4UM9B

Crystal structure of alpha v beta 6 with peptide
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
470
structure length
448
Chain Sequence
GCALGGTCEDCLLIGPQCAWCRCDTPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVCPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQVNSSKCHNGNGSFQCGVCACHPGPRCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of Integrin Beta-Subunit Specificity for Latent Tgf-Beta
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords INTEGRIN ALPHA-V
total genus 110
structure length 448
sequence length 470
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4um9B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4um9B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4um9B03
3EH1A 4F1KA 4Z7QB 3AL8A 2ODPA 2XWBF 5HGJA 1AUQA 1M1XA 1RTKA 1CK4A 3EGXB 5BV8A 1JEQB 1TYEB 4DMUB 1M2VB 2VDOB 4G1EB 3EOAI 2I91A 1DGQA 4NENA 3BQMB 1T6BY 3V4VB 4HQFA 3N2NA 2X5NA 4PN7A 3NIDB 4IHKA 3QA3E 4NEHB 4FWWA 3K72B 4WK0B 2NUTB 1CQPA 2VDMB 1T0PA 5KYUA 1OLZA 1MQ8B 3HXQA 3V4PB 2ICAA 4WFQA 3M6FA 1XDGA 3ZE2B 5E6UA 2VDPB 3F74A 3GXBA 1RS0A 4C29A 5HDBB 3T3PB 1QC5A 2VDNB 1M2OA 5KYWA 4UM9B 3AFCA 1IJBA 1DZIA 4MMYB 4G1MB 3BN3A 5KYUB 3FCSB 1SHYB 1YVRA 1SSLA 2VDLB 1M10A 1SQ0A 4Z7NB 1M1UA 1U0OC 2NUPA 3ZE1B 1JV2A 3EFOB 1ATZA 3F78A 1JEYB 3PPXA 2ODQA 4G1EA 3VI3B 3EH2A 3ZQKA 4MMXB 1RD4A 4HQKA 1M1XB 3EGXA 2B2XA 1AOXA 3NIGB 4K3JB 1IJKA 1IDOA 1NA5A 2XWJI 3HI6A 3ZDYB 1YVPA 4JX0A 1V7PC 4A0QA 4C2AA 4IGIA 1XDDA 3ZDXB 2XGGA 1ZOPA 5KYXB 1RRKA 2VDKB 3VI4B 4F1JA 3EGDA 4GZ8A 3TVYA 4CN8A 4O02A 4JDUA 1L5GA 1MQAA 4Z7OB 1U8CB 3HXOA 1YUKA 3OL2A 1BHO1 1FNSA 4MMXA 1AO3A 1Q0PA 2WINI 4IXDA 1JEYA 3FCUB 4O3UB 3EFOA 1JV2B 3OKYB 2NUPB 3E2MA 4BJ3A 5KYYB 5E6RA 3K71B 4MMZB 3FCSA 4WK2B 3T3MB 2ADFA 5E6SA 2IUEA 3AL9A 4G1MA 2I6SA 4MMYA 1UEXC 3NIFB 3ZDZB 1MHPA 3K6SA 3IJEA 1PD0A 3NVQA 1IDN1 1PT6A 1QC5B 5KYWB 1OAKA 3EOBI 4FX5A 3EG9A 3EG9B 2VC2B 1XUOA 2P26A 1FE8A 5E6UB 3TCXB 3IJEB 3K6SB 4C2BA 1QCYA 5E6SB 2VDRB 3RAGA 3K72A 4MMZA 3K71A 4UM8B 2QTVA 5E6RB 2P28A 2NUTA 4CN9A 4UM9D 1MQ9A 3TW0A 5ES4B 1PD1A 2VDQB 5HJ2A 3TXAA 2WW8A 1ZONA 5KYYA 1ZOOA 4NENB 2UZYB 4HQOA 4M76B 4WK4B 1M2VA 1BHQ1 1PCXA 3PPYA 4XW2A 1JEQA 3PPVA 3OL2B 1MJNA 4HQLA 1U8CA 5LN1A 3AL8B 4WJKB 1L5GB 1U0NA 2M32A 4O02B 2O7NA 4O3TB 1JLMA 1LFAA 1N3YA 1SHUX 1SHTX 2I6QA 3IBSA 3ZE0B 3BQNB 3EGDB 4CNBA 5KYNA 3OKWA 5KYXA 4HQNA 2NVOA 3Q3GE 1N9ZA 3PPWA 1MF7A
chains in the Genus database with same CATH superfamily
4JZJC 3RVTC 3CNEA 4B9EA 1QRTA 3A1CA 2ZD0A 3KDPB 5MEQB 5TQ2L 3QUXA 2QPDB 4BBJA 2VKQA 3FYDA 4GM0A 2FJFB 4QU0A 4NT6B 1TJ3A 5F77A 4JRYD 3REVB 1P7QA 2XWJA 2F7OA 3FLAA 5BVGA 3IKKA 4NKDB 2OXGB 5DHXB 2FQ1A 1TO2E 2MYNA 1RUQH 4EZIA 3RROA 5F7AA 2VC2L 1VPVA 4AZ3B 1A9QA 2IP2A 3VXSB 3IFOB 3VVMA 4NM8L 5BS0B 3D8NA 4J28A 1OK8A 2O4CA 5E5UB 4G97A 4MCHA 4RHCA 4FPXA 2CNBA 3S2FA 4AEEA 1HKLH 3LC0A 3PA8A 1PX2A 1VTKA 3UUWA 3COJA 2G4EA 2VCHA 4E4YA 4PWJA 5DWUH 5JLJA 5HTKA 4TUKL 3GLKA 4IX9A 4O8CA 4PZYA 1E6WA 2H1VA 5DJYA 3CIAA 4K3UA 4BFTA 1Y1SA 4HNAA 3NVDA 2ADJA 3BZ4B 1NASA 2ZCZA 3FYHA 3MLWH 2A83A 3BBPA 5DTEA 4MVJD 1SNYA 3GOQA 1CU1A 3U2SB 3VH8B 3NKFA 3MTAA 3LBAA 2JFVA 3DGGA 2G72A 3X11B 3HKEB 4DO6A 2NPOA 4H1LB 1NCAL 3OTOB 1T1SA 1TC2A 2PXYD 5IX8A 5A2AA 4KUCD 3VJ6A 1CY0A 4DMRA 1KBOA 2X7LB 4JX8A 2ACVA 1P7KB 1EE1A 2DQ4A 1W1UA 2CHUA 4QWWC 3C8DA 1BXZA 3SE3A 3M7OA 2H4HA 5DHUA 2F7PA 1QMGA 1XBTA 3DFIA 5B38B 1KV7A 2UV3A 2C9YA 3CZRA 2O5NA 5IBCA 2P9EA 2BN4A 2VISB 4S1NA 4K8RC 4GNRA 3WGIA 1OARH 1HKUA 4UOZA 4J43A 1EFRD 3IBFA 2BW0A 1U9IA 2NZ9D 2PO7A 1G9EA 4I0PA 1RZKC 1JUFB 1W8DA 2DQGH 3F3YA 2ZYHA 3ATEA 1J1PL 1WXGA 4Q93A 4RMGA 2EFCB 1A2QA 3KGUA 3D3VA 2R0KL 4KK9C 1JLLA 3GRPA 3PR3A 1BOYA 2GLXA 2CCGA 2A9OA 4HEMA 4BVJA 2L18A 1ZS8B 4NU6A 3FZUC 1D6VL 2Z09A 2F1HA 2M98A 1ICEA 1NDGA 1QH1B 3OE7D 4EI6B 3ZS8A 1W2HA 2YD0A 5K9QI 4GSRA 3UPTA 1Y4ZA 3K2EA 3A1FA 1WBYA 4DWJA 2WWHA 4XGQA 4JLKA 4HVAA 4S0HA 5CLGA 1L5QA 1E1LA 2Z9CA 4NG5A 5FBRB 1I3CA 5EIHA 3GJ0A 3FU7B 3MR9A 5C7IO 2ZR0A 3CB2A 3B7UX 4US1R 4A6XA 1ODLA 3FYUA 4XUCA 4L4TD 4NPHA 3RUPA 1RLUA 2QG9A 2SHKA 3G1UA 1I1OA 4DEYA 3BREA 2C9XA 2QVFB 1R9NA 3H2BA 4OXNA 2X89A 3PJNA 3M1LA 4FYTA 4E5NA 3ONNA 1E6OH 3FH8A 4FYRA 1T91A 5AW4A 4WDIA 4YDKH 3ZJ4A 1VMKA 2GERA 2F54E 3ECCA 4IDOA 1W6RA 2WWVD 3RRFA 5MN6A 3FAWA 2WSSD 4IEEA 3DA0A 2ZT5A 3N6XA 2AGVA 1EUCB 3O6KH 4C2UA 3ROLB 1A82A 1BF2A 4WZBB 1MAJA 3OLWA 4OU4A 3JASA 4NKIH 4H77A 2ODQA 4LC0A 1UWGL 1S8NA 1YRHA 4ZZ2A 3K3QA 3J81k 3V6ZA 2YAQA 2V0AA 5ELXA 4IXWA 1MJ5A 3WNCA 1VGEL 1MO2A 2IV3A 3UMJA 4JBGA 4EKGA 4XBPB 2BEVB 1GQRA 3MA7B 3P30L 4NKIL 4ZJ9A 3RIKA 5REQA 2H1HA 4AJEA 1HM5A 1X7QB 3FCEA 2FEDC 4XMTA 2AB0A 4M5ZH 4IBSA 4WCFA 5ITBL 3LP5A 4X8JB 4Y2DA 4Z6KA 4B6ZA 3UXEA 4C5BA 4M99A 5IDWA 1KOAA 2ZX8A 5CT4A 3RB5A 5E6RB 4IW4C 1FP7A 3DOUA 2OJZH 2CFRA 3WMEA 1SVIA 3ZHFA 3FTFA 4UTCA 1TQCC 1CUEA 5DEFA 3ITEA 3B7TA 4URWR 3PEEA 5E2BA 4E5XG 3BPOB 1GL4B 5LDSA 3X3GH 1BH2A 5D3KA 4PJHF 1NXPA 3OZDA 1ID1A 4ZIRA 2OCKA 4MYHA 1CK4A 1AQUA 4LSQH 2BIMA 1AXTL 2XX0A 2G5UA 2MHAA 2CM5A 4PMEA 4BMDA 3L82B 5BUQA 5LGJB 5DI8B 2X13A 3VD9A 1GY2A 3OFJA 1XEFA 1ECZA 4GBED 3STTA 3BN9D 4GWGA 2H6PB 3NAAL 4NF2A 3PITA 4QUGA 4TL9A 43CAA 3VDNB 4XX1E 1WVGA 2XKKA 2AJZA 2VNHA 1WCBA 2Z93B 3TQCA 2P9GA 4RDIA 2X14A 1K3IA 2XW6A 4U1RA 2C9MA 4B95C 5EESA 4JO2L 3U9PL 4DAGH 3CRQA 3G6DH 4BFUA 5HGBB 1YEDA 1T6BX 2P0YA 4I3FA 1U8UA 2RK3A 2YHGA 3BRWD 3KOUA 3JXAA 1XA3A 4G6JH 3NFSH 1MW8X 2R4TA 3P4MA 5DDIP 4HCJA 4XB8A 3ZN6A 1R3DA 5DYYA 4MWOA 4AV5A 1IG3A 1SLVA 3BL5A 1MFVA 4TUYF 4JEHA 2DLEA 2EDDA 2OTWA 3N06B 5C7XH 4KFZC 4GKZA 3KPPB 4M6OL 2VJ0A 3BTUA 3GAFA 5TSDA 4EEKA 1HWWA 3HBZA 1EAMA 4MJ6B 4AYFB 3D52A 4LF3B 2BISA 2XKJE 2Z5GA 1AXSB 2H1WA 4LJAA 2XQVA 3OX3A 4N6GA 3GTTA 3MUUA 5EZIH 3QUTA 3LPLA 3AL8A 2Q5EA 4MZXA 4CZ2A 1ZUNB 1LMKA 3MA9L 4N0DA 3FKJA 3OLCX 2VNCA 4M0KA 2LRHA 1VESA 1C4WA 2DTMH 1DAPA 1TCBA 2VWEE 4Q1EA 2OI9C 4R4FH 3BE5A 1NH6A 1FFRA 2PMEA 1ZRNA 1RHHA 4QJ5B 2HHAA 4U2DA 1KCRL 3DGDA 4GU5A 4KKCC 4FBGA 4HXBH 4W9KC 1QG4A 5DVZA 3IX7A 4P98A 4LPYA 1GNRA 2EX4A 1B6GA 1ZT1B 4RELA 5E6IC 3SDSA 3QQNA 1D5MA 1U4SA 1B4LA 5KSBE 4HXYA 2ZJSL 4WTQA 3I6QA 5DEIA 3TUJC 1SQMA 1AKUA 4FHFA 1TYCA 4P82A 1FNMA 1XZJA 3HA0A 4JFZH 1FLTX 1IQWL 5ETJA 4CM3A 2CGZA 4OLZL 3L1OH 3NOXA 3T5MA 3V4VL 4DCTA 1JERA 2ZAMA 2OBYA 3MQFA 3ZZQA 3V4LA 3G8BA 5CKGA 4MV5A 1MAHA 1ZRMA 2PNDA 1CF4A 1MO6A 4K94L 1PNCA 4UYQA 4DLTA 1DQPA 4W1SA 1N7GA 2KB0A 1TTHA 3X43A 4UQ3B 4F91B 4DCPA 2OESA 4GRWB 3TFKC 1Z6ZA 4KROB 2QTWB 1JJVA 4Y6OA 1CUWA 3KJFA 3EGCA 3FYUC 4WEEA 5CNJA 5L3ZA 5JJIA 4YDJA 4Y19B 2QU8A 3O0DA 2KPWA 3KD2A 3F73A 3VFRA 2REQA 2DEYX 3IQEA 3R1GH 4G9EA 3NRCA 2QQEA 2F53E 3AEZA 2MRYA 3TCTA 1QONA 3JVEA 1EHCA 4H18A 1R66A 3E1ZA 1R4AA 4S05A 4DR2B 4ZDHB 1M71A 4UJ3A 2G88A 1GRQA 5B3JF 4P5KA 2VP0A 3PHBE 4DCOA 2QKIA 2Y2UA 2R83A 6ADHA 3JS5A 1FOEB 3V0FA 4QHKJ 1SD1A 5JAUA 3WIOA 1O96A 2ZFUA 3KWWB 2J9RA 1WQ1R 2WQAA 3QUXD 3CLWA 4YT2A 5HX7A 3BN3A 4XXCC 1Y1RA 2H2DA 2JIQA 1JQEA 5FO1A 5ISMA 4TXMA 3EFOB 2DQMA 1CCWA 4K2UL 1B42A 1E7VA 1SBZA 3O47A 4PJXF 3JWPA 3KT0A 4ATNA 4BQ8A 1WFIA 4D9BA 2Y3IA 3A11A 2FY8A 3HFJA 2C1OB 1ZJAA 2NCMA 1OTHA 4WN3A 2GI7A 4RMQA 4XQ0A 3UOGA 4BLSA 2A9CA 2FH6A 3RSQA 4FNAA 1KR5A 3KPRD 5CEEA 3NP4A 1L9XA 1T1ZA 2ZT7A 3QDHA 4MUEA 5DJ2B 2WXRA 2QT0A 5IPFA 3GLFE 2W8BB 4IY1A 1XAKA 3LZRA 2LNDA 3R7DA 1C2TA 2JANA 2X70B 1NFDA 3GBML 1JPTL 1BS9A 1WUNT 4IJKA 4JENA 2YPLE 2F74A 5MHSE 3QXSA 4X8HA 1MO4A 4F4JA 4B40A 5GRVK 4G2TA 2DQ6A 2AJ8A 1YSOA 4B5EA 1ABFA 1JDSA 2HCTA 4O08A 4F4CA 1WFMA 1N6NA 3MRDB 1CQJA 1SRDA 2WWKT 2I4IA 2IS6A 3IM1A 2Z2KA 3S35L 2IHYA 4B6GA 3PDCA 1JXMA 3L3JA 2L19A 2VUKA 1KPHA 3RFZB 1DHRA 1T24A 1P1FA 4WHDA 4F60A 1NW5A 3F12A 3DMDA 2H3EA 4ALLA 3B83A 5ISZE 4MULA 2IH3B 1NANI 4O2BB 4NMHA 1CC3A 2VXTH 4J2OA 1XD9A 2CUHA 4MITA 1IJBA 5FBZA 3PD1A 4D0CB 2BMKB 3RU7A 4JHWL 2GTWA 3FQXB 5F1KC 5JNLA 1WU8A 4Z8YA 3C0KA 4RY8A 5GRYA 3TZQA 3ZPXA 2ZS8A 3STHA 3V5HA 4Q3DA 4X45A 4ZHQB 3BMOA 2RI1A 4QPNA 5ITFA 1A98A 4DDVA 1HCFX 4DXAA 5T3XE 1ZBDA 4W9MC 4U6VL 2V2TA 4OBSA 4LNVA 3ENWA 5E9DB 4GP5B 1I0ZA 3A6GA 1H5BB 3AHIA 2I6GA 1FFQA 1B41A 1Y6KR 4W81A 3PNQA 1UR5A 3DXAB 3D8UA 3HVNA 4E5UA 1QEWA 2DKUA 4MD4B 4U7TB 4L9AA 4PIPA 1OI4A 3WRWA 4AZ0B 4Q52A 4ODTH 3B2XA 4A1FA 2JB5L 1R4NA 4N20A 3MUFA 1PZ5B 3CX4A 4ANXA 3S8GB 3OHXC 5F7MC 3TIGA 1MKFA 3CJRA 2FYYA 5BZZA 1FC2D 1X77A 4F97A 2GEUA 1BAGA 4XVUC 1OALA 2IZ6A 4ZAVA 4MR9B 4P05A 5DE3A 4J39A 3L8FA 4JHXA 3TZVD 1ACYH 4J5VA 1KGXA 2YJ3A 2Y72A 3G85A 4OYRA 1A8PA 2XDQA 4IHAA 3RR2A 5EXTA 1W1WA 2NU7B 1QKZL 5AKKA 1EVJA 3FFTA 2B4QA 5TF4A 3GFOA 2LV8A 2POQX 2MINB 1P1KA 5E6YA 1CETA 4TTGA 5EHIA 1U2GA 1BAFL 1HHJA 1ZAGA 3WDSA 2W2KA 2XWJI 1PFGA 1F9AA 2PBRA 4P3PA 1HNGA 1L8OA 2NOAA 2PLAA 3N7AA 5DTMA 4H27A 1CEXA 1J18A 1JFLA 1GN8A 2Z9BA 2ZXGA 4JFFD 2X6BA 1UAGA 1NUDA 3MAWA 2NYUA 1NIAA 2PGXA 3WWYA 1MFNA 5D5QA 4X1YB 3P4OB 3IEKA 4XLLA 1F51E 2XOKA 4E41B 3R9KA 4ZFGL 4CU6A 5HYJE 2VP4A 1ZI8A 2GJZA 3WLWC 1YFLA 2EG9A 4LHJB 1H2RS 1EFHA 1I8IA 3THWB 1BSIA 1Q9OB 3BH9A 4LCCC 4XX1A 2G70A 3M4ZA 1BVLB 5FR2A 2WE7A 1LU9A 1XSKA 3ZGVA 1KNOB 3GNLA 4HOYA 4D0BA 1NUTA 1R0XA 4B6OA 3OL2B 5B64A 1DXQA 3TBWA 1M7UA 3R3JA 3KPSB 5MEPA 3BGIA 5I1JH 3QHZL 3NZSA 5FXMA 4CC0A 1V0JA 5E2UL 1E9OA 2R0LH 1TAUA 4J0EA 3BO8A 3DO5A 1ET8A 3L4ZA 3HNSL 3KWJA 3ZIUA 5FCDA 3PHQA 4ABWA 2HMAA 4HH3C 4Q4CA 5JE8A 5ALYA 2EKQA 4OTXH 2C2KA 1RZ3A 3MGOB 4XB7A 4Z7QE 3OECA 1NLBH 1TKWA 1PKXA 1HF3A 3RUDA 3WKDA 4ZT4A 3WTWA 5B55A 1WJ3A 2GI0A 3V7NA 2Y67A 2WY2D 2GLUA 1OWMA 5A71A 2E89A 4MGZR 3E35A 1KFKB 1ZW6A 2VHEA 4BVGA 1VMAA 3QAQA 5EU4B 4J1TA 1JU4A 4F9LC 5F7BA 4WZZA 2PJZA 4UTAA 3BEDA 3FA2A 3U3ZA 1WBXA 1H2HA 3S8FB 1KYQA 3PWKA 5KSVB 3IIMA 4WUKH 2B5IB 2D31B 1T25A 2IG2L 4GPBA 2GEKA 1X0VA 3QEQE 3T4AB 5L3SA 2WWTA 3NORA 2R23B 4XRGA 4D3CL 4FQ8A 4YDMA 3L7AA 4NJAH 3IL2A 3TW6A 4CM1A 1NCOA 2VLJB 3VFOB 4PBWD 3SODB 2QRQA 1S78C 4M8RA 2QGCA 4TV9A 3GHBH 2XXAB 4ENED 2JFOA 5DYOA 3RS2A 4W4OA 1UJ6A 1W581 4OL9A 4OJYA 1OAXH 1L8AA 2GPYA 2VR9A 2AK1H 2LDXA 4RH4A 1SOSA 3MI6A 5J4HA 3CFDB 1FYDA 3V10A 1L4BA 3KBOA 4JLRB 5ECYA 3KQVA 3G8DA 3GS0A 4YFLI 4P58A 1CG9A 3ZTNL 4FWWA 4D9LH 4ZMOA 1IAII 1VZ2A 4YRPA 1JZDC 1ISPA 2DWSA 3S3TA 3PLRA 3JTMA 2BGWA 3Q2WA 2OMVA 5C4MA 4M6WB 3FNEA 3I74A 4PX5A 2XZAH 2VYCA 2UVEA 1AR2A 1ZD1A 1NM4A 3V5KA 4QCIA 4RULA 3IBOA 1GZQB 1KGSA 3SQNA 4KQ3H 1ORTA 1A5FL 1Z9SB 1XL1A 3HLAA 1K6EA 1L2TA 4K8RB 2WTMA 4ODUA 3ZI4A 2NMSA 3QFDA 2GEQA 1OLLA 1S9YB 1KXVA 3CX8A 3L3HB 5D3QA 4R8VA 5EJ4A 2XKBA 5AM1A 2AZXA 4LHEA 2BKAA 1HKFA 2X1WL 5IK2A 3TTSA 4A03A 3LHAA 4FXTA 5FPPA 1Y37A 3P2JA 1DSYA 1O1YA 3AIIA 1LO4L 1XWVA 5CUSH 3VSTA 2ZU6A 2Z92A 2D8MA 3RLIA 2GZRA 1GG2A 3GLIA 4HTFA 3ZXIA 3VXUA 4YSCA 2XPCA 1A7NL 3FGNA 4HUVA 2VW4A 3BZEB 1X3LA 3PIQA 1XV8A 2WBLC 5HHOD 1SXHA 2APTA 3NPSC 3KEFA 5FPYA 2QSJA 4UMFA 5F7OA 4TMFA 4O02B 3IVKA 3EBHA 4Z78A 4BTEA 2ZB7A 4HUWA 4QDGA 3VXRD 1R88A 4QIRA 3WJMB 2Z58A 4EENA 2ZP1A 3OIUA 5TPWL 3FPLA 3NDZE 4WGKA 1SVWA 4I77L 1ZNQO 1PLGL 4KO1S 4MEAA 1N5MA 1EQAA 4RJJA 3UOWA 1LDGA 3SLKA 3PWPA 2R5NA 3ETLA 1YMME 1CZNA 1UXSA 1F48A 1QKJA 3RS0A 2A6KB 5HOEA 1INQB 2VCEA 2COQA 1RWPA 3Q10A 3UGJA 4ASUD 4A3SA 2EP7A 2R1XA 4ICXA 4AZSA 3URMA 5TGBB 3L40A 2Y77A 4BUGA 1CDJA 2P40A 3HHMA 1DELA 2GITA 2V9CA 3TL2A 3U1PA 2FWRA 2Z2YA 3E0QA 5F7JA 4X9BA 3DC7A 4NBNA 1O9ZA 3LWZA 2D7NA 5FYKD 5KMGA 1L0QA 1IEBB 1A5SB 3DZJA 4J3TA 4H7VA 5I1LB 3CXUA 4OBEA 3T0WA 4LEEA 6FABH 4X61A 2D0DA 1AXEA 1DVFD 1E6UA 2VITB 2AS5M 2PWYA 1C3XA 3K6SA 3GZTB 1SF5A 1BW8A 1PAZA 4NBWA 3O91A 4HIJB 3RTAA 3W8FA 2OCBA 4LDJA 3ZC3A 5IVIA 4P9ML 3IVXA 3IGUA 2O30A 4LOJA 3RSSA 2FP4A 5EIAA 3SDXA 5CILH 4YHNA 3P77B 4HCRL 4XP5L 4L76A 2GBLC 2F53D 4LIPD 2O2JA 1OF2B 2HSEA 1E3MA 4Z7WB 4KDFA 1QUNA 4GYJA 5BP7A 1URZA 4RKQA 5F9WB 4IBYA 4Q4LA 5FK9B 3AKCA 4BNHA 3F7MA 4X9FA 3QVWA 2OHJA 1NKTA 4HHAA 1Q20A 1GT6A 2K78A 3IXMA 3TBCA 2YRBA 1UM5H 1K7SN 4OGWA 2WMPB 4BQCA 3LSYA 3INOA 3VG0L 4FEEA 1P5HA 2QGFA 2VSOA 3WFHA 3TMAA 5EO9B 3DW3X 1WNFA 1TVBA 4BVFA 1NGWA 3MRGB 3ZU6A 1DIRA 1OBVA 2HMID 1J42A 2ZWOA 4HF7A 1OKEA 5F23A 4XDYA 4AGLA 4UDTB 2P67A 1K0UA 2PL1A 4QOEA 2QZ5A 4E5KA 3GQBA 2GQ0A 2KX7A 1M53A 1NAKH 3T4XA 4GKVA 2NUPB 1VZIA 3NZ8A 4LGCA 1C3JA 2PN1A 5LD2B 4G5OA 2IA5A 4GFXA 4NAUA 5E6IA 1T34A 4Q0XH 2FFBA 2XUJA 2JEYA 3O0RL 5D1QD 3OMAB 3EBLA 4L4UA 3CFKA 2JJSA 4I2XB 4OXYA 2HLPA 2XWRA 3EA5A 4EEXA 4AS1A 3EBAA 3KM2A 4QRQB 5CMLA 2VDQB 3MRIB 5DULA 4JDTH 3CVIL 3UYOD 3ZKXC 3AG3B 3NTVA 4O2AB 3F71A 2D03L 1EZSA 2JJ1A 5CGTA 3ARBD 3MOSA 4LE2A 1AOHA 1SLUA 1X3SA 1T9GR 2YWZA 3G2JA 4CVWA 2QVYX 3DM9B 3MROB 5C0AB 3PUWA 4P93A 4IDDA 3N3AC 5EYPA 4XUGB 1I3GL 5EBGA 3PI6A 3QG5A 5IMMB 4RD2A 4DLSA 1KBWA 1YY8B 3QIUB 1OE0A 4BQEA 1MTZA 1XCQB 4Z9FA 3VQTA 2NTJA 1WUTA 1CT8A 2R7KA 3ISVA 3R4RA 1J1PH 1RZ8B 1SG0A 5IBTL 3T52A 1NCBL 3O93A 1UAYA 2C3VB 1O0VA 3HIZA 2AI2A 4ECEA 3CLRD 2NY0B 1YEKH 3OQIA 1UBHS 5FYJD 3WADA 2WWWA 1WXFA 2A14A 3QHFL 2N0KA 2ZCKH 2JFPA 2WCSA 1JF6A 5FGBC 5GRVL 3P3RA 3AGWA 3ZDXB 4WW2A 1Z4IA 4IRXA 4CM9A 5J6HB 1Z5YD 4MJJA 1VGKA 4NECA 1QDUA 2IS4A 1KHHA 4BB5A 4Y9UA 4NC1C 4JR1A 4Q4HB 2D2CC 4FSDA 3EGSA 1HZZC 4L3EE 3HWWA 1QSFB 1TQ8A 1WPCA 4JLBA 5FIEA 4OM0L 4RPHA 3TEWA 2NT0A 1K2DB 3W82A 3F6BX 2ZCKL 5CFOA 2VMEA 5AOKA 1VMDA 2XUWA 5K6AA 1XMSA 4E9QA 2I5YL 2IP1A 3FZGA 2WR8A 3SDCD 3FHCB 4NBYB 5LU9A 3ZSSA 3IIKA 1H0HA 4PRHE 1G18A 3FRPA 1CE8B 3GGGA 4JSTA 4Z0BL 1ZOLA 4DN4L 3MLSL 3W11D 3MO1A 4KQHA 1ZY9A 3LRKA 2AFIB 5CGYC 4TRPL 4Y2LA 3V5DB 4DARA 1MVLA 4R01A 4H8WC 1T26A 4PJEE 2WU3A 3T7RA 1R3HB 1UMDB 2BCEA 4Z0XA 1VIMA 1BXGA 3IXAA 4LHUB 4FI6A 4S1QH 1M74A 3P20A 4K9DA 3EC7A 4MLDA 3WG9A 3LPOA 2H2HA 4MXVF 4ODWB 3T0AA 2BS8A 4IIQC 1Y5NA 1JJIA 3ZE6A 2INGX 4BHUI 5JNSA 3LZPA 4PSUA 3EDJA 3JATB 1HG1A 3W0LB 3ZJ5A 1CRWG 3FTEA 4AM0Q 4R31A 3L1IA 4EJMA 3BZWA 2XNJA 3G88A 1T4DA 1JHRA 2FWSA 4HX1A 3RFFA 2FWIA 2WAQA 2X15A 5IR1A 3HUJE 1MWAH 1SQSA 5C07D 3AREB 4P46C 4BDVA 1Z4QA 5DNDA 4M56A 5F6HJ 1E4WL 2QFPA 4MJ4A 3G0HA 3OY2A 2J43A 4R9HA 1TEHA 2G5BB 4E03A 43C9A 1PR4A 3TO4A 1YKSA 5GGRA 4NTZA 5SZIA 3TR5A 2E6PA 1OB2A 4OUDA 2J59A 1ZGHA 4P46A 1JQDA 4AK9A 2WLIA 1V05A 1G4RA 1YN6B 3JWEA 3RW9A 3P9KA 4LIQE 4MAFA 4KHZA 1E1KA 2COKA 3OJ0A 4RTQA 3DLQR 2RMKA 5FLXA 4PX9A 2BGGA 3WKQA 1JKFA 3FO2B 3U4BH 2V9TA 1DQDL 5HHOE 1SWWA 2R0WL 2JCGA 5DGIA 2B3RA 4AZUA 3RUEA 4XVCA 1W36D 3PFIA 2VLBA 3RNOA 3HP1A 4OZFH 4YCSA 4NY1A 2Z7WA 4IIQA 1MF2H 4IWXA 4PR0A 2JWHA 5C9KA 2IIPA 1P5UA 3H97A 4ZTOL 1ECYA 4CJ1A 3RO7A 3CRRA 2WA2A 3FPCA 4QTIH 1GAXA 1FRGH 1S3RA 5JLZA 4N54A 4RKYA 2H7VA 1YU6A 2DIBA 4RPKA 1ACCA 4XPZA 1JPFA 1VG9B 3QAZB 1N7IA 2GA8A 1A7AA 2GC7C 2VO8A 2CT8A 3E9EA 2P5UA 3IDUA 4EW6A 4NNXB 3JV0A 3BRSA 4PSPA 5ETUA 3VTFA 3SHTA 3BLPX 3VXUD 4NDMA 4JHVA 3D2LA 1SOXA 4DRYA 4QKQA 3DAHA 1K3UB 3SKMA 3WQBA 2VGLM 3A32A 5ADOH 4GL4A 2LLGA 4CEJB 4LOKA 3BWEA 3C6LB 1L6IA 3GMLA 4YCLA 2P80D 3WGZA 4D0RA 2GBFA 4NKMB 2ZVJA 5DNAA 1A14L 2B37A 3FFCB 4W9NA 1DHTA 1JQLB 1YC7A 2BFBB 2J0QA 3LZDA 4RVBA 3GSWA 2B15A 3ZDCA 2O6PA 3PV6B 2WC1A 4B7XA 4DLYA 1A1OB 2X58A 4OQTH 2NX5A 5TPZD 3WLNA 3MOIA 4QF1B 4AKTA 4LRQA 2H31A 1XO8A 4QQ8A 1T9HA 4TXVB 3DBRA 2ZJ0A 4G71B 4TVSa 3Q7RA 3NIGE 1BAPA 2OSXA 4HADA 3AACA 4IXMA 1K8ZB 1IH8A 3IILA 3NJLA 1MCWM 2BFGA 3I0NA 1MT0A 2E6KA 3DH0A 1JD7A 3AY4A 2H07A 3LRLA 3DFKA 4K7PL 5JW4M 3AEYA 1USKA 1QATA 3FTYA 4IILA 2WB2A 2OSWA 1Y5IA 5M2QA 2E27L 5E4AA 4WESB 2GN2A 5IBLC 5FAAA 3C3YA 3BHBA 1KBQA 3IDNB 2X9YA 1SBSH 3UO8B 3VPAA 4GSYA 5MF6A 5KVCA 3DYOA 4CLOB 1N57A 4HW6A 4OLFA 4YMLA 1TQDA 1L4EA 4H8VA 2ARWA 4Q1BA 1XZQA 1BA2A 4IH9A 1IAOA 1EAPA 2H1PL 4FZRA 1XCXA 2KZWA 2IF0A 2CDBA 4IRJB 4QNNA 3SKNA 4JJGA 3QVSA 5DU7A 3ZWOA 3DVAB 4INPA 5CJ5A 1MB0A 1RYHA 7YASA 5JR1L 3R5FA 1TYDE 5DCWA 1SJ9A 4JOCA 5K39A 2WLMA 5GAJA 5EWMB 1MVUB 4TQGA 1PSDA 3LX9A 4KTEH 3JZDA 2AOVA 2N0MA 3ZIAD 2WINB 4X7SL 3VXOA 1JXAA 5JMTA 5C09A 3RAJA 4EYSA 3FWNA 3S1LA 4CKWB 1DCTA 4WTWA 3DDOA 3A9TA 2Q2LA 2KPOA 3L8DA 3RA7L 4I5BA 4BNFA 4D4GA 1O6CA 1J25A 3GH3A 2PJUA 3BQMB 1IOWA 1YR2A 4Y4KC 3WTCA 3TH4T 2H7CA 1BMTA 1LL1A 3GB7A 2JKSA 3AGVA 2IOFA 3F2LA 3R7AA 4AJ2A 1UMBA 3KQKA 3TCLB 3T6KA 2FSVA 5EIIG 4Y8VA 3RWIB 2CCWA 3LEVL 4RYLA 1QV9A 1EQUA 2ORWA 3LKZA 3C3CA 3WNIA 5HR5A 3AETA 3ZWKA 2CHZA 1NG1A 4WEBH 3HCVA 2C94A 4HNHA 4F7MB 4EZEA 3GJSA 1YZ3A 2XXJA 4M7LT 3RE0A 1FBIH 1Z5HA 4LOAA 2CK2A 2CLKB 2V7HB 1EZ1A 1QVWA 1TQ6A 2IHJA 4LAFA 4MVJE 1YJDC 1EBFA 1RJDA 1Y89A 3NP3A 3GLIE 4MYWB 3DFFA 4JBIA 1CD9B 1F11A 3T9AA 5AW0A 3GLGB 5KIAA 4Y4FA 5IFJA 2FPMA 1RYEA 1NQTA 1CFMA 2FEJA 3KWTA 3ARDB 1NAKL 4KAFA 4QDUA 4E3ZA 3TL6A 4C20A 3A36A 3MN8A 2WSKA 4YAEA 1SDDB 2IWRA 1JHZA 4L23A 4ZPVB 2WLZA 4MIYA 1VRSA 2NPFA 4XPIA 1VP9A 4NC1E 5C1PA 3FQWA 1VL0A 4BN5A 3MCG1 1BVKB 4EUPA 3LX6A 1B2RA 4BRUA 3N75A 1G9SA 3T9EA 4TULH 3Q98A 3VCLA 3Q9SA 1XRPA 2VN4A 5JALA 3MTEA 2PUCA 4I3RH 4D8TA 3LWDA 2W6JD 5DS8A 1TPXB 3LIZA 3UAJC 1Q7EA 3KLBA 2FRXA 4H6WA 2ACEA 3ZKMD 3H05A 3TKYA 4PJ9D 3KCNA 3I9NA 2PKYX 3LEXA 3SC4A 1J00A 1CXLA 3A1EA 2ITDA 1V4NA 4OLWH 3G6JA 4L3WA 4Y16A 1OMOA 1GPH1 5BRJA 3RWHA 4QRUB 2NXWA 3B7YA 4EB0A 3IBGA 3A9RA 2ZWKA 2CQVA 3WLWD 2ATAA 2F8XC 3GDBA 3B6SA 4CR8A 1BU8A 1RYYA 2VPWA 3KB6A 3GZOA 4WJLA 4H0NA 1AYOA 3BF7A 5DTRA 5EP2A 4DJFC 4B75A 1U8MA 3BEWB 5TPZA 3BH8B 1WZNA 3JQ7B 4K88A 3HXLA 3HCDA 1QTSA 1W73A 1HEZB 4Q1FA 2BRRL 4CCYA 1XMQB 4AP5A 5JNUA 5FF9A 1NMZA 2SODB 4K6KA 5F96H 1CZLA 5JASA 2AITA 4YVFA 5ICUA 3QBTA 4ERSL 2BPOA 2J12B 1ULVA 2I34A 4YHPA 4AWBA 4ZO6A 1NVTA 4ZVOA 5LYJA 1U5CA 1JGTA 1P3DA 2WLYA 4FTWA 5IVZB 4WEUD 3ER9A 2YOCA 2FGJA 2IYOA 4YNYB 1NLZA 4EA8A 5I71C 1Y6ZA 3Q5GA 4EPRA 1M34B 3IAS6 1UK6A 2HJLA 4GRWH 2CSXA 1NGZB 2P8PB 4JG9A 4ERSH 4J23A 4U7FA 3HAEA 4OJAA 2HRGA 4NWIA 2N59A 3B2DC 3S0JA 1G7MA 4URXR 2YQZA 4JYPA 3T6XA 1NAMH 1EDOA 1N7MH 1T4BA 1QZUA 3DBXA 2WT8A 2IPMA 4JT4A 2XB8A 2EDHA 3MRFA 3MLBA 3TEZA 3CCHB 3VGDA 3KB8A 1PX3A 4G26A 2HT2D 3OIYA 5CR1A 4GZ3A 4DZBA 3WL9B 3D1JA 4WHYH 4FHEA 9LDBA 2DGDA 2OILA 3D3WB 1AE6H 1J33A 1TIBA 3SCMD 3C9NB 4LP8A 3CVJA 5JNRA 1N18A 2B1HL 2IIJA 2AH5A 2O59A 2FVXA 5HK8A 4Y9BA 4P4LA 2R2HB 3DAYA 1BECA 1AM4D 4ZOLA 4ENZA 5EEXA 3EGDA 5EV7A 3LNEA 9LDTA 1GU7A 1Q1QA 4M1GH 2NQ2C 1QF9A 5I5EA 1NFAA 3JALA 1YEFH 3FUFA 4POYA 1N9GB 2ZRDA 5MHSD 3I92A 2WFAA 1U3UA 3GMQB 4FMKA 5IF0B 4ZPTB 5EU5B 4JFXB 1CF2O 2XWSA 3H7AA 1T6YA 1LSOA 4KO7A 5A4MS 1QYXA 4KO8A 3O82A 4C4TA 2EZ0D 4TS4A 1Z5LA 3GR6A 1JN0A 1T5XA 2A6JB 3WGJA 1H2AS 3H5NA 1I7TA 3PRZA 3SOBL 1MC5A 4HPOL 3ZDAA 4WUKL 1MZVA 5JH7A 3AYXB 5GVSA 2BFFA 4BVBA 4TTTS 3WK4A 1Z4JA 1XCWA 1IARB 3AHJA 3C8KA 3L9XA 4HXEB 3TZHA 1AGRA 4KDTC 1TU2A 1YNSA 4B3EA 2QAGB 3ETEA 1A95A 3AUXA 3GIVB 4IDAA 4X8CA 2ENWA 4B2YA 4UMVA 3OUZA 1OD6A 1R17A 1MELA 3TBVA 3ID6C 1DV2A 3H7BA 1S7XB 1RQPA 4L28A 2K9UA 5TH2A 2RJOA 3N3EA 3MYRA 2IQIA 1C50A 1SLWA 3U6RB 3DKVA 2DHQA 4I3RL 2B4CL 2WC7A 1JZ3A 4YRNA 2R4RL 2G3ZA 1ZAKA 2JCSA 4EF6A 2PUVA 2GJPA 1J09A 3MMXA 1BZ9A 4IJTA 4HLZG 3SZ3A 4FJYA 3W5CA 4WLEA 2EKZA 3UZUA 2DM3A 4R7VA 1M0EA 1MUJB 3ZHKA 4Z3FA 4OCMC 4RS4A 3N2EA 3BJLA 5DJAB 1BE6A 2OJEB 1B8NA 1AQDB 2OP4L 1TM4E 2WAAA 4BNUA 1K7FB 1XGQB 2VLLA 3P97A 1NDUA 4FVTA 1AZZC 1KY2A 1H65A 3LFHA 4HJUA 3R8CA 3IUYA 1YEJL 4QAQA 2ZIGA 1ECLA 1JQAA 5ESVA 4PJIE 1RPUA 3H7LA 1ECGA 3NIWA 2CBPA 3N8DA 5IT9A 3U80A 5KYYA 4KTEL 3MJ9H 4G8CA 3OZKA 1KT2A 5KHOC 4QPZA 3UO1H 2O4EA 2COVD 5KHAA 4Q4AB 2DVMA 6TAAA 3OAYH 5ALPA 3L2MA 5C1MB 4OI7A 3IR5A 1CTMA 4N0MA 3SYLA 4L4VB 1T0HB 3NC0C 1BVUA 3CINA 5SZKB 3O8RA 3UG4A 3L7YA 3VHLB 4LSMA 3EOAI 5AIBA 1F1BA 4HFNA 1SPDA 4HIEB 4ZVPA 3VI3E 3SPHA 3L8YA 1GSAA 1PQWA 3D6NB 5IHZA 3B1FA 1E0SA 1F2UA 1D6JA 3BRQA 4EKNB 3UABA 3WV4A 1GGIL 2Q28A 3EJTA 3D6JA 2PW2B 1K4YA 1KIQA 3VYOA 3MAJA 2UYHA 2JI3A 4AGNA 5EWJA 15C8L 1DJQA 4UZEA 1E7QA 2P2LA 4RGQA 3ZW7A 3K9WA 2WU8A 4BCBA 5EJ9A 1DIAA 4M8QA 4KXZH 4KKQA 16PKA 4BA8A 3FTGA 5FKPB 4RMIA 3CHQA 3TSZA 1Y1UA 1Q1JH 1IBCA 4B74A 2XG5A 3J7AC 4K5PA 1ZANH 4AJNA 4EN3C 2FSVC 1REIA 3Q85A 2E5WA 4W70A 4U7JA 1PR2A 1BMFA 1PWHA 2XMPA 5KNDH 4X3OA 3OHXA 3GXOA 2P4QA 1EUQA 1U2EA 3EDFA 4MVBD 4OR1A 3V0WL 1D3AA 4Y4KA 7CGTA 3P0FA 8GPBA 5EO1B 3FFDB 4NNYB 1XIWC 3IYLW 5DKFA 4PG9B 4FGUA 2VAVA 3GMSA 3HS9A 3QIVA 1E98A 1H2YA 3QR1A 2D5LA 1JI1A 2OYLA 4EUPG 1U2PA 2XVGA 1N9GA 4AMZA 3TSOA 1CL7L 3HCCA 2ZUCA 1JBEA 1EX6A 1EEZB 4BCYA 3G79A 3T6WA 3Q06A 1QPZA 1U11A 4DQDA 4OCYH 2A6IA 2P8MB 4XCYB 4PGCA 2F1BA 3KZMA 4N9QA 4QRIA 3IHWA 2FZWA 4AEHL 4KKRA 4BO8A 4NO5B 5AUMA 1DXHA 2WJ6A 4D1YA 1KGCE 4JRLA 2PWGA 2CUNA 4IKKA 4XB3A 1CYEA 1R3IL 3OAAA 1FFYA 1XXFC 2DQCL 3RVLA 2B21A 3FCCA 4WV3A 5E6UA 3P5BA 5I73B 4XGZB 2ACWA 1CXZA 3EO0A 3VB9A 2GS9A 1DE4B 4L8WB 4AC4A 4V2IA 1TFPA 4K5QA 5B1HA 4OQ1A 4EJ2A 4HKZB 4IDBA 3E9DA 1I94B 1I53A 4QTIL 5G0WA 4HK3N 2Y1LA 3H3PH 1K6QL 3QWQB 4GLJA 4NPYA 3DO4A 4OF6A 4IGIA 4HLDA 3HE6D 1ADGA 1FK8A 2JB5H 2GPBA 5ECGC 3OSVA 1SJHA 3NH6A 1Q3TA 3QARA 4Q01A 1E62A 4FGSA 5JPDA 1WSAA 4RAVB 2CLFB 1VIAA 1GYUA 4X4YB 3K05A 1QZ3A 2KM1A 3MCKB 1E2NA 2PABA 1YNOA 1KGYE 3UVEA 4NM4L 1XDUA 4YHPB 4OT1H 4NJMA 1P91A 2MMGA 5IHLB 5JMPA 1EIWA 3HG1A 1ENYA 4YJGA 2ATXA 4BMOB 2GK0B 3KPRE 5CAEB 4GRDA 4J7AA 4R3NA 1NFKA 1VE6A 4MV3A 2MR6A 3QPWA 3WQRA 4KH9A 1LPPA 1QA9A 4MQ4A 5IM4F 3RGWS 3U0PB 2OX5B 2VF7A 5EE5B 3HR8A 3SGEI 3D7SA 4WKXA 3DRQA 3M5CA 1QH0A 1NZRA 1E4EB 2HC9A 1EGJH 3UO1L 4RZIA 2M32A 2F6RA 1FUYB 5KQMA 5DUJA 2C8KA 4HATA 3LD8C 4MYDA 1TSHA 3WFCH 2PVPA 4PWFA 3KPMA 3K9BA 1M1XA 4LDEB 2DUMA 2X0FA 1F45A 4KAQH 2X53A 4Z1MD 2EP6A 4HDKB 4QAWA 4YSQA 2XVYA 3H3JA 3SKXA 3O95A 5BRZD 4P4KB 1KFGA 4HT1L 2ZZUT 4G59C 1EXVA 2YJNA 3U4BL 3CMOL 4KL8S 2VYNA 1BBDL 4AS3A 4E33A 3O3UN 3SMQA 1QHFA 2VDNL 3DE7X 3S36L 2WVHA 2VXVL 3AUTA 3KVOA 1TZ2A 4HHEA 1VIDA 4QXPA 3MTIA 3AVYA 5T8IA 1G19A 3WGHA 4F84A 4HDAA 4K3DH 1XL4A 4Z86A 1WJGA 1CB4A 1FU7A 3VU9A 5I73C 3EVCA 3Q41A 4IEFA 2X1HA 3VFGH 3FUNA 5EXEA 5FPKA 2FXIA 2ZKYA 3GF8A 1JNHA 3WDKA 3FI9A 4HK0B 4P7KA 3GDFA 3VHXB 1YRQA 1SDDA 4TWIA 1IGFH 1WXIA 2CY0A 4QFMA 3ZKWB 2GUOB 3KWUA 1UOPA 1Q9KB 1UBLS 3ZHOA 3S8YA 3PWPD 2L82A 3KZOA 4HJJL 3NDBB 3ZGNA 4LVNB 2R6HA 3QMMA 2MH4A 3PG5A 3I2YX 1U8OA 4ZOQI 5A03A 2XTMA 3FSJX 5SV4A 1LI7A 4PRDB 3IU3B 3ZZ1A 1GUBA 5CEYB 3AKZA 5INDB 2ZWNA 5KYTA 2Z2JA 3G5XB 3PTAA 4GKSA 4K2UH 5BN3B 3DDUA 2NNRA 4YXLL 2CDEB 3K16A 4WUTA 5BYBA 4PJ5A 3IAGC 2EDTA 5AXAA 4DN3L 4EF5A 4WWKD 3IIIA 3FUEA 4RK5A 1FL6A 3HP4A 5BO0D 1H2XA 5DK0B 4NIKB 3TBBA 3L7FB 1B7GO 2CHVA 4GSKA 3LGSA 4ZO4A 3KRTA 4M83A 3Q7JA 3TJHD 1BE8A 2D54A 3L0IB 3W5UA 2K7PA 4DN4H 3DWIA 5HQ3A 1B14A 4RJKA 5A5FA 4N8EA 1BREA 5DCLA 1TUIA 4QTHA 4LJSA 1L7QA 1RZJC 3GRWA 1QZZA 4NO2A 1YJCA 1YB5A 4ESHA 4F1JA 1NA8A 5COQA 5C52B 3OPYI 1AE6L 4BTLA 4QDXA 5LZ2A 2DWXA 1CDBA 4Z3IA 4ZFFB 3SYOA 2ZYTX 2CKNA 5GGXA 2VRAA 4LYEA 1XZ0A 3CDYA 2EE9A 1NUQA 1H1LA 3DZDA 1I4DD 4MMZB 1KYYA 1HSAB 1QP8A 3MT7A 1XD2A 1IDN1 1UOQA 4UD2A 3FDFA 5ICXA 1A6UL 3E7FA 2EDFA 5EU6B 3DVAA 3TWYA 4IRSC 1DAEA 5E95A 1AZBA 5AAMA 4A5OA 2PV0A 4MS4B 4GSDL 4MDJB 5D7BA 5DISB 1IQWH 3HZ3A 3TBYB 3KWXA 3NR2A 4HR7A 4RMNA 3BPCB 4IDPA 3N1QC 1L7AA 3NSYA 3C5CA 1ZLDA 4PZUA 2YL2A 3QUKB 3M9LA 4HS3A 3OT5A 2VJ8A 3G6DL 2DQSA 2LKCA 3CRNA 5BWCA 4JGIA 4B9IA 1FPMA 2CFSA 4HZGA 5FYLE 2XMDA 4TQ9A 2B4YA 2PS3A 4M1MA 5HK9A 4NYJR 1XN1A 2WPGA 5AQ1A 1R0AH 3ZD8A 2J5LC 3TLJA 2PPEA 1VL1A 5L4FA 2BIIA 4M7ZC 1KXQA 2Y8EA 1IBHA 3LY6A 3PD0A 4EOWH 2B5WA 5CEJA 2B1OA 5BSUA 5J4MA 4Z51A 2H2WA 5BV1A 3GSWB 1VE1A 2O7RA 5G4LA 1ZEAL 4IKOA 1GAEO 5HKLA 3ZE1F 1XJCA 2O2YA 1CR0A 3K53A 4DV7B 3R1IA 1L9MA 3LSOA 4C56E 1UIRA 4NRZB 2Q21A 4G9FB 2CU9A 1J9CT 4NQXB 5C3TA 2R60A 1QPBA 4LRUA 1B8OA 2AQRA 1KIRB 1NVXQ 4TULL 4L8FA 2XT0A 1XNHA 4PRIE 3SQLA 3PUUA 4QRSB 3CVHH 2XTSA 2HGSA 3GRRA 5E5RB 3RV3A 4F7CB 4N5HX 4BX9A 4CQMD 1ES0B 2GBVA 1JPFB 1SXGA 3H99A 5CCXA 2NTVA 2VEOA 4R26L 3FB1A 2GPJA 2JJSC 2K3HA 2QRUA 3F2IA 1CGYA 3QTBA 4I5GA 2AQPA 4U6XA 1AXRA 2AEQH 1KYWA 4DK6A 1E9BA 3O74A 4JCMA 1O6ZA 4R2LA 2QN1A 3ZE2B 5L7XH 1QHQA 1CC1S 3PGXA 3RODA 2K5UA 4RLQA 1O6VA 2ZE0A 1UKTA 1IBGH 2P1DA 4E2YA 2AAAA 2SKCA 1CT9A 4QPCA 2I29A 1ZM9A 2DKSA 2O8CA 2E37A 2J9ZB 3HR7A 2ADIB 5L9DH 2R51A 5JHGB 4YUEL 1I9JH 4TN9A 3DZFA 5IQLA 1WW3A 5DASA 4O3FA 4ZXBC 2GJ6E 3S6JA 4OBBA 1H23A 1SVNA 2QE6A 1YBMA 4QGGA 2IF2A 1SC1A 5DGCA 5IESL 4N8VG 3GPCA 3DROA 3I9GL 3W5VA 1X42A 3MIIA 4EYKA 1U2HA 4MXQC 1D7BA 1S7RB 1YEFL 1N1GA 2NYZA 1IFHL 4DUWA 2BYTA 4M7OA 4HKXA 3D4IA 1NVMB 4OXKA 4Q82A 3LPAA 2E5LB 5E5MB 1O9GA 4MD5A 3KYOB 2IC5A 3AV3A 4J6RL 1Q7BA 3U16A 2C2GA 2ZUXA 3ZTTA 5DRXA 2JEOA 3NSCA 4Y4KD 4RTSA 3GPLA 5I1CH 4J1UB 2XMQA 1YNKH 2WW8A 4TVPE 4Z0NA 2YAFA 3G8CA 1XTZA 2H41A 5LDDC 3KWVA 1E8DA 1TZIA 4MYRA 4KJZA 2HBYA 2PRSA 3AR8A 5E2TH 2IXQB 5BZDA 4OP3A 3UC5A 4BUZA 1PZUB 4HGWB 3FF1A 2X0NA 3DJYA 1EUDB 1IEVA 1D2AA 5I8OH 2H2FA 1MJFA 1AKYA 3TZCA 2P62A 3N9GH 1HI9A 2HRCA 5I71B 4LYFA 4ZZ3A 4OF5A 5A3JA 4YXWA 5D2LA 1FAIL 4HC4A 1MCIA 2LCQA 2HL6A 2ZQZA 3ZZ0A 3GX1A 4MCYB 2XMGA 1FRZA 1PG5A 1UZ6F 4BYGA 1AO0A 3GSUA 4BOYA 3SVZA 3SBQA 2AJ3B 3DMGA 1SXPA 2V3DA 3VYPA 4RD0A 2NUAB 4P46D 1W19A 1CR1A 3AY6A 3UCXA 3HKCA 1DVUA 5FL7D 5HMMA 2IZ7A 2XWDA 4OLHA 3G5ZB 2DWYA 2B2XL 5CU5A 2I2WA 4YRSA 4GR9A 4AXBA 4X6DF 2ZUYA 4RX4A 2GUWA 1CP2A 3ZDXF 2VDVE 1YEHH 4FXOA 5BRPA 4B7LA 3O2DL 2BSBA 1JYSA 4GXRA 2Z30A 5LQSA 3LKDA 4TYQA 4TPRL 1OIXA 1VHQA 5K3SA 1VP3A 4BC1A 1ZFNA 1LLFA 1XZCA 4BGEA 3GLRA 1U0QA 4I85A 1NV8A 3WY1A 3FONB 3ECQA 3QDMB 1S5HB 2DDQH 4WJKB 5F1IA 1BS2A 3O9VA 2OYMA 3NCWA 4F71A 3BQNB 2HW8A 5J6HA 2RHTA 2NVOA 4ZT7A 4Q7QA 2AEJA 2EIZA 4BQPA 1CXKA 4G42A 2CO4A 4XX0A 3FONA 2PG3A 3G59A 2WVSA 3TH3T 4L75A 3FTVA 4D5EA 3HI4A 4HEA1 3V5NA 4J6RH 3EF0A 1QFMA 3TOCA 5HVHC 1N5AB 1RULL 3FCBA 5F70A 5L2KD 1PP4A 3EYOB 1T04A 5F72S 1FAKT 1AO7B 2P48B 5B3SB 5IMMA 2YY6A 3PEUA 1FG2B 7REQB 2QQKH 5EYPB 2HREA 5IBRA 1KDVA 3NV9A 1PJ4A 3HLKA 2K1MA 2NYKA 4MP3A 4CTNA 1MH5B 1F4VA 3MG9A 4A8TA 4DERA 4O2AA 1N1MA 4TNFA 1ASOA 4A6YL 2B4AA 4HKBB 1TQBC 4QRQA 3FOEC 2UYYA 3DIVA 5EZYB 4PJXE 2BTOA 3A04A 2XKSA 5JW6A 1XYGA 3IURA 5C1IA 4Q3EA 5I1HH 5KTEH 2B1RA 2EC8A 3COPA 2DF8A 4FD2A 4OW6A 3WNJA 4QT5B 1TM3E 4MCIA 4B2PA 3FE2A 5E9QA 4GB9A 2IY7A 1CY8A 4N47A 2QMYA 3A9WA 1UYWL 2WSMA 4MTCA 4RY9A 2LDBA 4HGOA 5FUOL 3OTHA 4BO2A 1BZYA 4UASA 5SICE 3FN0L 5IN4A 2YWFA 1KP2A 1UXWB 4GR5A 2R39A 2WTNA 3KNBA 2PW1B 1D1SA 2BBSA 3Q5TA 4HQFA 4J1UA 1SUJA 3WIBA 4BFNA 5BQ7A 4XODA 2A88A 4AQZA 1TPZA 1JPTH 3NBQA 1UKSA 4QRPA 4B46A 5B38G 2DFNA 1T36A 5M7EA 3M1BA 3L1FA 2ODHA 3GSXB 2QUJA 3LKBA 1T4KA 2BY1A 5KYUB 1N3IA 2NY6B 1YIAA 1S7RA 2DQZA 4GBMA 1S8FA 4IKEA 1K5GA 4Z7WA 2VSCA 4N3GA 2WZPD 2XIQA 1W88B 1JR6A 2K7FA 1LK2B 3RDTA 5C7OO 3B9EA 5CM1A 3PL6A 3S37X 4PJHB 2KE5A 4LRNH 2OMKA 3MLXL 2XXGA 3P77A 1OV6A 2Z3ZA 4DR1B 4OZHE 3RG2A 5LWYL 4TYPA 3RFTA 1E8NA 4LGYA 3BUYA 1N2IA 1NLMA 1JHTA 1QZXA 3MV8A 2C1XA 1NWOA 3F7OA 4X9GA 4HIJA 4PLFA 1FDVA 1SXSA 4F37F 3JTBA 2HVKA 4RCZA 1QE5A 1N2SA 4HWBL 3WIIL 4S2UA 3PKZA 2HRHA 2DB8A 1EM8A 2OSLA 1EXNA 5CLLA 4BUQA 2DMKA 2G36A 2COUA 4F5DA 5CHNA 2UY6B 3TA3C 2VNKA 1E40A 2O3JA 3S2UA 3WMGA 3S36X 5DMHA 3OLQA 4L8LA 5LQMA 2F5AL 2R66A 5JYLA 3C09C 5FGRA 4YJ3B 3FLBA 1TCUA 2M1KA 4WSGA 4AUMA 2R1XB 1F8UA 1Y33E 3I05A 4DLRA 5FI5A 3GIZL 4Q37A 4WWNA 2GIMA 1FZKA 3RNQB 1P1ZB 5IEKB 2CXNA 3QIUC 1BP3B 3GZNA 1U30A 1JBQA 2O8FB 1N0XL 4QE3A 1U0FA 3UAFA 2P3QA 1LO0L 1DEOA 5K8IA 3W5NA 3V0VA 1NUSA 5H3CA 5KJRL 1C16B 4RZ3A 4MSUA 2LE0A 1TTFA 3HN8A 1HUQA 1CUGA 4KDRA 2WIIB 2GG1A 4Z78B 3SS8A 1AB6A 1PNDA 3IEAA 1ZY2A 2EL7A 5KVEE 4LRIC 3KH4A 1FFDA 3QVJA 4Y8AA 1RRFA 5EHQA 1KNXA 2C5SA 4OXIA 3BP5A 2IOQA 3OJMB 1ZH8A 2NTSP 4MKZA 1JHLL 3KJEA 4P8RA 4KXVA 3JQ6A 2CA3A 2VJBA 1QPPA 3KD3A 2OCIA 2JGIA 3OURA 2Z92B 1Y4SA 2XCLA 1WAAA 3FDWA 1UVQA 4ZXBA 4Q3NA 3PTLA 4E70A 1QABA 5HEKA 5AWFC 3S99A 5HM6A 3QZWA 1KYXA 3QIBC 3FR7A 1Q95A 3SQWA 1NCIA 4ZTOH 3I2FA 5CK4A 4LCCB 1G7TA 3C3XA 5F51A 4BUCA 4XPTH 2R79A 3M70A 1V5WA 3I3OA 3PNBA 5T33L 1NSYA 1GZHB 4WE3A 4RPIA 3OFKA 1DL7H 2FZGA 1FUEA 4UHJA 1WFOA 4QLAA 1Q1ZA 1RHUA 1Q1JL 2B1AH 4EMBA 2F7RA 4D9QE 4ZI7A 4N85A 3QDGB 2AUTA 4F3NA 4P9HL 4M6WA 1LGVA 4PJBF 2WD0A 2X0EA 5BN5A 4FNTA 3RJDA 4EDWH 1Z36A 2XETA 4KMOA 1HAUA 1IGFL 4AQEA 3KPQB 1YIOA 2QM0A 4LLQB 5K33A 2WDZA 1GY1A 3MGTB 3DEKA 2IY9A 2EUWA 3I0MA 4JLRA 1C0EA 5AESA 5IAOA 2JLWA 4Z1PA 3CE1A 2VIRA 1UB6A 4ZWNA 4E2FA 3TA4D 3VXRB 4JVWA 2VAAA 3MRLA 5FD8A 3MBEB 1TKCA 1TT5B 4UW9A 3CUVA 3RH0A 2ILVA 5FUYA 1NP7A 2BR3A 2H8PB 5H37G 5CN3A 1UM5L 4NX2A 2JE8A 3IFLH 2H6OA 3UMRA 2V7PA 2VVTA 3DK0A 3FO1B 3B3GA 4WQMA 2TYSB 3DHWC 3KXFB 1KHTA 1ZGZA 1X4ZA 1VG0B 4MQXC 4G84A 1MQ8A 3DX6B 3QP9A 2QTVA 2WKLA 4WFIA 3OZ9L 1VACB 1S2LA 2OG1A 5C0RH 1ZIPA 3S44A 2VSKB 5EU4A 4RGOH 2OTCA 5TK2A 1CFSA 3T7JA 5JDJA 4NNPA 4B4OA 4XXDB 4GKSB 4H40A 1DVRA 4Y5VA 2BH0A 3FB8B 4NUQA 1B8UA 1GGNA 1T8TA 3H85A 3TQQA 3IJHA 4XWGA 4X99B 3DKHA 4JAMA 4HSAC 3OE5A 4WNAB 5HDBB 2PTVA 3Q8BA 5CLWA 4IMLB 1JMXA 3ILQD 3DB1A 2WV3A 4IOIB 4EJ0A 3TIEB 1YSCA 2PMBA 1JNHB 4TVPL 5IW6B 5DMKA 1SQ6A 1E2JA 2EDEA 3H4TA 5HOQA 3JY6A 4L9RA 5AVZA 1OJLA 3D0LB 5U4XA 5AK0A 2MOQA 1LEIA 1OFUA 2AJTA 2FT8A 5JW3L 3ALWA 3K2UH 4HH0A 4BWWA 3WHIA 4CXMA 1ZHNA 3WS6C 4KRMB 3WY2A 2A7BA 4D0BB 3POCA 3KS0H 3M6LA 4FHJA 3ZXSA 2RR3A 1YTUA 3IE1A 1I32A 4BY9E 3DTYA 5E6SA 1MCJA 3PRJA 1KJ2A 2I4NA 1SBNE 3L4EA 4H26A 1X1EA 3UAYA 4DUPA 2WKOF 2F1EA 4QDJA 1QSZA 1M8PA 4CDGA 2GJZB 4GUOA 2BSQA 4M4PA 2BEWB 2O3QA 4LMAA 3A4NA 5DGQA 4FQPA 1QAMA 4EA6A 1KYUA 3KMDA 4GI6A 4JEMA 3AFGA 1PJLA 3CK0H 2TRYA 3ES6B 4BMVA 4IH1A 2HHHB 2VDQH 3F8TA 5L2KE 3CO5A 5CNKA 1GTRA 2OX5A 3ROPA 3E0GA 4R4FL 5C81A 3WY4A 2I1WA 4FBMA 3B3AA 1HDIA 4ZD6A 4C0KA 4LZLA 2WHQA 4AYSA 4F5WA 2IDFA 3KJQA 4IZHA 3MRSA 3UFIA 1PJZA 5AD0A 4LSPH 3WWCA 2WQWA 2P8JA 4LHUD 2V65A 2VZ8A 2VHYA 4KKXB 2DWOA 1HT0A 4FQXB 1O2DA 1W34A 3IJHB 1U0OC 5EC8A 2B7BA 4DE5A 4X4YA 5JCXA 4OI0A 5GS0L 1QNZH 4MR9A 3PNOA 4MQEB 4ENSA 1GQQA 1R5JA 1MZYA 1NXXA 2MYUA 2PEZA 1A4BA 4XR8C 3WL4A 4ZRNA 5AW2A 2EJBA 4XOBA 2O8DB 2IOIA 3B2NA 2I7VA 5FCSH 1N0VC 4Z77B 2Y68A 5GM1A 3BSWA 2OULB 1WDMA 1XXDC 2VHQA 1X9LA 2HF2A 3HN7A 4ENRA 2J88L 2MSPA 4KN9S 5E6UB 2EDLA 3CU1A 4PG6A 4M1CD 3PNKA 3A37A 5I7OA 3VXSE 4M1ZA 3BXFA 4D8XA 2IWKA 1YPZA 3FPHA 3VFTA 3GRFA 2DEXX 2ON6A 5CA1B 4KV9A 2AS0A 3KQPA 1PCSA 3OUUA 1VKJA 3BMVA 5DD1L 5KNBA 1PT5A 1MIEH 2A9NH 3X13A 4D99A 3CX3A 5EJGA 3WYBA 4AITA 3PFCA 5C5IA 1WCXA 2ILTA 4GE0A 4RETA 1TJ4A 1NXSA 1IE4A 2JNZA 1ZG3A 4R41A 2YUZA 4GZ6A 4KMTH 4U7DA 4FBLA 1T0PA 3HBFA 5AXCA 1GITA 3GUTB 2P42B 1AS0A 4P4GA 2XCSB 3UWSA 2WVTA 3C4JA 3Q1LA 1BQHB 2AI0H 5CILL 5D9SB 1Q0EA 5ABPA 2BJMH 2BSED 3WMSA 4ZNCD 2WXOA 3UMBA 3F12B 3SGDH 2WVVB 2H00A 3WBDA 1OM3L 1DJGA 5AO9A 1MI5D 2N47A 2P6OA 5GQSA 3ZQKA 3NMUF 3I5AA 1JA0A 3NS7A 1J5OL 4EG1A 1Z6TA 3IKTA 3QHTC 5J1AB 1W93A 4N24A 4Z7JA 3VFVB 2VL5A 4FEYA 4IP0A 3OEHA 4JIMA 1OP5H 4FA8A 1NZDA 3JV6B 3ORQA 4F1ZA 3DKRA 2PZLA 4QYIA 2A9QA 4CW1B 5F9OL 4ZS7H 2OFWA 2YZ8A 3UAEA 4JFEE 3OLXA 4IHQA 3RHZA 5BMVB 3OMNB 1NBWB 4ZAZA 4C88A 4HD8A 3WGMA 4LZJA 1WE5A 4D3FA 1K66A 4LF4B 2MWMA 5ERWB 1ZS2A 3DOHA 3SEQA 1I7PA 3DD1A 4FQIL 4C21A 5ESWA 5I9MA 5IQ7L 3W9EB 1HESA 4MNQB 4Q39A 1Q16A 2CLVB 4UDXX 3MODL 1MRDH 1MY7A 3D2BA 5DV9A 1C16A 4Y2DC 5HRAA 1JVLA 2EX1A 3SOBH 3KJGA 4QELA 2ZWPA 1FBIL 4UVEA 2WO4A 2OR7A 5FYKL 1Z6AA 4LLYB 2FUCA 1SVLA 4IU2B 4OZGE 1TZAA 3TLRA 4YAUA 1QMUA 2Z7UA 1MV5A 3OWHA 3VR4H 4JSRA 3X14A 1U65A 4UNVA 3H56A 1XGQA 1YV9A 4P5KB 1L5OA 3RC7A 1ZU4A 3BWXA 2I7OA 3ZCVA 3DZCA 2NY2D 2OMZA 1RYBA 3KUUA 1YCDA 2CMFA 3UMMA 2NY0C 1ZL0A 4WUVA 4RW0A 3C6BA 1EDYA 3O2SB 4AP6A 3SDCB 5I0DA 2CD0A 4YRBA 5T33H 2O0MA 3N42B 3K74B 1G6RL 4KVGA 3T7CA 5KBLA 4MVWA 3RVWD 1PZXA 3T5AA 4EO9A 1W52X 2X4LA 5TGDA 2GJRA 1HK6A 3OKLB 2WHXA 3G6WA 1OIOA 5F3WB 4HXFB 4Z6AT 2HIAA 3KAQA 1IWBB 5DMIH 3SSOA 8ABPA 3O8NA 4PWEA 1YASA 3V95A 5GSRA 3B6MA 4GY4A 4QXWA 4QXOA 5AW5A 5HNKA 2M6SA 4KPYA 4HKTA 3SYKA 4F5EA 4OAWB 3U26A 1C2YA 3O9WC 1VYUA 5JH7B 1TU0A 2B5IC 3QUYC 2JHGA 4GFTB 1ZT1A 2OM5A 5EC1A 2XNSA 2WP3O 4DMFA 3TIFA 2R4QA 4J4PA 4L18A 1T36B 3JQCA 1DVYA 2VSNA 5BRZB 1QIMA 3LVFO 2QM8A 3RQSA 4X41A 1KBKA 2OLJA 5JW3H 4JUCA 1KL7A 3PXDA 1JS4A 1GLVA 3BUBA 3RAEC 3TOZA 4LPSA 4TOYH 1OZAA 4Z3KA 4J07A 3PFUA 1Z18A 1ZUIA 4JJ6A 4PHGA 1N0IA 5E5LA 3TT1H 1KCUH 1CGVA 1FP5A 4HIIA 4GX1A 2DC1A 3SWWA 4M8UA 2NY5L 2HJHA 3O4VA 3F97A 3WKCA 4PYKA 3FQTA 4I4NA 4NBVA 3AF4A 3GSNL 2XACC 3KPPA 3NH7L 4B41A 2IXEA 5THXA 4H7EA 2OTWB 3DIFB 1SCUA 4FFPA 4Z76B 4IKPA 5DLPA 5KVGL 3WNOA 1DQLL 2I6UA 3TESA 2XX1A 5ALTA 5E0QA 5I8CB 3BLBA 1G5PA 4L3CB 3PV7A 3NCTA 4U1HA 1NONA 4KG7A 4U7SA 2O3SA 2EDOA 2NO0A 4CMHB 5KOJA 2HJLB 5J11B 3IJ8A 2IITA 3TLBA 4QG3A 1QUEA 1G66A 5E7JA 1AUQA 1O9VA 1FLNA 4CVUA 1CY2A 3KEOA 3I6IA 4P5MB 4E6PA 4ZUSA 4G8DA 3IKVA 5B7QA 1PG0A 3F6SA 4FHKA 4BE5A 2L0XA 5DD6A 4NQSB 1NATA 2BV3A 1KQFA 3P11H 1M5TA 1ADYA 4V3BA 4DQVA 1N3NA 5JXIA 3FPAA 3GTVA 1DDIA 1WZ1L 4HAOA 1IC7H 4HZLA 2I76A 2RTTA 3CUPA 3ZKQD 3N5CA 2WZBA 2AIRA 5IAEA 4P4RA 5TQJA 1H3VA 2HA3A 1ZR4A 1ZOSA 3T61A 4MGHA 4EHFA 1AMUA 1WZCA 3DLHA 2KSQA 2G4GA 5JWHA 3KHKA 2Z2IA 4HUJA 5JBNA 2YLHA 4N2AA 2QRVA 5EOTB 1JDUA 4JZJB 1NJ8A 2FPWA 5IKXA 4LA4A 4BXSV 3EZ8A 5C0JB 5DI9A 2P5WE 1L6ZA 2P5ED 2WKWA 1DC6A 4U7MA 3O6FA 5AI9A 1HDRA 4KUZL 3ZIMA 3VXMB 3R6DA 2PYFA 4P2QB 2AFRA 2J0UA 4YRTA 5I5MA 3QUZC 3QS3A 2Y6UA 3INUH 4L29A 3VGJA 1BD2D 5H35A 3HBGA 3P27A 4OCRH 4JZOA 1E3ZA 2Y24A 4L7QA 3W5SA 1M54A 1JMKC 3CY6A 4QPEA 4RIRA 2J67A 1RKUA 1KKUA 2YN2A 2W6IA 5AKJA 3LUAA 4L2LA 1I9GA 3A31A 4FQCL 4R3WA 1PL7A 2GKSA 4GRWF 621PA 1GPMA 5DX8A 5JOEA 3K94A 3OQNA 1OSPL 5I1EL 3SHVA 3W9DB 3J07A 3K32A 5L3QA 4CMIB 2FX9L 4DVBA 1GKIA 1WUHS 1RXVA 1ZA1A 2J8OA 2WTPA 5AW0B 4UU1A 3OC0A 2Z4SA 2VJXA 5IVDA 1Y80A 1RVDA 4PJFF 3PPXA 3UUEA 5DU2A 2BP8B 3F7PC 2F9FA 4IG9A 1GZ4A 1U92A 2JSFA 1HU8A 5T3XH 3GFQA 2DBVO 1ADWA 4K8OA 2GFQA 1OYVA 4RXMA 4OB7A 2O4UX 4ETQA 3FYUB 4NZMA 4F9LA 4OLUH 5C6TL 1JDDA 4L57A 3BZFB 4GSQA 1LV8A 4OI2A 1Z73A 3RVOA 1D2GA 4MQ7A 1X1DA 5EUOB 3ZR6A 1USIA 3RS5A 4WI9A 3PSAA 4GPEA 4FHZA 3U7JA 1TUGA 3IA7A 4B31A 3IMKA 2EBFX 2GCYA 4YGVB 3FOMB 2RGXA 4J4PD 3K70C 1LVGA 2DY2A 3K1YA 2R1YA 1USVA 2GAFA 1UMBB 3VXNB 2CJXA 1OB1A 1K4DA 1SOWA 2JLSA 3ZX5A 3BMQA 3CWGA 3NOIA 4GH7B 3CN0A 1GDDA 1QQAA 1PSKH 3M07A 4B71A 1HZKA 4JJFA 1FW8A 1F8TH 3DROB 2ES4A 5G2NA 4FFMA 3KR3L 1UWEL 2V7QD 3L6CA 2FFAA 2FO1A 2H9IA 2EF1A 3PQDA 4G8EB 3LO8A 3QI2A 3N5KA 4K9EL 4M3NA 3EDDA 4JLAA 4Z4FA 3QK0A 3C5HA 4K23L 3HMXA 1J1OH 1R5WA 3O3BB 1SHWA 3UK2A 3LH9A 2ADIA 2ACKA 3ZVKA 2B8WA 3SE4C 4XIJA 5C0CB 3DG9A 4JB2A 3D4YA 1JYNA 1AGXA 2AJDA 1MH1A 1BZEA 3QV1A 1FVHA 1MOEA 2WNIA 2FW1A 4K9SA 1V3LA 2VISA 2JQZA 4QHSA 3NM6B 5CT9A 4DS3A 4DB2A 4EY8A 3CCBA 4AZVA 1MCHA 1P4JA 4NXSA 1NCBH 5GZ3A 3KPVA 3WK8A 2QLJA 1BVYF 2Y1XA 5CEZH 1NBMD 1JPNA 3O9WB 3FU9A 1S8DB 1EP9A 2Y1DA 4U00A 4FOTA 2E4FA 4ELMB 4HS8H 1EH5A 2IAMC 2XR1A 5AG8A 4PFJA 2R9HD 5IK2D 5DC0A 2DKMA 1MHPL 4ZT5A 2JH9A 1JWAB 5B4MD 1SKUA 1L4YA 1NJ2A 3DKIA 1YMHA 3DKKA 5I0XA 3KLKA 5LUAA 4AO7A 3JQOB 2IS1A 1LJUA 4IO0A 2VYRE 5A3SA 2IVFA 1U2GC 3OEHD 1MA0A 4JDTL 4UC0A 3PVSA 4YHZL 3WIFB 1NIPA 1X6VA 2NO6A 3RHWF 1DQVA 2VN3A 4DLKA 5G4NA 4L9LA 1PJAA 3VXUE 5CJ2A 1BVNP 4V2BA 2RJMA 2GM4A 4PLPA 4N8CL 3ON5A 4GVXA 4U2YA 2CV1A 4H1VA 1LP9B 1WA5A 1GAJA 1KJVB 5H7XA 3T5TA 3QQ4A 3KE0A 4HGMA 2VDOB 4G5AA 3KL5A 3MNMA 4MW2A 3L6OO 2Q6KA 4YP9A 3NAMA 1RVFH 4NQQA 3QVGB 3UIEA 5AL8A 1BEZA 3LUHA 3OGCB 4CEJA 5IUSA 2IANE 4FFLA 1QLEH 2YD7A 1IE5A 1ZLUH 1KRHA 4GOND 2A0LC 1Q9LB 1JWMA 3NHRA 2DY1A 4UFNA 2O1AA 4IRUB 2X1QA 2A0FA 4OQZA 1Z0AA 1X9UA 1OXMA 1IAVA 5CTAA 2XGMA 2PH7A 3ZEAA 4LSRH 5TDOA 1S46A 3VD1A 4ELDA 1NMCC 3D1VA 3LIZH 1O9BA 5JO5B 1S8DA 5SWSE 2ZKWA 2OL4A 5JDSB 1QBBA 4EI5B 4Y0AA 5AVJA 1S2DA 4DP0X 1I4FA 3IE2A 3L9YA 1C8QA 2NSJA 4EW3A 3GXUB 1BLNB 3P4YA 5GP1A 3KKMA 2QVTA 1QUFA 2V8BA 2OMYA 1Y1LA 1XD2B 3IGFA 4MAAA 5J2UF 3CD4A 1WMFA 4HXGA 2NUTA 1B16A 1NVVQ 3ZHRA 1WBZA 4BFJA 2YLKA 4MRSA 3S8MA 3D18A 3ZE9A 3VDXA 1U58B 3HG7A 4AJJA 5GS1A 3OFVA 2FG5A 2OHHA 1G3UA 1NQOA 2K2WA 6FABL 4NO2B 1XB3A 5IT4A 4XASA 3QHAA 3D09A 4BMSA 2JMRA 4IL5A 3WGLA 1RHRA 3QT2A 3WMXA 4JYAB 2WLIB 2UWEF 5EG6C 3IGAA 2C99A 3QLTA 3RS9A 1NLDH 1JIIA 4X66B 1DBJL 4OHZA 4O2FA 5BNWA 2P43B 5FUMA 5HQ3B 2G5BA 2J44A 1NSFA 5I18H 1WQ3A 3FC8A 4AGOA 3TOSA 4FFVA 3TBFA 2ZM5A 4JL6A 3SE8H 3TJPA 4Q9CA 3GAZA 5LZ9A 4V38A 3FOMA 4BV1A 2C9RA 3MV11 4LSWA 4ICWA 1H0KA 2HOQA 1Y0BA 3W2TA 1FL6B 4UQ9A 3G0DA 1TJYA 4OAOA 2C0PA 3BKXA 4XN9A 5HWSA 2FPRA 4HX1B 4JLNA 2DQGL 4QDOA 1QI4A 4PWYA 4V0NA 3F8SA 3HMQA 2EDMA 1FQOA 2ZGVA 2PP7A 1YNTA 4TKUA 3MOBH 2J88H 2V7BA 3G0BA 4A27A 3MB5A 4M5YL 4R7NB 1QGUA 3AG1B 4US2R 4MAYB 3HI1A 1QVAA 1PZNA 4COKA 3HE6A 1HZLA 3HYSA 1JAXA 3PABB 2R8SH 2XWTA 5BVPH 4OHCA 2DIAA 5B3NA 3A3KA 3IBCA 1N8TA 1N59A 4DAGL 1Q9KA 3SHFA 3LQZB 4YBLC 2EABA 3IB6A 4NAHA 4PP2B 4XE5A 4A15A 3L3OC 3FSAA 1G7CA 4GEKA 2O0LA 5IT2L 2EVJA 3L49A 5DM70 5L2JB 5AJZA 5KU7A 2G9RA 3JBG7 4JLOA 1GKOA 5CUSL 3QU2A 5DBIA 1UQUA 2VAMA 5EBLB 5ALHA 2R6AA 2WZPA 4HAFA 3VU9B 2GJ6B 1U3FA 2BDTA 4PLZA 3QLVC 2QX7A 3LNHA 1Z39A 1NQ5A 1S9WB 1FLDA 3C75A 2Z2XA 4KQ6A 3FQ4A 1YMVA 5HCIA 3ARBA 4DP2X 1TYEB 4G41A 1AZSC 2WEKA 2RHBA 4FTVD 3GLHE 2A0WA 2APBA 4DY4A 4P7JA 2O72A 2ZDHA 2IMMA 4X5QA 3O6FB 2W4QA 1HURA 2R27A 3BXZA 5FQOA 5C0JA 3VNAA 4DNOA 3DE6X 4KR0A 2OA0A 4RA9A 3VFUB 1ZTXH 2TSBA 3ETSA 3S28A 5BRQA 2B69A 4XWTA 1ANUA 4F2HA 5AWNL 2HRBA 3D7RA 3C45A 1IX2A 4EG0A 3GBVA 4MNGA 4OD1L 4M9OA 1CUUA 4YBZA 1OT1A 3VTTA 5GZOA 3S35X 4KHXH 1BWPA 1OZHA 1UF9A 2ZRCA 3BDVA 4ZGGA 1H8ED 2Q3EA 1N8ZA 3LGAA 3C5VA 5I45A 4FQIH 1SKMA 2IFGA 2A4MA 3SVTA 3CH1B 4YJGB 3SLRA 8OHMA 2RBKA 4OQXA 4WW2F 4L9LC 1WSBA 4RENA 25C8L 2WWNA 2NZ2A 2HF8A 4AIOA 5EIWA 1N9PA 1AY1L 5IYZA 4BRSA 1Y6JA 4R1NA 3L54A 1LLCA 1X5XA 1IC4L 2Q9CA 1ZK1A 1N32B 4AW4A 3DTVD 4OD1H 4O0MA 4B3XA 3REFA 1RIVL 3WGUA 4JNCA 5ALIA 5M34A 3DX9A 4MOWA 2XNDA 1NFFA 5F7EL 5FGCE 1P9WA 1G7LB 3ULSB 4NJOA 5KC8A 1UJ5A 4WZAE 5BRZE 1M2HA 3L8HA 3NGBC 3IE4A 2E55A 4DC1A 3PNRB 3QKRA 1SMOA 3MRIA 2YS4A 4CC4C 1E8MA 2IAMA 2FGWL 3ULVC 3N40F 3CEHA 1NBEA 3NHMA 3EXJA 5DNYB 3RVXD 1NFDE 2QW1A 1PTKA 4X71A 3VXMD 4AV0A 1U8IB 1XH3B 4NX0A 1SM3L 3GLZA 1U3VA 3UT5B 2VP3A 2ZRQA 3ZVNA 5C5EA 3ZJYA 4G8GD 1MJ8L 1Z35A 3NBNA 4Q66C 1JIJA 3RREA 2G2RB 4PGCB 1SBBA 2WUCH 2O2XA 1XP5A 2OQ2A 3M4YA 4YHYB 1HL9A 1R0AL 1EEZA 4GIBA 5C0OE 1DR9A 1EGJL 1S7WB 3QFJE 4MDIB 1IHOA 2Q0HA 5HHNA 4MHOA 4EA7A 1KIUB 4I1PA 5CEFA 1VL8A 3MHTA 4JFOA 1KJ9A 1GLNA 5DM1A 2HU5A 4PG9A 1ISHA 4O4LA 4D9FA 2EGHA 3PQYD 4N8CH 4D4JA 3HSSA 4HHAB 5KSAA 4EJ1C 5LG1A 3JVIA 4C54A 3TBSA 4NZRL 4G0QA 1AACA 2JIRA 4NBSA 4X8MA 3T5DA 3ECUA 4WAFA 1Z08A 3KPLA 2NYRA 2WJWA 1B0RB 3CPJB 2CO3A 2CPCA 4KLZA 2WV9A 2NTFA 1LLUA 2JD0A 1EWYA 1IN8A 4LEXH 2VRNA 3OMZA 2FVYA 4A73A 4X50A 3UGEA 1V35A 3LKSB 5T64A 2VOJA 5AW5B 3EZLA 1W47A 3MNZA 3SDDD 4AKOA 5I8EB 1HBJA 5EWJB 4G7RB 3ADKA 2MSLA 3RARA 4E9XA 5D1QB 2ED7A 4WY2A 4Q5IA 3F3MA 5CZVL 4YZFE 1CLCA 1BAFH 4M7WA 1E4XL 4PY7A 4YSUA 3SY6A 2R29H 1AMOA 4F7WA 4IIXA 3NGBB 5EQDA 1UDWA 1ADQH 4JG0H 4P4SA 3IQGX 2HLFC 3PT9A 4YPFA 5T5QA 4C43A 3AB0C 2VDOL 3TPUB 3ESDA 4D81A 2BOLA 2EFJA 4I3HA 3OKMB 4OLYH 4RLSA 1H9CA 1DBKL 5LQKA 1GZVA 4UHDA 3S1SA 2Q3MA 2UV8A 3R06B 3PQEA 5D7JD 1ROCA 4I4TA 3RRZA 1GTL1 2CCLA 5CCGE 1OHQA 4ISVA 4MVJP 1YG9A 2I9TA 5ESVB 2A6KA 4M7PA 1QPKA 5GS2D 4XNMA 4V0MA 3JQ9C 3ND7A 3BPNB 1SD2A 2IW3A 3WTBA 2ZCHL 1K5HA 3EQ8A 3SMVA 2KH2B 1GG8A 2VLLB 2FX9H 3KLHC 1HQYE 4PFSA 3E9YA 3E3OA 1C1EL 4RK4A 4E9SA 1G0XA 2AFVA 5AVUB 2Y06L 4JDVA 2NOYA 3P9CA 5ALBH 5FEUA 2H32A 3MV8E 4JP3A 5HVFB 1R9MA 3K4PA 2CLVA 3RPBA 4S24A 3UCEA 3Q3GA 3OUTA 2PTTA 5HJBA 3ADBA 3O6VA 1JJAA 1VBNA 1A0QH 4D3CH 4XOAA 5ICYA 4J2QA 3HN6A 3QOYA 3CNKA 5C97A 3LQ1A 3IFNL 4XVRA 4POZC 2HKIA 1HYEA 4U63A 4X1KB 4F45A 1O6TA 2D5AA 3OE4A 5F9JB 2FSUA 3P9YA 2HI0A 1I4OA 1OFHA 3V8PA 1RBZA 3DWFA 1HHIB 4M2LA 3BA6A 4GMDA 5JSQA 5KJ1A 3I75B 4F2DA 5CVDA 4W5OA 5LLDA 2YWRA 4JFSA 2D2VA 1DBBL 3WS7A 2HB0A 5IJKA 4GP8B 3T1HB 3CG8A 3IQZA 3JUYA 2FPGA 5ENWA 4CILA 3IFSA 4NEGA 2AMUA 3O3OB 4MTMA 3C41J 3Q6FA 3AADB 2BFPA 4J3OC 5J5AA 1ZD3A 2BI7A 4YHZH 3DL2A 3CLVA 1XHFA 3O6LL 1IM8A 4OJTA 4NDNE 5B1KA 3QY0A 2DHCA 2IBGA 1T20B 4JRXA 3RWFB 4HH4A 5TE4L 5LXGL 1OFGA 4U5QA 3JALB 3GNQA 4F80A 4G86A 3HNVH 2V1XA 4QXVA 5I47A 1EFLA 2D62A 2R2HA 2X44D 2IYAA 1JEQB 2QDWA 2YWYA 1ZX1A 1B3JA 4OJKA 3OC6A 4GC5A 1VKXA 1IYZA 3O8DA 1NDMA 2ECPA 4UAOB 5D5MA 1JTPA 1E2FA 3KKQA 2R23A 5DJCB 1LSSA 5KTSA 2QROA 3G2NA 4ZOLF 2AEOA 2VZTA 1AS6A 1NIDA 2J5BA 4ROTA 4R05A 3CN2A 1YLBB 4MA7L 5IZCC 5CA1F 1XZNA 4QLBA 2P0EA 3N44B 1PJ9A 1UWFA 2C3MA 4K5OA 5AJUA 5DRTA 5TARA 4WNJA 1YDEA 3N76A 1UWEH 1CDZA 4HJGA 5SWQB 2OV4A 2FV8A 3DBSA 4LGRB 1ZK2A 2CE2X 4EY6A 4EQ3A 3B2MA 4ZFZA 1ICTA 2G9ZA 2OXRA 4KOAA 4X92A 2MOVA 1PQUA 2J1KA 4JHUA 4ZRGA 2C3GA 2DSTA 3LKVA 1DAMA 1Y1PA 3B2VH 3QBTB 3STVA 4L50A 4XVOA 1T5SA 3HYNA 4B4VA 3FT4B 2I5PO 3I42A 4MR8A 2QA5A 2JBAB 3O0LA 1FZJB 1V3VA 4YJKA 3Q8WA 1M83A 1R3KB 1SURA 2IDUA 1OSYA 2VS1A 2V5SA 3WEAA 3UK7A 5BV2P 4P8QA 5TJHA 3OQPA 2XZQH 4M1GL 1S7UB 3AB7A 1KEML 1NAIA 3U46A 1E20A 1Y9DA 3IAM6 3DEIA 3UAWA 4DA8A 1NCWH 4N76A 1RAIA 2WJGA 2VLMD 1TUEA 4QRUA 3RWHB 2ID9A 3QJHB 2QXYA 1SEPA 1TO1E 1HSBA 5FBQB 3B8EA 5K05A 2IZZA 4JREC 5DJDA 2C59A 2PWDA 2ATCA 2BGNA 5I6OA 1MCBA 5EN2A 3HRIA 4J3OF 1T8YA 3W2GA 2Z98A 4RF3A 4HDRA 3Q5OA 5G0UA 1Z9LA 4ABVA 3B52X 3H6GA 4PO3X 1UPAA 4N8PA 5D2LE 1XF5A 4BVLA 2BC4A 4J3VA 4CW7A 5K5EA 3DVIA 2WKSA 2BHRA 4XHJC 4A2FA 4X7BA 4OQLA 5HJ5A 4PJDF 4MRMB 5A7GA 1RZRD 4G0WA