3ZE2B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
469
structure length
469
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 115
structure length 469
sequence length 469
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze2B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze2B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze2B03
2ODQA 3K72A 1Q0PA 1QCYA 2XWBF 2O7NA 3OKWA 2B2XA 5KYNA 4UM9B 4MMXA 3TXAA 2IUEA 1YVRA 3EH2A 3PPXA 4F1KA 1RD4A 2XWJI 1AO3A 4O3TB 5KYUB 3OKYB 1YVPA 1UEXC 4C29A 3ZDZB 2VDKB 1ZOOA 4MMYB 2VC2B 3K71B 2WINI 1U0NA 3EGDA 2I91A 3AL8B 4Z7OB 2VDQB 4JDUA 1M1UA 4G1EB 5KYXA 3M6FA 2VDNB 3K6SA 4G1MA 2NVOA 2I6SA 3NIGB 5LN1A 1JLMA 1NA5A 1U8CB 5E6UB 4WK2B 4K3JB 1N9ZA 4HQNA 4IGIA 4IHKA 3ZE2B 4IXDA 4WFQA 3PPWA 1JEYB 3OL2B 3FCUB 4GZ8A 3VI3B 1M2VA 4HQFA 1XDDA 1OAKA 4CNBA 2X5NA 1DGQA 4UM9D 1OLZA 4O02A 2ICAA 1TYEB 3IJEB 3EG9A 4WK4B 3PPYA 1XDGA 2I6QA 4HQOA 3TCXB 2VDPB 3K72B 1MHPA 2P26A 2VDMB 2ODPA 3T3PB 2XGGA 3FCSB 1IJKA 4MMXB 4F1JA 1RRKA 1N3YA 3IBSA 3VI4B 1JEQA 1BHO1 3F78A 4M76B 4Z7QB 4A0QA 3HXQA 3ZDXB 3K71A 5KYYB 3AFCA 5ES4B 3AL8A 1CK4A 5KYXB 1L5GB 1PD0A 2NUPB 3PPVA 4WJKB 2ADFA 1IDN1 3EFOA 4FX5A 5HDBB 4MMZA 3ZQKA 3ZE1B 2P28A 1LFAA 1FNSA 4O3UB 3EOBI 3V4VB 1T6BY 4C2AA 1AOXA 1MQAA 1PD1A 5E6RA 3HXOA 5KYWB 4UM8B 4DMUB 1SQ0A 1M1XA 4CN8A 5HGJA 3GXBA 3EGXA 4NENA 3HI6A 1QC5A 4O02B 3IJEA 3EG9B 3NIDB 1M10A 3E2MA 4HQLA 1V7PC 1JV2A 1DZIA 1PT6A 3FCSA 3F74A 2NUTA 3ZE0B 2VDLB 1MF7A 3BQNB 1IDOA 1JEQB 2WW8A 1RTKA 5E6SA 3TW0A 1XUOA 5KYYA 1ZOPA 3EOAI 3RAGA 1MQ8B 1L5GA 2UZYB 2NUPA 4HQKA 3EFOB 4C2BA 4JX0A 4MMZB 3NIFB 5KYUA 1PCXA 4BJ3A 3TVYA 4MMYA 1FE8A 3EGDB 3V4PB 1MQ9A 5BV8A 3BQMB 1ZONA 3BN3A 1AUQA 3N2NA 4G1EA 5E6RB 5KYWA 1SSLA 3K6SB 1IJBA 4G1MB 2M32A 3QA3E 3EH1A 1SHTX 4CN9A 1ATZA 4NEHB 1M1XB 4WK0B 4Z7NB 1BHQ1 1SHUX 3EGXB 4NENB 1U8CA 1RS0A 5E6UA 1QC5B 2VDOB 3AL9A 3ZDYB 3Q3GE 4XW2A 1T0PA 4FWWA 2QTVA 1JEYA 3OL2A 1SHYB 1M2VB 1JV2B 5HJ2A 3T3MB 2NUTB 1CQPA 4PN7A 1MJNA 1YUKA 3NVQA 2VDRB 5E6SB 1M2OA 1U0OC
chains in the Genus database with same CATH superfamily
2KDYA 4LYAA 3TBWA 5TQ0A 4LZAA 4E5XA 3N1PC 1VCAA 4JQVA 4LDJA 2B9AA 3VGAC 3STTA 4NFLA 5FXMA 3AL8B 2VOEA 3P32A 3O6FA 3QPDA 4G41A 1D5XB 4IGBB 4ZFOB 5DZLA 1FVEB 1RFDL 3EW9A 1MJFA 1ZLUH 4BXSV 3TWYA 4DA8A 2FHBA 3QUYA 2CO2A 1DXQA 2PKQP 1JR3E 4AYWA 3P9SA 1KDYA 1FA4A 3NPAA 4DABA 3FF4A 3G9UA 4DUXA 1A2KC 1ZGLM 5AK6A 3DX0A 2P2CA 3KPJA 4KB5A 3Q5GA 3UPTA 3G49A 2M1KA 4IRSD 1RUQH 4BGLA 3PC8C 3EO9L 5G0SA 4CVXA 1SQSA 3T61A 1WC7A 3KYOA 4FL4B 4YS4A 5CR8A 3L9WA 4OZHB 3IILA 3EXHC 3X1MA 3JQ7B 3QPBA 5LOVB 4AJIA 3E27A 3ZU4A 1Y1SA 3L2MA 3PF9A 2PABA 5ARDA 4X5WB 4XNXL 5CZXD 3MV9B 2WZDA 2PO6C 4AMKL 1AB5A 1ZLVH 2GN6A 4HCFA 4B73A 2YTZA 5DJ2B 1FVXA 5F9HA 1BRTA 4JO2L 4B6SA 4JFFB 4TNFA 4BNIA 1XQYA 1DVZA 2I67A 3GQBA 4V0SA 4XNQB 2IDZA 5BNZA 3S3DB 5A0FA 5BMVF 5E5UB 2R69H 2FB4L 2AJXH 4NKOA 1FMTA 4IDFA 2NOAA 1G1MA 2ARWA 2NY2B 3K30A 4KXQA 5EU4A 1GRCA 1QBAA 3QXUA 4X6EA 5B58T 4EA6A 3HJBA 3UBGA 2JHPA 3O2VH 3QHFH 3FDWA 4Z4FA 1SMOA 1NOJA 1Q20A 4M7LT 3HZ3A 1KJYA 3LV3B 4IW3B 2NNCA 4C05A 2P30A 2A1TS 3BWMA 1KR5A 1RBZA 4G26A 4TSBH 4HLEA 1XTQA 2ZSKA 3NM4A 2OYCA 4EXKA 1CDZA 3DMDA 1PD0A 4MX7B 1URPA 5AMXA 2X3BA 5IFAL 1XXHB 3CG0A 7YASA 4L02A 4JJ6A 2LLGA 2QQFA 1A5SB 1B8UA 1IJNA 5GOZA 4DPAX 2H1HA 1LI7A 4MW4A 3UQYS 5ESXA 3PQ3A 3ANSA 2W4QA 2GX6A 3QXDA 4FE4A 4E5YA 2C29D 3QNFA 3HUJA 4FQHA 1N5AB 5E6ID 3LT2A 4V1CB 1P84K 4BZ1H 1JALA 1CZHA 1BHJA 2C2KA 3BJZA 3R3VA 3QORD 1TZBA 1XWWA 3SR0A 2ITDB 2YD6A 1ZM9A 2BDUA 1RJEA 3RILA 3CC1A 2YZ2A 5FWQA 4YSQA 5DXWA 2O6PA 3EBLA 1DO0A 3JR7A 4O2EB 1G9HA 4UT6L 4FQIL 4KITB 3LB6D 2J8UE 3NCYP 3FQUA 2GT1A 4IOIB 3IT1A 3PHIA 1P4IH 1JE1A 2ISCA 2WWIA 1FXSA 5C0IB 2Q3FA 1SXJB 3RVWD 5C35A 2HCJB 4WQMA 3VX4A 1SZDA 5DW0A 2DQEH 2OMTA 2QR0B 2NNAA 1OREA 4WK4B 2PVSA 3BDAA 2EJTA 2AHIA 3DX8B 1C8KA 5JZVA 4KPGA 2GBTA 5TQ2L 2QUKA 4R7DA 2YGOA 1TECE 3RY5A 3UIYA 4KR0A 5DNVA 3QKUA 3WGIA 3AZQA 4W4TA 1HE8A 3FGNA 3ODGA 4JFOB 1L4KA 4IF6A 3CA8A 4CN8A 5KANG 2E1PA 1VE6A 2QHLA 3OAYH 3GUFA 4F5CE 1H3UA 4G5AA 4JI4B 1AMYA 3KQWA 3WGKA 2HJWA 1Y7TA 2AL7A 5HR5A 3PFFA 3HU2A 4OX9Y 3MCYA 2XMPA 1U3WA 1M5TA 1BKYA 2VN7A 5C3UA 5DV9A 1A8PA 2QL1A 4G24A 1MZZA 2HH0H 4RQTA 3QH4A 3OG9A 3LRKA 5KVGE 4PTTA 4HJUA 5D1ZC 3M1YA 1QIHA 3U6RB 1B4LA 4IUBS 821PA 4XYLA 1E7WA 5KQLA 4L4VD 1EFRD 4BCDA 4KQ4H 2BFBA 3NCTA 3WFDL 2ZKHH 2AJVH 2WJGA 5HS6A 2NM0A 3TOCA 3BZ5A 1DJGA 3WN5A 3NTOA 2VQ4A 3QUML 1XEUA 4OSOA 4TSKA 3UMGA 1F2UB 4XSVA 3SHSA 2DUWA 4C4BA 4GEJA 2AFIE 1M33A 2V6JA 1B6UA 3KHKA 4DP6X 4X80L 3Q98A 2UZYA 5HHMB 3FHQA 4JQZA 4KX7A 1BN6A 1K8ZB 5FNVF 4FIDA 3NACH 3WI7A 5GGRB 3CBKB 4FYXA 1GW0A 2TAAA 4E68A 2DQHH 3BCHA 5LQBH 5BSTA 2PYEA 1K6QH 4UE6A 4N85A 4RVSA 2MTPA 3AVTA 3EFDH 4RC9A 3U1VA 4F9TA 1OB1B 5FUOL 5CW2A 3VDAA 4Y1TA 2LGJA 4DSTA 1Y9DA 1U3FA 1XUOA 3QJYA 3OKNA 2NYVA 4R83A 4NEGA 2NX5A 1DCTA 1V8OA 1RJYB 4HU2A 1KLGB 4OUOA 1WLYA 1ANUA 1ZCRA 4AZ3A 1LJ8A 2MYNA 1OI4A 2AK1L 1RUML 1ED3B 4UBDD 2DLCX 1H69A 5A02A 1IC1A 2V7NB 4TYNA 5L51A 2R69A 2CV0A 3V6LA 1UD5A 3KWTA 4WDIA 3RBXA 2IQAB 3GMRB 2WWRA 2YOFA 4LXUA 1UC9A 4EG8A 3THXA 3ZHLA 3EDQA 5FYKE 4J0QA 4EITA 4OI8A 2RGDA 1XR8B 5GZND 1BVKB 3HS0C 5KSAC 4LJYA 2C3GA 1NIJA 3E2IA 1Q90A 5C6TH 4XTRD 4Q9BA 3NFNA 2ZJ6A 4ER3A 3ETGA 4BQIA 4LF5B 1D09A 3E8MA 3KPPA 4DUYB 5K9OB 1UKVY 4EQ2A 1MCIA 5FHAH 1HHGA 4C1BA 3ZIAA 2ZBEA 3RJDA 4JMXA 5EC2B 1SUFA 2YGNA 3CBJB 3V6ZA 3IBFA 2VM3A 4UUPA 4YCBA 1YQ9A 1M6YA 1QK5A 4Q6IA 4E5SA 2AKRA 4QHPA 4ZVVA 3QFCA 1IG3A 2AXJA 4R3SB 5E2UH 1L1RA 1KCRH 2BEUA 5F33A 4U1IB 1VDGA 3ZKND 5SX4I 3UHOA 1TK9A 3LDHA 1MC8A 4Z0TA 3WRVA 2I5PO 2HRBA 3GJXC 3W5SA 4A37A 3P4NA 5F97E 2R6HA 2YWEA 3ZDZF 3NC0C 3ESAA 2E8ZA 3J07A 2F3PA 5CLTA 2YV1A 2W2XA 2D4AA 1PJRA 4LSMA 2DQUL 3F5WA 1BROA 1C8VB 5B37A 5JOFB 4EQ3A 4LA4A 4HEPG 4D5GA 4JL1A 5EXSA 2J3QA 2R85A 4CMHB 2X2JA 4ZAZA 3B2VL 5HI4D 3QZUA 1E0SA 4WWHA 4OIIL 2C2YA 1SBIA 2LVEA 2OTUA 4H1LG 4DLBA 3ENNA 1PZHA 1Y1TA 3ILHA 1SHXA 3RS2A 2E9WA 2ZE6A 3O2JA 4LMAA 2CIIB 4QUEA 3FN0H 3D3NA 1EWTA 3BH4A 1FSKC 2R7AA 2OTPA 2BBOA 6ABPA 3VD9A 4HUNB 3U4QA 3I9NA 1DTUA 2UVQA 3CD4A 4P58A 2WTRB 3RI5K 4P9MH 3OB0H 4JUSA 2EE2A 4IIUA 1AG0A 3U25A 3ZUNC 4Z7WF 2IUSA 3LEYL 3HNSH 5D7SH 4LF3A 3HCRA 4NOJA 3IBOA 5IEBA 1PVOA 3FT0A 4GOLD 2JKSA 4B9AA 2VIRA 4M7KL 1VKHA 2EG5A 4HCIA 3K4QA 4Z53A 4OA8A 2BHYA 1T1WA 3OAYK 4W7SA 4UB0H 2IU6A 4N41A 4UWQB 1HA3A 2HZ7A 4WIQA 2IPOA 1UEYA 3NBMA 3DZGA 4J3OG 3R5KA 5DM70 3QV2A 4B3SB 4UBKA 4KXNA 4IQGA 1OBCA 4LDLB 3AFLA 3C6LA 1UBOS 3DHVA 2Z34A 3CNNA 3O6LL 5KVDE 5FQNA 3UAYA 4NKIL 4I2VA 4JYCA 4CI0B 5A4KA 4DDHA 2GUOB 3E7JA 1JA0A 2IV7A 4M43H 3PNLA 4Q9QH 4KN8A 5AKKA 5DNAA 1C4KA 4DG9A 3MJCA 4RWZA 2B4CH 1G8AA 2QSVA 1ZINA 3OCUA 3VXUE 5DTFA 5FYQA 3TRKA 5J63A 3J81k 5LMUB 3UTPE 4IXDA 3U3XA 4J16A 3U0WL 1NFAA 1N7MH 3WE1A 3NTLA 1QRNE 2NGRA 1M9NA 4HX5A 2D7DA 1O6GA 1X1CA 5ALBH 3VFSB 2HSDA 4E3WA 4P2RB 1OFUX 4GEKA 1WKBA 4HD9A 1HNWB 4NRYA 2OCFD 3UXFA 4EFDA 4OM0H 1X3LA 2MINB 3U3JA 2FEWB 1CLZL 4KROC 2DTSA 5ENWA 4WAFA 4K3EH 3VYOA 4WPGA 4RV9A 1UBNA 2Q2LA 4P99A 2NDGA 4TTRA 2MQ0A 5AOZA 2JJVA 1XD2B 1S3IA 3S1SA 5DHUA 4CM6A 3U7YL 3PU6A 4OOFA 3H65A 2WYVA 4YQXH 2VAJA 2KDGA 2PGXA 5ELXA 2AYZA 3RDTD 3N0TA 1YSOA 4I0PB 2UZ4A 1BN7A 5FI5A 1TDQA 5HHOB 4C59B 2YD9A 5AK0A 4E7OA 1A7PL 1ADCA 2A9QA 1QCCA 3ZBQA 3MT8A 4ODUB 4CU6A 3S5LA 4NZTH 5DN6A 1R6AA 1DJPA 4L3EB 4N4AA 4NATA 5DK2A 5JJKA 1KH1A 3IQEA 3KXFD 3L08A 2BSBA 2DLTA 4GLRH 2CXSA 4RPCA 1WS7A 2CGZA 2J8UF 4FQQB 1JK9B 3KXKA 1KO8A 3JVIA 3BAWA 1GZ3A 4YHLH 2J12B 3WB9A 1HH9B 4UHBA 5ICGA 4K9EL 1FO0H 4FFWD 2ODWA 3HHSA 5I01A 1FRGH 4MPJA 3E8UL 3QJ5A 4RTPA 4WY8A 2H9GA 5EC1B 4KRPC 4ESOA 3PGXA 4ALJA 1V6SA 4GUCA 3U7IA 3KE9A 3KR9A 5FPHA 3F4LA 1ZH4A 1D6JA 12E8L 2C7PA 1C4OA 3UKDA 2W22A 5ID1B 4H3VA 3LUAA 5B38B 1IC6A 2YEQA 3UOWA 4RGNE 2CIKA 2MOKA 3S0JA 4HWTA 4DUGA 2C3YA 3JARB 3FB1A 1RE1A 5HHVL 4YRNA 1JPEA 4URZR 4FBMA 2W8BB 1DOAA 1CUXA 3KOOA 2Z31D 2H0QA 3LKPA 3PAYA 3O2VL 1KGWA 3QHFL 1MB3A 4QREA 1VSBA 3N0WA 1EZSA 3HRZB 3MFFA 3ZDWA 2PLRA 4DV7B 4GKNB 3DULA 3TNLA 2H3HA 2PKDA 4FEYA 1P7QB 3QU4A 5IYZF 5GISH 1LLAA 3M6LA 3KZ8A 4RXMA 3GNLA 1SPXA 1P7PA 2EYTA 1SXJD 1GA6A 2I87A 3E0QA 4IVRA 4K3HA 2UVPB 2HJGA 1RLOA 4LRXA 3L41A 4HJJL 3MV11 5IW1A 2GT9A 2MPAL 1B0RB 2EE6A 3AG4B 2ZBDA 3OP4A 3CK0H 1S9DA 1R0RE 3TTYA 3IHLA 3DEJA 5I82A 1JPUA 4F11A 4JYAB 1T1ZB 2VDOH 2F1AA 2FLRT 2EE3A 1RD6A 4CKQA 4TLCA 2C1XA 2X0WA 3D39B 3AU1A 2WTAA 1IMHC 3JVFC 2FEEL 4ENSA 1B2LA 3FUNA 3OAZH 4BUCA 4S1NA 2QGNA 2I62A 4E30A 1EFHA 1Z4PX 4L4VB 4KQ0A 1IOZA 3UYPA 1NIFA 1A7KA 2XKNA 2JIXB 4KYIB 1MOQA 4LASL 4OLVH 5CEZE 4ITVA 1Y5LA 4N18A 4GI1A 4P7JA 3M4YA 1NANH 1AP2A 1H4VB 4UAOB 2Q3JA 4YDQA 4HLUA 3FPHA 1Y3HA 4G8IA 1Y6RA 3PWLA 4FQ7A 3EGSA 1TA9A 3VW3H 4MEBA 3LCRA 3R3SA 5A2FA 1FTQA 4KQJA 5EZLB 1HHJA 3CN2A 4G4SP 4WTOA 3QM1A 4MYTA 4GW5B 2PZEA 2WXOA 4PJ8A 3K0FB 1JDZA 4LSPL 1M9SA 4RSVA 5CGTA 1GJIA 5IZCC 1JGLH 3HG4A 2IAMC 2ZUEA 3F49S 4JVLA 5ICXA 2WYOA 1EHIA 2QTAA 1XU7A 3QA9A 3ZKMD 1T7WA 3HP7A 2BIHA 4S1DD 4YUEH 1FSPA 3H99A 3COVA 4FT2A 1IXSB 1FFSA 1XL4A 2K8QA 3UAZA 1KY3A 2HKIA 4EUPA 1C08B 1VMDA 2OK0L 2CMGA 5HHME 2FKNA 4KBYA 3FR7A 3X43A 3IAXA 3KB6A 3D4ZA 4NOMA 4YWJA 4BQOA 1DE0A 2VYND 3K5HA 1WAAE 4S11A 3TCXA 4ICXA 2ADFH 1OP4A 5J4VA 5C6WH 4JE0A 4CW1A 4LCYB 3PG2A 1NJ6A 1Y81A 1U0NA 1EAJA 2DWUA 2FK7A 1N1DA 2ZYUX 4XX5A 2F54B 3DFIA 3RE0A 2UZAA 5E5MA 2CFOA 2QVKA 3CFQA 4DV3B 2DHCA 5KBLA 1XH2A 3FCCA 3MLYL 3EXEA 2HUPA 5LBSA 2GHQA 5IESH 4QKXB 3ORSA 2X7LB 3L1IA 1QYDA 4HXFB 4JFSA 1UKYA 5E2WH 1F6BA 1H5NA 1UEMA 4UUOA 4QUGA 1QZTA 4U6YB 2GN1A 1K97A 4YSDA 2JBAB 3D1VA 4PCKA 3WFBH 5AFSA 2J4WL 1F0NA 3D3EA 1DKPA 1VKZA 3MV01 3JYPA 1GZPB 1QLFB 1PU2A 1W0VA 3E2HB 2Z65C 4F3FA 4IFIA 4B35A 3V8VA 3S28A 4PJXF 3VHXA 3JQGA 4QHKI 3LW7A 3FMOB 4LHUD 4LQFH 4L5FH 2P6OA 4YT5A 2BGJA 1FLDA 1SOWA 1S2LA 3TJEL 1W72A 3QX7A 4QT5A 3LB6C 3BHBA 4TVSa 3AM4A 4TUUA 4ISVB 1TTQB 2X5OA 3ORFA 1YDFA 1OLUB 3A6KA 1FZOA 3MFQA 2OR3A 4ZCRA 4KTEH 5ALGA 1CLCA 3P52A 4F45A 4Z4HA 3H5OA 5AJYA 3GJZA 3QXTA 3TOZA 2Q7YB 2YHUA 4ID9A 1NCAL 2VERN 1QVWA 3KPWA 6AT1A 1G2IA 2NO6A 2R8BA 4LLVB 3MN8A 3H8NA 2YQBA 3KJ6H 3ZL4L 3T52A 3LXRA 4DQXA 3CZFA 2FN9A 3N2IA 1CQKA 1RKXA 2R9HC 5EMLA 4L29A 4QHNB 5K0ZA 4XPTH 3E35A 3IQGX 3QMWA 1VDMA 2EATA 3T9DA 1RSZA 2WUDA 2NY2D 5KBNC 1CRWG 5DDHA 3DNKA 5AVTB 4MDJB 2J7KA 4LSRL 4CADB 1JFVA 2EKBA 3S2CA 1P2CA 3CN3A 2GESA 4RNDB 1S2GA 5BYKA 1UA6H 1B0ZA 1E20A 3ZZLA 3T8MA 2KQUA 3ORQA 1HC1A 4DLLA 3ZV3A 1DSFL 5K3OA 3A1SA 1W34A 4WO4B 2EEFA 4N5NA 3HVDA 3NGBC 3RWMB 4L4YA 4C7OB 1MHHA 3IU4L 3NA4A 3BEWA 5KVFL 2I6FA 3A4TA 1JNHB 1R24B 4Y5YC 1JPFB 3HTXA 3KALA 2VDMH 2IPMA 1KXHA 3WIHH 4V3CA 1ACXA 4P2QE 3GJFA 2FEDC 3OCWA 1UD3A 1YCHA 3WBKA 4LHZA 3U1SH 1C5DA 4QDGA 4AL8L 3W4JA 1J18A 4AULA 3H1FA 4L4JA 3RJ5A 4ZIRB 5FBRB 3W0WA 1GTMA 3KUDA 1ZA2A 4F58H 4GFTB 3VC2A 5SYNA 4UFPA 1ADBA 2HUHA 4BFEA 1X7TA 3C8UA 4HUJA 3N8DA 2VZ3A 3LGXA 2ZX7A 2CKMA 5F21B 3S3JA 1N6OA 4MMXA 2O6CA 4R1LA 5HF9A 3Q10A 1H2FA 1NP7A 2VQ1B 1ZOOA 2XCLA 2B34A 4Q9NA 1QEWB 1FW8A 4MPPA 3RIAK 3VFVB 1PWYE 2Z5GA 1OH8A 1S7SA 3TCNA 1G7HA 3C08L 4PAWA 2BHUA 1I3RB 1HS6A 1G7QB 4WEBH 2XWBA 2ZFUA 4UINL 3BMNB 3WGJA 3C6SA 1JIKA 3RVBA 3MLRH 2EC9U 1AOZA 2X9YA 3L3KA 3O11B 3C74A 5H1YA 3WKMH 2ODNA 1JI2A 1TMCB 2IPUK 5CP7A 4FPXA 2CWWA 5J2TB 4WV1A 4HJEA 5LZ7A 1DUIA 2IDFA 1BHGA 3Q43A 4OD1L 1RRPA 4P5DA 4CDNA 5AI4A 5CXQA 4PX2A 2QUJA 1IIIA 4UTAH 5SWZD 3NV9A 2VH5R 3KPLA 2N1MA 2Z1DA 4HUVB 2FOLA 1YDPA 3FSVA 4D46A 1YQQA 2E6PA 4BXVA 1LNQA 3C4JA 3Q8EA 2MQ3A 5B30A 5HFJA 3RVSA 4F72A 4MROA 1FNNA 2BMFA 4EHHA 3AKYA 1X7SA 4UDYX 2RQ8A 1CE8A 2WXKA 3LPPA 3AOEC 4DR6B 4NFDA 2WLIA 5CNHA 3E9MA 1JYSA 1ZIDA 4Y1AD 5JPIA 4QTUB 1FORH 1NT4A 3Q8FA 3EYAA 1QZ3A 4R4BB 4Y8DC 3FB7A 5EE9A 3L7IA 1FSGA 5TK4A 5KYNA 1H8EA 2IYZA 2XFGB 4PWFA 5BV7A 5JBQA 1G5FA 1V1MA 2C4XA 4R8SA 3IDMB 2BGKA 1TZMA 1Y8RA 4A7VA 3RWDA 3Q0TA 1XF3B 1ZPLA 1VYHA 1IUKA 3WIIH 4E2OA 1NURA 2Q2OA 2YXLA 4ENED 3VO1A 1X70A 4ETYA 1ZNWA 2OHJA 3PGMA 1WB5A 1DS6A 2WBKA 4LCCC 4PPGA 1IFHL 5I6MA 2H1XA 1JNLH 2FX5A 3C7DB 1R3LA 1X9RA 4JFRA 3ZHOA 4MUHA 2H2DA 2NT0A 3BWDD 2DJ4A 3ZE1B 4AIZB 4RF3A 5CAEA 5K4GA 3H8WA 4KO7A 3QDGB 4Q39A 5LD2C 2WAYA 5F7XA 2CHEA 5DOZA 4JCCA 4KZKA 1XXFC 1Z3GH 5HQ3B 5J12C 3GT7A 3NWEA 4RGVA 1E4OA 4QNPE 1P2SA 1NH6A 2J5LB 4JO1L 1XZIA 3W77A 3QIVA 1JBEA 3OQVA 3LM8A 4XX0B 5D86A 2DZDA 1G9NH 1XRJA 3P9RA 1ADQL 5KTEL 1H3PL 3I37X 3ETTA 4P46A 1PJ2A 3AI7A 3H6KA 4C07A 1ZLSH 1KF0A 3MRMB 4BNHA 1SXJE 4L8CB 2IXGA 4IMIB 3V6FB 3E9TA 2VP4A 3IDNB 4PJCE 1KEGH 3PITA 4HD8A 1GQFA 1WG8A 5CGZA 2WIBA 3SBOA 3FOCA 1H93A 5E1GA 4QKQA 5FLUA 5KOMC 4JUFA 2IADA 5FPQA 3M4ZA 1LEGA 3QIBA 4TZ0A 2W00A 4NI3A 1VKNA 4NOKA 1TVCA 4XMUA 4NJ9H 5EJFA 1RCYA 5CW1A 2R8RA 1C1EH 3VR4H 2WP3T 5B1DA 1MCQA 3VA7A 3DMTC 4ZK6A 1RZPA 2VZUA 4NQEE 3NCHA 1V7QA 1YPZB 5L0QC 3EPRA 4F57H 3LVRE 3SIRA 2BVUA 1YMHB 3AEQB 1HORA 3IAHA 3D06A 2K7QA 3DBSA 5BVGA 3ESUF 4MVBC 2C5LA 4FFYL 5DIFA 4EPXA 1OTUD 1ZDSA 5HHTA 3AIKA 3CKKA 4WFIA 4DG5A 2Q6WB 1Z26A 1BREA 1P4HA 4X5OA 4NYJR 1IKFH 4TN5A 3FB4A 5D7JC 2AVNA 4MS8D 4KZCA 1TJGH 4YXWA 1JHLL 3DUSB 4BLUA 3E3QC 4D0DB 2JCCF 1YUNA 3WO3B 2GJAA 5IBLC 2WDZA 1VHTA 1F11A 2O50A 1HAWA 3TA4D 4XHQA 5EJGA 1JJUA 3BH9B 2BJML 1T6YA 4RGBA 4CMKA 4JY7A 2YS6A 3L13A 5IBQA 1CDGA 5C7YA 1KYOJ 1NATA 5T7BA 1K89A 1L7IH 5I17B 4ITRC 1UKAA 1SLXA 4TTDD 3CFDA 1VDZA 1EGMB 2R1VB 3PZRA 1OQOA 2B4YA 4FTWA 4OLUH 5E8NB 1F8TL 3TO4C 1A27A 1QIEA 4QXRA 2EKSB 2H85A 5TK2A 4LSSH 1NQAO 3VG9B 1OF1A 1H0DA 1J1OH 4M1CC 3OCZA 1LQUA 4YV7A 4YSSA 1IIKA 1KN2L 1UXSA 3GBVA 4CT5A 4KI1A 1OA1A 4HDRA 1UOEA 4RMBA 4CM7A 1Q95A 2YPKA 3LX8A 2EW2A 1OXMA 4MGXA 3A06A 4PLKD 2Y6TE 4EG1A 4DCSA 4FMDF 4BNDB 1VSUA 3DO6A 4NFCA 1BQUA 3MUOA 2IYLD 2O05A 1P1VA 3GUHA 4Z1OA 2J9GA 3D5TA 4TMYA 4RZIA 4TLLB 1TW3A 1KYAA 1I2DA 3SE0A 2CXPA 2NXYD 2O7QA 3LY6A 2R7LA 3DL4A 4Y1RA 4NCC1 3EXFA 4XFJA 4PJHE 3SXUA 2Z5LA 4ED9A 4EO9A 5AVQB 4PP1C 2JJSA 3LDUA 4JJFA 3P0GB 1L2TA 2DFDA 4IDEA 3VXSA 1N0WA 4N5DA 2JIBA 4NQVB 5KX5B 4TKUA 2ZM5A 4M54A 3OM8A 3K81A 1P0MA 1GJUA 1T89C 3QLVC 2WJ3A 3OKOB 5GGTL 1FFGA 2Z08A 3GR6A 1R75A 4OK5A 1OAYH 2SBTA 3TI7A 4YMVA 2HRHA 3RAJL 2PPDA 2BXZA 1CICA 5H2BA 2OXEA 5K0EA 5LG6A 4P4KA 3FUKA 1U7OA 5FGCE 4X1KB 4WO0A 3EXLA 1CGSL 1XZHA 4ILEA 1HL9A 3ANXA 3HS3A 2W0FB 2RD0A 5JI3E 221PA 4CL0A 1FSZA 1T5WB 2ICWB 5D01A 3QQ4A 4QF1A 1N3IA 4AGLA 2X22A 3R44A 5EJ9A 5DA0B 1O89A 1MI5D 4BQQA 4HRAA 4BWGA 4DEPB 1B43A 1WFOA 4DP9X 1KAGA 2XHNA 1T3FB 3FJYA 3UDWC 3D8BA 5IDYA 1NMCB 3KDPB 5AP9A 2D00A 5DU7A 3G6WA 4TV3A 5J2TF 2O4UX 2RKBA 5G4NA 3RG2A 3PDDA 3DZBA 5KJ6A 3ZNPA 3A2MA 2YV4A 1PR9A 1CE1H 1UATA 2VF7A 4LVOC 2WBXA 5HF5A 3TQHA 3RWOA 4TF4A 1AF4A 3SE8H 2HJ9A 1B41A 3AIMA 4UT7L 1KTLB 4IAOA 1UOPA 2J59A 2BDNH 1K6JA 5JYDA 3CRNA 2QTBA 5T3XL 5L3QA 1BX3A 3L4XA 3QKSA 3V6OC 2OSWA 4RVBA 1TF5A 4JFDE 3EVFA 1JHTA 5HXAA 1OZUA 2N3JA 3DNPA 2VR3A 4UVHA 4PZDA 1KETA 3BMOB 1FP4A 1GSOA 4D3XA 4RTMA 2FK9A 4WI0A 1I8UA 5I5RA 4AG4H 1ND0A 3ARFA 3CH4B 2F8MA 4DUWA 5EJMA 2E37A 3ARDB 3N39C 3ZWYA 2TS1A 3UB2A 4M48L 2NQ2C 4I5FA 3EYOB 4KE8A 4UEJA 4QJ3A 3VI3F 1Z9MA 4ZUTB 2FVYA 5FR1A 4YHPA 2P5WA 2NP6A 4M55A 3E5RA 4LBEA 3NRQA 1OZGA 3V5KB 4P2QD 3P0RA 1PFGA 3A9SA 1XCGB 1J0CA 1G291 3KQNA 1EFTA 2WICA 3BZBA 2AV7A 2VN6A 1DLIA 2CEKA 3UZVB 2TMGA 5TE4L 5B4UA 2R68A 5FTLA 3PKZA 3GMPA 1PF7E 4IYRA 1FDSA 1PJCA 1PLGL 2H45A 2WQ8A 2Q21A 4F8EA 1EQAA 2VDWA 2B36A 2XY1A 1TZ8A 3NORA 5FCUH 2RSLA 1X5IA 2CLLB 3GG2A 4I4LA 4LBWA 2O93L 2MSDB 1UVQA 5A4FS 1PT9A 4DIEA 4NPCA 4E4RA 3BD5A 4YR6B 1C3LA 5C0JB 4KI0A 4U1RA 1DVQA 4R2IA 3RHZA 3UPRA 5D1XB 1N59A 1P8AA 1P80A 3H83A 4ZCMA 5I76A 3HW7A 4ONFL 4LAFA 1H4QA 5BQ7B 1WXIA 4NV0A 5I1HL 1W5AA 4AG5A 4BU0A 4JDTL 1YAZA 3A32A 4G8JA 4V24A 1S7UA 4ZFNA 4LU5H 5DCUA 4QEZA 4RJIA 3EIWA 4KFCA 2P4HX 4W5HA 1T0IA 1Z0JA 4QBIA 1ZITA 1KI7A 4G25A 2Q6OA 1H2WA 4YX2L 1U7TA 1A1OB 4DF3A 1ZNQO 5E7QA 43CAA 4OXNA 5H3CA 2I2AA 5T1DL 5BT9A 1CJTC 5A40E 3G1UA 5F9OL 2FDRA 2XNCA 2BPBA 5FYLE 2FQWA 1U5AA 5FEUA 1DFIA 3GIZL 3HG7A 5BV7H 4EOWL 1BXRA 2JFVA 5I4KA 4RGNB 5FR3A 5J3JA 1DCFA 3S5LG 2WSYB 4QAWA 2NXWA 2EQAA 3DYIA 3T41A 1XTPA 3L7EB 2QVFB 5FI3A 4XGZB 1L5RA 1VPTA 4D79A 3U79A 4WUUD 3UEQA 1VI5A 3KNBB 1GCOA 2UV8A 2NY5L 3EBIA 3SBWC 3DE0X 1Z6JT 3WGTA 1MVOA 4PJFA 1LO3L 3KSDO 2BNUA 1MFEL 1E1LA 3B7WA 5E4EC 2G36A 3KPNB 1BJTA 3V5NA 5IX8A 4CCWA 3E3NA 1T4CA 2NYRA 3N2LA 3A3PA 4IQHA 1O5IA 1D7DA 1EGJL 4QRSB 3VFDA 3H11B 5DO2D 1FNCA 5AVKA 1RLIA 4GZ6A 4A9AA 3KOXA 1S5PA 2OLEA 3LOUA 4Y2UA 4O9HH 1YN6B 2UUBB 3IJEA 1D5ZA 1ZV5A 1EU1A 4WEBL 1VRWA 1DZ3A 3T65B 4I18B 4OG2A 2PH7A 4G1UC 5TMBA 3I3OA 4PHZA 4JU9A 5A2BA 3IHKA 4KOCA 3QVMA 2FP4A 1TCVA 2XRAL 3LWBA 3O0RL 2WRZA 1XAJA 3LNTA 4PJDE 4NBYB 3SXJA 3FKSA 4G9FE 3TZKA 1JDPA 3V46A 4FXKA 2OJ1A 1QP4A 1I7DA 5J1TC 4DIKA 1E9AA 3T0VA 4P32A 2VHEA 4F8QA 2DIBA 1SKAA 2XCRB 1PZUB 1FP6A 4PGAA 3OL2A 4HIHA 1TJNA 3I3BA 4Q74A 1D07A 4G8BA 2C2OA 2BVQA 5AFAA 1RIHL 1OM3H 4EKEA 4NHUB 3AIOA 3ARVA 3CUWA 1E40A 3LV8A 5L4NA 3CN1A 5JW4M 1BFVL 4K8RD 3GJ6A 2WXQA 2DQKA 3RLIA 1JMYA 2F5BH 2C3HA 5FBZA 1YMME 5B53A 1N5MA 4R0LB 4Y19D 2F53A 1Q3KA 1E2EA 1DBMH 2CR3A 3CQFA 3HDGA 2VA8A 4KLAA 1NFRA 1C9SA 4M7ZB 3QNXA 3PHHA 1ASQA 1Z5PA 3OSZA 4WCFC 5AUOB 3WFIA 4JB8A 5ULLA 2UWEB 3O47A 4ZW3A 4QOGA 4F9FA 2YK1L 2HFFA 1UDRA 2B2XL 3NIGF 3M1IA 5FYLL 3MPOA 4OGXL 4O5LL 3PFKA 3QI9C 2BM1A 1XKQA 3T1NA 4YDNA 2EWVA 5ERYA 3T12A 3SWWA 2Y3AA 2BIPA 2HJSA 1IJEA 5CCJA 2DWTA 3MHPA 2R47A 1B4JH 2HA0A 4Z1MA 5JHDB 1CFNB 1YIOA 4YY3B 2I80A 3HH8A 5UKDA 1UAYA 3CGGA 4YRKA 4F3NA 2OYSA 4WWKD 1OH6A 3D0LB 1QRTA 4ECNA 4W6WB 4NFYA 4AQ8A 2V7HA 2HMVA 2GZ3A 2YZ7A 4HS3A 2Z5VA 3WY4A 4OBXA 3I5UA 5MEPB 4MVJH 1SM3H 4ZPXA 5FOUA 1YZGA 2B5VA 3O4JA 3QYAA 4JHVA 5JSUA 4LPXA 2FQ1A 3RBZA 3MD0A 3OXRB 2AZ4A 4TTIA 4HS6A 5IB4B 3W3BA 4D0RA 2PRSA 3U9PL 3PJEA 5LGHH 3HBMA 4QOIA 2SEBA 3CLVA 2Y0EA 4IINA 3U62A 4OQTH 2XV3A 3D7KA 1WHSB 3KQQA 2RD2A 1CWUA 2XY2A 1G6RB 3UMFA 3NMEA 4WTXA 2XIJA 4XM2A 2PS1A 4JH0A 4YQFA 1SIBE 3WFHB 3KOUA 1DGQA 2W6MA 2VM9A 2HWUA 2NMSA 3DCJA 1ZHBB 2NCMA 4U2EA 1IJKA 3HSKA 4OF5A 3KTAA 2Z7YA 3MRQA 3FBGA 1IEBB 4X7BA 2OTCA 3WGUB 3WNVA 1RJ9B 4P5SA 3VGHA 1NBWB 3NDIA 3VKUA 4J4PC 2Z91B 4MPTA 2QZJA 4Q7MB 3ARGC 3FUWA 2YR3A 4ZI3A 3HJGA 4C21A 2W0MA 2Z35A 4MJID 1F7VA 1EK5A 1B8OA 2J5XA 5AVYB 4LDNA 4OOEA 3EYUL 3AUXA 2XG5B 3VI4A 3LKZA 2QE7A 4JLJA 4D9JA 3F3YA 1RIVL 2PCPB 4EI5A 2VAXA 3HB4X 4ANKA 1JIJA 4KDRA 2JFXA 3BIKB 4X7FC 4X1OA 3LZ6A 5HHOE 1O5TA 1R46A 1XVVA 1FG9C 1P8JA 4URHA 5IB3B 1BD2E 1OAQL 3DS8A 4FOLA 2IUFA 3HOGA 4FFZA 3QO1B 5EVCA 4BK4A 3VU9B 5IEKB 2YOGA 5JDJA 3VR5H 4KLRA 1ZD9A 1BOOA 2YC4C 4MMZC 1V25A 5DBFA 4C4YA 3HA7A 1HLPA 3G02A 3QE5A 4ZAKD 3I2YX 3JQ9C 2ZT8A 5AG9A 2WT8A 5EI5A 3OKYB 3F3MA 4MEJA 4J8RB 7ADHA 3VVMA 3BEDA 1NDQA 1G2PA 1YH3A 4MWEA 1U1FA 2W8ZA 5GS0C 4MH0R 2F2HA 4XCCH 4X7MA 4KTDL 4ZBJA 4EATA 1PL6A 2QUIA 2BNQB 4X0EA 3L7LA 3OE7A 2VDKL 4HKJA 5U9CA 5FA5A 3D50A 2DAPA 3LN4A 1U7DA 3TIGA 3HJTA 4PJ5D 4BMZA 1ZA6B 3HS8A 3T0FA 3AVYA 4N68A 3F3KA 3M89A 4MVJI 2ICEB 2HT3C 3EX7C 1JRLA 3TNMA 4G72B 3T2LA 5SX5K 2WVGA 3I2GA 1QWUA 4JQCA 1F0YA 2YUIA 3DDUA 1W2WB 3AP2A 3BREA 2MRYA 4CV0A 4A1OA 4AO8A 3HR5A 3L4TA 4V1DB 1E5XA 1V3QE 5L8KB 3JTTA 1DUZA 3E48A 1GZDA 3PDOB 4Z4CA 1ECGA 3WELA 2IK8A 2NADA 2YUXA 1AI1H 1X5LA 3B8YA 4YCMA 3BTVA 4H7FA 3RAJA 5J4LA 4X8LA 3V5DB 2IH1B 3PQDA 2R4SL 5C0FA 1ZUWA 1CHNA 4JRXE 1EE2A 4B83A 2OJEA 5ECWA 5TX7A 2AQ1A 3X12B 1MO6A 1A5ZA 3OKMA 5HKKD 4RMTA 1MHPH 2HVJB 3KJGA 4NCDA 2G5TA 2AKAB 3OD5A 5E4JA 2PLWA 3PJFA 2WQSA 2Y4SA 3OKLB 4KNWA 4QU5A 4K2AA 4Y16A 5E2JA 3SM3A 2ZR9A 3DVAA 4BWFB 3LH2L 4N0FA 4GRWF 1V16A 4RAHA 4LSVL 5I16A 2BO0A 1KIMA 1T6XA 1AGFB 1I7PA 1KTVA 2YINC 3BKJL 1V48A 3LWDA 3RM3A 1DQIA 4RD0A 3IXAA 2B8WA 1VJCA 3C9NB 3CEAA 1TEGA 4RQBA 1N9ZA 4HEPA 5D1HA 4PB9H 3D0KA 4N3GA 2H2AA 2QX4A 3A11A 4NONA 5DCYA 3TLGB 4FBGA 5LXTB 2WJIA 4QICA 1FYEA 3ZTTA 4RTSA 3E6HA 1N6NA 1JWMB 3GPDG 1F90H 2VLRB 1AGEB 2RFXB 2A0FA 2ESRA 1LK3H 1GTJ1 3B9KD 4NJOA 1IRXA 4P7GA 2LU3A 2CL5A 3TLKA 4P86A 3WTYA 3NJ4A 5IMOA 1JR6A 3Q48A 4TV9F 3D4GA 5BV7C 4I2XB 4YCCA 3ICCA 1EFAA 2RMKA 5ITBH 1C7TA 1M6WA 4AYDC 5AJXA 2JKIS 3VD2A 3HMXH 4Q37A 2GM5A 3IO3A 1WMBA 4RZCB 1KI8A 1H23A 1OH5A 4Q0XL 2JFYA 2DLIA 3QRWA 3BRDA 3ST7A 1HFEL 1PFYA 3BGOS 4XI5D 1TM4E 3O2DA 3BN3A 2WV9A 3D6VA 1OZHA 3MTDA 4ZMNA 1KYTA 2ZYTX 4NE9A 2JLZA 3V2GA 3EBPA 1OJLA 4Y7MA 2GFQA 1HSAA 2GSMB 4M8LA 1I8IA 1GFSA 4II2A 1S3RA 4ZGWA 2VDQL 4LEXH 1WITA 4QECA 3TH2T 4N0UA 1GOTA 2FMXA 1FYTE 4YSAA 4YJ2F 1PBNA 4CKCA 1AHWA 4EENA 5TDOB 5KSBF 4WLOA 1U2SA 4G56A 4BQSA 2EDQA 4X5RA 3JVUA 1O94C 2ZOUA 5INDA 1A6VL 1U91B 3GSNL 2FEDD 1ONQB 5CJQL 3DXAE 3MRFB 5ETUB 1TOAA 3R9XB 3Q88A 3QQPA 3CRRA 2V6IA 2ASEA 4IPTA 1FP5A 2J3MA 1GZQB 1VENA 1UPBA 2A1TR 3TLBA 1H6TA 1I8AA 2ALWA 1J06A 4GLOA 4X3PA 4P3XA 2F6RA 1ZGHA 5LLIC 5AOLA 1KC5H 2P28A 4PNHA 4OZFG 1DKRA 4W70A 3KBFA 1KYOK 1EFDN 3TD2A 3QVWA 2E4WA 1NQWA 2X10A 1U9CA 4ODXA 4CIAA 2ZP9A 1HDYA 3UJAA 3MWEB 2CUZA 5ICFA 3KZNA 2EIZB 2Y7MA 2I9TB 1EB9A 3DMTA 4GI9A 1BXGB 5DHVB 4CGUB 4Z9YA 4JXJA 3QP3A 1PCXA 2PUBA 2OQRA 4CF4A 3VR4A 4OGAD 4KFMA 3B6MA 4BLRA 1USGA 1WZMA 2BFOA 1OXUA 1KIUB 4G2NA 4YJ3F 5FKPA 2EP7A 4Y6LA 4U3CA 2FL5B 2V9ZA 3A6CH 2XV1A 3PGVA 3GQFA 4WZ6A 3I75B 3G7NA 3FZEA 2Y67A 5ALDA 2KZBA 1W4BA 2XCOA 3HRKA 4A8PA 5C0CE 4FC3E 4RWEA 1KT2A 1P0CA 1AY1H 3BXXA 4NXSA 2CALA 1J0HA 2WSIA 2DLDA 3NFPA 3EPPA 4FFWC 1E9CA 5GV7A 4NDMA 5ALHA 3WJJC 2XKSA 3S8GB 4U6VH 4ZDKA 5EP3A 4PZ0A 3OG4B 5JOQA 2HFEB 5G0WA 3NHLA 3N40F 2REOA 3H2YA 1U2ZA 1GL7A 2I2BA 1AHIA 5I7SA 5KTOA 4EEZA 3ET4A 1PFCA 1OKKA 5F9OH 1X1TA 1DCLA 2BZ1A 1WV1A 5AW1B 4LSTL 3N76A 4PPYA 4WNAA 1GGFA 1VJTA 3QUBA 2DBLH 3CFJA 4GG8B 2V96A 5JHMA 3G5VA 1EGVB 1XR9B 1SVMA 3V8EA 1NGXA 1SQ2N 3IDGA 4IMPA 4P3NA 5ELIA 3WLBB 2E3JA 5CGYC 2GLUA 3ATFA 1JGEB 3WJ1A 3FHTA 2FH6A 1TUBB 3HCWA 3WTWA 5IROA 4GS5A 2CXHA 2IFGA 2VH1A 4NHCL 1IC4H 3U3OA 4C4KT 1L4EA 2G71A 1ACYH 5D5MB 5KSAA 2RGNA 3VNVA 3IMUA 4N0EA 3ISVA 3E2HC 2OOKA 2JFNA 3PWVA 4LARH 1BHQ1 1QEXA 4U39A 3AHEA 4RVUA 3L7FA 1F4YH 2XTAA 3UJ6A 1CQIB 1N2ZA 3BVTA 5B7FA 1AZBA 2V9RA 1EAYA 5BSVA 2HJLB 3S3SA 5KNLA 1P5HA 2SICE 1EJ6A 4AY6A 4HS9A 5F64A 1ES0B 1MQ8A 4C9BA 3AV3A 3U4MA 1ZJJA 3DTVA 1UPTA 3LRTA 3P2EA 5JD4A 3WNPA 1NCOA 3Q9QA 3PAUA 1NU6A 3WB0A 3K0KA 3TLAA 5T8IA 5L8JB 1ONSA 1SG9A 3NWPA 2R7MA 1KEWA 5SX4H 4F8NA 2VEDA 4RK4A 3NJXA 4CW7A 5DSCA 1R3DA 2YHIB 3GRZA 5C5EA 3G7UA 2I55A 4GSKA 4CMBA 4MQEB 1E2GA 5T1LB 3ZY3A 5BQ3A 4LK3A 1R3IH 4J6IA 4AS3A 1HG0A 4LK2A 5KZMB 2FR4A 5D9SB 3OQBA 1QRDA 3DSNA 3IR6A 3HJHA 4HUMB 4WVFA 1KK0A 2BF7A 4PGGA 5A4IS 5F35A 1YQGA 1W5BA 3EGEA 3WB2A 1M1YB 4K8OA 3FCGA 2A6IA 2EYSA 4WWKB 4ZEXA 1N7ML 2WAXA 4OI9A 1JLLA 5BN1A 5DQ9B 4C56E 3SE7A 4WKZA 2N0MA 5D7HA 4WZBE 4PJDA 1QTPA 4Q3AA 2ZDGA 4PWZA 2NT1A 2VLJA 1RUMH 1I3VA 4NAVA 1VFMA 4PRDA 2A99A 1DQVA 3TCLA 1NBAA 1YZTA 2O2DA 3T3MB 3A58B 4I5DA 4M6MH 2J3JA 2YJNA 4OV6B 2H5LA 4RV5A 3L2OB 3TMKA 3FRPA 4QDJA 3DWIA 1AKNA 5AW3B 2VC2B 2H4FA 2E87A 5J4YA 3IOMA 3QLJA 4M3NA 3G17A 1OD7A 3V2UA 4LOVA 1E69A 5GAJA 3O0DA 4UQ3B 5AW5B 15C8H 2VXVH 1G20B 1U6AH 5I24A 3DDWA 1PKOA 1MCHA 2JWHA 1U02A 2I1WA 4AQYB 1F4PA 1JPGB 1XGTA 1ANKA 1KBBA 1XH3A 2YGQA 3FYCA 3BTOA 1TM5E 2A6JB 1B6RA 2ZM6B 1TYAE 5EWJA 2G8LA 1EPUA 4MR7B 2HKAA 3K3QA 3KYKL 3C15C 2XCSB 1VADB 3RWBA 5J4KA 3ZVNA 1AS7A 1DQZA 4RH1A 2DMHA 2NN3C 3JZDA 3IC5A 1L5ZA 4MINA 4CC4C 1Z8DA 3WOHA 3OIFA 5IBRA 4DVJA 1WD7A 4B85A 4TQEL 1X5ZA 3TS8A 4TKVB 3FU3A 3RAGA 2MIZA 4M9SA 2VCEA 4TUJB 4M8QB 2CXQA 3W4KA 3ME0B 1HDEA 4PSDA 3DURB 3E7PA 4M61B 2CJWB 2W2VA 3B5GA 2W83A 2FSUA 3BQUB 2IYTA 4HYQA 5IMLA 2GTZB 3N06B 2OZPA 4PYLA 4PJEA 4NN6B 3VXRA 1XF4B 1YQEA 3ND5A 1G7IB 1BCRB 3FOBA 1R3JA 1OAKL 4GG6B 1IB5A 3D7SA 1RIVH 4K7FB 2X4TB 1A2YB 3ZGNA 1AC5A 2X8JB 2RH8A 4K5PA 1KXZA 4Q16A 4IV8A 3H75A 3CF4A 1OROA 3FVWA 1NLMA 3ENZA 4E12A 4YXWD 1HZJA 2RG1A 3F7PC 3HBLA 2Q27A 2F7QA 4I55B 4L16A 4XVSL 3RDTC 3SEFA 1A0QL 3N2GB 2QN9A 4L15A 5EJ7A 2H4JA 5ESQA 4MUYA 1PSKL 2K2QB 2OMXA 3MD9A 5AUNB 1S5HA 1N2SA 1FDOA 4IIJF 3DVNB 3FIUA 3BG5A 4YPOA 2ZQYA 4YCDA 4HATA 3PC8A 2R6CA 4WU5A 5FA8A 3OQ6A 3FMPB 5A62A 1CT8B 3OKAA 4EF5A 5T1MA 4D8XA 3G2PA 2BVTA 4TXLA 2FF5A 4PC7A 4I9HA 2Q3DA 2VT3A 3I0NA 2NTFA 2XX0A 3TYGH 1BGVA 2C4WA 4PS0A 2XUGA 5CBKA 4BVHA 2Q3ZA 1B0PA 1SUEA 3W39A 1QBMH 3NFRA 2HJHA 2B1HL 2JHGA 1QRNB 1PTZA 3SMVA 3UPDA 2BIOA 4KXBA 2VPTA 4N01A 5B1BB 3LF2A 5KNBD 1CI3M 3PT9A 4A8JC 3CPEA 1FCGA 2NXZB 2RHGB 1UUNA 4HF5H 3NRJA 4KRNA 4QVGA 4YCNA 1Z9LA 4Y9EA 1T9ZA 4JFHD 3MIZA 5LIRA 3C5SA 2NZ2A 4NNOA 3GSRB 3GG9A 4DNQA 3OQ1A 2J4DA 2OILA 5CFPA 4ODVH 2YUTA 3N42F 3HDQA 4UVGA 5CEZL 5DLEA 4PJ9B 3T4AC 1MCZA 3RNKA 2IKQA 1Q12A 3M34A 1AU9A 2G6BA 4FDWA 5K6TA 1P9MA 4Z0NA 3I62A 2ZX5A 3AGWA 1E6UA 2YMPA 3G23A 1EJ8A 4I4TB 3MINA 1XLTA 2FWAA 5B3JA 3M8OH 1E79A 2VATA 2F53E 1I10A 3B36A 4AYMC 1F8FA 2ADIB 3AAZA 2NYYC 4NO0B 3VU1A 1KCKA 4R1PA 2VHTA 3QS2A 2WN2A 1S8NA 4XOAA 2FUEA 4KREA 1MCSA 2WGXA 4D0GA 2Q28A 2YWGA 3M6VA 2WZ5A 3QUCA 1SXGA 2DM7A 3U7QB 4CEJA 2XE4A 3HZVA 1FG2A 1Z36A 4U7DA 5KS9E 1B4RA 5JR3A 5IDXA 2ZITA 3MTJA 5PNTA 4H2CA 2QTRA 3MLYH 3OKKA 3MWJA 3H2SA 1R8YA 1VIAA 4RS3A 4ND8B 4ML3A 2OESA 4RHUA 3QVGB 3KYDB 3QEQB 3C1AA 1PG7L 5HY9A 3PXJA 4OCXH 3DBLA 3VXTA 2WWFA 2R2BB 3M4XA 2HSWA 1GAFH 3G5ZA 2B78A 3RVVC 2C9AA 4HLJA 3S55A 1LQBC 5KWYC 1XTRA 2QQQA 3TU6A 4HGWA 3L81A 1CIJA 2QTFA 4WUTA 1E9DA 4L1BA 1KNXA 2BGTA 1D7BA 2NUTB 4CR6A 4M9PA 1JEJA 4MAYD 1FFCA 1PO7A 3KE8A 4POZC 4PPFA 2OZNA 1NCBH 4J8QA 2DLHA 5B1YA 1RE0A 4MD0B 5LUAA 2A83B 1RZRD 1QPBA 5DYOB 4HLZG 1IARB 4EJSC 3EZGA 4XCXA 1PDOA 4ZS6D 4ZI2A 4TZKA 3PE9A 3HN3A 4MXQD 2J6EH 5E5RB 1KSJA 2X7XA 2HG5B 1KARA 2Y0BA 3OQOA 3B9QA 3FQRA 1NEZB 2VXQH 4CJ0A 1EFQA 2IKSA 4HEA6 1HQDA 3GRCA 2X9XA 4H31A 1PS8A 1CFQB 1EBAA 5IXJA 4Z3DA 3ARBB 3I23A 4K46A 5CU7A 4OGAC 4LISA 4NX2A 4X4KA 5AW0B 2P35A 3LPDA 1FRNA 5HD8C 1F4XL 5GZNC 5DD0H 5PCYA 1J0DA 1SXHA 5GISL 1CFVH 1LKZA 4GMFA 1DVFC 3MRLA 2ZSAA 3AR7A 4HVAA 1NCCL 2V7XA 5DEOA 5AO9A 4C2BA 1PK7A 3IDFA 2PNJA 5I5GA 4OLJA 1XDBA 3HTLX 1A6AB 4UUQA 3UJ3X 5CCBA 4FM9A 3C8ZA 1GGYA 4E36A 2ON6A 4Y4HC 5FUBA 2GSIA 2GN0A 3SKYA 1TEZA 4ALAL 1KCWA 4JG0L 1W0CA 2QPFA 2A3RA 3LS4H 1H22A 4QLAA 2PGOA 5IP4A 1MAAA 3D25B 4ZT6A 4K4KA 1GGEA 3GFGA 4Y5VC 3SDCC 3KSAC 1TLTA 1OTXA 1A47A 4DESA 5CJ5A 3GLGB 2WVTA 1JP7A 4ZVNA 2ZIAA 2L7EA 3ECBB 4ZUVB 3ICEA 4JROA 3RDPA 5EEYA 1RK1A 3R4RA 2X9LA 3BAYA 3K4DA 1AKRA 5A2LH 2AUTA 1H6AA 4DFHA 1QYGH 1YKSA 3WQBA 5AG8A 4J29A 3V2AR 2FBOJ 4WI2A 4LGYA 3JWPA 3EARA 1NUFA 3FT4A 1TM1E 4MKZA 2OR7A 4OHMA 4B9EA 3FTGA 2XXFA 1MG3C 4OCSH 3HL0A 5C08E 2EACA 4GMTL 5CSZB 1O96B 1UXJA 1BAFH 1TO5A 1E1YA 1F6FB 1MWAB 5FM5O 3GIVB 3IPBA 4ZW8A 2DYKA 3PPSA 1PX0A 5BO0D 4Z7IA 3BILA 1QH9A 1VACB 3ESCA 2ZXFA 1INLA 3QDGD 4DQ0A 5ILQA 4XIYA 1E3LA 4E88A 4J3OH 3QUZD 3NIDB 4P3CL 3H9ZA 4MRVA 1NGWB 2A58A 4XDZA 1KJ2L 4NDAA 1I3GH 1I9JL 3I6ZA 5EOVA 1TRKA 2ZSDA 1Z0KA 5KYUA 3FBKA 4RENA 3EZNA 1V45E 5BWLA 1ZO8A 1RWBA 3OEED 4Z5RA 4H1HA 4DW2L 3O1LA 4L37B 3DFFA 4P5TB 1H9VA 3NG1A 2XNHA 3BEVA 3HCCA 1Z0DA 1O7SA 2FWBA 3OFJA 3FQXA 2GR9A 4EMSA 4J2QA 5EU6B 3ZYCA 3I9IA 4DLWA 1SHUX 1TZOA 5TE6L 3WKCA 3OC0A 2EXYC 3JUYA 3GSNB 2VLLA 3VZCA 5CLZA 5D5HA 4GRLC 2Z92A 1OKEA 3MZTA 2HIHA 4EIUA 1U3YA 1S0UA 2V58A 1TQTA 1S8DA 3CVCA 3T1QA 3BQUC 2ADJB 2H17A 4JDUA 4LRUA 4WI4A 1I8MB 2GZ2A 5E0OA 1N3LA 3CH7A 4WADA 4A55A 3KZCA 4XOIA 1K75A 2Z7WA 4NQXA 1QWSA 3VYWA 2A9CA 3G04B 1KFKB 3IUJA 5KPDA 4KHXH 5LHDA 5K3AA 2WTPA 5E1BA 3KETA 3OLVA 5CFOA 1M73E 1XAGA 3T77B 2GBLA 2Y2UA 1V7ZA 4MRCA 4KKRA 1PJTA 1Z5GA 3U6XA 2DPGA 3ZHRA 5DFAA 5IW8A 3V7NA 4P0TA 3LT4A 5AJTA 1H05A 1BJRE 1P5UA 3K0CC 4J12A 5KSZA 1BGWA 4XEHA 2BH2A 4D8PA 4ZPJA 4JT9A 2JKJA 2JNWA 5E9DE 4R6UA 4M93C 3DHMA 1PT5A 3PC4A 1UWLA 4DMCA 1A1NA 2OO7A 4D4IA 3J7TA 3K0AB 3E1SA 5ADOL 2ZBQA 1QTRA 3O4LD 4M6NL 1RPQA 2ZDHA 1G84A 5I19L 4EGQA 3Q5EA 4ZICA 3BHMA 3FYIB 3CFIC 2BNRA 4MW2A 1YQVL 1G43A 1G0XA 3CHRA 4ZMYA 3EZLA 5LBSH 2UZPA 2JH2A 5GS0L 1PQUA 1IQWL 3CLUD 3D30A 1Z06A 3IKLA 4KMTL 2VWEE 5MEND 4HSEA 3AUSA 4JUBA 3V4PH 3VXSD 3RHFA 2DQJH 3BC9A 3RIXA 1XFDA 3KZMA 4QXTA 2A33A 3SJCA 3RC7A 1YOVA 2A14A 4PZPA 3GMOB 1KBGL 4WGKA 5HVHC 1UM4H 5CLQA 2B59A 3EYSH 4UU0A 3SNHA 3LXBA 5HTSA 5HDBE 1GVNB 2ZX6A 4AL8C 4Y3UA 1AVTA 1C9NA 1P0SE 1N7JA 5LR6A 4KC3B 4YALA 3JQ8B 1DJZA 3SE6A 3FXAA 1WUHS 2DQYA 2IEYA 5F2KA 2P9GA 2CPCA 1DSFH 4O51A 3TIVA 2ZWYA 4KKBD 4MCYB 3UFBA 2REBA 4M4SA 5DX8A 4OJYA 3AY7A 2IH3A 1VBFA 2G7MC 2W42A 4PM1A 3AESB 1ODCA 4PRIE 3FTPA 1AD9A 4JFEA 4FX2A 1E6LA 4LNRB 2WNIA 3OMWA 3L1EA 3SDBA 1YNSA 3F7RA 1KQ3A 4JFPB 3ABQB 1LPNA 4QQRA 3ZJYA 3V0EA 4LJAA 4BP8A 2AS5M 1VLJA 4MIYA 4QD3A 3M9XA 3HZMB 1E6EA 2JJTC 1E1NA 4XCNB 5A2GA 4CHTA 3MEQA 3FE2A 5EZYF 3SX4A 4EXPX 3MNVB 3I6YA 1QR1A 5K39A 3PEFA 2ET6A 2FBJH 3TZVD 3RV3A 4LKXB 4APQC 3DPDA 2GUYA 4TNGA 4OLXL 1KCBA 1VKXA 1DBVO 1LBIA 5CEZD 4G4JA 5CLYA 4UTBA 2WIIB 4OM1H 3JV4B 5KS2A 2VHQA 1NJ1A 1Z4JA 4HEME 1TTRA 3DV2A 2ZR0A 1VFNA 1YS4A 3MNWB 3AYZB 2VSKB 1WXHA 3GY0A 2G9HA 1E7MA 1JG1A 2BGWA 4HKBB 1A88A 4YO0B 1HWWA 2LU7A 5LZ9A 5BMFH 1L9OA 4H40A 2IZOA 4EJSB 3WLIA 2OHFA 3DYBA 3D81A 4C4ZA 3BUYA 4YDKH 1EVUA 3HKBB 3JWNE 5HCNA 4PG8A 3ZTNL 1CIUA 1KS2A 1GPJA 2XG4A 3VFWB 5HGXA 4L72A 1A65A 2J0VA 1A7QL 1SVOA 2HUEA 1KN2H 2MEJB 1A0QH 1JQDA 4K05A 2YFKA 2H7WA 1D5IL 2GPWA 4WUUE 3OESA 3QEKA 3MUGB 1FGNL 1I8LC 2P62A 2ZIUB 4B33A 1M8GA 1XN4A 4DDMA 3AR9A 4KKNA 1KOFA 3L45A 4BZ1L 3FWZA 2XB8A 2ZIDA 1T2QH 3WE6A 4J3XA 2ALJA 3TBTA 2QIOA 3FO1A 3RJ9A 3UJCA 3MLWL 4R68A 4D2NA 4DW8A 5AUMB 2ZI7A 2RONA 3FDJA 2V03A 4ND4A 2YXNA 3B7GA 1CLOL 3H5LA 2CXNA 5G55A 3MB5A 1CUZA 1MPAL 3BGVA 1QSEE 2NTYC 5DBIA 1A97A 1VIDA 2PG3A 4AQ1C 2OCKA 2BDTA 2JGNA 1J8QA 4DCNA 4KTGA 3OU6A 4PY7A 3IVKA 1VA9A 1Q0YH 1RSFA 5HX7A 1OAYL 4TSAH 2Q2VA 2LP4Y 4I5EA 1OLSB 3L0ZA 2QG9A 4I0KA 2BNQE 4FQ1L 5KKAA 4BL5A 4ZJ9A 3WLSA 3CJRA 3TIEB 3V3TA 2AJSH 1AZTA 2EIEA 5AOMA 1JT2A 4JJOA 5IMBA 4B3BA 4LF9B 2A9ML 3DO3A 3ABLB 3IPRA 2UXTA 1X94A 1I7RA 2PKCA 1EIBA 5IKOA 2X40A 1FQ9C 3BMVA 3NSDA 4JKPL 2NPFA 3WMXA 2BD0A 3OO1A 1CYGA 4XYMA 1RZVA 1FL6B 4OJTA 5DRWA 1DG1G 3GUUA 3KCQA 1RC0A 5EZIH 1T03L 4QSHA 4OMFG 3VR3D 2PW1B 1DIOB 3ZU6A 1ROCA 2WVAA 3VXPA 1PJ4A 3GLRA 2AA3A 3EE6A 1E9VA 5DVKA 1RYZA 4G8EB 1GQYA 2X2HA 1OU0A 3FHAA 1TI7A 4X4MA 5D6CB 2GXUA 3DG9A 4U3SB 4ZHSA 5I45A 4JJ5A 3NCFB 5KG9A 3UTZA 1KCLA 1ZM7A 3KQVA 2AOTA 3T3NA 4XNBA 1JF1B 3IDSA 4FXPA 1IAIH 1Z9NA 2BE7A 3IDIB 2VDKB 4HWRA 4CDMA 3FKSD 4UQPA 4AEIL 2OFOA 2IEPA 4BFLA 2PWFA 4W4NA 2OD2A 5IJBC 3F8SA 1H3NA 3EQ2A 1ZANL 2ZIGA 4BH8B 3KQHA 4XVTL 4ZSOA 3R4CA 1N2XA 4A39A 3QLVA 5E9WA 3X11B 3W34A 1OLZA 3RY6A 3TV3L 3WQHA 3WMFA 1PZDA 3PDIB 1TM2A 3H17A 1FMCA 1ST2A 2PGLA 1LD9A 2QM7A 3U13A 4XPGH 2C9MA 5ES4B 4N39A 4ISBA 3THWA 1JH8A 1U8KA 1UQSA 2AD1A 1K9TA 4L4RA 4K3VA 3REQB 1IM3D 4OUUA 5I5EA 1RHQA 4PWYA 2XTJC 5ISZE 3HIZA 4DKAA 4N7MA 4U49A 3CDYA 3G5TA 4NC9A 4RA9A 1CS0A 1H2AS 5JQGB 1Y6FA 2FW8A 3CH6A 5CBAA 4JY6B 1XMWA 3FZYA 4U7SA 3OF6A 3CVIL 4DK6A 2I24N 1NLBL 3DTXA 3EAFA 4HB2A 4JP5A 3EFDL 2DPMA 2DXIA 4W1QA 3DK2A 1EVEA 1XVIA 3PRYA 3ULUH 3CW9A 5KC8A 3K9WA 4NKMB 1CICD 4ELKA 1AE1A 1GNPA 3SU8A 1EUQA 3K2UH 4FC6A 4IIGA 1HOEA 4MZRA 4YRZA 4PN7A 3EFFB 2IU4A 4G1FA 1CICC 4EGFA 3KYJB 4Z7WA 2FPLA 3NZ8A 4GG6F 1NIPA 2ZI9A 3VG0L 1PZ5B 1EBBA 2RE8A 1A9VA 3HG1E 2OM5A 2DQEL 1D8AA 4ZX4A 3JT2A 3SX0A 3UJJH 1IBCA 5BR4A 3J27A 1FTWA 1UK7A 1YR6A 2JLBA 1REQA 4JC8A 3TOXA 4Y9RA 1JJFA 3Q6IA 1OTHA 2DLNA 3PB3A 1NOFA 3PHQB 3GXTA 1JPTH 2KHZA 2ZYIA 3OPMA 4OF7A 1XVUA 3PIDA 3ARFC 4B3XA 3UACA 1W9HA 4WZBB 1KB5H 5LO7A 2J0QA 1UZ6F 1OC2A 2IE8A 4TSFD 2BHLA 3ZIAD 4UEKA 2I3BA 1LDPL 3KYNA 1YWGO 5K1ZA 3FY4A 3BPSA 3JQPA 2HU7A 4QATA 2CVPA 5EGNA 3NJKA 3ZIMA 4TKMA 4UM8B 5CINL 4QCIA 6FABL 3QVLA 3QULB 4JFDB 3IDJB 2VDVE 1Q7TA 2Z6AA 4DCQB 4PRHD 4GQZA 2TRSB 1FYVA 3D4OA 2ID7A 2VISB 3U46A 4BAGA 4MDIA 5F1NA 4Q1EA 4JRLA 3E18A 2OMEA 5BV1A 1CBUA 3IRVA 5H35B 3HE6A 4HDNB 5AAPA 3QBDA 4HH9A 3KXIA 4WT7A 3SD7A 2WAAA 4TNVF 4LE2A 2W07B 1C29B 3IA7A 1E4HA 1D03A 1KCRL 5I9BA 2Q1SA 4TTPA 2P4UA 5C18A 5E2VL 3I12A 1FFPB 3GB7B 4JJ4A 4JX8A 3D3WB 4F4FA 1XPUA 1NBOA 1NVMB 2XADA 3LFUA 4XBPA 3A25A 1FIGL 5E5LA 4M6WB 2PXHA 2JCCA 2KLBA 4BZPA 4ZRNA 4FNTA 1IATA 5D1QC 3HB1A 1IJ9A 2IH9A 1Z2EA 3GI9L 5C0DB 4FJYA 3S0PA 3IOYA 3D51A 3OHMA 2NYAA 3PQ6A 3HSYA 4ZWNA 2WJVA 4HGQA 3ZLQC 5L6MB 1TTTA 3NBUA 2WM9B 5L4SA 3EUUA 1I1AD 2GZMA 1JI0A 2GEQA 4X99A 4XVJL 3V48A 2XKJE 4MULA 1PW3A 4L3CB 1Q44A 3JXAA 1SELA 1JK8B 4AUYA 2Z1PA 1K9VF 2NY4B 5A5EA 4LB8A 3BXPA 3JWDL 4LVNC 2EYQA 5TV2A 3T4AA 1V96A 1AJ7H 3COSA 3H3JA 2W2KB 2CJPA 2Q1WA 2RIKA 4JM2F 2HLDA 5IAGA 4JU8A 3IB4A 2O3RA 2CYAA 1JF6A 2VNCA 3WMPA 2FMFA 5GM2A 3M17B 2W0KA 4BX2A 2CDRA 4ZAWA 4HQKA 2G1PA 4V0MA 1EHLL 1YRYE 1ZI6A 4IZ6A 1OAJA 4O2CB 3JSXA 4ND3A 1SYVA 2AK1H 1Q0UA 1PZFA 2LTQC 3AGQA 2JB9A 4F8PA 2DB3A 3BWUC 5HJ2A 1X7XA 3B9PA 4MJIA 1HO3A 5BS0E 3A4IA 5AVRB 2CV2A 1TZIB 1RACA 4L78A 4FNSA 2W94A 5KEIA 1JWUA 4MO9A 1FL3A 1HG1A 3QOXA 4MMYB 2JJ2D 4EAQA 4DWHA 4LIPD 1TIUA 1Q11A 4QRRA 2YGVA 1NL0L 1H3VA 3P9ZA 4X60A 4GFDA 3JRXA 4LGRB 1YQVH 4WFJA 5K8CA 4F9LC 3MMEA 2XFXB 4NJAL 2VWHA 1N6QL 4NNXA 2J3KA 3R76A 1R9JA 4GUQA 4AC4A 4BUJA 4ZQKB 3NJVA 4RISL 3C3CA 1YUKB 1ZIXA 1T10A 2HNBA 1GNQA 5IMKB 1K7FB 3BULA 1JAZA 3X3GL 1NF2A 1RI5A 1BS2A 3EOZA 4JZKA 5EOQL 3ABRB 1USQA 5JW5A 4B74A 1PVHA 1UM4L 4NUGL 3BPOB 1GHTA 4TTGA 4RK0A 1XZPA 2JGDB 1VIYA 1U3HA 4XN4A 3TTSA 1MGOA 1RC1A 3OHXC 5TDNA 1M10A 2UVFA 4YWHA 3LC0A 4PZZA 5ITZA 5HVWA 2F48A 5T33L 3KXFE 3OB8A 3OM1A 2PMZA 4L0ZA 1N92A 4XO5A 1HH6A 4JZOB 2QT0A 1M2WA 4L73A 3QQ3B 5DNWA 4LTDA 1AGNA 1NMAH 2DTMH 4NZMA 5DR5L 4C56B 2R1YA 4F3YA 1DARA 2JLAA 4DA0A 5IV2B 4EVSA 4KVAA 2D3WA 3AJ7A 4HBQA 3SXPA 3CNBA 2Y06H 1FNSH 1YY8B 2E76C 4MXWH 1BA3A 1W581 1USZA 2R1ZA 4ZT3A 2ZS8A 1Z08A 4RVCA 1M2OA 3OZLA 4NP4H 2RJ3A 3MRDA 1US8A 3WC4A 2ARKA 4OHWA 4RAOA 4H7HA 4RTRA 3W5MA 4CU8A 3HS0B 4MI6A 1IGIL 2DMBA 5M29A 2R8EA 4ER0A 2Z93B 2Q8PA 5D93B 4LCIH 3VFRB 5C0AE 1K7EB 1XMJA 2YD1A 4ELMF 4MP8A 4UQDA 1GYQA 2WWXA 4FGJA 1ES9A 1HKUA 2I7VA 1L9TA 4PG2C 4QWMA 2VHUA 2X4RB 4ANVA 2ATAA 1WBJB 1O75A 1HINL 4EI8A 4Q7DA 5IBUB 4FCWA 3T5MA 1G8FA 3OKCA 1EO7A 1Z12A 3HNSL 3EBOA 2AQ8A 2D5IA 4GXQA 5A7BA 3TLZA 4U2BA 3V52L 1C3VA 2P3LA 3DA8A 2ZWOA 2XUAA 2QY9A 4PSRA 2OENG 2QJOA 3WL3A 2F08A 4O02B 5HHVH 1DCKA 3A6JA 3WDKA 4U1KA 5BVJA 1QLRB 5IWLC 5F1OB 3TXXA 1ZH8A 1WAEA 1Y4UA 3PYLA 2BSQA 1J5XA 2CY0A 4KK6C 3PNBA 3QEHB 2FO8A 3ELDA 4AWXA 3KT6A 4LVHC 2A5DA 2CHGA 1I94B 1EA7A 5IZCA 2H54A 4NSNA 1BZ9A 4EZEA 4G1CA 1PZGA 2ACWA 3LQZB 3BJMA 2VO1A 3P19A 4R5HA 5CCXA 3BVUA 3N41F 2ZRAA 3HJUA 3HXLA 5AL8A 1UFOA 2QKYA 3N59A 4HXEB 3GRVA 3OUTA 1OCEA 3R2JA 2BFAA 3H87A 1RI3A 2CHXA 2PWBA 2LCQA 3U9WA 4R2LA 1C1YA 16PKA 3ZE2F 1P19A 5EU6D 4DADA 3OO0A 5L2KE 1PGRB 1WXEA 1JR3A 3KL4A 2FEJA 1NTOA 4HYYA 3FCUB 2R48A 4OHBA 2A77L 2JARA 4KUZL 3I0MA 1XSKA 3EIHA 1J9ZA 2DY0A 5D7KD 4L5FE 5FXCH 3OEYA 1R37A 1THGA 4N24A 4P3WA 1XCBA 4MA7H 3PQ8A 1YCSA 1EP1B 4PG9B 5D3MA 3SLRA 5DI3A 4XB6B 3C6BA 1OLOA 4S05A 4PGCA 1CP3A 2KI6A 1Y37A 2C9QA 1YEEH 4JY4B 2H8PB 2QEQA 2VKQA 1QS0A 2B1JA 1BM3H 2FYYA 3FDZA 3T5CA 3OZTA 1ILSA 2AG1A 1H5BA 2XCMC 3WKEA 3E9UA 3S8MA 4BASA 1SWVA 1EANA 5HJ3B 3BQNB 1JE0A 1U2EA 1OGAA 1T0NA 3OICA 4CDRA 1UM6L 4DLKA 3LLVA 4E9XA 2Y92A 1A82A 5L2JA 5GGSY 3GP8A 4KLCA 3QCVH 1RJFA 1ZQ9A 5B36A 1GLVA 4JFTA 5FYJL 3IU3B 1YUBA 4G5GA 1ODLA 1NEZG 4H18A 1M6HA 3OJWA 3UP1A 2HM7A 1KNQA 4XIJA 5DF0A 3VSAA 4E15A 2DHQA 2FGJA 4FLEA 1U9IC 2Q7AA 1QGAA 4U0JA 1UASA 1Z4QA 3E15A 3T5PA 2NZVG 4Y4KD 2X6AA 3LUGA 4ZFZA 4RLDA 3DZHA 4EIBA 5EUBA 2ZX9A 3DOSB 3P4OB 3GEWB 3NYIA 4PJXA 1ZMBA 2VDNB 4PQYA 4Q6BA 5C92A 1V8FA 1WXXA 3NSYA 3BSSA 5FL7A 4JVUA 4EVNA 3KR2A 2WWVD 1CGUA 3D1MC 5I9LA 1QDLB 3LRSB 1UOQA 1PY9A 1ROWA 1LUAA 3B9VA 5JATA 3FUUA 3K2IA 1HY3A 4X6UA 3RU2A 4NE2A 4I6EA 4LEXL 1N64L 5E1DA 3KFXA 1MWAL 3ZQWA 4JRYD 1TQHA 1S2MA 4A2WA 1E1KA 3BISA 3QI9A 5C2BL 5L9DL 3UTTD 4TNWF 1NLZA 1Y6NR 1HWGB 4MKIA 4S1QL 3O3AA 2HK6A 2XKBA 3WXBA 9MHTA 5HDBF 1QA9B 5E8DH 3OT1A 1OVGA 5BSKA 3WFBL 3FJ1A 1G5AA 5D1XE 2I8LA 5LQUA 1HMYA 5C5IA 3OZXA 3RI3A 2AOUA 5IIEA 2W5UA 4P46C 3K1TA 3FCAA 5E6SA 2D7JA 4ZXBD 1ZIOA 3LKQB 1OV8A 1BFDA 4L3OA 3FULA 2J3LA 1IB6A 3UTTE 1YEDA 2LNDA 3CYFA 3LBIA 4JE4B 2B14A 3ORJA 4LEEA 3MUNA 4HJJH 3PJGA 3JWHA 5I1LA 4PWJA 1VB9A 3KHOA 3GI1A 4ABUA 4PTUB 1G7PA 5DVLA 1AE6L 1ZWIB 1JJVA 2WVVA 4UQ9A 2DQMA 3O4LA 4TS4A 1LZLA 1WPGA 2QVGA 1Z29A 4JFUA 5B1CA 2P3OA 2FX8H 5K0LA 1QQAA 3HPJA 3GSQA 4TNWK 3AETB 4KPHL 1EQWA 2RG7A 2HLFD 3UTSA 3TTTA 4C54A 1ND6A 4B1FA 4MAYB 2JASA 4PRHE 3DLPX 2F74B 1DDHA 1MFAL 4HHWA 1MX5A 2R97A 1WCWA 1IAKA 1TYBE 2H5JA 3I05A 1N8ZB 4BNMA 4LQDA 2Z4TA 4GRIA 4EPTA 1BWSA 3HKFA 4H1UA 2HTLD 3UAJD 4J7UA 1QIFA 4HJIA 2QX8A 2GK0B 4RAVA 2I07B 1GVHA 1EDYA 3TECE 4R8WH 1L1QA 4DCUA 1LLUA 3IKVA 3ZQ9A 4RIRA 1TT7A 1A7OH 1CG9A 5EJIA 2AF4C 4BMPB 1YEIL 2VO8A 5B2ZA 1EEQA 3V2IA 4K9KA 2E59A 5SWZB 1LWJA 3N75A 1FYHB 3MMNA 1SZCA 2OMNA 4X4YB 5KVFH 1FFQA 4RTQA 4HFUL 2CCKA 3FK3A 4RX1A 4HAXA 3BAXA 4AXBA 4QRQA 3V9EA 3HB3B 3ULVH 2ZF9A 4AS1A 3KW8A 2NU9B 2YWCA 4BVJA 4F9GA 1MP0A 1DLHB 1LO5A 3V6MA 3HAEB 2R8YA 3U5TA 2VHWA 5C0AB 4B17A 5REQA 2NX5D 2GC4C 5K1NA 4N5UA 2PKYX 2VW4A 4OFZA 4PIMA 2VTBB 4YDMA 1R00A 5C0GB 1GTNA 2F18A 4D92A 1T34A 1OAOA 4PGMA 3LZCA 4DRXB 3PUJA 4K40A 5JUWA 4S0SD 2DYPA 3Q2VA 1CPUA 1J5OL 3ABOB 3IKCA 3EG9A 1IY9A 3G8CA 2D4HA 1PAMA 4LNUB 5LNDA 1HI6B 5B55A 3HCOA 3WWZA 4NY1A 3T6XA 3DE4X 4BQNA 4YHNB 4MJ3A 3SZOA 4NC0B 3S2AA 1B0WA 5J5EA 4P3YA 1SY7A 4YHOL 3GXUB 3HWSA 2VSFA 4PRNB 3R9IA 2ZKLA 4GZMA 5DCCA 5I7RA 1KGCD 1JFFA 1QKKA 3IIIA 1CRLA 3L4UA 5HNKA 3PRKE 5AD1A 4R1TA 4YRBA 4TZTA 2JGMA 1W0WA 4QG3A 4IR7A 1QX4A 3QSGA 4B5LA 1UM9B 4UIMA 1VJ1A 3NZEA 1T3ZA 1U94A 1AANA 1KR2A 3QUHA 3KFVA 4GP9A 1R3IL 2BOCB 4Y9SA 3ZJ4A 1C2TA 1ZK1A 3L05A 5TARA 1NCAH 2HMAA 3TGPA 1JBQA 3QQNA 1FUIA 4K9QA 3DVGB 5DEIA 4ZOLF 5HI5D 4EPVA 3BKCL 2FZWA 3HHEA 5DYYA 2OAAA 4HDIB 6PFKA 5DZSA 4IMJB 2IWFA 2JFCA 2APSA 3ZKXC 5T3ZE 1G6VK 2B5IB 3BAEH 1KY4A 3DYOA 1E7RA 4AX8A 2D3LA 2PO7A 1ZG3A 2PMFA 1J1XH 3LP5A 4NCJA 5B1EA 2VLBA 2OKCA 2V65A 1Z5LB 4PRAB 1M6UA 2BGIA 1RFDH 2X1OA 3EA4A 2EXTA 2QDVA 1S3KH 4GGPA 4OZHF 4KQ2A 4R2KA 5C09E 1SC1A 5B1JC 3BZWA 1HE2A 3V6BR 4URYR 3OA0A 3TX6A 3SZKC 2WPDA 1P60A 8CGTA 2FJFB 3OMXA 1XTLA 4IDLA 1T1SA 3BSYA 4WJ5A 1JECA 3FB8A 1EMTH 2BX5A 3DTVD 1JVOA 5D7LA 1SQ0A 3B2NA 1JR2A 4UHCA 4OTXH 4TSFA 5C6PB 2CJXA 3GDHA 1LDBA 3F7KA 1TFPA 3WY9A 2BOLA 4IJ3C 2HR1A 2OJZL 1E4WH 4XNAA 1UOOA 4JLWA 1NBMD 4C43A 4AQAA 3TW0A 3KAKA 1ZOIA 2LHAA 1YCDA 4EY4A 3RPKA 2CVOA 3L3DB 3CHSA 4U6XB 3RY6C 3R6LA 2X6CA 4FI3F 5C2JB 3AXHA 1I1FB 3GEEA 3L3JA 1ECJA 1QUPA 1NHGA 2ORBL 5AT1A 1KG0B 2YBRB 1RJDA 3LHKA 3O7WA 2FSGA 3U4DA 2XZQL 1WWWX 1YEFH 1QC5B 3U7HB 2O6EA 4WNCA 1WUNT 1A69A 4Q1FA 1RZKL 3RVRA 1H6DA 4MGZR 4RQAA 4B6RA 1TTUA 1C4WA 3CC5A 3R40A 2J31A 3VR6A 2PGNA 1JHYA 1V4NA 2VKTA 4FTVA 1P2TA 2VTEA 1UKEA 3ZY6A 8LDHA 5A1AA 3K8OE 4KGXA 4DQLA 1PW5A 2W6OA 1T66D 1OQAA 3HLAB 1E3EA 4XBMA 5JWRA 1DQQB 2WTBA 2FZGA 4PJEE 5JAHA 2J5RA 3WKML 4D9GA 2BFWA 1XDDA 2EX0A 3ZIUA 3LCYA 2OZLA 4ALMA 4S1RL 1CCZA 1F56A 2CMKA 1D9KC 2DTEA 1NCUA 4N20A 1TUIA 2GABA 5AOIA 4DMKA 4ZXBB 1OXKB 4Y1SA 4TGLA 1LP9B 2D8MA 4RVGA 4CV2A 3IH5A 1G2OA 2BR5A 3IKJA 4TVBA 4OTZA 3VD1A 3TF7C 3H7IA 4QFMA 1IC4L 3FZUC 5C0RH 4XUEA 4K28A 4HXAH 1HTYA 3BW9B 2A8YA 3MPUA 4JFDD 1Z45A 4OM8A 3RLFA 2FCRA 4CIBA 3R3HA 5CLWA 3U4KA 3EADA 3ZCPA 3COOA 4JRXB 3VC1A 3F7MA 3WK9A 3P45A 3KCPB 4HEJA 4PO9A 1WXGA 4Q5IA 5EE5B 2JI8A 5IT2L 3JQ7A 3MQFA 1S5IH 4JFYA 3POHA 2ZEJA 3MV9A 1I4OA 4RGOL 4TWIA 3BZ4B 4TVPE 5FFLA 4B9FA 5K3BA 1IVSA 1P5VB 1QP7A 4HMDA 4B8YA 4O2BA 3VXUB 1K3FA 2IYSA 1NI4A 5LP1A 2ZE8A 4P5RA 4NOLA 3T9CA 3HKCB 4OMCA 3F90A 3B9RA 4RA3A 3WEBA 4P22A 1P0IA 2EHDA 2N59A 1W2GA 1EFCA 4G0NA 1GQQA 3GFPA 4XGIA 3PXEA 1DAFA 1EERB 3P11L 2PMEA 5ICEA 5B57C 4ZTEA 1BEXA 5A6SA 2VZLA 3QWRA 1X19A 4DKTA 5IQNA 2VDMB 4FD0A 3GA5A 2Q5OA 1G6RH 4U6QA 3QJGA 3Q1SL 1HURA 1V11B 1XF9A 4GIPD 5GJVC 1D0IA 3V1LA 2FEOA 4FDAA 1RM3A 1RYBA 1NC2A 4LE8A 5ESRA 1GNLA 1EZ4A 3ZQ4A 4BP1A 1ADQH 5F3BB 1TLKA 5KTEH 4DNFA 5EN2A 3VXRD 2HT3D 3QEBZ 4NOFA 4K6OA 3UYRL 3S7TA 3MELA 2D0HA 2VR7A 1U5BA 1NGSA 2EDRA 4WV3A 5A5DA 1CU4L 1QSFA 5JHHB 1N6RA 3HEIB 4DLPA 4HC1H 3BH8B 5HK9A 4NNPH 3L7NA 1IBDA 1E3WA 5FP0A 1WF3A 4APXA 3CKYA 3EYQD 3KKPA 1ZNXA 3QXDB 4INZA 2ZRQA 3C7CB 4YXHL 3WWDA 4RLQA 5K2OA 1IK4A 2RAVA 2JH8A 1GQOA 5E6YA 2HMYB 4J3FA 2FWOA 3T2NL 5G1PA 1S1MA 1WSST 5A9SA 4A6XA 3EO9H 3KHSA 1J39A 2FZVA 4YL4A 4AM0B 2PXYC 3CF0A 4QYIB 4XNMB 2JDIA 2ITDA 4IJWA 4IBWA 4AG6A 3I9FA 2JGFA 1EHAA 5AAMC 5KVGH 4X5LA 3PNKA 3WS3B 3CTTA 1HFKA 4AV4A 1HOCA 2DPXA 1ZUNA 4AT1A 2PYIA 3FA2A 1K3UB 1JNNH 1NSTA 5HEKA 4D45A 3ZWMA 4O4HA 5BOPA 4E9VA 4PJAE 4GPIB 4UCWA 3ESQA 3IE1A 2VDPL 1X9IA 2QRNA 3W82A 4RA6B 1FFOA 1NUNB 1E2JA 2BP7A 1X9GA 3CWCA 3JVGC 2BJHA 4OZIE 2DQIL 5K0NA 2JA1A 3Q8KA 2BCKB 3ZE0B