 3GHEL 4I4WA 4YHZH 1LEGB 2FWSA 1QH1A 4D7AA 5T5FL 2GFBB 1ZYUA 3H8SA 5ELXA 2R7MA 1YY8B 2CV1A 8PAZA 1TOAA 4OBRA 1E2VA 4FCVA 3B7YA 1XZHA 2H9YA 5A4AA 3WLTA 4H6XA 1BS9A 4Z7UA 3U13A 3FHOA 2V3CC 4L05A 2CLLB 4O02A 3U7FB 4ND6A 4ZS6C 1NIJA 4BP9A 1L0XA 1TIKA 2XCSB 2F4VB 2GB2A 3WWDA 4GG6F 2AJYL 4WO4C 3STYA 3IFLH 4JKYA 1JGEA 2O4UX 4U1SA 5I7RA 3OKOB 3ABOB 4P81A 5DS8B 1OAKH 1T80A 1HDMB 3E6FA 2J3IA 1SHKA 5G1PA 3GSUA 2WQSA 4M1WA 4Q9BA 1NAIA 4LNUA 4WDQA 1W5BA 4GUPB 5ICXA 1UDBA 2CK0H 2V5AA 4MR9A 4JFYB 2IPKB 2FEEL 2NNFA 4ZSOB 3HKDA 1KZHA 3FRPA 1XQWA 5DD6B 4RZHA 3FKSA 3NDPA 3Q3JB 4EKIA 1L5VA 4Y1TA 1I51A 4R7NA 3SMQA 2A5FA 2AEEA 3NLLA 4DJAA 1A0QH 4P2AA 3H0CA 3QR1A 1MCKA 3I01A 4KUHA 2C4XA 1U8IB 1M2JA 2HV9A 1M3JA 3B5EA 2IELA 3N28A 3GCWA 3PUIA 2Q3XA 4HJRA 3HG5A 4DAGL 3P4OA 1WW3A 4HXAL 4CMEC 2OFQA 4HSEA 1UJCA 1YQDA 2ICES 2QRVB 3SJVE 1DKLA 4UT6H 3IS0X 4B9CA 4DJDC 3CVHA 3QVLA 3P0JA 3ZY3A 2FHSA 3HCPA 2Q0HA 4R2KA 5K8JB 3DVGA 3VO1A 3QDME 4PBWD 3JVEA 4UTAH 3U39A 3IEKA 2O93L 3ZIYA 1ZHBA 3HRHA 3QZNA 5JW4Q 1C3VA 2DLCX 3QYAA 1IBGL 2ZRDA 3ZPXA 1MQKH 3AZUA 3JZFA 4MV0A 2O2DA 1N2CE 3AS0A 3B2XA 3NTCH 4QO8A 3SE4C 1VL6A 1HL4A 2EF1A 3R4DA 1DWUA 4NJEB 3GHBL 4BS9A 4S11A 1W5FA 3T9BA 1Q0QA 4C59B 4N2KA 4HGKC 4Z9BA 5C0BA 3D8SA 2HP4A 3GKWH 1E1CB 4NZDA 1G3MA 3KFLA 2YW9A 2CFSA 1E79A 2H1HA 1QSFE 2NNXA 4AIZB 3RS2A 1EUTA 5EZ5A 3HMWL 3L6FA 3V4RA 4JXJA 2BMEA 2OQIA 2J6IA 4G23A 3X43A 3ZCQA 4WFHD 1WWCA 2FW1A 1KEPA 5CP7A 3MJ8B 4UYPA 1FX1A 3SIRA 5CKAA 3ND6A 1CIVA 1EP1B 3MSXA 2BRQA 2XY1A 4ZQCB 5AXBA 3ZK8A 4ZSOE 1EGHA 3CSPA 2C04A 4Z7WE 2O5YL 4G4IA 1FLTX 4IHKA 2DSTA 1VFOA 5EWJB 4YV1A 3DPIA 4R4FL 3OU6A 1KBZA 1YEDA 1SXAA 3TFKC 3IMKA 1U2HA 2VH5H 5KJFA 4PVMA 4TVSa 1P7KB 3SKXA 3SPVA 1YH3A 5EQDA 4QY8B 1GH7A 1N34B 3MOQA 2QTZA 4NQCE 4PGEA 3K2UL 5CCKH 3IFLL 3GH3A 4IF6A 1A8IA 4YDRA 2OOSA 2YQ2A 4IBSA 2PO6D 2X2PA 2QBYB 4AYXA 1T5KA 2D31B 1AJ7L 4DP7X 2YIMA 2BGGA 4I3GA 2BFEA 3L0YA 1AGNA 1I1AA 5B4VA 1I2AA 2VAAA 4MWFA 5JPMC 3VD2A 3TLXA 4G0VA 4OCRL 5FM8A 4MIOA 1AYRA 2QAGA 3SC2A 3WMXA 5I73B 3IURA 4XVJL 4O51B 3L3HA 4PXSA 4GRDA 2CO1A 2CO4A 1QHXA 3N42F 3SWWA 4YAQA 4IJ6A 1I6WA 3GBML 4HQFA 1NC4A 1RW4A 4L5AA 5FLVA 1REIA 4L3OA 3SO3C 1PZFA 2IV9A 4KQEA 3U2JA 2EZUA 1Q9LA