4UM9B

Crystal structure of alpha v beta 6 with peptide
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
470
structure length
448
Chain Sequence
GCALGGTCEDCLLIGPQCAWCRCDTPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVCPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQVNSSKCHNGNGSFQCGVCACHPGPRCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-V
publication title Structural Determinants of Integrin Beta-Subunit Specificity for Latent Tgf-Beta
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 110
structure length 448
sequence length 470
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4um9B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4um9B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4um9B03
3VI4B 3ZDXB 1OLZA 3PPYA 1ATZA 1JLMA 3T3MB 1T6BY 4HQOA 4CN8A 4CNBA 4WFQA 3AL8B 1U0NA 1DZIA 3BQNB 1QC5B 1MQ9A 5E6UA 3IJEB 4K3JB 2XWBF 3HI6A 1LFAA 5E6RB 2I6SA 1U8CB 3AL8A 1N9ZA 3FCUB 5HGJA 2VDOB 1SHTX 1QC5A 3EGDB 1M1UA 4NENB 2NUTB 3OL2B 1JEQB 5E6RA 1L5GB 1U8CA 4BJ3A 4WJKB 3ZE1B 3ZE2B 1MQAA 3NVQA 1NA5A 3EGDA 3EOAI 4NENA 4UM8B 2VC2B 1MF7A 1XDDA 1JEQA 2B2XA 4G1EB 1L5GA 2ODQA 4FX5A 2ADFA 4C2BA 1FNSA 4MMYB 2VDQB 3BN3A 3BQMB 3F78A 1Q0PA 3GXBA 3PPXA 1MHPA 4G1EA 4IHKA 4Z7OB 4JX0A 1BHO1 1TYEB 1ZOOA 2VDLB 3ZQKA 4PN7A 1M2OA 1M2VB 4CN9A 2WW8A 1SHUX 1DGQA 5E6UB 4O3TB 1ZOPA 3EH1A 1MJNA 3V4PB 3OKYB 3NIDB 4O02B 4Z7NB 3K71B 1M2VA 2NUPB 1M1XA 4MMXB 1IDOA 4O02A 3EG9B 4A0QA 3K71A 4MMZA 4F1KA 2NUPA 4C2AA 2P28A 3QA3E 4MMXA 2X5NA 1BHQ1 2ICAA 1SQ0A 3EG9A 3F74A 3ZDYB 5BV8A 4WK4B 4WK2B 3M6FA 3ZE0B 3PPWA 4G1MB 1SHYB 3K72A 4UM9B 3EOBI 5HJ2A 5KYWB 1PD1A 3Q3GE 2M32A 3OKWA 1M10A 4G1MA 2UZYB 3HXOA 4IXDA 1JEYB 5KYWA 3N2NA 2NUTA 4FWWA 5ES4B 4GZ8A 4WK0B 3TXAA 1PCXA 1JEYA 4DMUB 3NIFB 1M1XB 1AO3A 1PT6A 4HQFA 3TVYA 4MMZB 3EH2A 3VI3B 1U0OC 2XWJI 5KYUB 1MQ8B 3EFOB 2WINI 3HXQA 1CK4A 5LN1A 4O3UB 5KYUA 3ZDZB 1RD4A 2NVOA 3EFOA 1IJBA 2VDMB 3K72B 2ODPA 2XGGA 3TCXB 4F1JA 3NIGB 3E2MA 3FCSB 3EGXB 5KYXB 3AFCA 2VDPB 1YVPA 2I6QA 3T3PB 1N3YA 1PD0A 4NEHB 2VDRB 1AUQA 1UEXC 3RAGA 1RS0A 1XDGA 1XUOA 3FCSA 1YUKA 3EGXA 1CQPA 5KYXA 4HQKA 5KYYB 3AL9A 1YVRA 5KYYA 1SSLA 4C29A 2I91A 3IJEA 1QCYA 4IGIA 4XW2A 4JDUA 2IUEA 1IJKA 3PPVA 1FE8A 3TW0A 1RTKA 5KYNA 5HDBB 3IBSA 2VDKB 1RRKA 2O7NA 3V4VB 4HQLA 2QTVA 3OL2A 1ZONA 3K6SB 1V7PC 5E6SB 1JV2B 4Z7QB 1OAKA 4UM9D 2P26A 3K6SA 4HQNA 2VDNB 1T0PA 1JV2A 1IDN1 4M76B 5E6SA 1AOXA 4MMYA
chains in the Genus database with same CATH superfamily
3MCTA 4KKPA 1CY4A 2WZPD 4DKEL 1NRIA 3ZE9A 2QM3A 3GBLA 3BZFB 4QM7A 5EUMA 4WHTB 2JANA 1WW2A 4Q0XH 5JCZA 4ZZFA 2J7KA 2PL3A 3SWWA 3BO8A 3V5HB 1Z0AA 1F38A 2J0SA 4RAUA 2I9KA 2JGDB 3T1HB 1Q92A 2OHVA 2V03A 4HEA1 5IC4A 1EBPA 7MDHA 2WI8A 4ZTPL 2FL5B 2C5DC 3LVQE 2CFIA 1KELH 4EBQH 4IW4C 2AZAA 2O5VA 4LCIH 1E32A 2JFWA 1LP9E 5GS3A 3KLSA 4RE6A 4TYWA 4ZAYA 5DF1A 5CBAA 1EZ4A 3CXHJ 4ZPXA 5D01A 1TQCB 2R2EB 1Z36A 4BQEA 4J3NA 2XRZA 3QZWG 3R6TA 2PW1B 1NGQH 2PDAA 3UB2A 4HI0E 3P9NA 1QTIA 1IM3B 5JE8A 2KZ1B 4XDGA 4TTDC 4Z9YA 1RIUL 3W0WD 3FPAA 3SGJA 3TRFA 1L5OA 1OGAB 4I0CC 3P9KA 1OWWA 2IYZA 4O2EA 4EPVA 3ALWA 4HVLA 5IUKC 5AAMC 2QG9A 3X2SA 4OM1L 1UWFA 3U4HA 1EIZA 3HJFA 1FW8A 4X8LA 4TLEA 2R1TB 2ATEA 1EO8L 1C30B 3EN0A 1OAXL 4YY3B 2WNKA 2C9ZA 5FUOH 4CMCA 5C9JB 3I23A 2QDKA 1Y18A 3RHSA 1LZLA 2QMHA 4QFCA 1IGTB 5DO8A 3OPYA 2WJ3A 3FYUC 2DBVO 2PUFA 5C5IA 4APQB 3VVWA 4XMKL 2F1OA 3FN0H 4ZW5A 3BL6A 5BSTA 1P1BA 4KGZA 3LEXA 4FE7A 3JWNC 4W9EC 5CDTA 2C3XA 1QNIA 43C9A 4PQFA 3P7MA 1GKOA 1IBBA 4IGKA 4AYXA 5KIAA 3MROB 2C3PA 4MXWL 3ZPDA 4K9MA 3ZK7A 3DL0A 3TLBA 5HK9A 3C5JA 3FX2A 2C2XA 3ZE6A 3NBUA 1KCUH 4MUMA 5KBLA 4ZFZA 1JZ5A 3MGBA 3BYYA 5DM2A 2I5PO 4KFCA 2MNJB 1RK0A 2EZ9A 2Q6LA 1HILB 4P5SA 4H0CA 2Z8WC 1K3ZA 2B0SH 4OH7A 4X6CE 1M0EA 4KE7A 1FZJA 2RH9B 4PJEF 4E21A 1TOXA 3N0XA 2EZ0C 5BV7A 3V7AE 5AFAA 2MPVA 3MSPA 5AJUA 4PV1C 5SWZE 5CZXD 1VE9A 4AKIA 1FFOB 2Z35B 3S5JA 2L7EA 4P34A 4DIUA 2ARJQ 4Y9UA 1GKUB 4MZRA 2XIDA 3BEWB 4PBRA 4MA7H 3H5NA 5CLGA 5D1ZI 4S1RL 4WFHD 4TS9A 4Y2UA 2CNKA 5F7DA 2WJ6A 2F5BH 4OQTA 3OM1A 5JI2E 5JHMA 1QBAA 2BFMA 4BKLB 4GSKA 4RU1A 1PS9A 4R7VA 1SOUA 5LCVA 1LE9A 4IQGA 2OKMA 2DV6A 1UR5A 5I1LB 1U7PA 2QV0A 3TB4A 1SJHB 1IU1A 3EZGA 4J1NA 1R5JA 4CJ0A 3RBSA 1KJJA 2Y3NA 2CDGB 1H94A 2IVZA 3A05A 5CBPA 3NSFA 2FQWA 4AMWA 2GSDA 1WBXA 1EWVA 1Y1TA 3KTOA 2BMWA 4Y9DA 1PV4A 2Q0SA 5FO2A 1J18A 4EKIA 1PW5A 3RSZA 4TVOA 1WBZB 3VR4D 2WT4A 1AUPA 1S02A 2JAQA 2XPCA 2G1PA 4PAOA 5J1AA 3SCMC 4V0ME 4R5VA 3UABA 1TAHA 1A3ZA 3SDXE 1KTRL 1WIOA 3OBAA 4ROTA 1X1CA 3MGKA 3WN5C 3MR9B 4DIBA 2BP7B 2XN9D 5TJHA 5CILL 2D54A 4BVHA 3S37H 3SDDC 4P4UA 3DKVA 1MFAL 4LPSA 2JKYA 2FR4A 5FGCB 4OHBA 4R0MA 4S1NA 1E6WA 2ZWPA 3GDCA 3FCSB 2WF7A 3WSWA 2PT7A 3ADKA 2PL9A 3W2EA 1L7IH 5D1XC 2EIHA 5BWLA 2AMJA 3EODA 1R10A 5EA0L 3TOSA 1JHAA 1EM8B 4OFYD 3DOEA 4ZT2A 3L7IA 3FYDA 4NCNA 5EU5A 4GXNA 1JL8A 2AJVH 5FEBA 2HJGA 3QEHB 3HU2A 4X3CA 3F8SA 4F2MA 4WBNB 2DL9A 1NDGB 2VAJA 4H08A 2Q3LA 5KSZA 2W07A 2Q3XA 1NA5A 4ZMPA 4ENPA 3LH2H 3QO0B 4LTNA 1UKSA 3OJMB 4UIKL 1CFSA 1SEVA 2JI6A 4MPJA 2B4RO 3NGXA 4DYHA 2ZIUB 2OAGA 4G5XA 2ICEB 2RMNA 1ES0A 2IOYA 3O95A 3IELA 5JAPA 3UA4A 3OHPA 3S2EA 5E4IA 4BHUI 1V26A 3K9GA 1ONPA 2XG5A 4X62B 1SHMA 4JC4A 4FF9A 4AL8C 3MREA 4Z3EA 5FV1L 5J63A 3WLOA 4GQRA 2Q3JA 5H0IA 3TOPA 1WCQA 4JY6B 1ML4A 1N77A 4RTNA 1FNGA 4KTDL 2RGAA 5M29A 3DRQA 1BWPA 2FVXA 4IQ4A 4WDIA 5KYUA 3OX3A 4DQOH 2R79A 2G9VA 5FYKL 4P04A 4LDQA 5KOJA 3TT3L 1TETL 4Z76B 4FADA 3EXFB 4XH2B 2XV3A 3EBIA 2QMZA 2Q7AA 1B4DA 3MS7A 3P0EA 3B6SA 3DL2A 1L0BA 1A2BA 4BAGA 3U4EA 4ALLA 4QOKB 4HQ6A 1XGUA 1H2XA 3IETA 5BV1A 5HDLA 1ZY2A 4BCBA 3VR6D 3H0TA 1GTMA 4IRMA 5EHQA 4JEUA 2YQBA 3TEXA 4X8JB 1NBMD 3MOBH 1DG3A 1C3VA 5DJCB 4H8WL 5E4EB 1BW9A 3V4VH 2X05A 2IEGA 4HAFA 1W4RA 1VFUA 3O3EA 3IBOA 4K5QA 3VHXA 3WGUB 2ZUVA 2I9TB 1UKBA 4ZYUA 4HFWA 4HWBA 2FW8A 1S7SB 1EDQA 4Q1EA 3SPIA 4WTZG 3R8FA 4U3JA 2H4HA 2YASA 1KEEA 4A9AA 3SKJL 2MHAA 4BO7A 1U2ZA 2HQ1A 2R6HA 4FC3E 1JV5B 3OEED 2BZCA 1BMWA 4GHWA 1FNFA 1UQTA 4PZCA 2KYIA 2ZJ3A 3U2IA 3BICA 4GZ3A 3G5VB 5AVTA 7REQA 4CDNA 2Z4RA 3IUSA 5LLDA 5HDRA 4WFFE 1W35A 3H18A 4OATA 3ERXA 1UVQA 2Q7OE 1Y3DE 5EF0A 1CJKC 3DV6B 2E5EA 3CE1A 3UGKA 1QLEB 3O3NB 2PT6A 4OJFH 4L18A 4D46A 5CJ2A 5MFPA 1BWMA 5JHBA 3V8BA 3KSAC 4R4BB 1IC1A 5C07D 3AI1A 4LB8A 1BECA 3ZGVA 2R6JA 1KY4A 4OM0H 2DJSA 4JQXC 1FYHB 4HUKB 1QZUA 2VAMA 2IDJA 5T3UA 1JVKA 2YHGA 1SOVA 5FO8A 1QSFD 3QXDB 3C2QA 3KC2A 4HWPA 4Q9IA 5GZ1A 4NFSA 2O7NA 2CE6A 5GM1A 3P69A 4H0FA 4OAWB 4ZFGL 2NUAB 1JYEA 1FVCA 3N6XA 1G59A 3ZDRA 3NXKA 4NPAA 2J9FB 3R6WA 4FHFA 1II4E 1UZMA 3ZYJA 1XSOA 3PA8A 4PRKA 4LGRB 1YBVA 1ZJJA 2VP5A 1NRXA 3WL5A 4HAWA 5IKXA 2J7LA 1XJ5A 3S2UA 3EOTL 3JWPA 2Y07L 5LL6P 1XZIA 3LHPH 2Q7YA 1OGAD 1DXYA 4K6CA 3V9EA 2H3HA 3TYGH 5EZLA 2EKSB 3IL2A 2E7BA 4WPGA 4YV0A 5BS0B 1BVLB 4ETNA 5CKAA 2ZR9A 4EG0A 4G59C 2WJGA 4QRAA 4URWR 4YT5A 1Y48E 4A4DA 4DG5A 3UERA 1O6BA 4LVNB 3WIIH 2YAMA 4D9QD 2JJ2A 3BKXA 3VDNB 1UJ5A 3DVQX 1L3WA 1XLTC 1GG2A 4X5XB 4P4TA 3GBNH 3KOMA 1AQ8A 1MFEL 3RLSA 5FW6A 4XCCH 2P3SA 2XRAL 1L5KA 3FHJA 3U3JA 3QQ3B 1U2GA 3HDVA 5BUQA 3RFUA 1FF5A 3HC7A 3LXAA 4Q4IA 3ZWMA 4OBEA 4X9XA 5LQCA 5EVJA 1SBNE 1PJAA 2FETA 3V6OE 5F93C 4V1CI 1F2UA 1E1RA 2CJWB 1RZKL 1GZ7A 5JANA 1Y0LB 4QECA 3ZDFA 3QXCA 1I85C 4URXR 3WRXC 3FYIB 2J5KA 1IV8A 2DWOA 3GJYA 4XE5B 5SV4A 3C48A 2BH0A 1VGQA 3HJBA 1AHMA 4YAGA 2XMCA 3F96A 3H19A 3HZMA 4KXYA 3NA4A 3CH7A 5HPMB 4LCYB 4FQQB 1SBZA 3AU9A 5C9ZA 3Q6FB 2ODEA 3K0FB 4F9LC 5LG1A 2FR0A 4NXNB 2X8BA 2B61A 5JYCA 1CFJA 1YB6A 4EW6A 1G84A 5CA1B 2EXTA 3WIHA 3VFSA 5HGHA 1RHRA 1APBA 1HSOA 5FYLL 4TQUS 3H5WA 4J07A 3HCVB 3KYKH 4LZZA 1M71B 2PZBA 3B56A 5FI1B 1WUTA 1HDRA 2EUWA 3U80A 3U4BH 3O91A 4ZMNA 3LHSA 2VJMB 3GIWA 3WAKA 3L9XA 1PZDA 5AM0A 2VTEA 4MQ7A 4DIEA 2BERA 2YN5A 5FLYA 3PKIA 2CNZA 4QTIH 2HT6A 5ILTL 3X1NA 3QIVA 1DQKA 1NPYA 1HE3A 4I36A 4TNWK 3BMVA 2E27L 4PUBH 3DSRA 3IFNL 4ZUUB 2GD0A 4AROA 5CZXC 4Y19D 3AROA 4WW2F 2VZ9A 4OQXA 1R4MB 2X4OA 3I9LA 1I7QB 3PP3K 4X90A 2YS4A 2O93L 1M6OA 3LNHA 4TQAA 5EIFA 2ATAA 1XTTA 3GNLA 2UZ1A 1X5ZA 3JZFA 4JZNB 5TE7H 4R9UC 2KH2B 4L3CB 3L93A 1IY8A 5CK4A 3TXYA 2BSRB 5GGUB 5JHLL 3SFZA 4TX1A 2C0QA 3HO6A 2QPUA 3LN9A 3N2JA 1DE4A 4JFHD 1VA5A 1VPEA 1BH2A 2CXSA 3BQMB 2XN2A 3TS1A 5KQGA 5JSUA 1YJXA 3RHFA 3CXUA 1K66A 4OHUA 1CNEA 2XX1A 3U0TA 1QO0A 3GA5A 1DXOA 3NYRA 3UYPB 3N9GH 5EMYA 3N2KB 1QW8A 1OQAA 3U37A 3SSNA 1SBTA 3W8DA 1A7RH 3MA7A 1OAZL 1M5TA 4JJKA 2B4CC 2R8XA 1WC7B 5J2TF 3HU3A 2BH9A 3TXAA 4UNPA 1JBKA 1UM9A 3ZX1A 1YB7A 1XVTA 3V95A 3HYSA 3G6JA 4FFWD 2GARA 1ET5A 5KVVA 1NF2A 4IJ3B 2NZUG 4MDIB 4PRAB 5FADA 4EKXA 3O47A 5F7NC 1H65A 4QVIA 2A6IA 2P79A 1UDRA 4ZYXA 1O6SA 4XP9L 2K87A 4GVLA 1Y4DE 3VYTB 2BKUA 4MXDA 4PGCB 4PG9A 1N2ZA 5E1QA 1EK0A 5AW1B 1XLWA 3G2OA 2W9XA 1VKXA 4FFBA 3WNIA 4X5RA 3ILSA 1LHZA 1UMKA 1M6NA 3MUHL 4XYLA 1J7KA 1XEUA 4PW0A 5ULLA 1LO5B 3HPLB 4D9RD 2PN1A 4EJ0A 1T4MA 4TL7A 4J3XA 3TW6A 5I4KA 5IJ9B 5IMBA 4WFQA 3TMAA 4YLBA 4D8VA 1ZTXE 1A6UH 2RJ3A 1AXRA 1EZVY 3OQ6A 4QBGB 4GQ9L 1KVSA 5L9AA 1OXYA 4NVRA 1BEEA 2GN9A 5EOQL 5B3NA 4GMTL 1JQDA 3RSHA 3BGFB 4X4ME 1GQFA 2XQKA 2G5PA 3PCTA 1FNSA 2COKA 1LO4H 4AJYV 2C8NA 4CUKA 3A4FA 3CHYA 3V7NA 3L4VA 1FYFA 1DGQA 5T1DH 1CFQA 1LBIA 1UK8A 2NAFA 5CWSB 3H97A 2JBAB 2Y1WA 1ISPA 1EXGA 4Q4HB 4JVWA 1NFQA 2VAPA 4RKQA 3FJTA 4DZBB 4HJGA 2SCUA 3AVQA 2OV0A 4QOKD 1KP3A 3CT4A 1K5HA 4WU7B 1LKZA 3DX0A 4NNYB 2EXSA 1EUDA 4FZEH 4TMYA 5I9SA 4FIDA 1UOKA 1KMNA 4QDXA 1CQXA 4OR1A 1A9ZA 2AN4A 3F3MA 3I8SA 5EBGA 1NP7A 1F2XK 3CRQA 1HYHA 5LCXA 2XVYA 4NHUB 2NY5L 5AOVA 5LQNA 4BGLA 1XPRA 1L6RA 2O4EA 3F6LA 1PJ3A 4HJJH 3GQFA 2LABA 4QASA 5ICCA 1NJFA 2JRLA 3EGWA 4ENTA 2O6CA 4UUJB 3QFJE 3DDCA 3HXTA 4OFVA 2XD9A 3HJTA 4MAAA 1FGNH 1XQ1A 1E1LA 3OIWA 1N3NA 4OK6A 2LXNA 4YGXB 4KUZH 4DAGH 4IRZL 2XHNA 3UHFA 5B6IA 4YALA 4J6EA 3KLHC 1TYCA 4TSRA 4EY3A 3DCNA 3FRUB 5GRUL 3M46A 3QPBA 1Q0TA 2DWXA 5E9DB 1GZUA 7ABPA 2YNMD 3E7WA 3QUXB 4IHOB 1ZO8A 1DPGA 5ALWA 4CTKA 2YZ1A 1CWUA 5KSAB 2Q1WA 1CHDA 2ZGVA 4YDRA 4KK6D 5DJDA 4G1EB 1A4CA 2YC2C 3S3TA 3VBCA 3UW3A 4YK4B 3ICCA 4WW1A 5H37G 4AVJA 2W2MA 4CEHB 3GO1L 4U7HA 1FC2D 4NB7A 2PN5A 2CF6A 2R1YA 4GMKA 5J9FA 1Z32X 3PNYA 3QZWA 1KLGA 5EDXA 2HFGH 5IQ7H 1X0VA 3FU3A 2B6NA 2FBRA 4GDMA 2R7AA 4ZJUA 3ARFC 2OMZB 3QFCA 4OMDA 1AE6L 1T24A 1T8PA 4E31A 3WIVA 3OHSX 3UAOA 4ZJ9A 2EDOA 3D4IA 4RQAA 1TK3A 3GSRA 1Y0BA 5D3ZA 2C2OA 4JZJB 2VG8A 2ZIZA 4OH1A 2ENPA 5F5LA 5B22A 3MU3A 2VDPB 1UJ4A 1IKFH 4Q3CA 2EX0A 1CQPA 2CK3A 2VDMH 1NAMB 4ZQGA 4XYEA 1KWKA 1JFTA 3SQMA 4YLEA 1ODUA 5T64A 4ZEWA 5I9TA 3VGDA 3HJNA 2YQ2A 2CYBA 2X19A 2YDXA 5LQRA 3G82C 5CD1A 2D1QA 4RF5A 2GCNA 3PL5A 4IZ6A 2AV1B 2YSSB 3S96B 4OHKA 3G8DA 4I3HA 5DS2A 1SLVA 2J9ZB 1JA1A 1HAUA 2OPBA 2RA1A 2CW5A 2LCIA 2XYPA 5A9SB 3GZTB 4CTMA 4DLNA 1FTGA 4KQCA 3U26A 4R26H 3UJTL 3P4OA 4L1LA 3QO1A 4XDZA 3LF1A 1RZQA 2YGPA 1LQ2A 4YDVA 5JSQA 2CJUH 4CA4A 3HABA 5DUPL 1RE1A 3GEMA 5FUVA 1TQCC 1YEJH 3X11B 4E2FA 1OZUA 3N0PB 3K31A 4TV9A 4WQOA 1AI1H 3VD7A 2WWRA 2OSXA 3AEQB 5BV8A 2BOCB 4X7CC 3LBAA 4BBZA 4N9GA 5IMKA 4BMZA 2R8SL 1OC4A 3UTDA 5IAJA 1KGDA 3ZN2A 2DULA 4DRZA 1TUBB 4R3SA 5C1PA 4KZCA 2RGWA 2WWOA 3AEZA 1P9OA 3FL7A 3AF4A 3PR3A 4IMLA 4PWZA 2I67A 1DN2A 2P48B 4YDNA 3FPFA 4E2ZA 3RX5A 3PQYB 3VB9A 5E6IB 1Z62A 4KXQA 1GY2A 1DQIA 1LP9F 2FN9A 1F4HA 2XDWA 2YFNA 2R4RL 2G8NA 1AD0A 1XR9A 3CIAA 4Q03A 3VFDA 3A1SA 1WBJB 3UBFA 2AHIA 1F5NA 4JJ5A 1D6EA 4PLKD 3FFDA 5DV9A 4L9SA 4Z53A 2AJ3B 4FA7B 1AMUA 2NSQA 1Z2DA 3D33A 4JDZA 3P0VH 3V8CA 5HFJA 1Q1JL 5BXQC 1VGVA 2OQIA 2NVUA 4PS4L 1Q1EA 3JALA 1EHAA 1G5QA 2BE9A 1SMAA 2ZRPA 3DX6A 4ER5A 3V52H 4LZJA 4GBXB 3VR0A 2IYTA 5I19L 1DANU 4LRTB 1CR9H 2O4UX 3WE7A 1JLLA 1YPZF 4OD3L 2HQBA 2MWMA 4MMXB 1H2WA 3ZDXE 4I55A 4I48A 2VJCA 5KJEA 4NQUA 4N5DA 4YXHH 3MFFA 2VS1A 2CLLB 2IANE 5I1GL 3QDGA 2HTKC 3RUIA 5AOCA 1FA4A 2RHCA 3L2MA 3GD7A 4WQMA 4ZI7A 4KPHL 2PH3A 3OBBA 4IHJF 3I4LA 2Y1YA 1H8HA 4X80H 3I09A 5DGXA 4A66A 4H16A 4ETYA 2YICA 1TVKA 1ONOA 5DYYA 5D1QE 1DINA 4IXWA 2CV1A 1FVXA 3C08L 2VA8A 2HPTA 2F54E 1QE3A 3KUKA 1LK2A 1DAFA 4FJ1A 2L82A 5HIKA 4WKGA 3HBLA 4U4AA 4ND1A 4X6CF 2NZJA 2FSUA 1RUAL 4E9VA 1GAXA 1WS8A 3N42F 3ILQC 5K8JB 3RFZB 1OLXB 3R9IA 3S1AA 1SHSA 4FP8H 1UD6A 3VZRA 4K73A 1Z6ZA 2IPUG 1L8LA 1XNQB 1ZL0A 4QFDA 4Q9AA 5LZ4A 3MLWL 5M7EA 1V3QE 4E9YA 3VWJD 4IVNA 1NV9A 4NAVA 3AUVA 4ESEA 3FOAA 1KN4H 3RVKA 3V2UA 2HAZA 1QSEB 2V6GA 1U2TA 5DHDA 2Y1OA 3LHFA 1H19A 4NC9A 1YVLA 5DYWA 3ZYCA 1TMKA 2EERA 4QU9A 1UP6A 2VEDA 1XCXA 1ISSA 1LTXA 1Z2KA 1GCUA 5ELMA 1XZFA 4YS6A 3ETBF 4CU6A 3GKWH 3GELA 3G2QA 4MDRA 2JCCB 1BYOA 1CF8H 2YVUA 5CA0B 5ARCA 3HG7A 3UDWC 3JXEA 1C1EL 2OMUA 1M4KA 1F6BA 1OTTD 3RIFF 1S7WB 2NYVA 2HNKA 3H3BC 3EHBB 3KZKA 3S6CA 2ZR7A 3QEMB 5IK2A 4OLFA 1KIQB 5BO0D 5CDUA 2AOUA 3E2IA 4GZLA 2CBMA 1OA0A 4W9DC 4FFWC 3LC0A 4DLXA 3SDXF 3D3NA 5C8VA 1B00A 1PKXA 4Y6PA 4P4KB 1ZD1A 1A3QA 3H17A 1RCYA 3GJEB 1Z63A 2ETVA 1J9TA 4WI1A 1MHHB 3L49A 3FB4A 3KR1A 4WTZA 4FYXA 1P9MA 2FJGA 1DRVA 1GGNA 4MW6A 3TQHA 5C6TH 3B6MA 3EYAA 3QITA 4DCMA 2POQX 3IQDB 1GPDG 1AZVA 5MERA 4MR9B 2GUGA 4OLWH 1DYZA 3KYDB 4LXYA 4C01A 2ICEC 1XU9A 4N25A 1XPOA 5JPMA 3KPMA 3ECBA 5GSRA 2WXQA 3OZEA 2DE0X 3DE4X 4U1KB 4E07A 2RBEA 4HVBA 3KBFA 3QWBA 3L0PA 3FMGH 3TLGA 5DTFA 1I3GL 1YQXA 2B1OA 5CFAA 5IFAL 2AFHA 3CC5B 1PJSA 5MENB 5KTNA 1ZM7A 3DYVA 3K9NA 4H1HA 3E6FB 3ECVA 5IQOA 1UBSB 3N2ZB 4Y6QA 3RL2B 4MNQA 3QUML 4YCNA 4BIIA 3DPIA 5JMTA 1MZPA 1ADBA 5ALCL 3OGOE 4QPZA 1VZ2A 1DAMA 1ACMA 1EHCA 3UHJA 5E9DD 2JTYA 2P8LB 4Q6YA 4JR0A 3RC9A 5A7GA 4L0YA 2Z4QA 2ZUBA 1VG1A 1PDVA 3OZCA 3ILYA 2IE8A 5LN1A 3GYBA 1RJEA 1W4AA 3B4NA 4Q0XL 3FB1A 5F3RA 5KSAD 3RLIA 4JG9A 4M61A 1THCA 3ZSSA 5FBVB 1RABA 2VXUH 1WP9A 5E4EC 4ZOQI 3EGCA 1K27A 1KIMA 2WFMA 1UD5A 1X7DA 3B20A 4OQZA 5JW5B 4PINA 4JYAB 4BFIB 1DIBA 4GI8A 3F49S 1KELL 3KZ1E 5HRAA 4EBQL 1F00I 1B0PA 4MA3A 5AB9A 1ZA2A 5ITBH 4R1NA 4O8CA 4AK1A 4W9FC 1A4BA 3OMLA 4G2TA 4YP1A 1NKVA 4K3DH 4NC1E 4YJGA 1Q0XH 3D6AA 3IIMA 3KW8A 2BIFA 4LIPD 4BH7B 3SKMB 3PXGA 2ZUEA 1NGQL 5A02A 5F88B 2HJ9A 4BQOA 3A3OA 4UVHA 1OGYA 1W85A 3NFYA 4NJEA 1O94D 4FN5A 3IM1A 4XVUD 4XBMA 2XUFA 3J8F7 4C3VA 5D8JH 2WCPA 2YMMA 1PX3A 3ZI0A 1E2JA 4R0LA 2E3VA 3S35H 2R1VB 4YZWA 2FYYB 1BVZA 4XWOA 1VKJA 1J8MF 5CNHA 4RNRB 4PSUA 4GO6B 3VR5H 1W76A 5FUOL 2NTFA 1HFKA 4PO8A 1F3JB 1DWOA 4JVMA 3RX7A 2IV8A 3ILEA 4G42B 4HGWA 5BN5A 1L8QA 1P0CA 5E99L 5I6MA 3PDHA 3M7FB 2DQDH 3D6JA 3O8QB 5CNMA 2IDUA 3V9AA 4XXWA 1Y5IA 3MNVB 2PPCA 2ZPUA 1JI1A 1U2HA 1MW9X 5FORA 1QRSA 5LHDA 1S89A 1KQGA 2CLDX 4NV3A 2ZWIA 2G25A 3SDAB 1BX2B 3H5LA 5AVRA 4UREA 2YWDA 4B9AA 2GJ6E 5B1BB 2W6JA 2ZRMA 4MDJB 3AJ8A 1P9RA 2JKZA 4RAVA 1C9YA 2GLTA 5AB0A 1BVYF 2W2QA 5ALYA 2W8BA 1ONBA 1PKOA 1WBBA 4KTEL 2V58A 1SBIA 2O19A 5DC9B 3RWFB 1QR6A 1WCYA 4M3KB 3PUCA 2B1GA 2B0SL 4Z3GA 3S3PA 1TJ3A 1OVZA 2Q87A 3MBKA 3QKIA 2PKYX 3HA5A 4NKIH 1FSZA 4U7MA 4UFOA 2OHHA 3GZPA 3HZKB 2QMKA 1IIRA 3L3HA 4AJWA 1IX2A 4H7JA 1ULHA 3EOAI 3SHTA 3K9LA 1GRWA 4F7DA 1DIGA 4UKDA 3BJIC 2CXGA 1LE5A 3P77B 3C1OA 4WLFA 1AGEB 3FLEA 1QF7A 3PQYD 1PYWA 1E5VA 4MA7L 1P29A 3IP1A 4JZKA 4YHKH 4MSWA 5E6ID 2VYVA 2PYFA 3NYIA 4CKBA 1XWVA 3JTTB 2OX5A 2IH8A 3X0DA 2A6DA 2TECE 4XB6B 2C1PA 4DV7B 4F7MB 3RO7A 4I0PA 1W72H 4RK5A 2C7FA 3SHOA 1ETUA 3HRPA 1U8LA 4WCYL 1NYTA 3QBEA 1HE2A 3DZBA 4HO1X 2J1WA 3VZQA 5GS0C 3L43A 4L9LB 2PBLA 3IK2A 2V4UA 1AR2A 2VLMD 1AXTH 2EYTB 4O2FB 1SJXA 3OC8A 4CKXA 2WINA 2LPMA 4HYYA 1QO9A 3T7AA 4EF6A 2XOKA 4GBXD 2FEEI 4RXTA 3HS0A 2OR7A 2G67A 3CX5K 2EDEA 3LKBA 4QSHA 2D7CA 2JEOA 5JEEA 2BFCA 1VGKB 4UYQA 1BS1A 1QHGA 4RZSA 4WWNA 3E3NA 4FHDA 4ZW6A 3HZVB 3RYFB 2HXYA 1HWWA 4BZ2L 1OTSC 2B7CA 4LE1A 2HJLA 1U4EA 2H6OA 1YHYA 1ZC4A 4ODWB 1XTIA 4GP9A 5HWSA 1ZNXA 2I6SA 4LOEA 2QG4A 4UUQA 5K0JA 2FATL 3KPVA 4U1IA 4PLKC 4Z3FA 1FJ1B 3STTA 1OAYH 4IBLT 2KI6A 4Q6IB 2AS0A 4AKSA 5FUQA 1MWOA 5ECYA 1XHHA 3PFHA 4TOIA 1RUPH 4CN9A 3Q5YA 2J5RA 1L7IL 2A73B 4KDWA 3BCFA 5BNTA 3P2KA 2FX8H 4WZBA 2R96A 3VFPB 1UF9A 1YN7B 3QX7A 1OGSA 5K05A 4V0QA 4BO3A 2G4EA 1SKBA 3KQNA 4U7JA 1T4CA 4K9JA 3R4DA 2JHPA 2I34A 1A1MA 4EGQA 3SS8A 4HX5A 1O97D 1P2GA 2FZCA 4QJ3B 4BNVA 2EJUA 3P9IA 5I7EA 2AJVL 1L1EA 3F97A 3SY0B 2DHEA 1I0ZA 4G0VA 4PGEA 5CLWA 4C56A 2CO4A 1WCBB 3GCZA 4Y8VA 4KODA 4OXIA 1ZM3A 3LH2L 1TD9A 4P4LA 4NO0D 3HEAA 1GSHA 4NC0B 3T2PA 4QTYA 3LX5A 4OD1H 3P3RA 3D39D 4FOMA 2I2WA 4GI3A 2ZROA 4AZ3B 2YD9A 4WNIA 4EG3A 3SPVA 1EEZA 1SIOA 2ZG6A 4R7TA 4YSCA 3CX8A 1ZLVH 3NHKA 1WSST 1CTNA 3ATFA 3TAHA 3L7FB 5H81A 1X14A 5IBPA 4IEIA 2A58A 2OCAA 1RYMA 5CR9A 2W2TA 5IK3A 2NUBA 2H4XA 2GSGA 1S9WB 2O1SA 3TO4D 5KREA 1QOKA 1X39A 2B4TO 2Y1LA 2G5CA 3B7WA 1E9EA 2UWEA 1PZ5B 4NE2A 3JRNA 4WJ5B 3EHBD 2FLMA 2IZOA 1V3LA 3T1OA 3L6BA 2AEMA 3OPYI 4AKEA 4AGQA 4BUCA 4ED9A 1Y6NR 4FLMA 4LVHC 2QPLA 2W4QA 4N8VA 1P6AB 4I85A 4HDSA 3O2SB 5F7WC 3EXEA 2OGTA 1UZLA 4HN4B 1TEYA 2BFVH 3BE5A 4TV8B 4H88H 3T3IA 3MWDA 4YAUA 4NNPH 3D34A 4YMSA 3H6KA 4EOWH 4YMPA 4FVTA 1CZHA 4J7XA 1UJMA 2K1MA 4DLUA 1NAHA 3PRHA 3MOBL 2P46B 4RXUA 3P73A 4EZMA 1RJWA 4P0QB 2B4YA 2YJZA 1ZCRA 1AZRA 2CXHA 4AQ1B 4GW3A 5JHLA 2ZNXA 1UDBA 1S1CA 3RNOA 1Z9PA 3T5PA 1OTTC 5C0DA 4KNQA 3BCUA 3ZNOA 1AUQA 3IIIA 4EFMA 4HGYA 4QDKA 7PCYA 1C0KA 4KKAD 2AN9A 1PF7E 2F17A 4FXKB 3BRDA 3BGFC 1F3LA 1N3IA 2GAZB 1QX3A 1ED3A 3KYNA 1MLCA 3C09B 1ICIA 5JPDA 3K1AA 1RU3A 4FNAA 1RQ2A 3LY9A 3SE4A 5EXXA 4NQQA 4U33A 3EYQC 1GRNA 2FX7L 3TRHA 3COSA 5F7XA 1T3FA 3GLFA 1GG5A 5DQJB 1DUIA 1MC5A 1Z2OX 2MSNA 1PBTA 5IROD 3VPDA 4YDJB 4EGCB 1FX0A 4ETQB 2JB9A 3CM0A 3BZEB 2ONCA 4YBLB 4OM0L 1P7QB 1Z3RA 1Z56C 1FZQA 5EXSA 3UMMA 5LP1A 4MHHG 4E94A 1KP2A 4DTCA 2QS9A 1EHKB 2CPCA 4UNTA 1TZHB 1WUHS 4RDQG 2VR6A 3DFUA 5CCHE 2BR3A 3UK1A 2YA1A 4MPRA 2VW4A 1GLVA 2VR7A 3FNGA 1HSBB 3ACCA 2V9QA 3PVSA 1J8SA 1TQ4A 2UUOA 1FFNA 2JK5A 4ZT6A 2XZLA 4ITVA 4URVR 4N7RA 4RY0A 2IH4A 4KDVA 3TOVA 3ZVLA 2WF8A 2VH5R 1V1RA 1SO8A 2ZJ8A 5C4IA 1FSFA 1W93A 3ETCA 1NR1A 5IVPA 3DUSA 3F85A 3CFDB 1R5WB 1QO7A 1KR5A 4RLQA 3QUXC 1DIAA 1MFPA 1XO1A 1WIWA 4GMXA 1CB7A 3LHPL 1N2RA 1TVBB 4PC3A 4LY9A 5EEWA 4CMIA 3TYGL 3O03A 4X60A 5KSAC 2VRAA 3EEIA 2Q3AA 3JQGB 4WLNA 2E1RA 1G5IA 5D6NA 3W1EA 1I30A 1A76A 2BJHA 1Q0YH 3W2IA 4L5FL 3F62A 3EZFA 4BV9A 3WIIL 5I1HL 1C9NA 4GM4A 4C2TA 2QSCH 4P57A 1R4AA 4IGBD 5CT8A 3W06A 1JHVA 4QTFA 2WHQA 3VYUB 2ZNWA 4F8PA 2Y06H 1RXLA 3GBNL 1OI4A 1HI6A 3DXAA 5ANHA 2FIRT 4CNIB 3E7PA 1P75A 1OB2A 3EJUA 1LV8A 4HUUA 3UN1A 1OD9A 4ZMTA 1J1ZA 5DSXA 3KUXA 4XCCL 3NCXA 3UG7A 1RRCA 3V6ZB 3OZDA 2V7TA 4JITA 4JZJC 1FPQA 2OJZH 5C0AB 1TO5A 1SOXA 5KJ7E 5ALMA 1ZLWH 1OYOA 3PP8A 5IVXA 1MO4A 3L45A 5AVYA 3COOA 3AY7A 4K3HA 4XVUC 3TF7C 5LGYA 3URKA 3TBTB 4OTZA 4B43A 4JLOA 1XFDA 1JEYB 1JZEA 4DERA 2MIZA 2AJZA 4ERSL 1AKEA 2PMWB 4JFSA 3FTYA 4RZCA 3F6CA 3UGJA 2OHIA 3MRIB 3K4AA 2YCLA 1GCIA 4I4CA 1Z13A 2WPDD 2TRSB 3VMMA 3OOWA 4JPSA 4UQ9A 1NBYB 3IWUA 2EG9A 3QZNA 3R5TA 1M7DB 1IFRA 2XACC 1JN6B 2XUOA 5C8YB 3DJYA 3QEGH 4WL0A 2I65A 3VRIB 4PLZA 2QT1A 3R7WB 3UT6A 5C08B 4UPDA 3K05A 4YRNA 1M9WA 4TLLB 5A0FA 2HLAB 4WO4B 2QD2A 4I14A 1GZDA 4JKMA 1ZUNB 4MQXD 3A06A 4DC1A 2ZTMA 4KXZI 3SBXA 5AOIA 4CM4A 3KYKL 1QIKA 1SK8A 2D3TA 3L8YA 4HIIB 3M6WA 4WNAB 1XU4A 2OW7A 3U4BL 4EXPX 1JB9A 1XVLA 3ESCA 4PY8I 2WV3A 4ZQBA 2REOA 1QNFA 1JXDA 2CN1A 2V3EA 3KPQA 3PHQB 1EI9A 4F7EA 3ARTA 3K8OE 2VCHA 3L1UA 3GGCA 1QTPA 4AIEA 2PZ8A 1HNXB 1YAZA 2FHPA 1JLSA 2FSEB 2VDQB 3E70C 5ER9A 3TGPA 2Y1ZA 3VGGA 1F8TH 1UXMA 3FQ2A 2QGBA 4O02B 1ZD6A 4BLWA 1P4BH 4YX9A 1FCCA 2KUTA 2EYSB 3X1DA 2D9QB 2I66A 5TE7L 1E3TA 3LVFO 3OLIA 2P9EA 5DD6B 4HDNA 4GIOA 3M9XA 4G1MA 1E7YA 5E6IC 5K6AC 4CM3A 4A36A 1U1DA 5D55A 4LCWD 4PRHB 1YB2A 3R8XA 2O2DA 4PCAA 4WO0A 5DTMA 2GKOA 2VZ0A 3VTTA 1PFWA 3G08A 2Y4OA 3Q48A 4V2IA 2C3UA 4KI7A 2P2ZA 5JRDS 3EY9A 4QRSA 2XKNA 2RIRA 3ESAA 1IAMA 4C0XA 5FC9A 2AS5M 1PG7W 4UTBA 1QR1A 5GRJH 1O75A 1GP2A 2XDQB 2R39A 5ANRB 2XBUA 4QHNA 3T0WA 1Y3CE 1G5RA 5L7XL 2PTGA 3N9GL 1Y3HA 4ABTA 3LH8A 3WXWH 5GPBA 3GSQA 4G9DB 4GBXC 5LP6F 3KPYA 5EGNA 2BK8A 3QHTC 3F2LA 2PS0A 4EW2A 3UHAA 1H4SA 2ZBFA 4M76B 1MWAL 1V35A 2X4UB 2YYSA 4KDTC 1GYCA 5FHRA 4MMXC 3ITEA 3D09A 3V2HA 2VLLB 5HHNA 2DYRB 4RHUA 1S7XA 4WOCA 5FOSA 2NCMA 10MHA 4YWHA 2NU6B 4LLUA 3VA2C 2BFEB 1THTA 2K7FA 3OOYA 4DV5B 1KTCA 4ZAKB 1OSZB 5CIPH 4ZOLA 3X1WA 1YECH 5FF6A 2CRYA 1QMPA 1WMFA 2HA4A 1NC4A 4ZSOA 1YI0A 4PHXA 3M8OH 4J16A 3HEIB 5CJXA 5CM9C 3WIOA 1QW9A 1OPXA 2ZKLA 1L0PA 2GYVA 3QBJA 4BTVA 2ZCJA 1K1EA 4YLQT 1H5BA 3TLXA 2QSJA 4ZUVA 1E4EB 1QX4A 5GJWC 1P5FA 5CFNA 3D3WA 3RSLA 3NEEA 2FZ3A 3RRNA 5GGQL 2V6FA 4ICWA 4HNVA 4BUHA 3Q43A 4P8QA 4FOPA 2I24N 4GRMB 7MHTA 4CQMB 4J2HA 4NFLA 4X4YB 4FYTA 1H0DA 3CZEA 1G8JA 4BE6A 1UMCB 2FHSA 1W0VA 3WLJA 3CIFA 1U0OC 1A6UL 1NKTA 1XDWA 5JO0A 3RFZC 2XVLA 3BGMA 1SEPA 1PX0A 3L5KA 1D2EA 2FAUA 1CZ8H 2DCUA 1HEIA 3ZDXF 1O97C 4ZIRB 1LO4L 2FDXA 1Z08A 4UQ3B 2GLUA 3QUZB 3AQDA 5TF4A 4HWZB 2D5LA 2Y67A 4HPOH 5T1DL 3RWJB 4I66A 1M66A 5EC2A 4HH3C 4JJ7A 4K9SA 4CC0A 3HZYB 2JDIA 4GS7B 4LDOB 4AP9A 2PKEA 2IPUK 4M0CA 1NMSA 5LWHA 2EP5A 5TPWH 4PGAA 5A2AA 1WJGA 5GZOD 4CN4A 3V5DB 3WRYC 1IEHA 4ODUB 1Q7GA 4DARA 2FO1A 5DBGA 3GRPA 2XYHA 1SPXA 5D7KE 2F53A 3ONDA 4G7YL 4RESB 1N9ZA 3S34H 4KR3A 4LP8A 2O72A 4AWAA 3E3LA 2FWPA 4HJJL 1VMAA 3I6SA 1YRKA 5ALVA 1E3WB 2GBIA 2O8BA 1NW3A 2XCTB 3QI9D 3UJ9A 5AAPA 1DANT 3AKEA 4C55A 1TVHB 4FA6A 2PKCA 3GEPA 4NWIA 3EHBC 5EU4B 4Z9BA 5BOVA 5F7JA 1V7CA 5IXJA 2GF9A 4KUZL 4DAGL 5CNIA 1GNQA 2TAAA 5A7BA 5LQAA 1P80A 4NXKA 4YQFA 3SSOA 3O92A 4N5HX 2NLJA 1QVOA 3V32A 3EYVB 4YAQA 3KP1A 4BE7B 4KC3B 1YZLA 4P4KC 1GEGA 4CLRA 3AR3A 1LLCA 1XDZA 1QP4A 2W6ID 2X9QA 1X9QA 4MPTA 3ICQB 3FNIA 1J5HA 4L3VA 2AFVA 1UZ8B 5K0NA 1RIIA 5C97A 1LRLA 1NDTA 3A6LA 1S8FA 4BX8A 1TF5A 3PE3A 4RL4A 1YL6A 1JWLA 2Z8ZA 4OBBA 1OCZB 1U8FO 1P7QD 3CA8A 2P3QA 4H17A 3H5VA 1PN3A 4IJUA 4HHGA 2JVIA 1DVFA 5E9NA 4GYYA 5JPCA 4XO4A 4UZUA 3HB3B 5F4ZA 1NXQA 3WHLA 4FB5A 3IUJA 4E41B 4XC3H 4PG4A 5B7QA 2QE7D 1UP7A 2RAFA 3W0WB 3AY4C 1VTKA 4UM8A 1RRGA 2F43B 2Q6TA 1II0A 4Z4IA 4J3OF 1KS2A 4K9RA 2H32H 2X4SA 4UB0L 5I76A 3ZHYA 3WTYA 4DA6A 1XTLA 2VQ1B 4X7RA 4MR8A 4KTTE 3VZDA 4FZJA 2PZJA 4KMTH 1BJ8A 4M9UA 3S70A 2GGSA 3CSPA 3ZRFC 1BHO1 1MEEA 2NW2B 5LGJA 3QFHA 4RZIA 2VDML 3TT1H 5IROC 4OFWA 4PJ5A 3B70A 4P80A 1GW6A 3OU2A 5TQ0H 5I6NA 1YAJA 2DTSA 1SQ2N 5L95A 4DLZA 4MJ6A 5CDFE 3E2HB 1ZT4A 4GOND 4X7MA 4Q3EA 5D2CA 3ILHA 2BP8A 4EDHA 2V6JA 1GILA 2XUQA 3KOWA 1NOKA 1H3EA 3VI3B 2V3CC 5JUEL 4AJ9A 3UT0A 4O4LB 1MA0A 1VCNA 3NM5A 1OARH 1FOEB 4EY8A 5JU6A 5D7BA 3BUSA 2NXYD 1F4LA 4NU6A 2XMBA 4LCJA 1W75A 2CJUL 1D2NA 1Z33A 1EVQA 3DZJA 2BVQA 5A2LH 1NJGA 1IO4C 4XSGA 1N5AA 4MV3A 2W83A 3K2IA 2VPZA 1AI1L 2YVLA 1UFVA 4J28A 5C0AD 4AH2A 5L2KD 1M7XA 2C26A 2QX8A 4ZAXA 4AW4A 5L40A 4NYMR 2IDKA 1WZ1H 2UVQA 4CETA 1XELA 3PRJA 5KNBH 4GOOD 3QUMA 1NFIB 4C6TB 2WBWB 5E5UB 4G4IA 2EATA 3JQ6A 3UUWA 2PYZA 5HHPA 2FO8A 5JIBA 3QSKB 3O2DH 4JFVA 4ECEA 1TZJA 3TIGA 1KQFA 1K75A 3MVSA 2V9TA 4N0FA 4NQDE 4IGBC 1D03A 2TMDA 4RA6A 2EXWC 3UH8A 3BGIA 4AX4A 2F58L 1NR7A 6FABH 1CRPA 1RZ7H 3D18A 2OFWA 2ZUUA 4Q24A 4WO4D 1EH5A 4U6XA 3SDAC 1ZJWA 2Z65C 3FBQA 3KKLA 1Z29A 2K9UA 4F27A 3SF0A 5GP1A 5DSZA 4JVSB 3KVQA 2OMYB 3LQAC 3QHAA 2OCGA 4S24A 3HXOA 5JS1A 4P4SA 3HB4X 3TBKA 1ZXQA 2XUAA 2PUWA 4Z0TA 2VM3A 1XQ9A 3P0VL 3M1OA 3TPKA 3X12B 1NJ1A 3B7PA 4WSKA 3RJOA 2VP6A 3V52L 1WISA 4CTJA 3SX0A 2E8ZA 5A6VA 4NFYA 3JWOC 1T6BX 2KW5A 2WFLA 3TLJA 4UVDA 1JRHL 1IN4A 2R4SH 3MRJB 3AUKA 5LDUA 3LTVA 3T1YB 1HORA 4N3BA 5HY9B 1MNAA 1Z6GA 5F7YC 1SVCP 1CUEA 3RG2A 2RQ8A 4F8NA 5C4GB 4UU7A 1AT1A 4GI5A 3D6NB 5E1BA 4MQXC 1EFDN 4ONGH 4X80L 5EN3A 2XE8A 1TJYA 5JADA 4QI3A 1J49A 1ECBA 2IWKA 3H65A 3LRSA 5IW6B 4Q1VA 4RPJA 1MHEA 4BC1A 2FE4A 1PSKH 2DAPA 5HDBE 1DRWA 1VLZA 1P5JA 5C0CE 4L9LC 1S5HA 4M1SA 4K4KA 2ERJC 1O8BA 3JTBA 2H6UA 4C7VA 5GRXG 1RJ9A 4N6GA 3DHYA 4Q16A 2HHJA 3EH5B 4OLAA 2V3VA 1ZGGA 3OUUA 1Y8ZA 1CDEA 3LDFA 2CHZA 5DJAB 1PLAA 4OB5H 4REQA 4GXVL 4HWGA 3ED1A 1TZMA 2EG5A 1IAIH 5T33H 4RTSA 4L4TE 3MYJB 4KYUA 3VXOB 1UD4A 3ITKA 3DKHA 3CINA 1USIA 4HDMB 1AAJA 3AETA 3AEKA 1SRRA 4I9XA 2DJ5A 4ICXA 4XNMA 3LPMA 4WEBH 4B8WA 5H8DA 1YEWA 1BQUA 4ZX6A 4WVFA 1MAAA 3LPGA 4MCZA 4Y0NA 2R8OA 3P2EA 2YHIA 2W2LD 4BQQA 4Q6IC 2NTYC 3BP5A 4TRPH 3K6OA 3GR6A 3OHMA 1N9GB 1IL1A 2P26A 4WZAE 2BCJQ 3FFCA 1R0YA 5DMXA 1U8EA 1NQ5A 4CQMD 3ZLJA 1IC4H 2LOEA 2VMFA 2QYTA 3MJ7B 3OL2B 5E8EA 1VBFA 4GE3A 3V55A 1PCSA 3MQFA 1LI5A 2NO1A 3I9IA 4AZTA 2VDLB 4M3NA 1UC5B 4E5UA 2COVD 3WB1A 3UP6A 4DWWA 2CO1A 1YEDB 4ZEXA 3MGOB 1BRMA 1X8XA 3QVAA 4INOA 4JUTA 3SN6A 4OFDA 1W8EA 2Y2UA 4F58L 3Q15C 3CFBB 1KCSH 1P77A 3OKWA 4OLWL 5JXAL 1VFMA 2P8PA 3VRLE 4PRDA 4BFRA 3ZBPA 1KNXA 1TMYA 4YQZA 3H05A 3LYHA 4RAHA 5FCUH 3LSTA 1LDGA 4BZ2A 2Y5TA 1QVZA 3LNFA 3US1A 3HQ4O 5IP5A 1UM5L 1NZFA 5A3QA 2GEDA 2XZZA 1JAHA 2VCEA 4JSRA 8GPBA 4F7PA 3WKQA 3BEVB 4M49A 3EGXA 1NBVH 3HB5X 2C5BA 3NCTA 3CZFA 2F4NA 2VZ8A 3UPTA 1R46A 5C0BE 3BCHA 2BVTA 1BE8A 4Y0VA 3WWYA 3VFMB 5C07B 3DCJA 4HOWA 4IXTA 4L2IB 3ULVE 4LLDB 4XTRD 3GIVA 2CA4A 5G2NA 5HSGA 1UJ3A 5I7OA 2Y92A 1HIMH 3ZDZE 1R6TA 2AV6A 3IQGX 3FQRA 3CXRA 2R68A 3PWLB 3VCLB 3EMDA 4IIBA 4C14A 4HFMA 4JN2B 1QSFB 5DGDA 3LQZA 2QYHA 5E8PB 5D5MB 2NY6D 1JDZA 4TN1A 3H4MA 2O8FB 3B78A 2FPRA 5MI0B 1V5EA 5GZOC 3KELA 2H4JA 3SIXA 2D13A 4JY5H 1A5TA 1NLBH 3TRKA 3JAWB 3RB5A 3RL1B 1IONA 1KY3A 4AC9A 2XBTA 2IUUA 4AQ1C 4EI2A 5IEHA 1MFNA 4FCWA 4ZQIA 2H9GA 4Q4AA 1KIPB 1JS4A 3CUPA 3HB3D 4IDEA 4P0DA 2XXCB 5FLEX 4Y5YA 1CF4A 4E41D 3KE8A 2MWCA 4P5TD 5ITBL 4CKEA 3V4PH 3MNWA 2A74A 1C16B 2DTDA 1OOAA 4KO8A 1D7FA 4K3DL 4FXKC 4UAGA 5AVZB 1MJ8L 2XZAH 5GAJA 1Q0XL 3B2EA 4D92A 2OCFD 3ZL1A 5K4AA 3C09C 3GJFA 3HXQA 4FSHA 5I8KL 2X0EA 5B55A 1U1CA 2VMJA 2PMFA 4RK0A 4U1SB 5CR1A 3R8QA 4Z7AA 1T03H 3O41A 3ME5A 3FPHA 1QHYA 4MJIE 4P23B 3CF2A 2H8KA 3S97C 2DPMA 1HHHA 1G7QA 5AK4A 3NHPA 2VK1A 4B4WA 2XAAA 3BH7A 3VO8A 2G40A 5AXBA 2GZ2A 3TVMD 1KBBA 4I4TA 2FGKA 3N40F 4YBLC 1BCIA 1HTWA 2ZANA 3J7AC 2DFTA 3IULA 3STZB 3PXUA 2WKWA 4DCJA 1WB9A 4KBPA 5BXFB 1EA7A 1U8KB 4P2QA 4OAOA 2DQDL 3QVTA 4B5LA 4B0MM 1DAIA 1M0TA 3RVRA 1J2TA 5L53A 3IE1A 3D4BA 1E2DA 3AXHA 4AMXA 1B1AA 5KWEA 5CAEA 3T4YB 2BTEA 4Z0BH 3D0AA 3F78A 1XCTB 1SCUB 1QH8A 4Z4EA 4I9UA 4IH1A 4I3GA 5JZBA 3IGLA 1DG1G 3SXJA 2OCIA 4RTRA 3EUDA 1PT7A 3KFVA 2OYCA 4CI9A 1CVRA 1E5TA 1XWIA 5ECDA 3BDXA 4QYSA 3REWA 2JIBA 1FUKA 2OORA 3HC0A 2AK4A 3LUDA 4IQ0A 1FB5A 1XF4A 4ZQCB 1IILE 5H3CA 2E18A 4DAOA 2AJYH 1ZD2P 4JLDA 4FIZA 2OR9H 1OEZW 5FW8A 3HN8A 3H9SB 3NEOA 3I1JA 4NQSA 3CDCA 5ETUB 3ECCA 4JI1B 2RIKA 3ETGA 1M0WA 4DGVH 5IP4A 2ZUTA 1GQQA 2W1NA 3V1KA 5DLYA 5DIFA 3HOGA 1GGVA 4DGQA 5GJSH 2FSIA 3S8FB 5AM4A 5F35A 1TQUA 3GJFK 1XEAA 1AKJA 4IIJA 3PB3A 4DCSA 2I91A 3B5GA 1ZLDA 3G9UA 1TCMA 1FAIL 3CWGA 4FWIB 4TKWA 1W72L 5EJ7A 2X1LA 2R84A 4JJZA 1HE4A 3PWSA 4OSUH 4Y19B 5EZIL 5ELLA 4P2GA 4KACA 4F5WA 3BQNB 2JJUA 2C3MA 4L3EA 1UMBA 1XXHE 4DJFC 3Q3VA 1U8IA 3MV8A 1UFQA 4TZ6A 4WJKB 2IIQA 4PLFA 1ZGAA 1TTUA 5BW5A 3TW8B 2EFDB 5DBEX 1W2KT 3ULUL 3VE0A 2QNBA 4MNTA 2V65A 1BP3B 1EHXA 4KQMA 2JV6A 4JFTA 4ZFFA 5INCB 1NU6A 4QGSA 1V9CA 1BXGA 4FAAB 3I6QA 2FDBP 2C8JA 1HXMB 5EO0A 1SHZA 3UZQB 4CMMB 2R4TA 4UHJA 1XN1A 3ZGYA 1JMZA 4WO4C 3FH8A 4DC9A 2VLBA 1T5TA 1CZRA 2I60H 3JAKB 3QY9A 2L7JA 3V1UA 4BFNA 3VTZA 1BD2A 4RQBA 1ZHKA 4KX9A 5BQ7A 2CRMA 2F9FA 2PRJA 1W0KD 1BOYA 2B9VA 3CBGA 5ID0A 4JLAA 4TUJA 2DFDA 2PIDA 4IIFA 2X9XA 2FX8L 3GJQA 3MJ4A 4M1QA 3AEUA 5ICUA 1RPNA 1E5UI 5E2VH 4R8VA 3W05A 4KRLB 3SBWA 4M1ZA 2XMPA 4K55A 1Y6JA 1KJVA 3QU7A 5AKGA 3KGSA 2A9OA 1LDEA 3MRDA 5BMOA 2CLVB 1DCLA 1H0HA 1G2QA 4XGKA 2WXHA 1DJMA 2F8XC 2VLJA 4NMHA 4W5HA 1NCDH 2ZRHA 2ZTVA 1YVDA 2C99A 1YH3A 3NHBA 4OD1L 3QXVA 2P77A 2EO7A 4W1TA 5DN6D 5THXA 3STLA 5CEJA 3LPCA 4WECA 1TK2A 4YCJA 4GI1A 4HT1H 4HZUA 4H0GA 4NZRL 3KJXA 3B9KA 3VNAA 5LG6A 3WMPA 3KZMA 4L8FA 1A5AB 4BELD 1MU0A 4L8LA 4W6YB 3V5NA 3MQ4A 2LU4A 5MEPA 1JWUA 1J2YA 3SQBA 2JEYA 2PANA 4GPZA 4M7LH 4YCDA 5BORA 1C12B 2R2CA 1UBLS 1P0SE 4IDJH 4AT6B 4Z8FL 5J2UA 2Z6VA 5LZ7A 1V3MA 5K8TA 2AX3A 2PCPA 3MINA 4TYQA 2WZCA 1DBWA 4J4BA 2X4IA 2CHNA 4EIWA 1GQOA 3KNBB 1J21A 4G7SB 4BZPA 4OCSH 5B58T 1H23A 2B8NA 5MF6A 1UATA 4OLXH 5HJBA 4MITA 1YEFH 3I37X 4QGBA 4ZAKC 1I1OA 3A23A 2EYRB 2BFVL 4K7JA 3HCOA 3MOIA 2RAPA 5FO0A 4KV5E 1EJ8A 4NNPL 1X7QA 3KXFE 1BZDA 5LGKA 4PIVA 2VE6B 2WXJA 2WTAA 3IU3A 4AX3A 3QI2A 4O2CA 4L8CB 3KBHE 3NIGE 4ER0A 5IB4A 2SHKA 5DP1A 1HRKA 5CFRA 4QOGA 2V2XA 3W82A 1HO3A 3GDBA 2F7QA 2BS71 4X9YA 3PXEA 1W7AA 5HGDA 3WO0A 3CZPA 1QSZA 1QPZA 1G7LA 1IE3A 3R06B 3UAEA 3PTZA 4PB9H 5FUZL 2DH6A 4MW7A 1EKXA 1ZHBA 3DOJA 1SKUA 1VOTA 3QY0A 1FFEA 3QUZC 3M1BB 3JWIA 2WWNA 3OFND 4R90H 3TQCA 4A63A 4G8GB 4WWOA 1DMRA 3ZMRA 4G85A 4ZMAT 1CYEA 1FUNA 1PIFA 2X6VA 4ENRA 3ET5A 4RD1A 4GS7C 2AI2A 3MRQB 5TJWK 4DCPA 3A4DA 1VP9A 3VXUD 1ZTMA 1MWAA 2FH5B 2XY2A 3RWBA 2J44A 2X4QB 2WTMA 4IH4A 2M1ZA 2Q3MA 3WK9A 3RWGB 5JDIC 3PJSB 1ZINA 5HHME 3HC3H 1BFVH 4HLCA 3K73O 4GSLA 4IM7A 1SC4A 1KYDA 2MNUA 1FFHA 5IMOA 3V2AR 5EE9A 1QA9A 1EESA 1OAKA 4OGLA 1Q8MA 3UMVA 2ODBA 1DEEA 4PS8A 4DK6A 1F11B 3ROLA 5EJ5A 4X98B 3H0CA 5GS2H 3DC7A 2HY7A 5AKHA 5I18L 4WI8A 2H54A 3NFRA 4ZUWB 3NC0C 1OH7A 4Y6SA 4XTRC 3E18A 1XL0A 1BYIA 3BTUA 3QBTA 3GI9L 1SXQA 2JKVA 2P4QA 3NMUF 3MS2A 4DLRA 3HDJA 3E6AA 4W1QA 4YL9A 1OYWA 2LIVA 5HJ5A 3JYBA 3GPCA 5JR1H 2QU7A 3EX7C 5HI5D 4AVHA 1RT9A 4P23D 4N0MA 1RZ8A 3I6KB 4RGQA 3A3YB 2HKHH 3NJFA 2FTAA 3L4BC 3FWPA 3MCLH 1RZUA 5D4JA 4R2KA 4AJPA 3FNBA 2WUFA 3RWEA 5HR5A 4LOLA 3GZ4A 4B3TB 3WGZA 5FOWA 2YGOA 2IKQA 4O1IA 1OGIA 1XN4A 3HB3C 3W4IA 5D7LA 2P9BA 1B6GA 5DLEA 2Y06L 2ZBEA 2EQDA 2QGDA 4YPOA 2PBRA 1USQA 1KENL 3GRGA 1U9CA 4MPPA 3DXFA 1XXFC 3VDQA 3K7EA 1IM2A 4EQZA 2OJZL 2L0DA 5EJ6A 3U6BA 1NQTA 1X7HA 3H9QA 2EDMA 3TJPA 4NQXA 1NUNB 1CQIB 2QG6A 1TYRA 4D8YA 5TY0A 5F2KA 2WMDA 1U8YA 5F21B 1RRPA 1NVWQ 3PPYA 3FTCA 5T5NG 2DFVA 4L3AA 4RACA 3E2HC 3SHSA 4YR6B 4EVSA 3PC8C 3H9SD 1PR5A 2YQ3A 1Y5MA 1Q2XA 2Z1KA 4JASB 4DWOA 4ANVA 5J6HA 1NNEA 4GSDH 4FHJA 2QZQA 3TTTA 2P67A 3QEGL 3OLEA 5B7PA 3FRHA 2QVMA 3BMCB 1WHOA 3IGFA 3VM7A 1OCOB 1HKUA 2CFTA 2WMPA 3SBDA 1CG6A 4P08A 1P6QA 4LSPH 5FO9B 1AGDA 1LM8V 2Z6UA 3FSVA 1UASA 4FXTA 4ZFOB 2WVAA 3UC5A 4US1R 4OZFB 3QEQA 2B9EA 4FFYL 5L6MB 1TZCA 4LSSH 5F3HA 3PXXA 4V02A 1L5WA 3SKUD 5HGXA 3JQ9C 4DKJA 4GBMA 3TBVB 1ESEA 3C8HA 4LJ8A 4ZEOA 1CVLA 5K0GA 4G7VH 3HPJB 4N47A 5JXIA 1BXRB 4JLUA 4DUVA 1JIUA 1X7YA 5JH7B 2J8UE 1UBOS 3GGWB 3OE4A 1KACB 3G85A 2BN4A 2EP7A 2VXBA 3KKZA 2AG5A 1ORTA 1Q6ZA 1A8UA 1F8TL 5JMPA 4HXEB 4LKCB 1T15A 3FSEA 2FJFB 3SXUA 4P7BA 1MCPH 3OCXA 5FFMA 2MYTA 1LO3H 4FFZA 3GI1A 3IUYA 2B1JA 1E4XH 2W2VA 3IDXH 2HU2A 4UQEA 5FO7B 2QL9A 5HI3D 4WVLA 821PA 3TN7A 3BZ4B 1BPVA 1FO0L 4POUB 5DM4A 1C4WA 3M3PA 4WJG3 1YZGA 3QZLA 2VUOA 4Y6GB 2YVAA 4ZVVA 4YBQD 1A1SA 1ACLA 1E9PB 4ES9A 1HH9A 3F4BA 4BEIA 3NVQA 1RMFH 5HHVL 4M37A 3WLRA 1I3UA 2JLUA 5GRJL 1ZIAA 2VR4A 2I27N 3LUGA 2WMNB 2QUHA 4J2XA 3CHQA 1XB8A 4EXKA 3VWJB 4FNSA 1U8HB 2XTSA 5I66A 3FHQA 1FP1D 4OZ4A 4LVHB 2CLIB 4M1EA 3WXWL 4RDXA 3HI5H 4J1TA 2YCBA 1X3SA 4NUQA 4PY7B 4PX2A 3L3GB 3IDGA 3TCKA 4MZ3A 1UKZA 1JK8A 5KG9B 3FPLA 4C9BA 1YEHH 4NT6B 1MCHA 1MH5B 4B45A 2KM1A 1YECL 3QJUB 2HMAA 4P46D 3FOMA 3GDOA 4U8GA 1K2WA 1U3GA 3TTYA 3I5XA 3M8OL 3EUUA 5CDGA 4OVUA 2IYYA 2WE7A 5I5MA 1R6DA 4HUNB 4CW1A 3WKEA 4F2WA 3LUAA 5EZJB 1BEYH 4G8CA 5C2UB 3L3IA 4HIEA 4U1MB 4JSYA 4JYPA 5I1KH 1AS0A 5IC6A 3TNDA 4NKDA 4BNTA 1NQBA 5KZMB 3PVCA 4RA0C 2PV7A 2V97A 1G9MH 5HHOE 3BVVA 1WPXA 4GRWE 3V5KB 5IBUB 5HCUA 2NX5E 3O3CA 2F8VA 4K2UH 4NONA 2HDNB 3OIDA 5DSCA 1DBPA 2BEWA 1H4QA 1KPUB 1M2GA 4Y2GA 1DELA 2HGZA 4BM7A 3CNBA 2EDAA 1SY7A 5JECA 3I02B 1NCCL 1CZ8L 1Z35A 3TNNA 4IW3B 4ANWA 4M2LA 1ZJ5A 2EE9A 3BN3A 3PD7A 3T5WA 1RI5A 4Q9HA 3VTAA 5JYLA 2NNAA 2PX4A 1XHFA 3N1QC 4N8VG 1PV1A 3PHOB 1CL7I 2YEZB 1LSUA 4PHGA 3WLLA 4HJTA 4TYNA 4PZZA 2PMZA 4LC0A 4BO0A 3EG9A 3SO5A 2UYHA 1ZT1B 3GLHE 1D5MA 3T3GA 2XBMA 2O61B 3RUCA 3SS7X 4ML3A 4GX5A 1DEDA 3EGEA 5C2BH 1W59A 4FFVA 4EOGA 3DZ8A 2OBFA 2V7UA 5HDBF 4JKLA 2N0SA 2ORBH 4DOHE 1ULSA 3M9LA 4G5YA 3MJ9A 2BWDA 3EFOA 4OU4A 1BAGA 2I69A 4JOSA 2LU7A 5IBQA 3HP1A 1DQVA 5T3ZL 1N2GA 2YHUA 2W2KB 4GW4A 4KB5A 3R0IA 4TKZA 5F98A 3SSMA 3KKQA 3IGAA 3MBWB 4FXPA 4RELA 3DAHA 4RS4A 3B7UX 2EQBA 3EDDA 4XR8C 4ESKA 2G77B 3V4ZA 1JUFB 3VH2A 1JHMA 2VHCA 2YV4A 2W90A 1GU7A 3O3AB 3NP4A 1RTTA 1JQKA 5HYJB 3QXSA 4IMIB 5HXMA 4CVZA 4G8GD 5DD1L 2QN9A 4JCWA 1E3QA 4PJIA 3CBJB 2O05A 5LLIC 1YS4A 3GNQA 5IJWA 3MRGB 1NVAA 3AT0A 3EY4A 5KSUB 4IS6A 1YTLA 5CEYA 1WXGA 1UFRA 2O8VA 5I71B 3ZGXA 1DJZA 1QH1B 3C7DB 4JDVA 1E1NA 4KN5A 1IFGA 4U1HA 4LJSA 3EXHA 3IKCA 2YBGA 5EF3A 1TF2A 3MRFA 5KU1A 4AJIA 1HEZB 2OHJA 3HC2A 3KYIB 4PGDB 1T2AA 2EEDA 1SHYB 4HY3A 4XX0B 1ZVJA 4QNPE 2XN1A 3IUNA 5EDSA 3SFVA 3THMH 4PRBB 3OTQA 5KWYC 3TINA 3A6CL 1AHNA 5HKKD 3CPUA 3FCGA 4WHYH 2NR6A 4NRZB 2DWUA 5D87A 1XIWD 2X8JB 1R5BA 1KOGA 4KVFA 5B38G 4KMTL 3BJRA 3KD2A 4UAHA 3MLZL 4UU8A 1L7PA 2XXFA 1ADJA 1U8MB 2DM6A 4JFPB 3L06A 2BZ0A 5ES3A 3WKNA 4M6OH 4YHYB 1JF1B 3INRA 3W2DL 2WTRB 3KLOA 3HUDA 1IZZA 1K88A 5JNYA 3VRLF 5EEGA 5KYVA 4G86A 4CG3A 5MI0C 2XE6A 3IE2A 3GP8A 5KBDA 1FYTE 2IHJA 4JMNA 3DEYX 4PO9A 1PJWA 1VSCA 4G8DA 2VPQA 1JYFA 2GT9A 1VJTA 4R2LA 4DYDA 2I2DA 3Q6GH 5DFTA 3ZWPA 3O7MA 5IZ4A 1MHCA 3UWOA 5AICA 4WOPA 1EFCA 1OARL 2OLEA 1J0BA 3LCJA 3QVUA 3G2PA 4YJ3F 5FYJU 2YARA 2H6EA 3ZU5A 1K8IB 2YW2A 3ULVF 3MRVA 1T5WB 4RV9A 3BTSA 2ZJSH 1A04A 3ASYA 4TZKA 4Y7MA 2MCG1 1KTJA 3ZDZF 2EAUA 1UKEA 3G9TA 3M07A 2XQ0A 4XCYA 2IK8A 4E30A 3IAAA 2AMGA 1W5TA 3VNYA 2FW7A 4KDEA 1SDAB 3IDQA 5HI5C 5KVAA 4P23C 1V11A 1GDTA 3LKSB 3E82A 2F8TA 2AJ8A 2IVFA 2JF1A 4JJ6A 4OQDA 3UX9B 4XAQA 1TZIB 3K4ZA 5JLAA 5I17A 4GI2A 1IAKA 3RNKA 1VF5C 4RF3A 1AS3A 3O2DL 5DZVA 5J7CC 4LXXA 1DDHA 2XZQH 1IHDA 3PHGA 4EHLA 4UDNA 3I3SR 5EZOL 4XH9B 2I3AA 1J5XA 1FMFA 5I1JH 1GS7A 6FABL 1IEVA 2IUFA 2ZLBA 3QENA 1KWGA 3TEUA 5C0FB 4PHHA 2DWCA 5CKGA 1Q9LB 1DUYA 4JR9H 2RONA 1VSUA 2B0CA 3DX7B 3K92A 4KIWA 4AB1A 3RY5A 1FIGH 4BINA 3D30A 2B8OT 2BXZA 2C9RA 3CN2A 4PJ9D 5H59A 5JC8A 3I45A 5LXTA 3WK7A 3X1XA 3BD6A 3S0JA 1Z28A 2E4YA 4TUYB 4MJXA 1GC1C 2E7MA 3WQRA 5ITFA 1BVOA 2OXEA 5EJIA 4EG1A 4JM0A 4MD4A 3G5TA 1CUCA 2VK4A 3F12A 2R4SL 1GWNA 1T0NB 1W48A 2WSSA 1H1DA 3D85A 2GUOB 1A5FH 2Q5CA 4Q9DA 2IYUA 4LISA 1AO7D 3A2MA 1MD9A 1ZSVA 2QN8A 3HGMA 2D9CA 1NBZB 5KSBA 3U81A 4ONGL 1RQ7A 4M7OA 2IAMB 2IPKA 1E30A 3U1SH 1M3JA 2BTQB 2OLDA 3JWNH 1NE2A 4M43H 1NPJA 4JC5A 4F6RB 4ZMSA 4ZKDA 5J59A 5CLZA 2Q29A 1E3ZA 1BLNB 2Z57A 1PSKL 4M1TA 1EFXA 1LILA 4NJAH 4Y9GA 2AFNA 2ID8A 1K3TA 2Y9RT 1KTLB 1U8JA 1VG9B 4ZODA 4ASUD 2HFFA 4LF3B 3NJ4A 5HRUA 4NO0B 3CSDA 5CVEA 1W8OA 2Y5QA 3D39B 5FDWA 5AUPB 2VLKE 3S1SA 5SY4A 1SXBA 3MNZB 1IAIL 5T33L 1GL4B 2QKIB 2QD3A 2WV7A 2WAOA 4D9GA 4CEJA 2WUEA 4CC4A 4Z6AT 2TSBA 4EIZC 4LQFL 5ITVA 5HI3C 3Q3GB 2ZEJA 4QAJA 3TO4B 3ZE1B 3D7MA 2XYVA 4JHZA 4FTVE 3AXLB 3EEQA 4E2OA 2AKAB 3WL4A 2X76A 3UKDA 4N01A 3W39B 1F6FB 2DKFA 4JBIA 4DO5A 1H2YA 4Z0HO 1JIIA 5D6CB 2D4AA 1GARA 1NCWL 3SPXA 1W6LA 3GLGA 5C1OA 1RHQA 4QBKA 4Q9NA 4TRPL 4UTAH 2FOXA 2VW6A 3QTBA 4JDEA 4M22A 4G9FA 5K9KB 5TK2A 3QLUC 4EWLA 5H83A 2V7QD 2B2NA 4W7HA 1QHIA 1FW6A 1AGYA 3FQ1A 4CF3A 1FL5A 2PZKA 3SXPA 3DRTA 2RARA 3Q8WA 2D7DA 1A9XA 3QEKA 4FQHB 1IC4L 3ABQB 3S4YA 4NZZA 4TS3A 3OIFA 5DM0A 1NUHA 2P6UA 2C9PA 5EJEA 1ZGBA 4P9HC 4OA5A 4EF3A 2PL5A 4GAYA 1Z39A 1PZUB 3R40A 3ANLA 4FYMA 2PJRA 4Y8DC 2RI6A 5AYTA 5IB3A 2C1XA 4NCC1 1KT2B 4K9EH 4WX2B 1JDUA 1CRZA 3KWVA 1Q12A 1QYWA 5I5RA 521PA 1M7IA 1X7ZB 5JBIA 1I7ZA 3DHJA 2AMUA 1ZNQO 1N64H 3U3ZA 4P46C 4RAOA 1GUDA 3WIFA 4KNTA 2AGVA 3ZIMA 1WGVA 1XH3A 4B46A 1CYGA 1KCSL 1R15A 4TUOB 5E6SA 4ND8A 4YT2A 5DJ6A 1OV8A 1DEXA 5IHXA 5I0YA 2XNJA 3QARA 3OCZA 5IZCA 4U6QA 2XFXB 3H4FA 4J7CA 3UOGA 1XFAA 4O3FA 2PYEE 4C08A 3LKQB 3ZY5A 5B1YA 2ED6A 1I24A 4RMRA 5DZNA 2X8LA 4ZJYA 3LKOB 2CLEB 1KEMH 1A50B 2GW5A 4ANFA 4Z2AA 1R0SA 5FPHA 3KKNA 4HAIA 4FMPA 3U4GA 1POWA 3T1VA 4L29A 4Y4HB 5AAWA 1L1FA 4TKUB 3ZVMA 3IS3A 4KK8D 2BPBA 3NP7A 4BPBA 4IKNA 4DUYB 1N10A 3JYNA 4PJDB 5IXYA 2BKLA 4JI7B 1HIML 3X44A 3FOWA 1LD9A 1VYHA 5D2LE 4DT1A 4PAZA 5HYJD 1BEZA 2FTKE 3BSZH 3LHDA 3D08A 3ESVF 4UT7H 4A7SA 2JWGA 1OSPH 1I9EA 2OM5A 3WFBH 4WZ6A 1RZ3A 2HF9A 4Q4JB 3L6DA 2REXB 1IXYA 4O2AF 1DC6A 4ZZ1A 1EWQA 5IBCA 1ORIA 2NW3B 5C86A 3ETDA 1YA6A 4LCIL 1XROA 1F1AA 4Q01A 3IMBA 4JY5L 4HNQA 1VE5A 1O96A 1TQBC 1NYRA 4BFJA 1I1FA 1HHKA 4DO4A 3S2CA 4H4NA 3TOCA 1YE8A 1RQGA 3GF4A 3J81k 4OEHA 2K6WA 1JWSA 1T2QH 2QP9X 4ZHSA 3QAZB 4Q3BA 3GBMH 1XWFA 2GEBA 4HJ0D 2YNMC 4AL8H 3V4PL 4YPGB 2FWJA 3GXIA 4OZIE 2OV1A 5C31A 1U8QA 4X7TA 1PF3A 1I6KA 2ZICA 1Z5WA 2GTZB 4KK6C 1OIXA 1CU1A 2NVBA 4MI6A 4WNCA 3DVNA 5J4KA 3I5YA 4MEJA 1NFDB 1ODLA 3ETJA 1BWWA 3BM5A 1RXVA 4G1VA 4B35A 4XBPB 4KV5F 3SQDA 4IGBB 1WG3A 4DFHA 3MTGA 4TTVA 4NMLA 2R2HB 5ACZA 1BYNA 3FN0L 4YCAA 1DDTA 1W0WA 1GGUA 1JKXA 1E64A 4P4NA 2MYNA 1KDPA 3NIGF 3T2NH 3BLKA 3LQ4A 2QPOA 4HK0A 4WWPA 3SC2B 5A3RA 2ODTX 4E42A 4U1GB 2BGGA 4E6EA 1T35A 2I8LA 4G70B 3FHAA 1CDOA 1XGPB 1XZKA 1KCUL 1PAZA 5C0EA 4EBFA 4PZYA 2QY6A 4P05A 4DK3A 4NNPA 3N2GB 4U1LA 5KWJA 4MB6A 1URZA 4UU9A 1CPYA 1Q3HA 2PW2B 2LVBA 3R8BB 4QG3A 1QFOA 5EESA 4UTRA 4OB6A 1W6RA 5J89A 3VXTA 3ITNA 3VUAA 1XT6A 5DMGD 2C4VA 1NVUQ 3VWKA 3RNLA 4Y16D 3P9PA 2DMRA 2DLIA 1IBSA 2AV7B 2NPLX 3D0QA 3LKPA 3R0VA 4JM2B 4QCIA 1OT1A 1KAEA 2AFIE 2FWNA 1E9DA 4XZ4A 4MBOA 1B0AA 4V11A 1U11A 3R5SA 2FUTA 3WS3B 4TYYA 4OSPA 1ID5I 3MUFA 4KE6A 4NIMA 1E8XA 3HR7A 3IKKA 4I9WE 4WI0B 1J8HD 5JIHA 1IM8A 2F5BL 1I7LA 5L7WA 3CU5A 5CSZB 1FC0A 4YZFE 3FQWA 4D56A 2X2JA 4DGVL 1Y63A 1JE6A 1UXIA 1QCDA 1WVMA 4B6GA 2FPPA 5I8OH 3A70A 3DV0B 5LYJB 3VC7A 2BSXA 2VT3A 4C2UA 4XIJA 1XEDA 1CUBA 3BK7A 3H42B 1P8AA 2OQJB 4Z8YA 3QR0A 3OAYK 4LLYA 4UQCA 3SOPA 2ERJB 4F3FB 3QJHA 2OMTA 1M2KA 4MS6A 1NURA 1DX6A 1CJCA 3FZEA 5ALGA 4ZV7A 2V3WA 1U1EA 2FGJA 3CNEA 1Z4PX 2KLBA 5IH7A 2Q8PA 3MMEA 5LBSH 1E1MA 3U7IA 1E5CA 1YBMA 4A8JA 4NWUH 3R6LA 2WD8A 3V7UA 1AE1A 1JTTA 4DQDA 3PITA 2AZXA 3EVEA 2BMKA 3RKPA 2IDSA 1XRPA 3ZYIA 3DX9B 3DVIA 3HG5A 5SYMA 1GQ2A 4RIGA 5ER6A 2GDZA 1V8PA 4LCWB 2PBZA 3I4CA 3CZCA 3S37L 1TF4A 1FQ9C 3RANA 5F73A 4NO3A 3S4SB 3R44A 4PPQA 2Q76A 2X0WA 1FNLA 4CADB 3V0DA 3DMFA 1SEQH 4W9NC 4QT0A 1QP8A 3HKDA 2W6MA 3AV0B 1ZA3B 4CSZA 1IH8A 2I60L 3NTOA 3VSVA 2IAMD 5KOVC 5BVHB 3OOJA 3FHOA 1N4XH 3HA0A 4JI5B 3LIZH 3S3JA 2JLBA 3GEEA 4FKBA 3AREB 5JCJD 3AJ9A 2RFLA 4MHHI 2A6KB 3SZUA 3LXCA 4WGWB 2YDYA 2YWGA 3T4PA 3F6RA 2DYPA 5EP3A 2QAJA 3ZIAD 1RHHA 1KGYE 4W9MC 4RWYH 4G8EA 3WYNA 1UHVA 4HIHA 1MW3A 4QJ4A 2EP8A 4XWWA 3VJ6B 4I5IA 4ONFH 4H1UA 5E2VL 4G11A 4N9QA 2AANA 3FT3A 2C9VA 5TX7A 2AJBA 2XWRA 3QJRB 2Z93B 3OWOA 5GIRB 1RJCA 2D3JA 1X80A 4GRDA 3AB7A 1PG2A 1T6YA 1P5VA 3EFDH 5DS8B 4AQ8C 2RH0A 4NDMB 5FWRA 3PC3A 4YYEA 1Z4LA 3JWJA 2R5NA 2APTA 1FFBA 3ZL4H 1RKQA 2JKSA 5EN2A 1NCDL 5H70A 2JCBA 2WHPB 3ENVA 4ELME 1ZZGA 5TEWA 2G1AA 2PVPA 2ZSIA 4ZGBA 2XEDA 2WSBA 2Z9DA 4HGKC 3WBJA 4PRPE 1PIWA 4XXDB 2AXNA 4H2AA 4O4HB 2ZI9A 4HT1L 4Y2JA 2R86A 3KKOA 4DQOL 5HKBA 1BROA 3MVEA 4DMLA 2ASEA 4CM1A 5I9IA 4EPRA 1TAUA 4GB9A 3M4YA 5FCDA 3VWJC 3CCHB 1N7MH 3OVUB 3EEYA 4BVEA 2J8UF 3CQFA 4PJ7B 5E5MA 1N2SA 5KSOA 2XZCH 4M7LL 1ZNZA 2PPEA 4FFYA 2C31A 2QQQA 2HHCA 3LQFA 4NEQA 2IWGA 3KKKA 3M86A 3MZ0A 3ZX4A 3F6IA 3TEWA 3EFHA 2EKJA 4C3OB 4A2GA 1LVUA 3RRZA 3TR6A 4MMYB 3BWMA 4OCSL 2CXXA 4HC4A 2OBXA 1UXWB 4U2BA 4X1IA 4BK4A 3ONNA 4OLXL 3V4VL 4FT2A 1YEFL 1X5YA 3AJ7A 1K97A 4OF4A 4OI8A 4NULA 1PKQA 1M3IA 5DJYB 3LCRA 1KH2A 4XQCA 1LEGB 5JVDF 1WSWA 4PNHA 3RGBA 3QI9B 4HHAB 3FWKA 4YDZA 1ZESA 2GD1O 1H3TA 1YR8A 3VXRB 2FN4A 2H06A 4QBTA 2HVKB 1PTKA 1QP0A 4O4IF 3IDFA 5CH3A 3MRPB 2OV3A 1DEHA 3K94A 3H5IA 1XA0A 5JNVA 1FO0A 3S7TA 4AYGA 3VZCA 3WTXA 3KIPA 1Q7EA 2AQKA 1MDTA 4IOSD 4HAUA 4UNVA 4N2BA 1ANKA 2R0QC 3FFAA 3CPLA 1EWKA 1N6HA 4PB9L 4OJFL 4Y4HD 2JK1A 4KY2A 2V5RA 1QGYA 1ECPA 4Z78B 1RVDA 4JKPH 3K0HA 4LJYA 3QUSA 3ABOB 4JCCA 5CFZA 2C9YA 4R90L 3RUGB 2B4CH 3QS3A 1Y7VA 4IOLA 5GJVC 3IR6A 5DMJB 3IBEA 2NX2A 3ZY7A 2GVZC 4PAMA 3W6UA 3PXJA 3NTXA 1TL7C 3NAZA 4A2QA 2YA0A 3UTTA 1PJCA 1IGYB 5E6RA 2FFBA 3VPHA 4HLQB 1J42A 4P5MB 2AKRB 2BHYA 5DE3A 4GSYA 4EJ6A 5HPYB 1TMOA 1QAWA 3CPJB 1GPOH 3RDTA 1V7NH 1P7HL 4KQ3H 1PW3A 4CMGA 1O9BA 2H52A 4U1JB 2VRCD 4RTMA 3T5GA 4GRWF 3HC3L 1BFVL 2VTBA 1E8YA 3IUPA 4DA9A 4G0ZA 3GLSA 2BSTA 2EDRA 4AZVA 4NP4H 1X1EA 4FZRA 5HHXH 1U94A 3HZZA 5B38A 2D7JA 4RIIA 4B32A 2XWBA 1OD7A 4I18A 3MRTA 1VRWA 1CURA 5BXYA 5LGHH 4MR7A 2J3LA 4KK8C 3S2FA 5IB2A 4KMSA 4F7KA 4KLNA 1OLSB 1U3ZA 4K5NA 3E3QE 5BRZE 2HIGA 1CJUC 3F6SA 4XMWA 1DBBH 4BCDA 4QGFA 5JR1L 4TMTA 3HS8A 3WGVA 5TLSA 3T65A 2NQ3A 2IQIA 3AG5A 4WH0A 3HB7A 4Z7VA 3PDJA 2HKHL 1E1YA 3QJFB 5I71C 3KVPA 1SUEA 2E48A 3SYAA 4B6OA 5H35B 2I1LA 2NXYB 2GCGA 1YS2X 3T1WA 2NV6A 1P4IH 3EC7A 3IRCA 3I3DA 3PR2B 3W9YA 4RYLA 2MPAH 1JLMA 1U93B 1LO0H 4YEDA 3K09A 1DVUA 1UAAA 5L2KB 1ZITA 4HJ0C 2VP9A 2VDOB 3HKBB 3G2JA 2Z0UA 1O94C 2ATPA 1BMFA 4JLRB 4TNVK 1HSZA 5ERYA 1IIKA 3K0AA 3GLIA 4N82A 4A6DA 3QLJA 5AJVB 4JB2A 1IE4A 3GXBA 1P5ZB 1P4LA 3EXG1 4WI9A 4OQEA 1SM3H 4IRZA 5LMCA 4ADJA 5JALA 5DMKA 2GILA 1DLIA 3ZKQD 2EWWA 4DEVA 1RZFH 1YC8A 4XVCA 5GIOE 4JM2D 2G63A 3ICVA 5BMVF 3TBYB 4TXMA 2C5AA 5A6MA 5IB1B 3TB6A 4PW3A 4YHYC 2Z2ZA 1XD8A 3K4QA 1JR2A 5HJDA 1FH5H 4GZ8A 5DNYB 4ONOA 3OKPA 3HADA 5GONA 1KE1A 3M6AA 4JO8A 4WUUE 1E0DA 2BY1A 5DC4B 2EUZA 2CB0A 3JQ7A 1UADA 4DMKA 3KPPA 4GQIA 1E2VA 4PHFA 3G04B 3OV6A 4RQQA 3AQ4A 3PLYA 2GIXA