4UM9B

Crystal structure of alpha v beta 6 with peptide
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
470
structure length
448
Chain Sequence
b'GCALGGTCEDCLLIGPQCAWCRCDTPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVCPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQVNSSKCHNGNGSFQCGVCACHPGPRCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-V
publication title Structural Determinants of Integrin Beta-Subunit Specificity for Latent Tgf-Beta
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 110
structure length 448
sequence length 470
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4um9B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4um9B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4um9B03
1XDDA 1XDGA 1M2OA 5KYXA 2NUTB 1L5GA 3K71A 2VDLB 1ATZA 3HXOA 3T3PB 2I6SA 2M32A 4PN7A 3IJEB 3ZE2B 1UEXC 1M1UA 3OKYB 3K72B 3EG9A 2ODPA 3V4PB 1QC5A 3ZDYB 5KYUA 1IDN1 3ZDXB 2QTVA 2I91A 5E6RA 4CNBA 4WK4B 1CK4A 1SQ0A 4IGIA 3EGDB 1M1XA 3K71B 1T6BY 1YVPA 1DGQA 1MHPA 3GXBA 3FCUB 2IUEA 4G1EB 1SHUX 4MMXB 4HQLA 1BHQ1 1V7PC 4HQNA 3K6SB 4Z7NB 1RD4A 4JDUA 3AL8A 5KYYB 4HQFA 3EOBI 5KYWA 4F1KA 3PPYA 4NEHB 1MQ9A 3FCSA 1JLMA 2ADFA 1NA5A 1JV2B 3HXQA 4Z7QB 4MMYA 1N3YA 5E6UA 3BN3A 3F78A 4JX0A 5E6SB 4WK0B 2VDRB 3OL2A 1JEYA 1JEQB 3EFOA 4O02B 1IJBA 1MJNA 4C2BA 1M2VB 1XUOA 5HGJA 2VDOB 4NENA 4Z7OB 1BHO1 3HI6A 3VI4B 2XWJI 4FWWA 4IHKA 4HQOA 4WFQA 3ZQKA 4DMUB 5KYXB 1U8CA 1PD1A 1L5GB 2I6QA 4MMZA 4C29A 4A0QA 5KYNA 2NUPA 4UM9D 1LFAA 4GZ8A 3F74A 5E6SA 3T3MB 3NVQA 3PPXA 1PT6A 1SHTX 3EG9B 4HQKA 4WK2B 3VI3B 3ZE1B 1QC5B 4G1MA 1MQAA 2VDMB 3NIFB 2ODQA 3OKWA 1AUQA 5KYUB 3AFCA 3TVYA 1M10A 2ICAA 2X5NA 2NUTA 5E6RB 4O3UB 1FE8A 3BQNB 3N2NA 1IDOA 1M1XB 4K3JB 4C2AA 3IJEA 3V4VB 2VDKB 1ZOPA 3EH2A 3ZE0B 1PD0A 3PPWA 3QA3E 3AL9A 3AL8B 1TYEB 1QCYA 5KYWB 3EGXA 4F1JA 1OAKA 5LN1A 4BJ3A 2VDQB 1MQ8B 5ES4B 3FCSB 3EH1A 2O7NA 4O3TB 2WINI 4MMYB 5E6UB 3M6FA 4M76B 3RAGA 1N9ZA 1ZONA 5HDBB 1ZOOA 3IBSA 5HJ2A 3EGDA 3TXAA 3OL2B 3Q3GE 1JEYB 4XW2A 1YUKA 1MF7A 3E2MA 4G1EA 1RTKA 3BQMB 1YVRA 4MMXA 1U0OC 3EFOB 3K6SA 3PPVA 5KYYA 4NENB 3ZDZB 2B2XA 2VDPB 3NIGB 1SSLA 2XGGA 3EOAI 1DZIA 3EGXB 1SHYB 1U8CB 2UZYB 1AO3A 2XWBF 4UM8B 1JV2A 4MMZB 2VC2B 1CQPA 4FX5A 4IXDA 4CN9A 2VDNB 1RS0A 2NUPB 3TCXB 4CN8A 5BV8A 4WJKB 1PCXA 1AOXA 2P26A 4UM9B 1IJKA 2WW8A 3NIDB 3K72A 2P28A 1OLZA 1RRKA 3TW0A 1FNSA 1JEQA 1Q0PA 4O02A 2NVOA 4G1MB 1T0PA 1M2VA 1U0NA
chains in the Genus database with same CATH superfamily
3BD6A 4TSAL 2NY1B 3EZNA 3UC9A 3EG5A 1M56B 3OKYB 3U0PA 5G4OA 2H0EA 3M5PA 4ZYKB 3ITEA 1IM5A 5C3UA 1TVKA 5CRIA 5E7FA 1JDCA 5HDLA 4PUBL 4LJKA 5KO2A 2BZ1A 2UZ0A 5AVSA 3P4XA 4C0SA 1ZJYA 4JKPL 2BEKA 2J8UB 3ZIDA 4F12A 5E2WH 2H2WA 3D3EA 2GSGA 3H5OA 1BZ7B 1A6WL 3ZQ9A 1QGZA 2CYAA 2PO6B 5DCWA 4DT1A 1SQ5A 5IKCB 3R5XA 4EI5D 2R85A 1KLGA 4ZXBB 2G67A 3UXYA 3OPZL 4C5BA 4O4HA 4CVXB 1CK0H 2IDUA 5HPMA 2EJTA 5KOHB 3HSYA 1U1IA 3FUEA 2FN4A 4DA4A 1TF7A 4X5RA 1FJGB 4XAWH 3ZNQA 4PI2A 4GZ6A 1OP5H 5IKEA 4WHTA 1YQVH 5IC5A 4AQOA 3EEOA 3N8GA 5T5QA 3RFZC 4Y9UA 1F42A 1N4XH 3Q6IA 3SQBB 5LOVF 1TSRA 2EYSA 3U7QB 2BM1A 1USUA 4QRIA 2C4FU 2XU9A 1VCNA 3HU3A 5IZCC 1T66D 4BE4A 3OL2B 3CSYB 3TSWA 4M62H 3X1FA 4OXYA 2VSXA 2YC1A 4HAFA 2O93L 4OF8A 3H3PL 4B60A 2VT3A 3Q9UA 1RBZA 3SU8A 3PNQA 2F68X 4P3PA 3DYIA 4RH3A 3Q8MA 4PGHA 2PT9A 3QZWA 3MRRB 3QUGA 2BMJA 3RB8A 2IV2X 2OLDA 4COKA 1SEQL 1WJGA 4DCUA 2XZDA 1TO2E 5J12C 3F58L 1SJHB 4BLQA 2R79A 5T3ZE 1JG2A 1L7IL 3MTXA 2UWEA 3W2EA 4QOIA 2CD0A 1NVVR 3GGJA 1U3ZA 4JJHA 2Z30A 2X15A 1IQDB 1ES0B 4RH4A 4JR2A 4RFEA 4OBBA 3OAYH 4Z4EA 3MCUA 1A7PL 5BV0A 1F17A 1LD9B 5FYLE 3N2KB 1P33A 4DTGH 4MV5A 1SOSA 4KHTL 2AJXH 4BASA 2XQBL 5DO9A 1JPGB 1MG3C 3N0PB 2J6HA 1TXGA 2CHFA 4WCFC 4RGOH 1HC7A 5REQB 2VNKA 4IQFA 3ACCA 5KHLB 2QNIA 1Z7GA 2DWDA 4LF3A 1QCCA 1FNGB 2VXOA 4RF3A 1KKUA 4XUDA 4U1SA 3UTSB 1D5ZB 2HPOA 3FU7A 1XU9A 3U4BL 1QZXA 2A9VA 4OX9B 2XN1A 1T5IA 2WTEA 2BELA 4RU1A 1TDJA 4N5NA 4ZO4A 5JZ9A 2J5BA 3WGYA 1QIKA 4L6AA 1QWUA 2XUDA 4KXQA 3SY6A 4Z0NA 1H23A 1DBKH 4HFUL 3U49A 3WL7A 5HP5A 3DDHA 1EBUA 3CRVA 5IVZB 3BJRA 2IUUA 3PI6A 3D30A 1SY6A 3MV8A 1KI2A 1ORIA 3U4MA 3SGEH 5CFOA 1DVFA 3OJCA 3H8JA 4PXSA 2O8FA 3MACL 3L8FA 4MAYC 1LQ2A 1S5IL 4JRYA 1HXMA 1X86B 5E9DA 4YPGA 3CINA 3DRQA 4LHUG 2FN7A 5HMMA 1R74A 1ZPUA 3WJ7A 5PGMA 4ZK6A 4Z7VE 4QG3A 1JXGA 4R1UA 5CKGA 1FMFA 5ES3A 1A7UA 1M76A 4ZODA 4LMAA 4H2AA 2ZOSA 3AU1B 2YWGA 2LFEA 3FE2A 2JJMA 3C08L 4PV7A 4DEWA 3NAGA 5SY4A 4KVNH 1SHUX 4U4BA 3H1PA 2LVCA 3CUVA 3IQHX 1VIVA 5FL7D 2DQHH 4GG6B 2NY7L 2IH8A 1PZXA 1LNUA 3IDMB 2A35A 4EYOA 2GAFA 2YX1A 3GCXA 4JM0A 3ONDA 5I8CB 1ZZEA 1NFDB 2DOCA 5BSFA 1J0HA 1E4VA 1LBQA 2EBHX 5MP6H 1EVKA 3NSXA 1ZRMA 4JO1L 1SBSL 1VP9A 3T5AA 4OB7A 2NZUG 2PX6A 4IJVA 1GYWA 4IHOB 2ZXGA 4ZDJA 4Z3GA 3TG8A 2IXQA 5FA3B 3QQXA 1K7XB 3GBSA 4PX9A 3MGGA 1AURA 1J0YA 4RSVA 3DBIA 5JSZA 3HNPA 4GM4A 4MNGE 3GUTB 3AOEA 2X7HA 5HNKA 4OHPA 3HKEB 4ZDHA 1S7RB 5DRWB 1FLDA 3BJZA 1N0LB 4N8CL 3LDBC 4LWPA 4GPD1 4TKWA 2C9OA 1G7RA 5TB5A 4MLPA 4ZUUB 5DYOA 3GVXA 1RIFA 1I4DD 1L4KA 4OCXL 3QXCA 3MUUA 1CZLA 1R0LA 2ATXA 4IGAA 1S7UA 4CMGA 2WQZA 1UP6A 3EYVA 2PSJA 5AJTA 3NR2A 2ZRKA 2OUKA 4G5ZL 1TI7A 2W43A 5TMEA 4O4JA 1YRLA 3O47A 4GYJA 1MCOH 4ZK2A 4NDNE 2NU7A 2X0NA 4YIQA 3PFKA 1CRPA 2CH8A 1KTVA 5K2MA 1TA4A 1XLWA 5JHDB 1MB9A 3IGAA 2IDTA 2GXQA 3H85A 1UBOS 1E2KA 1ODCA 4KXFB 2O72A 5DRNB 4OOEA 4UXJA 2XG5B 1RFLA 2P1DA 5C71A 5J6GA 2QPOA 2IWKA 1KBGL 1SVLA 5SV4A 4FFRA 2R29H 3DCIA 3ZDBA 4EJFA 1DR9A 1UXSB 4B6FA 1A9XA 3JR3A 3HBQA 1PQZB 3BXXA 1KENH 4CKEB 3GDGA 2I9LA 2ZJ1A 3MINB 4ON9A 3D3VA 3WBKA 1YMVA 4YDIH 1WE2A 2ZUWA 4AZVA 3EBIA 5EC1A 1A7QL 4LSGA 5EZPA 2X6QA 3KS9A 2ZJFA 2OP1A 4QGFA 5DGDA 4C4ZA 3FFXA 1NVGA 2IXGA 2J12B 3DHVA 3P2IA 2KQNA 4KG7A 3TNJA 2K0RA 2JIZA 4XMXA 3MXVL 4ILKA 5AYTA 4JG9A 1L9KA 2BR4A 1REQB 4LDZA 2FU5C 2WG2A 3KPSD 1Y1RA 1GUAA 4DWVA 1MEJA 3LKDA 1PSDA 4M8NE 3P9PA 3AT0A 2PCPB 1HEZB 5A16B 1U5BA 4HFWB 1XD8A 1V7NH 5ESXA 1II9A 2IP1A 4M22A 2G5BB 2QR2A 2J8UE 3ZXSA 4JRXD 3INUH 5ENWA 3A36A 4IFTA 2JFGA 3V6OA 1DB3A 2EOAA 4N41A 4YSAA 2A74B 2OO5A 4A27A 2Y2WA 3MT9A 3ED5A 5JI3E 2Z4TA 1DO6A 4WV3A 5DPMA 1XRNA 3ARSA 1U2PA 1WFIA 1K5PA 4HAOA 2W2LA 3HR5A 4RDQF 4EYQA 4ES6A 2ROQA 5DRYA 4A0HA 2AI0L 2VM9A 1CPUA 4JKIA 3MTIA 4WW2B 3WY3A 2YDXA 2B92A 3L3IA 1CXEA 3JXAA 3GD1C 3JASA 4FLFA 1A65A 4XB8A 4M5ZH 2ACKA 4GAJH 1TQBB 4MRPA 1HOTA 2ZKHL 1G9XA 4R0VA 4IGBC 1D6VL 4ENVA 3QIVA 5DMJB 5KOIA 5BZWB 1VI6A 1P5UB 3QWFA 1JT2A 4ND7A 2IHYA 2CBOA 5DC2A 1OF2B 5KZCB 1SCJA 4M53A 1NSFA 2BKEA 3L8QA 4LAQL 5HVWA 3B3AA 2X5NA 2DN7A 5L6YH 3I02A 5FYKH 5AVQA 3JBG7 3WNCA 3QEJA 4G0QA 3ABIA 5CIPA 2C7UA 5E4EC 5DHVA 1QYGL 1UXWB 1LSJA 2AI3A 4AJNA 2KB0A 5K7SA 2WLHA 3GSVB 2J4FA 2W98A 2GN4A 1CS6A 1RC0A 3PLRA 3RIEA 3MLZH 2ZOKA 3ABMB 3RVDA 2VYQA 3H2ZA 2YQBA 5DMKB 2VJAA 1MJUL 4N2CA 1X7QA 4P2YA 1VA4A 4OMCA 3W77A 5E2TL 1F11B 5EJIA 3L7EB 2I8LA 2WU8A 3O1IC 2A5DA 3ZBQA 4FBGA 1QTPA 4L29A 1JYSA 2ZI3A 5EN2A 1XD1A 4CQMD 1WEJH 3QYCA 1A22B 3DTDA 3FPCA 4OLJA 4XN1A 1INEL 3QVSA 1IRIA 1QRDA 1ESCA 2PP8A 3WYGA 1SQ0A 2CK3D 1ADGA 4IMJB 4JJ4A 3UTSE 5BQPA 1QKKA 3E80A 1VL8A 3ARGA 4YFLI 4NZUH 2E47A 3UAJC 3UBXG 3MLAA 1GAQA 2J59A 1G3MA 2JGAA 5CFNA 2V17L 1QMGA 3V0FA 1YEJL 2Q49A 5DWVA 4AJIA 1E79D 5F1NB 4IKPA 1E7VA 3O26A 3A2LA 1PJSA 2IOYA 4PGZA 4KAQH 2H1VA 1JYEA 2LDBA 1FGVH 3QVAA 4TVPD 1E2NA 2F90A 1SUDA 5A0TA 4NS4A 1GGYA 1AKJD 4M37A 4X6BA 1MCKA 1UDCA 1X5KA 4KK4A 1OX5A 3A9RA 4U4IA 3CFTA 5E5UB 3RNQB 1HLFA 1IN1A 2RB5A 5I7RA 4RE5A 1XCJA 2VLRB 1P60A 1T2VA 2ZKLA 1MAMH 2I60L 4UT6A 2WKGA 4RISL 2KBGA 4Q4CA 4EOGA 1SVCP 2B5VA 1LLAA 3M3PA 5C7OO 4GG6E 2Q1UA 4FABL 1OT5A 3DOUA 3T0XA 3MRMA 3RWOA 3VDXA 3QEHB 1ORDA 5ITZA 5BVHB 4QRRB 3WDLA 2V03A 12E8H 1R3LA 4YALA 2VE6A 1E6JH 2OMTB 1E2PA 4Z7NE 3BSHA 3RFZB 5JR3A 2PLFA 4E70A 1CE6A 1XWWA 1QGED 4HGZA 3KG2A 4BUQA 4XASA 2Y1GA 3JAKA 2Q27A 3GRCA 3TL5A 3ZGXA 4ERSL 4PCKA 4Q4AA 5KTRA 3WLQA 3JZYA 1AXTL 4ZZ3A 4PRNA 4PCAA 3SDDD 4OQQA 5T4EA 4FGSA 4QUOA 4TYYA 3PWPA 1L7EA 1EB8A 5IF3A 3UH0A 1GL6A 1BQHB 2FNAA 3B8YA 2IP4A 3A67H 4Z7VF 4OD2B 2JKTM 3EJRA 2FZVA 1GZ7A 3PQ8A 3N0VA 4FT4A 3ZQJA 4B7LA 2W5PA 1U8JB 2CCKA 4YRLA 4XVSL 5J12B 1UBCA 1G60A 5H2BA 5C2BL 5AW5A 1EFXA 2O6CA 4P54A 1KJ9A 3ZO0A 5JHDE 3FF1A 1XGQA 4GKNB 5DT9A 1OT3A 2WYVA 1Q1PA 2GIYA 1KCVL 1CLYH 1UH3A 5DMYA 1C30B 3QBVA 4Y4FC 3X1MA 2LR4A 2YIDA 4A7SA 4IKKA 3R9XA 1XL6A 1SBTA 5D9SA 1TECE 4GE3A 4APXB 2XUAA 3EAKA 1SPBS 5FXMA 4OJDH 2P9EA 4NPAA 1KG0B 3CU1A 3O93A 3RDJA 3GT3A 3ULVC 5T1LA 4TMXA 3NHBA 2X28A 1DOZA 4WCFB 4D0CA 4N9GB 4N90E 5C5CA 3DO5A 4WNQA 3K6FA 1UCTA 2X4UA 2WJGA 2WD8A 3QWQB 2UX7A 3QKIA 4KGZA 5IB3A 2FW9A 2I2BA 2Z8XA 1U8TA 5D2NC 2QMEA 3KJIA 4NQDD 4K2UH 3ZK8A 2H0AA 2GCIA 1VJGA 1NFQA 5PCYA 2QLFA 1GKKA 2EFGA 1LV7A 3AL8A 2R9VA 1BJMA 1UB6A 1DUVG 1IN4A 3VFUB 4NZDA 3S8YA 2ARWA 4V0RA 1NBVH 2QQFA 1Z6PA 3PJDA 5IBUB 1X7YB 4KBFA 1ZNXA 5F5XA 5FM5M 3D85B 3LK7A 4NO3B 4UU9B 1NRIA 4MO9A 3TI7A 4R4ND 4OL9A 4XOIA 4MICA 1MCWW 1KCLA 2ERYA 5CM9C 4KJWD 1GW6A 4F91B 2EEBA 4MAYB 1P75A 1V55B 4HNQA 2B1OA 2W9DH 2WZ5A 3D8NA 1WNTA 4O5AA 1CL7H 2ZUQC 2QPFA 1Y3AA 5GV8A 3ZRCC 4U7WA 1KAEA 1QM5A 1PX4A 5HIIA 2C34A 4I8XA 2VDLH 5HI3D 2QTMA 2DYSB 3AVTA 1PD0A 2ZG1A 1A50B 2FDBP 4U6HA 2VDJA 1HCZA 5FWDA 5JCXA 5T1MA 4AYEC 2HNAA 1MIOB 1JPFB 3AQIA 3GEWB 2O2JA 1KYVA 4RBPH 1BJ8A 2Z2YA 1D7DA 3IQGX 3LA6A 1LI4A 5E6ZA 4LBWA 3RS4A 1MA0A 3HHSA 4MQLA 1F0PA 2Z35B 3WTSA 1NUPA 1GG8A 4U6SA 3BKMH 4ARAA 5EOTB 1EFPA 1R4ZA 4BFCA 4QGSA 1M7IB 1G63A 1E5TA 3L1JA 3ZGYA 1IHUA 3DX1A 3TDNA 5HIAA 2A6PA 4UUQA 2PTGA 1ORQA 2WHPA 3L7JA 3LDBB 3LYAA 4KQMA 4J0CA 1X1QA 2OCXA 4ZCTA 5IU6A 5HGAB 3BL6A 3GJ6A 2W2PA 3H0TB 3OTIA 2CSXA 2J8UF 5SWZD 5K8VA 2FR4B 1SUJA 3D33A 4K9KA 5GZOA 3KS0H 1MKYA 4NQZA 3K96A 3PQ5A 3ZY7A 2PR4L 2VN4A 4G8GD 2J9YB 3EY9A 4WXMA 1BHO1 2BI8A 3VSTA 3ZGZA 3EIFA 1RP1A 2PUFA 3S48A 4ZCSA 1SHMA 1ZY2A 1XVAA 1YQ2A 4RGYA 3V0IA 2P1YA 5EOQL 1TMGE 4ZX4A 4TOYL 3BE1H 4KBPA 4MGYR 1Z5UA 2RH8A 4LLVA 2VK2A 3DTYA 4UBKA 3QZLA 5EXPA 4PX3A 3GQBB 3T99A 1KEGH 3ARBA 1LF0A 3WIDA 1QNZL 3X2QB 5C81A 1BXGB 3BWAA 3SZLA 3BMWA 4BFYA 1A72A 1M2FA 4XWOA 1JF5A 5I6XC 4GO9A 3O4IA 2FJGA 3X0DA 1MLDA 1DJXA 2O2DA 1IEVA 1OXYA 2VBFA 3BSZL 2FT7A 1HSAB 2H6PA 5T3YA 3VCLA 3MS2A 4G7YH 5E1OA 1A1SA 5A3SA 3N2JA 2FBOJ 1USGA 3V6ZB 3K70D 1UZGA 2CMHA 4W93A 3BRGC 4ENUA 1F2DA 1IQWH 4OHXA 3EGDB 4ERNA 1H8HD 4F20A 2VAVA 4UV4H 1Z0NA 2R7NA 4EA9A 1J70A 3QZWG 2YZ8A 1EEUA 5F0JB 1MCSA 4B9EA 2BYTA 3H9HB 2IE0A 3DV2A 3GJEA 4Q6BA 4NKDA 3DE1X 2VLRE 3D2TA 2VEOA 5D2CA 4NM8H 1YR6A 3TAUA 2Q20A 3BH4A 4XBPA 4UVGA 1ZHBA 5TJHA 2GEDA 1NCBL 1A7KA 3OZUA 4QF1A 3LMKA 2G40A 1QGUA 4PE5B 1CW2B 1WCYA 1AQDA 4FR2A 3KJQA 4TL6A 1IHPA 4DUXA 3JD2A 1BBJB 2GITA 4NCC2 3K80A 3GP8A 3MUFA 1IC0A 1T5KA 4QRRE 4TM9A 1Z7BA 3HCBA 2JH8A 3QYNA 1I4EB 1YZLA 5C07B 1AQIA 3IB3A 3HFML 2W65A 1V7MH 2Q7OE 4KUCF 4HUQB 1TJGL 1U3GA 1OZUA 4G70B 5K9QI 3CTTA 1LC3A 2AQKA 3DULA 1XKQA 2ZPAA 1ONPA 4IGBB 3EDCA 3R0QA 1LK5A 1WTLA 2D31B 5I2IA 4R26H 1FRZA 2AEWA 2HQ1A 5EEXA 1T7VA 1Q14A 1KBZA 1G4UR 4REQA 3VR6H 1BVOA 2W2KB 1ZS2A 4G36A 2OCDA 3WXWH 5B3NA 1M1SA 1XGYL 2PKEA 2PXHA 2A9DA 1U7WA 4HWTA 5E4EB 1G5AA 2W71A 3O9WD 3VD9A 1AIPA 3C6YA 1T9CA 2E0PA 1OLOA 1E1RA 2I26N 1B15A 3FA2A 4GG6F 1NA5A 1QA9B 3FSOA 5E8OB 1E1KA 3HYNA 4EPVA 4A6YH 3NAMA 4XWWA 2GVNA 3LXAA 2FUCA 3LLCA 5GINE 3AADB 1ZT4A 5FHAH 2XWJI 1GXSB 4E30A 3FKSA 1IC6A 2A9JA 4MZIA 2WWFA 3L1HA 1Y7VA 1KK3A 1RAEA 2OV1A 4Z7NF 2C7QA 2IYSA 2JKIS 2J3EA 3QZPA 3QELB 3T12A 1JJUA 3IDAA 3OPVA 2PKQP 2I80A 4AKIA 1PPIA 2H4ZA 3V0DA 2IXFA 4BO7A 2IGFL 4Z7IA 4TZ6A 2AJCA 1TEYA 3UERA 5CNJA 2H1FA 2FWUA 1UD8A 4IHJB 2Y0EA 4YZWA 4HHAB 3OP1A 4J2OA 5CK5A 2GBPA 5KS2A 1FFRA 4Z1OA 2E59A 3WENA 2QVGA 4CKCB 3ARPA 1R3DA 5BOJA 1RR6A 6TAAA 3JQGA 3I83A 4AY0A 4N26A 4UYPA 1HYEA 1XVSA 5A5EA 5C8VA 3QEMB 5IK3B 2ATIA 1MG2C 3VRLE 3PYCA 1KZGB 1TEVA 3LDAA 1P7VA 4TQ9A 3P3SA 1NAMB 5GGTL 3V32A 4DCMA 4P2BA 6CHYA 4PLHA 4FQHA 1KBKA 3NBZC 1SUEA 3EDDA 2X5PA 4RX4D 3MIZA 4OLBA 1C4XA 2GN1A 3GZNA 2K5UA 4QHTA 2C04A 2OCBA 3W9UA 4M98A 3F6BX 4F8QA 5IJBC 2X4NA 2ZT5A 2Z43A 4LCUA 3JWOL 4QXPA 3MGCA 3NFPA 4Y3UA 3KBHE 4IY1A 4HB2A 5EUOB 1MD9A 2FRXA 1QLWA 1K7YA 2R25B 4O1MA 1OMOA 3KL2A 2O8BB 1AVTA 1NR5A 3RWHA 2GQHA 2P2ZA 3BP5A 4YSRA 4CW1A 2R84A 4P57B 3GGGA 2P4AB 5JH7A 3WQBA 2O5ZH 3U3KA 4LRNH 4FL4B 4P3XA 4MJIA 3VR4A 5EFOA 4X7TA 5MERB 2QM7A 3T5MA 2Q5IA 1I2CA 3DYVA 2CUKA 1AQLA 3CUWA 1MKFA 1JRHH 1Z9LA 3ESCA 2ZIUB 4MQFB 4XCFH 1ZGLB 4OM1H 1BGXT 5IT2L 3RHWF 4X7RA 3WYFA 4LYAA 3EODA 1GPDG 1OH8A 1L0BA 2C96A 1NEZA 1EJOH 1CVRA 5LGHL 3FOWA 1Q0ZA 5J13C 3DE3X 4O9HH 1AUPA 4WAFA 2VW6A 2G5CA 3WKQA 2FFHA 3LTEA 1J0CA 3WDHA 2CUNA 4YMLA 1US8A 5C08D 3SQOL 3VAYA 2DQJH 3G9XA 4LSRH 3X14A 4DYHA 1OCRB 3AREC 3L9RB 1YUMA 1J56A 1QUNA 2BDNH 4Q58C 5HJ3A 5KU1A 4OLVL 4NHCH 2ZSIA 1JSYA 3KHKA 3E9NA 1BAWA 2B94A 1Z0IA 3PICA 4JZNB 4AY2A 4NRXB 2GHRA 3MJFA 1FTWA 1WBZB 4IBVA 1MCNA 3L9BA 1AGFA 1N3YA 2B4RO 3E15A 4B75A 3V9AA 3MQIA 4RLSA 1AKPA 4ZVUA 2YUVA 4BCYA 1TZCA 3CH5A 3QXUA 3HH8A 4B3DA 1CN4A 4I18C 2CUZA 1S3KL 5DJ2B 4QHMB 5D7KE 4MI6A 4LPXA 2GG1A 1VGEH 4ZMQA 1QNLA 1D6EA 5THKA 2ED6A 2PIDA 2I76A 4TMKA 5B7NA 2GKIA 4L72A 5D2NB 4UZSA 1N7MH 2DW5A 4C4AA 1N64L 4PRHB 5BCAA 3IGFA 2QV4A 4S1SL 3VFNA 1GIGH 2C95A 5LG6A 5AVTB 3ES6B 2JRCA 2ZJ6A 1DIAA 2H9YA 3VB9A 2JD0A 4FKKA 1QB8A 3A9UA 5J6HB 2CD7A 2OFOA 1PQWA 2YJTD 4K5MA 3KYBA 4CI0B 4DR6B 5KDLA 1HQKA 2TRYA 3MA9L 4NQCD 4UM9B 1VB9A 3UMJA 4E2XA 4X85A 1NW9B 2Q6LA 1VFBA 1EXUB 1YVDA 2POQX 5HUJA 1DQIA 3W78A 3O94A 2ZUQB 2QLVB 5B1KA 2OZLB 1IILE 2VL5B 4PIMA 2C7VA 3FTPA 1J8DA 1X42A 1WYJA 1I4LD 3VMMA 2QTVA 5C0AE 3D59A 3FTNA 3WSQL 1BC5A 3LZ6A 3U19A 4N2KA 2WU4A 2WZCA 4H08A 1LD3A 1OB1B 4I2XB 3BBLA 4CM7A 3HDVA 5KYWA 3BEDA 3X1JA 4IKNA 3WFHB 4KKXB 2X2IA 1W9MA 3QAQA 3ASZA 4XC1L 2IE8A 3LHAA 3BVPA 3WQQA 1O2DA 1WZKA 2FW1A 1E3MA 2Y92A 1JNJA 4ZOEA 3A9TA 3AW9A 4U7JA 3S35L 1OOEA 4AGQA 1HU8A 3UYRH 2RALA 4UDUA 4OYRA 3N2IA 3ZD7A 1PI3A 5KVDL 1JNHB 4LNUB 4DSZA 3EMBA 1X74A 4OHWA 5HFJA 4EVRA 4XHJC 3D2UD 2BBOA 4ONGH 2FJPA 1JPVA 1CLOH 3OG9A 1EE1A 4HIXH 4JFXB 4DK3A 1OTYA 3RWDB 2ZPKL 3F2VA 3QM1A 43CAA 1THZA 2XTJA 1EXMA 1EO8L 3W06A 4B82A 4AWBA 4UOEA 4K8RC 3QOXA 1YPZB 4ZFOB 1YRQA 1SHKA 1P84K 1JFQL 2QGCA 5H59A 2FWAA 4N9QA 3SY8A 3W6PA 4A0FA 2I2AA 2ENQA 2HB6A 3FNEA 4HCRA 4XP6H 1XZQA 2WNSA 1AOXA 1M7BA 2VCYA 2XUZA 2X2EA 1PS9A 5KVGH 4QDUA 1M5UA 1V3LA 3O83A 3VW3L 3L01A 5ALCH 5BNFA 2JCXA 4NNPH 4F33A 1JN6B 4UM5A 4CG3A 4GXRA 4TWIA 1Y0BA 1TKWB 1IEAA 4PSCA 3B8HA 4HADA 1O95D 3ARDD 4OGQC 2CIKB 4ICXA 4LDAA 4BNHA 4GYYA 1WSWA 1Q6YA 4L3AA 2NSDA 1GUBA 3WO3B 3MOSA 2J3DA 4LGMA 1XE3A 3ULUL 1INQB 1PDVA 1U8PA 2YVKA 4Q9NA 1IJBA 1EAPA 1A5TA 5I6XB 5ADOL 3DV0B 3VQTA 1PVVA 1EJ2A 2WVHA 4NS0A 4OMDA 4MSUA 3ADPA 5DMIH 2AR0A 3JWHA 2OJZL 1ODAA 3BLBA 2ZZUT 3FAWA 1KQOA 1LEIB 2MSPA 3BJMA 3RRZA 1Q74A 2V5RA 3NGBC 3N5KA 1CB4A 1FQWA 2MMXA 3VBEA 3FO1A 1QR6A 4RJJA 5EKXA 4QRPD 1GCAA 3QG6B 2I4MA 5IJXA 4L6CA 1X4XA 5LA6B 4DESA 1JDPA 3HUJA 5EHQA 5AOAA 2OB1A 4YDQA 3MRGB 4TKZA 2QV2A 3ZEAA 2PRYA 2G4CA 4GRDA 1SCDA 2NVWA 3NA9H 3TT3L 5BSMA 5NLLA 2B4AA 2ORWA 9ATCA 4MZXA 3C3CA 4BGDA 4CN8A 1RZ3A 5EZOL 1AZZC 3ZJTA 3FPXA 4MXVE 2JB9A 1T1IA 3B5IA 4YQFA 3EXG2 3EFHA 5B7FA 1Q84A 5EUOE 3TXXA 2FSIA 1FL9A 1NQOA 3C8MA 3EGVA 2IVFC 1B41A 1C0KA 2R2HA 4LLAA 1OUMA 4MYSA 3E8UL 2BH0A 1NLUA 3MOBL 1GU7A 4JEHA 3PHSA 2FWBA 1JG9A 1T0JB 2PQ0A 5INDA 3FJYA 1FL6B 1NYRA 4MQXD 1HNNA 1RLTA 2O0HA 2PW1B 3MRHA 3VRLF 4DC0A 3VFTA 5MF6A 2VJKA 1K4MA 3ZN6A 3JAWA 3W2GA 1BQLH 3GJFK 4BQFA 5EWJB 4ZI5A 1NLMA 2O2SA 3NRQA 2D74A 4HIHB 4D96A 1OLUA 3DRTA 3K53A 4OHBA 1YQWA 3PGA1 2N7SA 1X13A 2HLDD 4JOSA 1WO2A 2LKCA 3GHBL 4J29A 5CIPH 1Q15A 2F7SA 4QU9A 5DHVH 4UREA 1NDTA 2J21A 4NDZA 1K4DB 1NNUA 4I4TB 3K0AB 1I9IH 3KJEA 4LBZA 1IZ8A 2VDPB 1VGKB 3G79A 3PHHA 3AX6A 1QUPA 2W2VA 2YHBA 3TH2T 2H2IA 5FBZA 2YBRB 2JQZA 3QCVH 2VISB 5EVJA 5CR8A 5AVRA 3V7UA 2JLLA 2EDRA 4D46A 4HDRA 3HI5H 1TQWA 5F21A 5TXGA 3QSKB 3ULVE 1W44A 1QBLH 2FSFA 2UU9B 2WF7A 1FAKT 2VHVA 1JBJA 2CGRL 4OYHA 3EMDA 3MWJA 1CC3A 3V0EA 3F5QA 1F90L 3ARFC 4N3NA 3WG7B 4QOEA 1TYAE 5JC1A 2P6OA 3X13B 1MAHA 1X94A 1ISHA 2OBYA 4PLGA 1LBTA 4PRHE 3LPCA 1UZNA 5F73A 5HI4D 1MB0A 3O6MH 3VTAA 1UWFA 1GNPA 3ZC3A 4BE7B 3QY9A 1MIML 1SFRA 4WSJA 4B6RA 3S8MA 3C15C 1IQ0A 2QAGC 3V0VB 2OP4H 3C45A 1JZHA 3NBYC 5J56B 4RIFA 1B9ZA 3ZKQD 1TEXA 4PRDB 1DPFA 4ENTA 5DSZA 3NK3A 3CISA 5IF0A 4HUVB 5IULC 1UOEA 1XH1A 3HABA 5BV2P 2BWIA 4M99A 2JJWA 4ZTBA 2MTAA 5DD5L 1XGPA 3FNBA 1ETZB 1VHPA 2DQYA 3KQNA 1C12B 3KSBC 4PJ6A 3BEOA 4UZFA 1UT6A 3ICWA 5A6VA 4FCHA 1BG9A 1PU0A 5DJYA 2RGXA 5JPNC 4I2XE 1NN3A 1DN0A 2NUPB 5CJXC 3VH4A 2NX5B 2V4UA 5CFHA 2H4FA 2YPLD 3ZGOA 5LDDC 3N0AA 4KQXA 3BXEA 2N3ZA 1E9QA 1DANT 1NQAO 3ICPA 2RCNA 4FXGC 3ENZA 4E9XA 2UZIH 1Z3RA 5INTA 5TDNA 1QZNA 4M1YA 1V37A 1UUNA 1RABA 2PQMA 1F4YL 3LNTA 5IXSA 4HULB 3SWWA 2B4CH 4L48A 4N25A 3W57A 3TLKA 4YK4C 3CIQA 1P4IL 2SKEA 5J13B 3Q5DA 4II7A 3PDOB 3C5ZD 4KYIB 4DSOA 1YPZE 2BEWB 1E9DA 5BNWA 1KMGA 2H2PC 5D1QD 5CZRA 1FDRA 3HFRA 5BUSA 4L8DB 2J0UA 2VLJA 2BISA 1GOHA 3WN5A 2LLNA 5AW6B 5ELLA 1JE1A 3AREB 3ZDWA 2VFAA 4BZPA 5H1YA 5AB2A 1VLXA 3DHEA 5KNLA 1TTCA 2BE9A 3L5XL 2QMQA 3V0HA 5BJTB 2XYQA 5TSDA 1PUJA 2QJRA 1NV9A 1QHIA 4HDOB 2PJZA 2EXYC 1I7DA 5T4FA 1QFXA 4P83A 10MHA 1L1EA 4AEHH 5BORA 4WEQA 3DCNA 5D3MA 2FZEA 4FBLA 2H11A 3RB5A 2QW8A 1DKMA 5I1CL 4EPTA 5L2KA 2X4DA 3JQPA 1CDBA 3LY5A 4QJ4A 3AC0A 2GPSA 1P1RA 3QV2A 4CEHB 2HGSA 1IUZA 2IXDA 2Z1NA 5CDUA 1HHHA 3IEAA 5A2JH 5I9IA 4I18B 3HMKA 4Y1AB 3V4VH 2O61A 1UADC 1KQNA 1TU4A 1IOVA 1Z38A 4L57A 4J28A 2VTBA 3QQ5A 4ORGB 2J46A 3DROB 1NATA 1KY4A 2OORA 4QECA 5CGTA 3L1VA 5CW1A 4KACA 4J0DA 3U0WH 3ULSB 5D4IA 1ZGLP 2P6NA 3ZV4A 3ZX1A 4HK3N 3O73A 1JMKC 5GSRA 1UAYA 4OJMX 2D5AA 3DYPA 4HEHA 2UXBB 3L0IB 4O5OA 5AW8A 3Q2WA 4Y2RA 2GLTA 2O4EA 4H1UA 3OQ3B 4FA8A 5KX5A 4K5NA 1E7WA 4P5PA 5JAUA 1CR6A 5JNVA 4DV2B 3CFYA 5AO9A 3AERA 3EMKA 3NCJH 3CEJA 4LEIA 1YFLA 5FCUL 2Q1EA 4DR1B 1RH8A 4Z9BA 3GM0A 4WIAA 3GLTA 3DMFA 1OZAA 1KDZA 1U8QA 2WXGA 4I1VA 1VMEA 4IIDA 4I3FA 1CIDA 1GFWA 3ZU3A 1ML0A 4ELMA 3R0ZA 4HBQA 1BCRA 5GIOE 3Q06A 4H0IA 5G3ZA 5LHDA 1QS0B 1D7CA 4DCJA 3N2GB 2P7TB 3E2MA 4QO1A 1V5EA 2UY7A 2Q0ZX 4EZKA 2VO5A 2J9FA 2VW4A 1IM3A 2UZYB 3KYCA 4EMBA 3D6MA 3QJSB 2VR4A 5FEMA 1PWYE 1LO2H 1JQJC 1MCHA 4IIFA 2UY6B 2HJHA 2YN3A 3H3BC 1U0NA 1D7BA 4P5RA 3TZBA 2OSWA 4ZVQA 4EY7A 5BS0A 1SURA 2X8BA 1PFWA 2P67A 5DE3A 1PDKB 1RPZA 4P46A 4EO5A 4AVYA 2R7EA 1JDBC 5T5NF 2YJZA 4HLCA 3BAZA 1D5RA 3TW6A 4UD6A 2CM6A 4K8RB 3E9ZA 4M1EA 5TDOA 4S1QH 4V3CA 1FFCA 5FA4B 5ESDA 1XPRA 5C3TA 3N8KA 4MXVF 3ER8A 1A3RL 4AQAA 1WA1X 4X6YA 2F18A 1X9HA 1TVHB 1SOWA 5IV2B 4EUSA 4QNRA 3SKUD 5EUOF 1E2IA 2BMFA 5KDDA 5EEUA 2JBAA 4DCCA 4ZX3A 1W36B 3MTAA 5G40A 1L7NA 1Y33E 4X6DB 5L7XL 2O48X 7REQB 4RH1A 3F6LA 3AAZA 5J2TA 4FW9A 4ZD6A 3BSZA 4F7CB 4L16A 5HHOA 5CJ8A 5HKAA 3RSZA 1TJHH 3R20A 1WVZA 2YVLA 2HLAA 3TXAA 4KRPD 4OCYH 2VR9A 1M83A 5K6TA 3RSHA 3THML 1JD7A 4G0WA 3LS5L 3IEIA 1EJBA 4AYFA 1JLSA 3WTCA 1TK9A 4YGXB 2VQEB 2C77A 2FLVA 4FX5A 1IATA 3SC2B 3NRCA 3GWGA 1W91A 1DJPA 1G9EA 1X9LA 2VT6A 5CTJA 1Y7IA 5BWMA 3VACA 5M34A 3KD3A 4L5JA 1SFHA 2XNKA 1EZVY 4M3HA 3DNKA 1BZYA 3OZAA 4EW1A 1SKUA 1LXMA 3MHZA 3NGBB 1DDGA 1NEZG 3CFKB 1R9GA 5BQ7A 5KCMA 2C2OA 1OPOA 1Z4KA 1VE5A 4PGBB 2XA8L 4IJ6A 4R90L 4MCZA 3DO6A 3CPEA 2PA3A 3NFNA 3LFUA 5CEZD 1AZRA 3G59A 3ANXA 4LKCA 2HPVA 3EIOA 4G80B 1K8XB 4N4AA 1CJTC 1ZSYA 3MGKA 2ID7A 4FYMA 3ATAA 4N2BA 2XKAA 3H0EA 2GJZB 2D4AA 1DFBH 3W1WA 2ZJBA 3ONFA 2CMRL 2AEMA 3ZUPA 3BQUA 1CDCA 1CY8A 3P96A 3ULVF 1JFTA 2ZUUA 3ZYZA 4DGVL 3OF3A 4ZUVA 4AG6A 3QYMA 4XMLH 4R2GB 4S2UA 2NX5E 4UAHA 4PICA 3ABZA 1SIWA 2IH9A 4EY3A 3F6IA 2DQCH 1UDWA 4RMGA 4XRCA 1IDOA 4RZKA 1Q2UA 2YZ2A 3C7TA 4DCNA 1CIVA 1E3XA 1S7SA 3FSEA 3THSA 4F21A 4XN4A 2XLCA 3PUIA 3AY3A 2AFIA 2FZ3A 2IH3A 1PJ9A 4I4WA 1OTSD 2W4QA 1LEKA 2RH9B 3GM8A 4L3EE 3L7OA 1VCAA 2D3JA 2CK2A 3ETTA 1P5ZB 4MNHA 2C0QA 1W30A 2AG0A 3U0TB 1KXJA 1E9OB 2DAPA 1VRSA 1JFRA 2EKDA 4DC9A 4WFKA 4JA0A 4JFFD 3NEEA 1Y8QB 1ADJA 5JXEA 1DJIA 1HHGA 3FRPA 4ALIA 4FYVA 2BHYA 1JL3A 2YHSA 3DK2A 1TR7A 3HG1E 1PR6A 3LP5A 1CLZH 2D5IA 5JZSA 2HT2C 5BSUA 5KSBA 2BHFA 3AJ7A 3ENWA 3CJJA 5EU6E 1I3NA 2O05A 1LU9A 3II3A 1PR0A 1CJUC 2ZUVA 3MJSA 4JO4L 3AYXB 1SHLA 1OSZB 3T3NA 1LI7A 4Q4IA 1LPBB 1AHWA 1BHQ1 1DEEA 4IYKA 3EDKA 3TBSA 5BVPH 3EXIB 4MUBA 5C9JB 5D7IB 3LMJH 1VJ1A 1BXVA 3CMOL 5ISZA 4AJ2A 2P5SA 4QFDA 4M83A 4UCFA 4QUBA 5FECB 4AMVA 2FOXA 1WSDA 5AK6A 2OTWB 4L1KA 1U8OA 4UQOA 3VA2C 7ADHA 2LTAA 4W7SA 1QVVA 5L8JB 3A6LA 4FMKA 2FRVA 1PUXA 721PA 3P3RA 1IMHC 1KL7A 3EVAA 3D7NA 1JHMA 1XR9B 4NH4A 1XZHA 1T80A 3C1UA 3IJEA 4G6AD 1OAOA 3L3GB 1N3BA 4ZVVA 1XGUA 1TLFA 2C9UA 4L4YA 5TGTA 4LLYA 4IH1A 3KKOA 2H57A 3LYLA 3G08A 3S1LA 4MNQA 2QV0A 4FEEA 4IKEA 4XPAL 4HPXB 1I7TA 1G21E 3ARFB 3GG9A 5L4JA 3REWB 1YPZF 4TSAH 5GGRB 3R3YA 4I0PD 1OREA 4YFEA 4GKZB 3AV3A 3LDHA 1DC6A 4AICA 1ZTXL 5GGTA 1TIBA 2V9PA 1HNZB 1SVZA 3E81A 5I1AA 1T6ZA 1T89C 1N6IA 4PUBH 2OC4A 3VVVA 3KPLA 2MQ3A 4JKPH 3LB6C 1M2VA 5DP2A 2AEPL 2QAGB 2HNBA 1ETHA 3R9KA 1VA5A 3KXIA 4G81A 4DGSA 2VPXA 2GEEA 3ECBA 1AY1L 4B0PA 3QXDA 4PB9L 2Z6VA 3G5XA 3OPZH 5H8DA 2J0QA 4QHLB 1P17A 1WS6A 4PR0A 1SO8A 4KWTA 3BS4A 4AGPA 2AMUA 5K59E 3W82A 4Y7OC 4PD4J 1DX9A 1KZ6A 5HK8A 4OGGA 5CXQA 3O8DA 3OETA 3VFPA 1DE0A 4FXKA 2V7VA 5JPNB 3TLZA 2Y1OA 4YLCA 3V8BA 4YJKA 4JLRA 4LGRB 1MVLA 2HN9A 2EVIA 5BN3A 2HLPA 4N2GA 4Q4EA 4XYBA 4OHFA 4GMTH 1WMBA 4E5SA 2VZ3A 3CVHL 4FHFA 4ZU1X 3O8QA 4MPPA 2CLZB 1V7QA 4F3FB 1OLSA 5ED0A 3FO0L 3CLUC 4WEOA 4MLSA 3BD3A 4FXGB 1D5XA 3VTFA 1GGHA 5EHXA 1ONSA 1LILA 2XWJB 1IM8A 5AKXA 3A6KA 2A7XA 3RL1A 5J3JA 5KUKA 2JGRA 3DEAA 1SOUA 3SQOA 3DIDA 1E1CA 2MPVA 3DDOA 3VZSA 1RIHL 3PABA 4W9RA 1O9HA 4RMHA 3RY4A 1EM6A 4YK4B 3TJHC 3MV9D 1FP2A 3MTGA 4AQEB 2QVYX 4I9WD 3QKTA 3B9BA 2LU3A 1RFGE 3MJVA 1GFSA 3DLPX 1LRKA 2FX8L 2RQEA 3F7TA 1XCBA 2LW3A 2FJUB 2IG2H 1WMAA 3GFQA 3E1ZA 3KSDO 1A7PH 3GK8L 2WO4A 1VRWA 3AWEA 1YQGA 4N5MA 5AW3B 3LRTA 1TU0A 1WZIA 1IPFA 5JNTA 3FKJA 5A1TA 5L9DL 3BUYA 4H0HB 1KH2A 4KHTH 1AV7A 1NMYA 4KQIA 4Z53A 3KNBB 1U3HD 1ZH4A 2GBLC 4NBUA 4X6DE 3DLBA 3M4NA 5JW5A 4C3ZA 5E6UA 2JXMA 4EPWA 4D3DA 1QP4A 3IV9A 2WCPA 1T3ZA 3DURB 2Y23A 3QX8A 1XKLA 1T6WA 1I1HA 5LDGA 4JY4B 3ZQXA 5KSUA 4EGCB 5AVUA 3E1GA 2C9YA 4KAFA 4PCSA 5E94B 1E43A 5SWSA 4X54A 3K31A 2EFCB 4HFUH 3WIIL 4X0KB 1H2FA 5DO2D 2ZZKA 3MUY1 1WEKA 3L1FA 1ECYA 1FU7A 1FSGA 2MU1A 1T4KB 4DY6A 1DLHB 3ZD9A 3MACH 1T0MB 2L19A 3GSQB 3A6DA 1KELL 4DUVA 1QQTA 3O74A 3ZMRA 3UN1A 2I6TA 2HMUA 3WHXB 3LLVA 2BVTA 1CJMA 4TLTA 1X1BA 4BJ6A 4LE0A 1FLVA 3C08H 4C6SA 4XQ9A 1IK4A 2RFXB 4B2LA 3QDMA 1M3IA 4X98A 3OF6D 1SB9A 3BEVB 2QSQA 4MIOA 4KTDL 3LO5A 4PNPA 1T35A 3ZK7A 3MGTB 3MOQA 2X4TB 5M29A 3OLIA 4JO1H 4NUGL 1AIFA 1DRWA 4CG2A 2X12A 3MTJA 4H7KA 3DPBB 5EQFA 2DR2A 4F57L 4TYMA 1Z9SB 5BT9A 4I9NA 2AOTB 2VHXA 3E3AA 4JITA 1HURA 1NZJA 4P2CG 4KVAA 2IL1A 4JLOA 3ONNA 4JJ7A 3CNLA 2YXWA 1DLIA 3WELA 3PTZA 4N8CH 3L7FA 1EBBA 1WY5A 3ZE8A 1NBYA 5J7CC 5AUMB 3O9ZA 1MF2H 3KJXA 1G1AA 4Y1RB 1G9MH 5CP8A 3FBKA 4Q9KA 1TO4A 4OCXH 2QEJA 1JZQA 4L8CB 1ICTA 2G6TA 2CK0L 4PS3A 2IYXA 4YO0A 5B6IA 2IYUA 2OPCA 1ITBB 5B3KA 1U28A 4G5ZH 4EVNB 1JDBB 4EJSA 3QUXA 1Z5WA 2IV7A 2GPWA 4JQXC 4OFYA 1EFRA 3ESDA 4OZFA 3HEAA 1WXDA 4YR6A 2BSSB 4QARA 2PUDA 2P4UA 5FI3A 2ZYAA 4HGOA 4EL5A 2A9FA 5EC2B 4KKNA 3IUEA 1N6HA 3NS7A 2CUHA 1T1EA 4R96A 1KBGH 3AIKA 3OEHD 4JBLA 3P0HA 3TB4A 1TZHA 1EO5A 3TFQA 4DJTA 5D7IE 3PHQA 4YJDA 4AY6A 4NTZA 5DJZB 4PN6A 3OHXC 3L6RA 1PQYA 4X45A 5FOWA 3PEEA 1ZKDA 2AOWA 1ATZA 4KAJA 5T57A 2IXAA 1D2AA 1FRQA 5DS8A 4HS4A 3HUDA 1SDAB 4ZQTA 1ECPA 1T3TA 4INAA 2HH0L 4PJHB 1AKRA 2VMJA 1UXIA 4LYFA 4IXNA 1BOYA 4A2FA 1H0DA 4IGIA 5AH0A 5BVGB 3T4UA 4P04A 2ZSJA 2RK3A 2AB0A 4M03A 5GZ6A 4HHEA 4Y5XC 3E8VA 5D7LB 1AO7E 4PHXA 3DDCA 4ZUSA 5ETUB 2DPGA 2O57A 1YDWA 5JJLA 4RNDB 1CE1L 3KH3A 3W5SA 5J1TC 3SD2A 3A1DA 3WQRA 2XRZA 4AH2B 2BP7A 4OQTL 4Y4KD 2QRQA 1QK4A 5EUQB 5JJ5A 4WJ5B 1KC5L 5FX3A 1N0VC 4YFLF 3M89A 3ZI0A 4J9UE 5FB8A 2R8RA 4M0LA 3BL5A 4HNAB 3LHIA 1RUML 2FYYA 3QXHA 4H3HB 2WV7A 2RGYA 3QEQE 5JW4R 3P30H 3OKMA 5JY6A 2VAWA 4B3XA 2PN1A 2VPTA 1ZEJA 5ALGA 4RM3A 4DN4L 1Z0SA 4JC8A 4YNYA 1P0SE 1RTKA 4UDNA 2W6QA 5CNMA 4PWFA 3VBCA 5DWPA 1FE8L 1KJ8A 2Q6VA 5IN4A 4F9LC 3V8QA 3EULA 4LDNA 2AZMA 2WVAA 1RIVH 2AI0H 3IP6A 3ZOKA 4W9HC 4JXXA 1VSUA 2ZCJA 1HEYA 4B46A 3RKUA 1UB5A 4P5EA 4IBSA 1P2CA 4KK9D 1RULH 4OF3A 1QP7A 3GFTA 5FX2A 4JHXA 1YDHA 1I31A 1WICA 2W6MA 4BMVA 3IHKA 1J8FA 3EQ9A 1YSCA 4ZO7A 3ECQA 4CVZA 2BDUA 2ZJ3A 3NSYA 2P5YA 5JJIA 2M1KA 5FORA 4BRJA 4CKZA 4NZFA 4S0XA 5BNTA 3LPNA 5C0IB 1JQAA 1CEEA 3L46A 3MUOA 1BCIA 1JJAA 4TT3D 2H7XA 2FNBA 1OBCA 5A3VA 4BKLA 4B3SB 4B6JA 2BJMH 5EWMB 1JHKL 4TUJB 1UMDA 4OHUA 1EJ0A 4C29A 3G6JE 3L3DB 3TEJA 4UT9L 5C1MB 1J18A 2ZXDA 1BDMA 3ZWYA 5E0OA 4UTXA 2VNHA 4NO5A 2GBIA 1E9PA 3ROOB 1VPEA 4UTNA 4UQAA 4JPKH 4KNYA 4GZMA 2DIJA 2X44D 2D2OA 1E67A 3LQFA 2FIKB 1B2RA 2O5YL 5K59F 1RZRA 5DK0B 3ZMNA 4BWGA 4JFSA 3DETC 4LS3A 4I66A 1H9DA 1JLLB 1S2NA 3HKDA 1E2HA 4C6RA 2WF6A 3A31A 1F56A 4XVHA 4R05A 1GHTA 4QOHA 3WEOA 1INEH 2VH1A 3OQ1A 3FT4B 5A9RA 3GPCA 1QPBA 3PQCA 2F1BA 4PJ8D 1BCSA 1OZGA 1KT2A 1T4DA 3WYEA 2B82A 2J9XB 1A6AB 3IMSA 3K8MA 4Y2LA 5AW9A 1A7RL 3HV2A 1L5GA 4PJXB 1O94D 5HHTA 4JB8A 4S1RH 5F3BA 4GEKA 4ND8B 3LCMA 1PL0A 1A4CA 4N0UA 1HKUA 5GGVL 2YK1L 3VFDA 4RV5A 1W85A 4MVJA 3T7TA 4BMNA 4OSOA 1FIGL 4UBDC 1K8QA 1TJ5A 4OQMA 2CGEA 4ND4A 3CNHA 3N50A 1YQ9A 4NPYB 1PKEA 2QKYA 2QE7D 1BLNA 3TSCA 1M3SA 3OKOA 4D0BA 4J8RA 2C3GA 4EHAA 3HCPA 3UJAA 1OEZW 4CM9D 1F4HA 4LXUA 4WY7L 3RWGB 4ECNA 4X1OA 3GA0A 2ZR0A 3DYMA 3FRUB 3F0TA 3GB7B 2JJ8A 4L4VD 3PTAA 2RKBA 3AIIA 2HX7A 4GOXA 3PV6B 2GEVA 5BSHA 2EDWA 4I9HA 4X6DF 1RQLA 4FABH 4NJEA 1WXQA 4J3BA 5D93C 3EF4A 4DQKA 1TM1E 4AZ8A 3K1JA 3UROR 5CDFA 1RDFA 3GMMB 3K9HA 2RC6A 1TTBA 1F3OA 5JAMA 4HDSA 2PYFA 4PBDA 3TW8B 4EY4A 2W0SA 43C9B 2BMKB 3ADBA 3VE0A 5SWQA 2CLRA 1C1XA 3MRPB 3W8DA 3JRNA 4HTFB 3BAKA 3HA0A 1NINA 4FW8A 4ER3A 5LYYA 1JK9B 5DCLA 2M1ZA 5JARA 1FZOA 2JFUA 1PZ3A 4RNRA 1JR2A 3GPEA 4L5AA 1P7KA 2F6AA 5AVZB 4Z3IA 2XMZA 4GP8B 2WCSA 4OFXA 4J6EA 1FLAA 5EH1A 1Y3DE 1NLYA 3PFUA 3OCJA 3NEXA 2WIIA 3X1BA 5C2BH 3ZE9A 5L0QC 3IEUA 4FP9A 4H4NA 4C2BA 3VSEA 5C0JB 4KQ0A 2V7UA 1IAOA 1KXZA 4TWRA 4TM7A 5KAMA 4G42B 4JKLA 2QRKA 1KCVH 4JWKA 2GBFA 2R5WA 3GLIA 2R2BA 3IETB 4HAXA 2DGDA 4BXVA 5E9JA 3AB7A 2X4PA 1H9VA 1CV2A 1C5DA 3US0A 3INOA 1NMBL 1U8KA 1S2OA 4HJEA 1HOEA 2P8MA 3MRCB 3RGVC 3RIKA 2OFQA 1C16A 4PJHE 2V65A 3RJQB 1QX3A 3D4IA 1VKOA 1OQOA 2ZG2A 3L81A 2OMUA 3N8DA 2H9GA 2BNQA 1HF3A 2XHNA 1JQEA 3LZOA 4ZZKA 1JZ3A 1EX0A 2D2FA 4S10A 5D7LE 4BNLA 1R5BA 4QXGL 5FFMA 3RIFF 3F73A 2APFA 4YAQA 1DKLA 2XWPA 3F9RA 2A5UA 1NP3A 1T20A 3RBSA 3LT2A 3U37A 4OVVA 5LBVA 4DR3B 4DP7X 2FPIB 4QUAA 2CJUL 4I7ZC 1C0PA 1Z13A 4H0NA 4PLJD 2NXYD 3OZIA 3L3JB 3F04A 5AI8A 4Z7NB 4KNWA 5D51S 4F2HA 4BNUA 1Z5HA 3MNVA 4K9PA 2XF8A 1P4GA 4NQED 3FRPG 1T0UA 4EUPA 3VO0A 4EKXA 1ZD3A 5KJ7E 1FW6A 4V1DD 5I6NA 2AG6A 5L4LA 3RK1A 2I55A 5D7IF 3UMMA 3IU3B 1EFCA 3BGMA 3FZUC 3B52X 5LCXA 2OK8A 5DHRA 3BGOS 1I3RA 4UHBA 3EE6A 3ZZ0A 4CM4A 2WLLB 3GSRA 4ZVSA 4PAMA 3EARA 4MB2A 4R98A 2IXEA 3AEQA 5C1OA 1UCBL 5EP1A 3S7TA 4XDYA 3B70A 3HRHA 5T64A 3LX4A 5EUKA 3NZ8B 5IW1B 3CN4A 3VO8A 1TEGA 5GWXA 3BIBX 4DDWA 4R7DB 3TIIA 1KBOA 1VESA 3IBGA 5K6RA 3NV9A 2OXRA 1SKQA 4BZZA 4FR0A 5B6JA 1F20A 5FOBA 4YMWA 2UYCA 4QELA 3BAJA 3A9VA 3UJJH 1NU6A 1TYJA 2AWOA 3JQ7A 4MCYB 1SJEA 2LIPA 1NNSA 4DKJA 4HCRL 2ZVQX 1RC8A 2RGGA 4EGSA 4CV2A 1T5WA 5DISB 3P11L 4BMZA 2BGRA 4HKXA 4HK0A 4QUDA 3WGUB 2CD9A 5HHPA 2BEJA 2R8PA 2OMZB 4PPFA 1MFAL 1T1JA 3PKIA 2QORA 2V2WA 4XJVA 1COWA 4HFRA 4P0TA 3DO7A 4BLUA 2IQIA 2XVGA 4A1OA 1XZDA 2PR4H 1M6VB 1JNNL 1FVCB 2W22A 1SQSA 3I6GB 4R84A 1FDOA 3KV1A 5DZSA 1YU6A 1UKQA 5FDWB 5ALXA 3P20A 1U93A 2EE0A 2NY3C 2VI5A 5H9VA 4EFDA 4UDYX 5EOQH 4D44A 4KI5D 2ORED 2HFEB 3ZU4A 1NMQA 5SX4I 4TOYH 3TLJA 3RFUA 2JGIA 4ZPTA 4BWVA 3Q85A 4AENB 2RCYA 4D56A 3JTSB 5LBUA 1Z0JA 3NJJA 4L5FH 2ZCKL 3E9RA 3SKOB 3OHXB 4KH9A 2Y0BA 2W91A 3L4ZA 4G8EA 3VJ6B 4HZGA 4KSYA 1E7SA 1V48A 1OBFO 2RMKA 1WZAA 3ELAT 4YWJA 2HQRA 5JDJA 4PJXE 3O91A 4G1BA 4DZZA 4JO3H 3SGLA 2ADOA 1OP3K 4G5OA 3FB6A 4D9RD 3N3EA 3HCVB 1IO4C 3MRNB 3G6JF 3O2WH 4QVIA 3HB3C 3BG5A 3GHPA 3R3ZA 3LXXA 2VUTA 3V2UA 5J1TB 3KTOA 2AZDA 3D4LA 1BJ1J 2RBGA 3BMNB 1DO2A 1XU7A 3HN7A 4MDHA 1YQQA 4YL9A 5AIAA 3FUIA 4XPFL 2XRAL 4PP2B 1F8TL 1VFNA 3L9WA 1WV1A 2NXZD 2GC7C 1H65A 4GSYA 4LBYA 3CFUA 4O2RA 5A2AA 1DTEA 5AQ0A 5CEEA 2P90A 1T22A 3PP4H 2IF7A 1WVMA 1NCBH 4LYYA 1QANA 1JWSA 4JVPA 35C8L 3PC2A 5IHHA 3OCXA 4AYMC 5T4BA 2UYHA 3ROKA 4MMZC 1TQCC 1DQLL 1XWVA 2XNDA 4H0FA 1JGDA 4ZT1A 2FPRA 3TCXA 1QKZH 2PT6A 2V0GA 3C5VA 2AFHB 5J40A 3HFMH 4HGMA 2VPQA 1Z7WA 3CFBB 3IP5A 1OFHA 1B43A 1I8TA 3IMTA 3X3GH 4YRMA 2VCEA 3AB8A 1GLGA 1MOSA 1ARZA 1NBAA 3GYRA 1OCEA 1U7HA 3HE7C 2KS6A 2E2WA 1DHTA 4KVCL 1GA2A 1T1YB 1OX6A 5B2FA 3O3BA 1K3ZA 2WXMA 3OXSA 3Q3GE 4N5LA 2XZTA 1WFNA 3VMNA 5FGSA 5M04A 2O5CA 2QQKL 2DWSA 3CH6A 4XNDA 3ARRA 5DMHA 2EUXA 4AMWA 3T41A 4DLTA 5EU7E 3L82B 5T67A 1G6RB 4DR7B 3MXWH 1ILWA 2R00C 5SICE 1LLDA 1IQPA 1DJLA 2H32H 4FMVA 1UP7A 4EHKA 1NKGA 5TK4A 3ONVA 1SXGA 1TF4A 3D2AA 2ADFH 3MUJA 3OXRB 3WIFB 2N46A 3OFSA 2PAFA 3V4PB 3GNML 4QO7A 2Q6TA 1G64A 1S7VA 4B53A 3V97A 3C5SB 2EJBA 4X6UA 3RODA 3TWOA 1JL8A 4L4ZA 1DAIA 1D9KD 1Z26A 2QSCL 1EQUA 1UMBA 2RTTA 2NVUB 2F54A 3CVDA 1WHPA 4NN5C 5B8CC 4P0PB 5FOUA 2BGIA 4L4TE 1LQTA 1N8TA 2ACWA 2IGFH 5KDOA 1AS7A 2AG5A 4DLPA 3RANA 4NLAA 3MBED 3X11A 3T2QA 1R2QA 2MCPL 4N7JA 1IGMH 4OB8A 4YHYC 2B2NA 5DRXA 4JJEA 4XWGH 5F1YA 5K05A 5SYMA 5IAEA 2YFKA 4HT1H 1UEMA 5JMOC 4IUYA 2QPDB 1XMPA 2AYXA 3PIRA 3I32A 3GRGA 2GXUA 2X6CA 2NG1A 3OZRA 2EDFA 3WKML 2C92A 1ZLYA 3IJSB 2B3DA 5EKDA 4X5XB 3ZWNA 1BS2A 3DVQX 1CXHA 2B2XA 3WY4A 3FFOA 3SKJL 4G23A 3O4GA 3VKVA 4NT6A 2QDXA 5B7MA 5GADl 2IS2A 2EAEA 3UTPD 2GO7A 4P2QB 5FV4A 1MW8X 1QVZA 4DY4A 4IJWA 4OZFG 2IHZA 1U9IC 3K16A 4S04A 4U7SA 4Y1SA 2HUNA 3DVGB 4OCNC 5A9SA 3E2IA 2WNGA 4G8IB 5D1NA 4PJHF 5TT1A 1FSPA 5AW1A 2WZPD 5E7BA 2F43A 2RIKA 3INNA 3CVHA 2BWDA 3QLUA 4L85A 3H1AA 2JCSA 2CLIB 5D93B 1X0VA 2QRVB 4CILA 3RADC 4XWKA 4XJTA 1B0RB 1T3FA 1T7ZA 2WD7A 3R1GH 3GGCA 2OR7A 2ODEA 4EJ0A 1HHIA 4U0JA 3EIQA 3Q0EA 2L18A 3FVRA 4BVJA 4OLWL 3D4PA 3EF0A 5GJWC 1DUIA 4F5CA 5HI5C 3OKNA 5KANG 2GD6A 5L6LB 1V1MA 2QTHA 5IT2H 5HA5A 4M46A 2WJAA 2WPDD 4PRAB 4AIXA 2XUQA 3C8UA 3RLFA 3M17B 1VADA 3FU0A 4HDIB 4QXOA 5DNWA 2L7JA 3GSNB 2A6JB 2QG6A 4LSPL 1IY0A 3HCEA 3QEUA 1FK8A 2F1KA 3J80A 2BIOA 3PGFH 1F4LA 3A4VA 1KDIA 4DK5A 2Z3ZA 3G6KA 2W07A 1CD1B 3LBIA 1A4KA 3KLPX 3Q1SL 4JROA 3ZKMC 1JF1B 3VO9A 1I4TD 1YR2A 2X0KA 1DAEA 3E58A 2D7CA 3AACA 4XN9A 2XTMA 4E5YA 1HG1A 1VDMA 5L0QB 4OLVH 1I7ZB 3DG9A 1DZ3A 2DETA 3QCTH 3MBKA 4G09A 4R8KA 1NIJA 4IXDA 4W5HA 5CNHA 1C7IA 1P29A 2XD4A 4PGAA 3HM9A 4UEQA 3FTXA 4X5QA 5F35A 4FULA 3WGMA 1S7XB 4I14A 1ZD8A 4OLUL 4LRTB 4B76A 5KG9A 4PN7A 2R8EA 3E82A 1D5WA 4C9BA 3TURA 3KLHD 1IM9D 3HW7A 4XTRA 3M3DA 4KN9S 3PRJA 1O97C 2M6RA 1S8AA 5B4MC 2BIHA 3QIBC 4N1EA 3JV4A 4PSAA 4R0LC 3EYQD 2OSLB 4EGJA 3UJ9A 4ZAFA 3RGVB 1P4LA 3DFIA 4CIAA 5K9KA 4EN3A 3GJQA 4EVIA 4EECA 5EP3A 4XXWC 3CLTD 4RCZA 2AQPA 4K81B 4KR6A 2VUKA 2X09A 4XPBL 3A4YA 5E2UL 1UASA 4CU8A 3GLHA 1ZLSL 1WW2A 1C9EA 1M6EX 4ATWA 5KB3A 3BPSA 4OJKA 4ALKA 1GJIA 3JWIA 1B0WA 2Z1DA 3AFCA 2KERA 1SLWA 3H7IA 2Q76A 3QE4A 1DVRA 5KC8A 3BREA 4MWCA 5C0FB 2ETXA 4XD2A 1I6LA 4KH2A 3GMQA 5FCDA 1UA6L 4YHNA 1BAPA 2YNMD 5AAMA 2O14A 2IU0A 1W88A 3HKCB 3B3FA 3AW8A 5AK3A 4U7GA 1EPUA 4BNGA 5BQ3A 1YECL 2FCAA 3QQPA 2FWSA 1EK1A 5CUSL 3GCGA 4BLRA 4WVRA 2OYRA 3DNMA 1I6MA 1FF5A 2QL7A 3WHE0 1LNSA 3HI1B 5F2KA 3CC8A 3UK6A 5FBRB 4PJXF 1R17A 3U3OA 2Z92A 1YEDB 4L7VA 3GJ5A 4OXNA 3S35H 5D72L 1JVOA 1NBCA 4KH0A 2AFHE 3IMVA 2BSQA 5LGYA 2VITA 3UTTD 3KX2A 1YVPA 4CG0A 1H0KA 3VYUB 5LQUA 1RYHA 1PZSA 5DURB 3OTHA 4HEQA 1M57B 4YP9A 1MR3F 1E3EA 1GRQA 1ZCFA 2BTQB 3M7FB 2W2OA 5I74C 2XOTA 2FH8A 5JORB 1MORA 2J85A 4ZVMA 3UIYA 5DK2B 5CJJA 5ESVA 2WZQA 1Z88A 1FGNL 4WNCA 4Y2DD 3NP3A 4LT7A 3EZ2A 4C56D 1EUQA 4CR7A 1JFQH 4MVJG 2B9AA 4BQPA 3EJYC 3FGPA 4ZI7A 3A32A 3HWWA 3D34A 1NCWH 4UUMA 2WSBA 1MOZA 3VNRA 3L9EA 2EIKB 3R4DA 5KAQF 4OGXL 5C0GA 4WV1C 2BIFA 4US2R 1Z1WA 3SQMA 2ZS7A 3E9QA 1U8AA 2NY3B 1PO7A 2AABL 1H5BA 2C4MA 1C9NA 4CCWA 4MQ6A 4PJ9C 4HKTA 4M0MA 4W1RA 4C0QC 2FX3A 5KJEA 2Q0HA 3KHQA 1MLBB 2JK0A 3G2MA 3O45A 4JLAA 4JELA 2PX5A 3LCYA 4CMMB 4ZZIA 5GZNA 5AJYA 3E9DA 4N0CC 3E3QC 2A9PA 4XDHA 3ZJ5A 3MGOB 2C99A 5EIQA 3EOTL 2FR0A 4TXJA 4XPIA 1B4JH 4PGMA 4JDVB 1WMFA 1F18A 2BSTB 1G9NH 4W68A 1ZU5A 3ILEA 3A23A 5ADOH 4X9BA 4OQTA 4RUKA 4UAGA 4QWWD 2OJZH 2O59A 4KYTA 5C0AB 1FJXA 1FFXB 4PV1C 3EXFA 4BFWA 2K3HA 4YMIA 3DKIA 5TY0A 3HB3B 1HH9A 5I7EA 2I62A 1H0HA 2H07A 1U2TA 1GDTA 1FCCA 5K01A 4WFQA 3OCZA 2AJDA 4P5KB 1RRVA 4TTGA 2F9MA 2QMHA 3RE1A 3QNXB 4F96A 3IMUA 4P5MA 4WN9B 2OTUB 5F7EL 4FP8L 2X5KO 4HB4A 5F96L 3M4YA 1CGVA 1BD2B 5FJIA 2HK6A 2ZCHL 4JV5B 4Y4HD 1FE8A 3OHSX 1TETL 4P2QE 3B6EA 2A8YA 3H6GA 2IQ9L 4IEFA 5JHGB 5I1JL 4UPEA 3DHUA 1OSNA 1TM3E 4DMCA 3WY9A 1CO1A 1NHGA 1L6PA 3IDJA 1VJRA 1ZJZA 2J8OA 2HM7A 1AAJA 5IUJC 5CEJA 3ZHQA 3IKCA 3V6FA 5CVJA 3QNZB 4IRSC 4DCGA 4H26B 5CDHA 1FHGA 4GP7A 1WABA 4MMZB 1TQCB 3PHJA 2GJ8A 1X5GA 3W8FA 5B3SB 2ZE0A 1JU9A 4NKOA 4BWUA 2CMFA 4XYLA 2I7DA 4X8MA 4D4GA 5HPYB 1F14A 2Q3DA 5JXIA 3MOGA 1NMAH 4NCDA 4BQRA 3OLDA 4QXQA 3J7AC 1XF9A 4L1HA 2IYEA 1EFQA 3FI0A 3ZS9A 4BH8A 3FB5A 4WWID 4QU5A 3EF7A 3E53A 4UT9A 3HE7B 3SZUA 2CXKA 1YBAA 1WSBA 4Z95H 4JJZA 1K9VF 3DOSA 1A5SB 5BO1L 4KZ0A 4I4IA 3HC3L 2WI8A 3D18B 4M8QA 4RYDA 5LXTB 4K9EL 1YYLL 3IJPA 2VDML 3S40A 4Q9BA 1E4XL 3GHBH 5BV7L 1YR9A 2ZB4A 3K32A 3ETHA 3HSKA 4MQUA 4D0GA 3OWRA 2HCRA 3IEKA 2Y66A 3D05A 5EAIA 1MWAH 1FYXA 4EUPG 4YSQA 2YFQA 3KZVA 1VBNA 1ZUHA 4XI5D 3PWJA 4JFHD 2IAMD 3MYRA 1HZKA 2EZUA 3IGKA 4DV6B 3O3UN 2PZBA 3HA2A 2XWQA 4J7UA 1B0GA 1N32B 3RKDC 1MJGA 4PWZA 1G7JA 4XOEA 3P0VL 2JIRA 2ZE6A 5LNGA 3VH8A 2Z2JA 4NN5B 5B8CB 3M5DA 2A0XA 4GWGA 3QEAZ 3QFCA 5HYSA 4ZAZA 1SU7A 2CGRH 2QL1A 4KK8C 4LZKA 3SEQA 1W8IA 4GKSB 1H9BA 2O8NA 4FJ0A 1D2NA 1ZM4A 4G72B 3GLGA 3GQFA 4I88A 2EFYA 1QSZA 1DBJH 3ZTYA 3FT2B 1LY1A 4QLAA 1M73E 3TBVB 4L2LA 3DBXB 5J0BA 1C8BA 4MZ2A 5ILQA 5CMLA 1UQTA 4XR8C 1E2VA 2NXJA 4IVRA 1WFUA 4LQDA 4UFNA 1MZZA 4EUNA 1A9ZA 3A1SA 5JLJA 4MVJH 4WSKA 1MREL 3EH4B 2VR7A 4RJIA 2MPAL 1WHTA 4DV7B 4YYEA 3WFIA 3AY4A 1X7ZB 2AK2A 4YJGB 3CFJA 1JB1A 3AVUA 3EYUL 4CKWA 4P4KA 3PYLA 1RD6A 2NAPA 3MMPA 4OLAA 1JR6A 1FVFA 5E4FA 4LTNA 4NNYB 3EZYA 4FNTA 5HE9A 2O54A 1F4WL 3H9SD 2NOAA 4JGJA 3GV0A 4FMFA 1HZZA 1KAHA 1YRHA 5J9FA 4EG8A 4PG9B 3EC2A 3U46A 3FNFA 4UHHA 3JD3A 2DBVO 1DAFA 1QYWA 2Y06H 4GWLA 1M1YA 1JPSH 2QN7A 4CNQA 4U3CA 1QLEB 3OIVA 2DWCA 3UQYS 3K6SA 1EIZA 2PGXA 3C70A 5A3QA 1T91A 4C20A 1YTUA 2A4MA 3A1VA 3PFBA 2OL4A 3U1QA 1MVYA 1KEEA 2PMKA 3NDPA 1I2DA 3RDPA 4K3JH 1RCTE 1ZIYA 5AHWA 4Y4FB 5FW7A 1CGXA 1GTJ1 3KUXA 3P2TA 1W4RA 1A7BA 4E9QA 4WL0A 3SO5A 4IU3A 1DV1A 3FKQA 5T7BA 3L54A 3HNTL 1P4IH 2I85A 3VXUA 4ZMXA 5F7KC 1NWPA 3FH7A 2F1JA 4NNOA 3TA4D 4DHWA 4HWEL 5J23A 4YHKH 3WFEL 4FFBA 2QTTA 1U1DA 5FHQA 3VYPA 1FZJB 4LSSL 4NUQA 4ZSOA 5C8YA 2ZJSL 2OMXB 1N6RA 1ZRHA 4MVCA 3UW1A 5JIMA 1RMYA 5C97A 1UMCA 5FCSH 2P5WD 1NBME 1RLJA 3I09A 4KLZA 3TQFA 1BQ3A 4MEJA 3L5XH 3WNDA 3JQCA 2I4TA 1IOWA 3TS1A 2IDKA 4B17A 2IY9A 1WWAX 3VO2A 3RL2B 1FSKC 3IIKA 2DVMA 3BC1A 3LF1A 1XQ1A 5IHBA 2HK9A 3CSGA 3T9EA 5EO0A 3GXPA 1R8XA 3Q13A 3CFCL 4PR5B 2G75A 3BO8A 5AAWA 2EKJA 1SAYA 3RIGA 5D6OA 1SY6H 1A4JA 3N7AA 2YXPX 1F1AA 5E6IC 4M3NA 2MNJB 3TLMA 3F96A 3QIBB 1BQKA 4Q4JA 2OXHA 1G5QA 2YPKB 5CITA 2OHHA 4DP8X 2VOJA 4X9GA 5CLXA 3M34A 2C3OA 5IT9A 5JZ7D 3VFWB 4NQSB 4D92A 5DGTA 1QR2A 5MFPA 1WCWA 1Q5PA 3G3LA 1A2QA 4ONFH 2WUFA 5D1HA 1NOLA 1G5IA 3UGKA 2Q2WA 3CBRA 2DOKA 1DDHB 3P9XA 2BIIA 4J23A 4HKJB 4X7CC 4NZMA 3KL3A 3EGIA 4J3VA 4ML3A 1R16A 3WICA 1K7EB 4DAGL 2NN3C 3FTUA 1SQ2N 2PJDA 2EZ4A 3AMLA 3BDYH 1QOZA 4IJTA 4H8WC 2WWXA 1BD2E 2PLAA 2OBFA 2GTZB 3RVBA 4IOLA 4MR7B 4PTZA 4N2EA 2IPTH 3CDCA 5DSCB 1Y6QA 4EUPH 3NNSA 1SXJC 4LYEA 3BD7A 3CPUA 1KPHA 4Y19A 2ZAMA 1DELA 4Y16C 4PN3A 2W42A 5AHXA 5HGXA 1QONA 5H0IA 1ZR4A 3Q15C 2JPDA 5JAHA 1NOIA 3ZR5A 3RVUD 2PLTA 2Q4RA 5MEPB 1NPTO 4G4SP 1BA2A 2Z91A 1OP4A 5DI3B 3H11B 5FYKD 2BM8A 3RIAK 1NQTA 2H4EA 1B9KA 2ZJOA 2WICA 3UG3A 1F4XL 3UTQA 4FJ2A 3NT5A 3GIZH 1RC1A 4I9FA 2DQTL 4ZAKC 4QT5A 2NLJA 3WS7A 4B2PA 4UBNA 1WX1A 1L8AA 4LPKA 1DUYA 1VJ5A 5I0ZA 4NFYA 5I74B 4UNQA 5CT4A 5TJ9A 5ICXA 1G7HB 2P69A 1ADWA 4CLOB 1RRKA 4EG6A 5KEIA 4JHAL 2R96A 3VXPA 3CDFA 4WWKA 3F97A 4NNJA 4M9ZA 4DIOA 5BNZA 1NBQA 2EE2A 1GL7A 3K4DA 5DJDA 4BPBA 1D3CA 1USKA 4IOSD 4HWZA 5CB8A 5E6RA 4V0OA 4WV1B 2EU8A 2QT0A 1HEHC 1BWWA 3LH2L 1LA2A 4EE2A 5AFAA 1JTVA 1FY2A 2DLIA 4HDQB 1MEXL 1ZH2A 5T6BA 3DZFA 1WS7A 3LEVL 4ZOCA 1UWVA 2HMIC 1E4KC 4PJ9B 4LEXL 4IJMA 1XBRA 1P9OA 3DUWA 2O9JA 1ZGHA 1CU4H 5DOVA 1SVWA 3FULA 4IHBA 2QN2A 4OZGA 3TFKC 5BO0D 1WPGA 3SKNA 3VKFA 5GGVY 3NZHL 5J58A 3ROMA 1A69A 5EIBC 1PGJA 4O3UB 2I4LA 3B9PA 3ZV5A 1N5KA 1K8ZB 4GOKA 3SXJA 4EBQH 2YARA 2VYCA 4HJGB 3TFBA 3VM5A 4BVEA 3OTQA 3DXAD 4BDSA 4X44A 3CZ4A 4TUOB 1IFRA 5HHQA 1FRFS 3JZMA 1YEFL 1Q95A 5AOKA 3P4OA 4RZCB 2E48A 4X1IA 4R2XA 2YQ4A 1J6UA 3JSXA 1T1XB 1CZRA 2XA8H 3FDZA 4O2FA 3IAGC 2XTZA 2CJYA 4LVNA 4ZP1A 3EW7A 2REQB 3CN9A 2IYZA 3BIWA 1QFWL 3QEKA 3U16A 2Y5TB 4BB0A 4FC7A 5JQ6L 3H9QA 1E0KA 1E42A 4OI8A 4B97A 4GNKA 2JKVA 3TIEA 5DD3L 5L2JB 3RSGA 2CMRH 3RVXD 4NJOA 4MHHG 4AQ8C 1E8NA 1NW5A 3BMCB 3GU3A 4DJDC 2EE3A 1EE9A 4WTWA 1CQIA 3EXHA 1ZK9A 1ACYL 1QGAA 3I8XA 4L8LA 2V8LA 4EDWH 1A2KC 4IRSB 3FM9A 4ETNA 1GNSA 3LKQB 4L4JA 1GZHC 4Q9QL 4DQ0A 5I76A 5IKPA 4O8ZA 2H92A 2VN8A 1Z4IA 1SXBA 4G9FA 3P9YA 1MSPA 1E4JA 1CG9B 3KKEA 1SQGA 2P9YA 4ADGA 4WRRA 2F5AL 3ZHCA 4XUEA 4K6OA 2A83B 2PTVA 4Z18A 1LDSA 4EI5C 2FEMA 4JXJA 5E8DL 1F4PA 3WV0A 2VTEA 3MMNA 1S78D 3JWDL 4ZFGL 1DTUA 1QIFA 1DQTA 2WWKO 4Z0XB 3CCHB 8FABA 1WLSA 3TOCA 3KT0A 1ACCA 5DD0H 2F7QA 4PRZA 1JZIA 3RNOA 3BAIA 3S3JA 2G77B 1K27A 1LYQA 2EZTA 5EIHA 4QTYA 3F7YA 4JEMA 4WJG3 4N6OA 4WEMB 3ZKAA 2PUWA 4D9EA 3RROA 4ZMSA 1MFNA 4FNQA 1C7QA 2GILA 4DDUA 1DARA 1RU3A 2CR6A 2DBLL 3L05A 3QUMB 2WD9A 4JO4H 5F9OL 5ALKA 1XHLA 3LBYA 4GRMB 2QVTA 3TECE 3FPKA 4X4KA 4A2GA 4AP9A 3LZDA 5DTEA 3S3TA 1BMGA 2P46B 1HZLA 2ZTVA 4PPQA 1UDXA 4FHEA 3NHFA 1XJ0A 2RHCA 1JHLL 5HMLA 3T5CA 1HNWB 4AITA 3H42B 2NYYD 3IPEA 2Q2EB 4DKTA 3L16A 3M4XA 4X9IA 1ZOSA 3IDUA 1C3VA 3D3KA 3CXDL 3G0GA 1E61A 1UXGA 4L9LC 4KMMA 4FONA 3KC2A 1EHXA 2XR1A 4PRBA 1P2GA 1Z45A 3VRIA 1XVUA 2EEXA 5JSFA 2MNUA 2XMRA 1QHEA 4RVGA 4NHUB 4IU2B 4XPGH 2HEIA 2O1SA 1MB3A 4PSRA 4JQCA 1W7AA 4LE8A 2J3HA 2WOBA 1I30A 4G1MA 3SE7A 5CCKH 2FX9H 3LQZB 4UT6H 4WT7A 2X4QB 1I2BA 3RRXA 1UIMA 1CBVL 3D0LA 4IVPA 1R6DA 5CBEA 3IFPB 5D70H 1UJBA 1N5OX 3ND8A 4GDFA 1W0CA 3H2WA 4WW1A 5B7GA 3U1SL 4HJJL 1SVIA 1U8EA 2V6GA 1AY1H 4BTVA 3R7WB 4PJ5B 1JHTA 4L3EB 4WEBL 1TNDA 2GNAA 5A06A 3IXMA 2IEBA 4EELA 2BIQA 1SLVA 1DPGA 1FMJA 4ZQBA 1NLDH 2E7MA 2KE5A 5DD6B 4JG0H 4F7WA 5IB4A 1FBIL 3CZFA 2D7TL 3F4BA 4BB5A 3MAAC 5KMGA 5J2UA 5LZ8A 3HG1B 4LKXB 5EXEA 3F67A 4OF0A 2HOQA 5ALWA 3QVOA 1LGVA 1VJSA 5EU6B 1FNFA 1OZFA 1C7EA 3E1F1 1ENOA 3GUZA 5HQ3B 3DGGA 4F5DA 4E41B 1EK6A 1MWOA 3UZEC 5AZUA 2QPAA 4XHQA 4LRXA 4ZX6A 2Q3XA 3OJVC 5AW4B 3EZFA 4Z1PA 3K6NA 1Z33A 4GS5A 2AR7A 5FR2A 3IKLA 3U0VA 2JI4A 3JPYA 1ZM3A 1EQ2A 5EEYA 3FNKA 1QSFA 2VAJA 1RIHH 2AQ8A 2X0VA 5HGBB 1RURH 4BQ6A 4A2EA 1C5CH 3K0HA 3W0WE 1OGPA 3OAWA 4ER0A 2R4RH 4HG4K 5JCJD 5EPUA 5DR5L 5D71H 4TNFA 1JWMA 2QGBA 3SQWA 4TTVA 4TV9A 1T15A 3PP3K 4UQ9A 1Q57A 5GJSL 1YJCA 3PYMA 5JDIC 2IYAA 5EERA 1DAPA 3CWCA 1OAUL 2O8DB 1UWEH 4L05A 3GK8H 1G21B 5LQCA 1CF2O 4JN2A 1UD2A 2EYQA 3K0FB 1XDZA 3PE9A 1BRTA 1Y48E 2NZJA 4YO7A 1J2RA 5E4TA 4TKLA 3LC7O 1HQYE 2ZOLB 5KOJB 2FPSA 5ILTH 2R2EA 1KIAA 1FSKB 1GYCA 2ZB7A 2YHIA 4S1DC 1A6ZB 4PJIA 3RS3A 5K03A 1PYWB 2ECKA 2JIXD 5T5FL 1XEDA 3L4SO 4FWTA 1WF6A 3VHLB 1RUQH 5CFMA 1RJGA 3ZTDC 4LDOB 1UJ3A 5LLSA 5E6IB 2EYTB 3I6BA 1YNKH 3E3QE 1V9SA 5AYVA 1B3IA 2GABA 1A2OA 3ARXA 4N48A 3KFXA 1JKXA 4FCTA 2HHJA 1WR8A 4LC0A 2PL5A 1MQ8A 4DKAA 2FT6A 1M1NB 3WIIH 4JYZA 3RWFB 4XQ0A 1MG0A 2G3NA 4IIYA 3LRPA 2BJVA 4GM0A 1H0SA 5LXTF 1MI5D 1G2IA 4U8GA 1PWXA 5E8NB 2H85A 4M1CD 4LDCA 4GI7A 4N8VA 4M4SA 3QJTB 2WKWA 1WB4A 1VB3A 3ESRA 2CCVA 2B1HL 5KPDA 1NYTA 3VFMA 3OC0A 1QX4A 1P1ZA 2A1UB 1S5HA 3WLNA 2PTHA 2FMXA 2R15A 1Q20A 1ADQL 2AK4A 1BIFA 4EHJA 3TEXA 4EI2A 1B42A 3T61A 4HD8A 3DV4B 2JCYA 3AZPA 4OLXL 4MA1C 4RORA 5I0DA 3U7YL 5EHZA 3A6ZA 1Q92A 1YEHH 3SR3A 3HJFA 1IJFA 3AHEA 4HV4A 3Q8LA 1YC7A 1T2DA 3CPLA 1SXJB 4NO0B 2BM9A 2XPGA 4MV4A 4Y16B 1E3SA 1RYEA 2I87A 4YO8A 1NDGA 3LW8A 4RAQA 3K4QA 3RG1C 2FPMA 4UQIM 3VR6D 3UANA 1E3QA 4OZ4A 5JD5A 3PWNA 3PNKA 4U1MB 1ORVA 3VH8G 2UUOA 3EDRA 5KTSA 4JVUA 5HYSG 1KJVB 4G8FA 4PMEA 4ZPVA 3FQUA 3KQYA 1NUSA 4HFJA 1FNSL 3DBSA 2OXCA 2P35A 3SPXA 4ZAKB 2C20A 1G1MA 1QFSA 4UMGA 2MINB 3DKPA 5DKFA 1OF0A 4AN1A 3MV7A 2ICWI 1G4MA 1RUPL 2NQCA 2P41A 2C4KA 1I1NA 2FZLA 3VTZA 4D80A 3NQ41 2WXPA 2I4OA 1KMHA 3QA9A 3I75B 1ELOA 4XGZA 3KWXA 3I74A 3EH3B 2OXIA 5DK6A 2HG5A 5DYTA 2ZIWB 5AVYB 4ZT6A 3ISRA 2AEQL 3WE7A 3SYRA 3U44A 2RGWA 3BZFA 1IBLB 4K1LA 4KTGA 2W2XA 2YC2C 3MUNA 1BHGA 2IH1A 4TQHA 1KTCA 3O6FD 2C5HA 2BEUA 1DHRA