3ZE2B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
469
structure length
469
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 115
structure length 469
sequence length 469
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze2B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze2B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze2B03
5KYWB 3VI3B 3RAGA 5E6UB 5HDBB 1M1UA 4WK0B 1BHQ1 3TCXB 3EH1A 1CQPA 3EOBI 4WK2B 3NVQA 1IJKA 1DZIA 3N2NA 3OL2B 3OKYB 4MMYA 3EH2A 3F74A 1M1XA 2IUEA 5KYXA 1T0PA 3EG9A 3HXOA 1M10A 4K3JB 2P26A 3FCSB 3EOAI 1XUOA 1SSLA 4HQNA 3ZE0B 5E6RA 4WJKB 1YUKA 4HQFA 3V4VB 2P28A 2I6QA 3T3MB 1SHYB 3EGXB 1RRKA 3GXBA 5HJ2A 4CNBA 4O02B 5E6SB 2NUTB 4Z7OB 3HI6A 5KYYA 4M76B 2O7NA 3AFCA 1MJNA 3BN3A 1ATZA 5KYUB 1BHO1 3TW0A 1FNSA 1QC5A 1RTKA 4NENA 2I91A 3HXQA 1NA5A 4WFQA 3AL8B 3PPXA 3K6SB 3EGDB 1AUQA 1T6BY 3K72B 1JV2B 1L5GB 1Q0PA 1U0OC 2ODPA 4C2AA 4MMXB 5LN1A 4C29A 4NEHB 1IDOA 4G1MA 1M2VA 4FX5A 4A0QA 1OLZA 1SHTX 3M6FA 4G1EB 3ZE2B 4O3TB 1JEQA 1UEXC 1JEYA 3PPVA 4GZ8A 3Q3GE 1PD0A 2M32A 1QCYA 2NUPA 2UZYB 1PT6A 3ZDXB 2WINI 2XWJI 4HQKA 2VDLB 5E6UA 5KYWA 4FWWA 1FE8A 3FCUB 3BQNB 3K71A 1N9ZA 3IJEB 4MMZB 3QA3E 1N3YA 3OL2A 3EFOA 1OAKA 2VDQB 1MQ9A 3FCSA 2QTVA 1PD1A 1MQ8B 1RD4A 3AL9A 4F1JA 2VDPB 4MMYB 2ODQA 3VI4B 5ES4B 1M1XB 4XW2A 4CN9A 3BQMB 5KYXB 3EGXA 3EG9B 2VDOB 1LFAA 4O02A 1M2OA 1IDN1 1ZONA 5E6SA 1U0NA 5HGJA 2NUTA 5KYNA 2VDMB 1SQ0A 1MHPA 1M2VB 1U8CA 1MQAA 2I6SA 2XWBF 4PN7A 5KYUA 5E6RB 3NIFB 1XDGA 2ADFA 3F78A 1JEYB 2XGGA 4BJ3A 5KYYB 2VDKB 3ZQKA 3PPWA 1AO3A 5BV8A 3AL8A 2X5NA 1TYEB 3K71B 3K6SA 1ZOOA 4O3UB 3EGDA 4Z7QB 4UM9D 3ZE1B 3K72A 4F1KA 1JV2A 3NIGB 4DMUB 1L5GA 1QC5B 4NENB 3EFOB 1DGQA 3ZDZB 4IGIA 4UM8B 1CK4A 4MMXA 1AOXA 4CN8A 3IBSA 4JDUA 4HQLA 4UM9B 1PCXA 2ICAA 3T3PB 4JX0A 3OKWA 1JLMA 4Z7NB 1MF7A 4WK4B 2B2XA 3NIDB 4G1EA 1XDDA 3PPYA 3E2MA 4HQOA 4IXDA 1ZOPA 3V4PB 1YVRA 3ZDYB 2VDRB 2VDNB 4IHKA 4G1MB 1RS0A 3TXAA 2NVOA 1SHUX 1U8CB 1YVPA 1IJBA 4C2BA 3IJEA 4MMZA 1JEQB 1V7PC 3TVYA 2VC2B 2NUPB 2WW8A
chains in the Genus database with same CATH superfamily
1GOTA 3EXG1 3EDKA 2UZ3A 4QHNA 2X6UA 2GY7B 4YBHA 1KL7A 2G4GA 1W2GA 4PJGF 2J9FA 2HBQA 2R8SH 4EITA 1ASOA 1EXDA 5ESXA 4NAJA 4M38A 3O8QB 1JNNH 3Q5GA 4CPDA 2QD1A 1AGEA 4PQEA 1EE9A 2UZIL 2B4YA 4ZCLA 3LX5A 3NYKA 3X1GA 4HMCA 4RK4A 2A77L 1FGNL 4HPWA 1BZEA 4HJEA 1TDJA 3V8QA 1A4IA 5HHOA 2YGQA 1EAYA 4PJFB 4GKSA 4HCIA 3TD9A 3DURA 4Z8YA 4WIAA 3PC3A 5MEQB 1RD6A 1W9MA 2IYRA 1XHFA 4LARL 3VFVB 2O30A 2ZUEA 3R1IA 3DFZA 4RL6A 1MHEA 5DNWA 4LSTL 4ND5A 2FECI 4YE4H 3GRKA 3UMSA 4K3EH 1V8PA 2WKLA 4FFZH 2DQ4A 5EMHA 5FA8A 2QKYA 2JGKA 3HI6L 4J3BA 4UINL 4GT0A 1CGSL 3BJLA 3I23A 2M1XA 1DSFL 4ZEXA 3N75A 3RRNA 4G84A 3NONA 1L4LA 1DEKA 2P1ZA 4MR7B 2A1WH 1N3BA 5DLML 1AZWA 4AJ0A 4J3OC 3S8WA 4NYJR 3N42B 3ILYA 3SOBH 2GYYA 1YECL 2YS6A 5JXEC 2IAMD 3AT9A 5EQFA 3HS0C 4HUKB 3QYNA 4UDOA 4HEJA 1CD5A 1MZVA 5IJ0B 4G9GA 4J3FA 1OAZH 1ET8A 2I25N 1E5CA 5TK4A 4DCUA 1BZ9B 4N0YL 3D54D 3BSZH 4ONFL 4QOFA 1MQSA 4L8BA 4N1AA 1E4HA 3QDAA 2GM3A 2CM6A 3TF4A 4B6OA 2IPKB 1CJUC 1ZNQO 1WIOA 4PSAA 2VP9A 4FW8A 3WWDA 1FS4A 1H6UA 4W68A 4L3CA 3IMCA 3BD7A 3CC5A 3B9AA 4U7GA 4EYSA 2X23A 4LNHA 4WCYL 1ZCBA 2DWEA 2AC4A 5EJ9A 3KT8A 3ARRA 4MB2A 1D2HA 2WQXA 3DX7A 2V2XB 1YB6A 1N7IA 4FQ7A 4QQFA 2RAVA 1CUHA 4XR4A 1SXPA 2A3TA 3FT1A 3D48R 4PGBB 4BFRA 1RAGA 2C4FT 3KYDA 3ZK0A 4PJ9C 3AGQA 4PJHA 5C0DB 3KJIA 3QIAA 5CM8B 2ED6A 1H1LA 1TRKA 3Q8LA 4Q9JA 4YDMA 3FVTA 3JQ7A 2NU9A 1ZONA 2V7UA 2XU9A 3JZIA 3ARSA 3L8QA 5HGJA 4DCNA 4KR2A 4W9FC 3AFOA 1NWPA 4PJBE 3EXFA 4L4TA 2OL3A 5F3RA 2Z1PA 3LKZA 3GEFA 4BMDA 1HCFX 4Y5VB 4E09A 4GI7A 2WJWA 1CU1A 2H3XC 1G66A 2VP5A 5IAOA 4RWZA 2FW1A 4YUEH 1WPQA 2O2XA 5IW1B 1LILA 2VW4A 3LRMA 4LWZA 2X0EA 4DMCA 2ZJ0A 2Q6OA 2ZSWB 3I9MA 4DN3H 4E4RA 3L4BC 3QEMA 5CU9A 1GZ6A 3QT2A 4FQCH 2N0KA 2GTWB 2HM7A 2YQ5A 2V8BA 5C09B 3INRA 3LH8A 1G4AE 4GUPB 3FHCB 3V32A 1LHZA 4YAKA 5FDWA 5F7LB 3VB9A 4PMFA 3V7NA 1U8UA 1AP2B 3FMIA 3M8KA 4I2VA 1VADB 3AVEA 1BV8A 3CXFA 5KG9A 4BNVA 1UT1A 3SDXA 1IM9A 1CF8H 1KVTA 4JBWA 1QR1A 1K8XB 4RZXA 3BRWD 2D0HA 2YRZA 5K93A 3ILQD 2EVFA 3SQBB 2C78A 3RL1A 4H26A 2BL4A 2OSYA 4BVHA 1X5ZA 4QXUH 5JVDB 3QJTB 4GKAA 3RZCC 4A73A 4B97A 4GJTB 3EFFB 1XJWA 3FNQA 2ZU0C 1J10A 3VKGA 1PNCA 1S8FA 3EK2A 3CE1A 1DCMA 2D2FA 5G3YA 2DI7A 1AZCA 4QHLA 3ZX1A 3DARA 2HZBA 3AL3A 3CN4A 2OYPA 1F41A 3NBYC 2CD9A 3NATA 3QIUD 3MJ7A 5TE4L 4ZX4A 3RUHA 1IUNA 3VOBA 1NMQA 2MSDB 4LOIA 3WNQA 1WZAA 3VNZA 2A6IA 4ZFOA 1S02A 4C7VA 4HJJL 2P4UA 4FN4A 2MCPH 2GSWA 4Y3UA 2WMNB 4HMEA 4L5CA 2QE7D 1NGQL 3WIOA 4RBPK 4BLUA 2XGJA 5FM5O 4JM2C 1WKBA 1OGTB 1DFIA 1JIUA 1CL7I 3QBTA 2BY3A 1MU0A 5AKVA 2JDIA 3FU7B 4NYLA 1G5HA 5HKKD 1VL6A 3REGA 3FNBA 2Z8VC 2V6JA 5KVDE 3ETTA 1HS6A 1UWVA 1J8HA 1ZK5A 3HN5A 4P2QB 1KKLA 2BM1A 1E5TA 4EG1A 2C84A 4MJJA 3HB1A 3L9BA 2YMQA 2VJOA 1A4CA 1A5SB 4PJIA 1QIEA 3MUZ1 2Z2IA 5HGBA 3G3EA 3QIBA 2WA2A 5BZXA 4I3RL 4K2AA 1S2NA 4BZ2A 2ORBL 3SU8A 5D2NE 5I0XA 1JDSA 4FNGA 2B83A 5FI1B 5LBSL 4KH9A 3PCTA 1QYWA 2AFNA 5BV2P 2HGSA 4IWNA 2BNQD 4M7ZB 3QG7L 5AW9A 1JVNA 5FM5M 5IVXB 3UAGA 4BQIA 1R0KA 3MLSL 2XYPA 2O2JA 5KSZA 1HF3A 1G0NA 4QRRA 4BC1A 5BPFA 1OXMA 1ZVVA 4LKCB 4OCWH 4EI0A 2H65A 2E87A 4BMPB 3BPOB 5HM6A 2D62A 4B2PA 2GQ0A 4H16A 2AQ1A 3NSFA 2AFIB 1AZRA 1PQUA 5K8JB 4P3CL 3BKWA 1Q19A 3JV6B 3KDAA 1W36D 1Z63A 1R5IB 1EFQA 1WXIA 5FUYA 2IDFA 2HT3D 3I1FA 3L3IA 3DX3A 1Q90A 1YD7A 1FYXA 3I3DA 4F5DA 1XHEA 3EYOA 5AT1A 4CE6A 1PDKB 4GBED 5T1LA 1VHLA 4Q74A 1NZRA 4TWRA 2YYAA 1RKUA 3W0WB 4PJFE 3I4FA 2DQSA 4IX1A 1O9ZA 1LF0A 4PC1A 3GR6A 1C3VA 4FA8A 5LA6A 2DQHL 1AN9A 4W5WA 2XITA 4ELMB 1TCCA 2XYCA 1XYGA 1GQRA 4YZWA 5K0EA 3KSDO 2OCCB 3E0XA 1E58A 2CUHA 3FUKA 4I1IA 1SK9A 4MCZB 5C8JB 2OSLA 2NSHA 1JHVA 3IPLA 1UWGH 3DZBA 5I8WA 1CRPA 4EUHA 1GRRA 5AJZA 5IVZB 3O3EB 2AGVA 5JMRA 3DTTA 1GVNB 5F7OA 3DPBA 1RHUA 4EI6B 1VZ3A 5EC8A 4LLYA 2XT9A 3CH1B 5AVTB 1K08A 1Z6PA 4G42B 2IOMA 2CKBB 4XD2A 4G1MA 5B3NA 3LK7A 1XGQA 3GMOA 4HBQA 1YL6A 3FB8B 1HZJA 4NS1A 4QKQA 4MI1A 3BIBX 2NUPA 2XPGA 5AWFC 5HY9A 4KRFA 1F1DA 1ZY2A 3IR6A 3WE7A 4NNPL 2WQZA 4DBZA 1Q0RA 5HPOA 4PWIA 5E08L 1ORWA 4PZAA 2FATH 2GEUA 4XP5H 1NW8A 3LTNC 2EEAA 3HYCA 2WUBL 3FIJA 1ZM4A 4RK0A 3HBZA 3EJSA 1J0DA 5IJBC 3ZHUA 5JLZA 1MZYA 1IGFL 1SKAA 2P43B 4WKZA 5CLIA 5DWQA 5EMKA 1T20A 2GYSA 4R0LA 5FWDA 5I0WA 2V5YA 4B31A 4EI5C 3CMOL 1I7SB 5AUOB 1RWNA 3DM9B 1AC0A 1GW6A 1HHKB 4Y2GA 4ZFGH 2WDZA 5T3ZH 1OAOC 4Y1RB 1DVYA 5DHUA 3B9BA 3GSQB 1O94D 5K0GA 4NM8L 3E2HB 1KB3A 3EO1A 3V0IA 4FYPA 2ZTBA 4UBJA 1IM3A 2IOQA 4WNAB 2BC4B 4OFXA 4W9IC 5I8EB 4JLMA 2Q5BA 4X7MA 4UNIA 1ZN9A 1O7JA 2F53E 1IIBA 1KY6A 1DRUA 4O8CA 4JHZA 4C4OA 2Q07A 2UZPA 3X12A 2Q8QA 4M2LA 4XUCA 4X64B 3WNJA 4TMVA 4I9NA 5JIHA 5A2BA 4XIGS 4KHXL 5HCIA 4JI5B 4AO6A 5FOQA 3FZQA 1P7QD 1PSKH 1XB3A 5D7JD 3BP5B 2NYRA 4IGBD 1EIWA 3NGLA 2XOKD 1B3IA 1CHNA 3U3JA 4IKKA 3PHCA 4R1UA 4HUXB 4WFGE 4NXSA 1P7CA 4D99A 4E2OA 1O5OA 1OT3A 5IVDA 1X5YA 4EPYA 4BNMA 3HKEA 2FMTA 3ITDA 4U3JB 5E6IB 2BGKA 3FB1A 3WFZA 4HK3N 3V4RA 4IRJB 2BCEA 2QVLA 3OZXA 2FWIA 2IXAA 5FBWB 4OHUA 2V7QD 1T04A 3KP1A 2E21A 1PFKA 5IEKB 3KOXA 3WN5B 4ZVOA 2HHAA 4F38A 3H1BA 1J5HA 4FC3E 2PNFA 4N3NA 1JLRA 1PR4A 1WCBB 5LQAA 1AHNA 4XRCA 4ZRGA 1OXYA 1IATA 2OCJA 2WBKA 4RHTA 4DA6A 4J3XA 1BBDL 4JL5A 1BD2D 1RAHA 3PD1A 4NQRA 4YJ2B 2AWNA 1QVZA 1VYHA 4Q4HB 2D3JA 5IB5B 1SBCA 3C85A 2ZPKL 2BBTA 3IKJA 3QVVA 3I6YA 4YHKL 5DM60 5SYAA 2ZJYA 5L8LB 1Z4PX 1SYVA 3NHPA 5EWLB 1DQMH 3B48A 3FO2B 1MJGM 1P6UA 4WZBA 1OO2A 1X70A 3DHNA 2KHAA 1LLFA 1NJ2A 3W8DA 2J67A 1DIGA 1P7KB 3WDHA 2WZAA 3OEEA 4D25A 3JZMA 5CR8A 2GD6A 3LX9A 4ALLA 1UADC 3I9GH 4DKDC 2PZLA 2HQSA 1N5OX 2FAXA 1U2CA 3L16A 4L5IA 1REQA 3DV0B 2PHZA 4LCUB 5CJOH 4P2QE 1VMDA 5I7EA 5CHYA 3TIFA 5D7KE 5AVYA 2H26A 3H5IA 3TSOA 3OHXA 5JS2A 1DAPA 1NLBL 3EQ9A 1GU0A 1J39A 2YASA 3IODA 4QGFA 1VE1A 3BXNA 4X1YA 3U82B 3E0QA 5FI0B 5FWRA 2VRBA 1ZUWA 4AQOA 1YB1A 4X4ME 4CI9A 4TTTS 3CSBA 3D8TA 2HA7A 5AXAA 4H31A 5DGQA 2G3NA 3GJQA 3SC4A 2WKSA 3D85D 3RI5F 2PU5A 4BBAA 1CK4A 2EKSA 5IVXE 2APTA 5GGSY 1JQDA 3E4DA 3CSYA 4TGLA 4DUXA 5CIWA 3HTXA 4XA8A 4LOUC 5HHXH 5F1KA 1YJBA 1DBMH 2VDNH 4FP9A 4YFEA 5G5DA 4G89A 2O50A 4AM8A 1Y6NR 1L5OA 2AQ8A 4BE7B 4MMZA 1P7PA 1UB6B 4WSKA 2AFIE 1BAFH 1M6VB 5EIBD 5CIPB 3PQ4A 2Y93A 3I74A 1W88B 4G5OA 5JXWA 2VPZA 4BVBA 3DSRA 4MOWA 4NCC2 1BIIB 4RH3A 2EQBA 4U6HB 5C08B 2VDLH 4JJEA 1ZS8B 2WPDD 4U7SA 3HIZA 2H08A 2ESVD 3HGMA 1JDZA 1QX4A 3HNTL 2PX0A 1S5IH 2Z35A 1XMEB 1UC8A 3TZBA 4Y4FB 1XQVA 3O75A 3U44B 4FKBA 3AAZA 3W0WE 4X66B 1VE9A 4BGUA 5I7HA 3IF1A 5DURB 2ZI9A 3SBRA 4LP5A 5F71A 3EIXA 4OCYL 1BJ1H 2WM3A 3FO0L 3T08A 1T66D 3QDGE 3DXXA 5DO9A 1H5BB 4ELME 4JL1A 4OAQA 4HWBA 4NLLA 3HEMA 1GGKA 3BKXA 4P2BA 1HLPA 4FYTA 4EIZC 2X4RB 4P5MB 3LEXA 2DE0X 2Q9UA 2F8TA 3LKNB 3GJ6A 3AB7A 5CEZH 3RG8A 5CLZA 3FUFA 2A5GA 3PJLA 4QVKA 3GGCA 4LVHB 2CDFB 1HEHC 1RIIA 1O6CA 4X6BA 4MRCA 3B13B 5L3ZA 3FQWB 4R8LA 3MGGA 5CA0A 3ZU2A 1KG0B 2GBFA 4MVYA 2D8KA 5CINH 3C5HA 2EDQA 1KLFA 2Q8BL 5GS1B 4CN8A 1YU9A 3UHPA 2ZATA 4JIMA 4YJFA 3L7FA 5IBLD 3D50A 1M7DB 4QRIA 2O26U 2OOKA 4OLYL 3NW9A 4ETYA 4GNKA 5J8OA 3HLAA 3QR1A 5DJ5A 4MB3A 1KK2A 1JFLA 4L8SA 1OP3H 3RFRA 1NUFA 1YPZF 4QTXA 4MD0A 1URIA 4FF9A 3DPIA 2V74B 2TSAA 3NCEB 2MPAH 1ZLWK 2Z4QA 1KIQA 1XK6A 1IAQA 2BFFA 4RHEA 1UXSA 5LSAA 5DEIA 5DCYA 1DXQA 4PJAB 3D1VA 2A6KA 1MEEA 3AOGA 5DEFA 5IK2A 4K6MA 2CLRA 3IT0A 2BCKA 2JB5H 3FNKA 3K92A 1W6LA 2QV0A 1CEQA 2AEIT 3CFEB 4FFVA 2I32A 3L6UA 1BO6A 4IJ3B 3ZXIA 5ANMA 1FZQA 1T0HB 4K3DH 4UOW0 3GCWA 1DTUA 1UCBH 4YXFA 3SBWC 1RNLA 1LFAA 5F9WB 2O2YA 3NJGA 2YWDA 3QKSA 4CW7A 2JJSC 4KC3B 3RIAF 2FD6L 2K8MA 5C0AA 1E1LA 1VACB 5DD1H 4N6RA 4QJ3A 2O2CA 3HE3A 5B7MA 4KX8A 1SUEA 3V8VA 3AR6A 3ZCXA 1SHSA 2PDAA 4JFWA 4N5LA 1EWQA 4RQQB 4JI3B 3O84A 1RBQA 4HXAH 3AKDA 1ZHNB 3RFZA 4DW2L 3TIIA 5DSCB 4KO5A 4I3FA 4BV9A 5FK9A 3HO1A 1IJNA 3UP6A 4ZAFA 3OV6A 1SM4A 1EM8A 3ZW8A 3MQFA 1A6TA 5CMLA 3AROA 4XE0A 3KV1A 3AOEC 4CNBA 1CGVA 3EVEA 4D8PB 2WJ4A 1BGXT 2P2NA 3LNIA 4OQQA 4TV9B 4GI1A 5H94A 4HAZA 2A9OA 4UAGA 5K8LA 4R31A 3UJJH 4EVNB 3EIHA 3KXFB 1KARA 4L5BA 5AJWA 1T5SA 5DQDL 4Z9AA 4UTAH 2WKWA 1ZHFA 4Z77A 1ODTC 4UQOA 4R9NA 5ESDA 1CQWA 3MV8B 3HI1B 2CGEA 2DLFL 3H5NA 4BMZA 3KVDD 43C9A 1GPKA 4MO9A 1QPKA 2WV9A 3TIXB 2R00A 2IXEA 3GBSA 4AMGA 2FCBA 1DBAH 1Q0XL 4ID9A 5FPYA 3Q4GA 1I33A 1JWLA 4L3OA 3I02B 3RJTA 3O4LA 2HXAA 5DVLA 5C46F 2OZNA 5DI8B 3QIWD 5BV8A 2P9JA 3I04M 1DSYA 3G2KA 4DLXA 1E2PA 4CNIB 4YNBA 4JA2A 4J3OH 1YACA 3TKAA 5DJZB 4YJZL 5ECWA 4WJ5A 2GD0A 3TJHD 2QTRA 4LVUA 4X71A 1UH2A 1MGOA 4Q6BA 3QYAA 4W9DC 1XKXA 3PGJA 5LQRA 5C07A 4UZUA 4MW1A 4FXOA 1ZLUH 4YE0A 3CFBA 1A8QA 3ONVA 3E84A 1T4KB 3VD1A 2O05A 4D56A 4G7SB 3SKMB 3A1TA 3HDGA 4OLWL 3GSOB 1Y0LB 3QHZH 4MD4B 1DOHA 3ZWVA 1UMCB 1P9OA 4B8WA 3GXFA 2R2HA 3DD1A 4AYWA 3L7BA 3V55A 3B70A 3PAUA 1LI5A 4FTDA 3N5CA 1ZHKA 1DJSA 5AVVB 3DI3B 4MDIB 3NBQA 4I5GA 3RPBA 1R74A 5FPHA 5TVGA 4DEPB 1V6CA 2W65B 1GCIA 3AFHA 3BVWA 1IKNA 1BZ8A 5B58T 5HM8A 2R7EB 3TWOA 2A38A 2R1UA 4TVSA 1VLVA 2BNUA 2RHMA 4AY6A 3CDZB 2JHGA 4L9DA 1HZZA 4MDJA 5FD8A 2KQUA 1K3FA 3GLUA 4W6YB 3ZPDA 1OQAA 3G9VA 5JFGA 1Z4OA 3K1AB 3EAQA 4GRAA 3LX8A 2DJIA 4HUCA 4HRXA 5KDOA 4C9BA 4QUOA 5M34A 1L2TA 4NU0A 5B2EA 3S2GA 5CBAB 4B53A 2HX7A 5DJAB 5JHGB 5GINE 1FL5A 5AKTA 3GK8H 1IHOA 3GWGA 3QXCA 1CUJA 3QWHA 2HHCA 3AIOA 1PR5A 4JVMA 4ZD6A 3K5IA 3M4XA 3LPFA 4WWID 4LXIA 3BH9B 1COWA 2JIDA 3OKCA 5EKUA 2A0UA 3C08H 2ZG3A 1HEYA 4YV7A 4AL8C 4K71B 2FWBA 1JSYA 2DTMH 4E5PA 3F64A 3DTNA 2BVNA 2DFVA 3Q0TA 3PXBA 5ARBA 4JFVA 3T9BA 3ELDA 1DZ0A 3SDSA 4P34A 2ZPTX 3NHKA 1IGTB 5DK0A 3GGWA 3IWUA 3FUIA 3NK4A 4C83A 2A74A 1CLOL 3BVNA 5COBA 3R4VA 4C0SA 3NDBB 3KDPA 4YRIA 1AV6A 1PZXA 1MR3F 3JV7A 2J9RA 5JJBA 1L6IA 3HXQA 4YRFA 3BK1A 4EKJA 4WFFE 3AONB 2XZCH 3C6LD 1EJ0A 4Y4KA 4X3CA 2WJGA 2ZBGA 3U17A 3UK6A 2ZKIA 2MQGA 3H5RA 1AANA 2IUYA 1OJLA 2VWHA 1QBKC 3P9SA 1JPFA 4TLCA 2FZKA 1EK6A 5CLJA 3F1LA 2IYVA 4R4NC 4V0LA 2ICWB 3W3AH 1PL8A 5FO7B 1F8UA 2O1XA 5DJ8B 3ZKAA 1CWVA 4YR6B 4ISCA 5MERB 1Z2EA 3T3NA 4HQ0A 1YEJH 1D5CA 3LKOB 2YA2A 3ZTNL 1TQ4A 4PJAE 4X6EA 1Z47A 5BOZG 4OV6F 2NTVA 3TTTA 2FX9L 4NP6A 5A7FA 1TKWB 1YEDB 2JFFA 2ZB4A 5HFNA 4QYOB 3OAWA 1CUUA 4JT8A 4DV3B 4I77H 2CXQA 1EB9A 1ZOPA 2Y36H 1KGDA 4M55A 4HDOB 5IWCA 4TXVB 4JSYA 3B8HA 4LOJA 5C5CA 5CH8A 1T34A 4US2R 5AICA 4MGXA 5ALCH 4JB8A 2N0SA 2Q76A 3IGKA 1YYCA 4I3GA 3NAAH 1L0XA 4R71A 4LLDB 2OORC 3CLSC 1N33B 2ZVDA 1Z8HA 3SSGA 1N64H 2Y5TB 4BXSV 3SK0A 3RWHA 2CXXA 2OXGA 3ZE6A 3EEOA 3R8XA 2OV6A 1YIAA 4AF8A 1V16B 2JGEA 5E4TA 3RARA 1RAMA 1GT6A 1IC7H 1Z6XA 2X2OA 4CSSA 4A8HA 3OLEA 3M6WA 3L6DA 3T35A 1HCVA 3UPRA 1Z08A 4XFKA 4OI0A 2OMBA 1DELA 1NRWA 1NGYA 5F76A 2WJIA 1CN4A 4JDTH 3R3HA 7ADHA 3H3XA 4QHNB 1NZJA 3R3XA 2RGSA 1RK7A 2DUJA 1UXMA 4ZQIA 3ZQ6A 2PLTA 1QH8A 2J9FB 4LXTA 3RS2A 4QDOA 5I17B 3P45A 3NMUF 1N2GA 2XQ0A 4NAQA 2B4KA 4IH9A 5I6XC 1G3MA 2GZ3A 1AGEB 1CTQA 3MQ4A 3ZD7A 3KXFE 2H2PD 2NT3A 2ECKA 1YJXA 5F96L 5IARA 3WXVL 1L4NA 3OMXA 2FRXA 1EIZA 1NE7A 1A5FH 3LBYA 1NUHA 1UZMA 2W07A 4MO2A 4DSYA 4ABTA 1O96A 4MQ5A 2JNWA 5B53A 1QQ7A 4G26A 1PZHA 4XYMA 5KYXA 1QFXA 4MXWH 2FSUA 3WLQA 4LBZA 3HJHA 5SYNA 1MHEB 3CRW1 6REQA 2OENG 5FV7A 1WP6A 1RZKL 1ZM9A 3LIZH 2VE6A 2ZSDA 1IBDA 5B58C 4AULA 5CU5A 1R6XA 2ZWSA 4HV4A 1ESZA 4JZYA 4XNMA 1UZ8A 5F44A 3SBOA 4LC1A 2I2AA 2H85A 4AXXA 1KCKA 4JASB 2OLDA 2XD9A 4FFZA 2R0WH 4KPHL 3P4XA 2PWPA 4X45A 5KTNA 2BNRA 4Z5XA 1IBZA 4TULH 4LBAA 1N9ZA 3LK6A 4DLWA 4DR4B 5FHBL 4UXHA 3BXOA 4NI5A 3ESVF 4JFRA 4UC0A 2ZSVA 2WTPA 4GX2A 4L8BB 4NM4H 1BM3L 4FN0A 4N6QA 2F4NA 1IGJA 3OXSA 3IB4A 4Y9GA 3TTWA 4L3CB 1U0JA 2IE0A 1AD0A 1Z2AA 4W9MC 1VSQA 2DWEB 1IAKA 1JLMA 2K0RA 3S36H 3DX7B 1CUSA 4LSVL 3KD2A 1ZJYA 13PKA 4L57A 3SLRA 3ESMA 5KTOA 4F7DA 3OIVA 1V3QE 1A8JH 1JDDA 1T10A 2R6HA 4NN6B 3OPZL 3GFVA 3KYDB 5CM1A 3EVNA 4PJHB 3L7NA 2V5MA 3X3GL 1ZK1A 3EUFA 4NO0A 2YXMA 4IRMA 5DYGA 3UMJA 1W5AA 1QVOA 4J2QA 1H1LB 2REOA 3MJ4A 5FYJE 2W9DL 3JQ7B 1AHHA 2PGLA 3RVUC 4L5AA 4BLPA 2NU9B 4U6VL 4ETIA 4KK6C 2ZT7A 2O7NA 4LSRH 2FMFA 1Z5VA 3WIAA 2NVWA 5IC6A 3S3JA 4S04A 4DVRL 1X9HA 3EXFB 4L4TB 2OL3B 4BFBD 3VRJA 1MI5A 4S0ZA 1OREA 1C3XA 1RRMA 3NNNA 2J07A 3QLUC 3S55A 3JVEA 4PXSA 3IQEA 1GSKA 2GKOA 1TK9A 4MQ7A 3B43A 2MYUA 2I5YH 3OAAA 4M36A 1EZSA 1AMUA 2X6QA 3T2QA 4R54A 3QEMB 3MR9A 1R5WA 1WK0A 3R5KA 4P6VF 2IIVA 3KQKA 1UP7A 1KEWA 2HT2C 3P11H 1FW6A 2D2XA 1E6OL 2BHTA 1ZAKA 4EPRA 5FDWB 4HLUA 2PO5A 4EBFA 1O0CA 1JSLA 1TJHH 3Q2LA 4YALA 3BWSA 1A50B 2EEPA 5KG9B 3PGKA 4EHKA 1KZ7B 1CGTA 3SDXB 1IM9B 1FNSL 2J3EA 1QR1B 1YS2X 1HHJA 4NS0A 1VE5A 4X6XA 2WM9B 1E5YA 2Y71A 4XCQA 4X7BA 2WAXA 4EG4A 1A7JA 4ZMSA 4TROA 2KI6A 2HMAA 3QWRA 3LN9A 3M6LA 3QVLA 3RIXA 4GQPH 3TAHA 3PHJA 4LESA 2Y0CA 2VC2L 1VJTA 4DIBA 3PQDA 1QLFA 2YFOA 8CGTA 4PG6A 3ZWMA 5DP1A 4HGWB 4QHLB 3P40A 4I55B 4JMNA 4GPIB 4MJHA 2QTWB 2I7OA 3UG7A 4Q18A 5KOIA 3MJ7B 3A14A 3WXWL 2CE6A 5HZKA 5BSEA 1P6AB 1ZXQA 2G9NA 2A6IB 5CGBA 4NZYA 1KFKB 3LC7O 1R3LB 4L4RA 1ZT4A 3QBTB 5LN1A 2EIMB 5CAEA 2FN8A 4MXQC 1U8AA 5I6LA 1U9KA 5IJ9B 1E5VA 1J8HB 5K3SA 2V1XA 3B6JA 2WTRA 5TMBA 1MNUL 5KX5F 4C0QC 4F1JA 1IB0A 4PJIB 2POQX 3A7DA 3GRPA 5HGBB 4A6YH 3UAJA 3QIBB 2IPOA 4OP2A 4GT7A 4OXNA 5D4QA 1DQLL 1I10A 3FHQA 1OWMA 1WKCA 3PVZA 1B4DA 4XCVA 3TKLA 1CXZA 1KVQA 5TPWH 2P9ZA 3T7SA 1ZN8A 3MCLL 2AN9A 1DN0A 1ODJA 3CPHA 1ZA3A 3JYBA 3BREA 1KENL 1NY6A 4KOBA 2QV4A 3L54A 3S97C 1MO3A 4YT4A 1QKJA 5L45A 3TCLA 3ETLA 2ON6A 3EIFA 4LASH 2ZX8A 1IRIA 3NZ8A 2VHZA 5SZIA 1L4IA 3NSYA 2XUZA 2XA8H 3ND6A 3OKPA 1R8XA 2YJ6A 2VNJA 1TVKA 2HJHA 3OH8A 3QXDA 2LRHA 4QPCA 1F5WA 2BOBA 1JNXX 3WFIA 12E8H 3QF7A 2IV9A 5JD5A 3DBRA 4PJ5A 3OUUA 4YJKA 4U2FA 4M0KA 5FBVB 2Q2WA 3EYOB 1JXMA 3MCAA 4NGHL 3W2DH 3NBXX 5T1LB 2WE8A 5HHOE 3HNRA 1K5GA 4ZHSA 4ZQKA 2A92A 2EHJA 1XXHA 3BXGA 2IEAA 4GZ5A 2CLZA 2CDGA 4HAYA 3A0OA 1QK4A 3PNWB 4TNWF 4L0MA 3K9FC 1U1GA 5LA6B 1O8CA 4IHOA 5A2KH 2FG6C 2O23A 3TF5A 1HRDA 5ES3A 2X7JA 2Q0QA 5LKNA 3LNGA 1X2BA 4WSGA 2A30A 3QI7A 4HC1A 1NPNA 4KE9A 1KCWA 4GY4A 1ZR2A 2JKTM 1TZJA 3F78A 4D0SA 1M6WA 3JWOL 2C7QA 2WYHA 1KFEB 4KUZL 3KDMA 3GSUA 3BL5A 5ABDE 4HAKA 3DPBB 3MLRL 4Y7MA 1U41A 1G8JA 4MRVA 4CMBA 4LLYB 2B5VA 3H3FA 2O5XL 3IQGX 2W0MA 3KB2A 2XCIA 3T41A 3P9XA 5FGSA 4G1MB 3IBGA 1XGQB 3GMOB 2RBKA 1HNNA 1XZFA 2PKEA 5ICUA 2NUPB 1RUPL 5HY9B 3SJCA 5CIYA 4KK8C 3U6BA 4PW4A 3ROPA 3LRTA 5TT1A 1O5PA 3FH5A 5C53B 5E6ZA 3BE6A 5FLVA 3S3PA 3S4SA 5F6IC 5GM2A 4O4IF 5HGXA 3QVOA 4TTQA 3W05A 4DCJA 3ZYCA 3L46A 1JHLL 2O8BB 2VHYA 4QGSA 3ZJAA 3NJRA 2Q1SA 3PDHA 1RRFA 5HDQL 4WKZB 1SXZA 1T2VA 3JQAD 1T20B 1OKEA 5LCXA 2DL2A 3CURA 4FYHA 2ACWA 3LLMA 3UJDA 3BPNB 3FBWA 5IUKC 2WRZA 3QUKA 4U7PB 4I4TF 4OCSL 3PS6A 4HLQB 3SR4A 3UYPA 3G5UA 5IG7A 5EESA 3OHMB 3BMOA 4PB0H 2IYQA 2WIGA 1UMDA 1YEHH 4UQAA 2P2DA 4PJHE 4R4JA 3EO1B 4C6TA 5AKGA 3M82A 3GA0A 1EP1B 1IM3B 4U7WA 2YQZA 4X5QA 4RZHA 3WGVB 3OPUA 3KUCA 3HMXH 4FSXA 3DEJA 4Q3DA 3M3DA 4N9WA 5DZ9A 3BKCL 1P18A 3EF0A 1TQDA 4Y2TA 4L4TE 3KJXA 3X12B 3QNUA 4IRSA 3UPDA 1TR7A 3O8XC 2QVBA 3N06B 2X4IA 5BOVA 1U04A 3KJNA 1GGBL 3R5FA 3NORA 1Q0SA 3DHEA 1YKSA 3X1EA 3LYUA 3L9WA 3BWZA 2BT4A 2BZSA 5LG1A 1EEUA 1BJTA 3NCHA 3DO6A 4DDKA 1IBLB 4UB0H 2QI9F 3O2NA 4LNUA 3IPYA 4IILA 4EHJA 2QG9A 3UUWA 2MYNA 3TL3A 3AQYA 4KTDL 1XCPA 1QG6A 4S10A 3P4NA 5ITVA 1OWLA 2C96A 3HKEB 4I3HA 4N7JA 1QAQA 5F12A 1LO4H 5DTFB 1I9GA 1JD7A 3QU4A 1QQBA 3RUDA 3SDXE 1GPDG 5DJCA 1QGZA 2R44A 3GXNA 1T04B 2VR7A 4H0IA 4QGGA 4AQAA 2CXRA 2NT4A 2IS6A 3L1KA 2G5TA 3ZY6A 2C9YA 2CXPA 1IDOA 1XLUA 1QE5A 3OZKA 4MI9A 1WDWB 3BZBA 4PLJD 1Z17A 3D7NA 1HXYA 2FSIA 5D3MA 5FT9A 5B1CA 3SPJA 1N67A 1IY2A 2JJWA 1G3QA 3S0PA 4ZI8A 4QF1A 5IGXL 3GROA 5K9ZA 4BO7A 4I48A 2XX3A 3Q9SA 4TTIA 1IQRA 3BFXA 4H0LC 4DR3B 2WWHA 4PWKA 1DVFD 5KZMB 4WWOA 1IY0A 1PEDA 3UT5A 3LHFA 2EDTA 4CCWA 1SYVB 4BFOA 4YMSA 1WP9A 4O58L 2FX7L 5EOCH 2JLQA 1O7DE 1A7UA 2G77B 2E89A 4QYWA 5D93B 1OTHA 4CMIA 4QT4A 4FHFA 1XF5A 3T9DA 4K94C 1KHHA 4UUJB 2HPZA 1PEZA 5LZ2A 5IBQA 3WRYC 2VDOL 4N5EC 1Z4LA 2LR4A 2QRQA 3GSNH 5ALFA 5KOJA 2G5GX 4B71A 3WZLA 1J8HE 1TW3A 2XIJA 2H26B 3LLCA 3OHXB 3QXGA 2RE8A 3U79A 4PJIE 4DM4A 1XTTA 8GPBA 5SX4I 3Q9LA 3DMTC 1W35A 3BXNB 2JCVA 2O48X 4J0FA 1RZ7H 4QUHA 1G5RA 3DVQX 1MRCL 1FDUA 2R25B 3HR8A 3T7JA 1XX9C 1AA6A 3BDBA 4L9LA 3S2AA 1WVMA 3AREA 4ZVTA 2CWRA 1DP0A 3HPQA 3D1MC 2EKSB 4LVEA 3UV6A 3CSYB 3VFRB 2Q8AH 2B2XH 1IUKA 2ZAIA 2IMMA 4QRRE 1FVEB 3OZGA 2I66A 5IKMA 3JV5A 5G5DB 5DW0A 3R3ZA 4MMZB 1E79D 5KJRH 2AVNA 2ZKHH 2V0CA 1SXSA 1CBVH 4KRPD 5KCZA 2EO1A 3CUEF 2FJGA 1S8DB 2CK3D 2WZCA 5F73A 3CBKB 2YZGA 3V0GA 1DUYB 4QRPB 5FNVA 4G6FD 1V47A 3Q44A 4LU5H 1YONA 2Z2JA 4PLZA 2ZKWA 1RJEA 1MSPA 1HKUA 1WTLA 4MA0A 5ESWA 2Z35B 1MW9X 4PW9A 2X4QA 4KR7A 4AL8H 5LNGA 2EDFA 3I75A 2X22A 2YQ4A 3AAZB 1QP8A 4DA7A 1HKFA 1XAGA 1NT2A 5TR9A 3BKMH 2D7NA 2JHFA 1UUSA 4TL7A 1GITA 2IJ0C 2HPOA 1WL8A 1GMIA 4UTVA 1KACB 1MFBL 4QHYA 1JHYA 4V0MA 3EOBB 3LEXB 3CKYA 3IC5A 5HRAA 4KFCA 1LTHR 3OP1A 4F3YA 3L6FA 4X6BB 4MPJA 4E2ZA 5JYBA 3SE4C 1VCMA 5CA0B 3KM2A 1W0JD 4Q93A 2O8FB 3VC1A 3BGMA 1DIRA 1G5FA 2PAFA 3KL2A 4OI1A 4FN5A 1JQ5A 1KLFB 4TRNA 1HYSD 3J27A 2CO7A 1BG9A 4BSVA 3P77A 1ZI8A 2P78A 3L7FB 1XNJA 4H15A 4JJZA 4X3OA 2FB9A 4F4CA 4TKWA 1Z0JA 4RMRA 4GNKB 2Z92A 1FQWA 3Q40A 2YIDA 3NKVA 3HLAB 3NP9A 2HRLA 2D5CA 4L8SB 3NBUA 2LFEA 2XAAA 3MNVA 3PT9A 2IDSA 4MD0B 7CGTA 4N4AA 5JATA 5A40E 2EDKA 4XVJL 3MD9A 3MT8A 2Z4QB 3A23A 4XPGH 1KIQB 2VL7A 4OI9A 1BWQA 3V8NA 2BFFB 1UXSB 1U2GA 2BSCA 1AH1A 2A6KB 4UCWA 1HZLA 1N77A 5F9OH 3BA6A 4DBLE 1INEL 4D9RD 1ZBDA 4MUNA 3UOAB 2CLRB 1QKZL 3I9PA 4UAOB 3V5DA 3DE1X 3NTCL 2BCKB 2ZOLA 5HI5D 1NEPA 2JJTA 3H5AA 3BWYA 2Z2XA 5LOVA 4HGNA 3ZH2A 3QWFA 4XQEA 5ANMB 5K9QG 1OANA 4HX9A 2NY6D 3CN0A 1WOMA 1Y42X 4I0PB 3MUNA 1ZAGA 1HH6A 4KQHA 1UKEA 5FA6A 5DVNA 4UEOA 2XZLA 1RZQA 2CHXA 2VM3A 2XQKA 1KYUA 5C0AB 3LHDA 4BNUA 4AM0A 1ISRA 4PZYA 1II8A 4N6RB 1B4JL 2V9QA 2MJWA 3ARBA 3CZSA 4QJ3B 5CMAA 2BAGA 3UAXA 4TMKA 4LGYA 4Y2DD 1X6VA 2XTSA 3ALXA 3GW8A 1ZLXA 4PV1C 1U3YA 1H3NA 4RXUA 5KEZA 2V5UA 2HFFA 32C2A 3DE6X 4NK4A 3RFZB 4O3MA 1QI4A 3SDAA 1DWOA 3C8HA 3ZMEA 5HHTA 3HL4A 4XPBH 4OKIA 5FK9B 4BYHA 1KFCB 3FE2A 2ID4A 2L8AA 5AW1B 4B9IA 2EADA 1X5MA 1EM8B 4NZFA 4FQHA 3P3TA 2LXNA 1A6TB 2TMGA 1QE3A 1OFGA 1NMAH 3BWUC 4Y5YA 4ENRA 3R6GA 2WXFA 1ISJA 1RACA 1U8XX 4AICA 1S3IA 4CQJA 3LPAA 4AGOA 1V7MH 4MV8A 3QY0A 1G4UR 3DSNA 4ALJA 4OLXL 5H94B 3VXOA 4JE4B 3SKYA 3LQ1A 3DE2X 2GPJA 4Q9QL 1JAZA 3JQGA 4HEA1 1UINA 4Z77B 1AQYA 1NW6A 1Y7VA 3HEIB 2X41A 1P5RA 1NASA 2H1LA 3AVOA 1USUA 2XTZA 4KVCL 2FRGP 4FUQA 4Q16A 3GJYA 5LU9A 4PRHD 5JRDS 1B0RA 4G8CA 3H0EA 2X2JA 4A6XA 1FUUA 3MFYA 3QHQA 1SVWA 4D4KA 4UTAA 3WS6C 5LQCA 2QTNA 4WZBE 2GIXA 3RTQC 5LP6C 3O4LB 2B82A 4NENA 4S12A 3GC6A 1X8KA 3RQSA 2C58A 4DEYA 1IFGA 4TXMA 1EDOA 3RY4A 1VPWA 4Q6KA 2CJUL 1M3SA 1KI9A 1MJ8L 3PICA 2ZVPX 3X14A 3M8OL 4ZVRA 1YQTA 3N3AC 3UMGA 4WJ5B 4OLVH 5GJWC 2GESA 1PG7X 1JPSL 1N6IA 3PUUA 1I8AA 4XI5D 1SXJD 3LT0A 3W9DA 5C07B 5IB3A 3HNVH 3BVXA 3CFBB 3MMEA 1OXKB 3FPFA 2PU7A 4BKQA 1DFBL 3R76A 1W75A 3SIXA 4KXQA 3BE1H 4Q3NA 3WP0A 3PXJA 4PFSA 4PNZA 4MNQD 3RYIA 4JI2B 4HHEA 4X7TA 1RP1A 3SN6N 1VC2A 4FTVA 2R2HB 3QPUA 4FMKA 1NJFA 2V7GA 2WD8A 2GCPA 1A6VL 3OCCA 4XMTA 3NSXA 1ZHKB 3PP4H 4LTDA 3PNRB 4E2YA 3PPYA 3QORA 2ARJQ 3ZN6A 5TGBA 3UZEA 4KZ0A 1JQBA 3FNEA 4S24A 3P4UA 3SKJH 3GCXA 4EP1A 1CI3M 2BNUB 2PYEA 2G80A 2XUDA 4E42B 2ZJSH 1TZOA 2C3YA 2R60A 3QPXH 3G88A 3HDJA 3UAYA 5AOLA 1TNNA 3T3MF 4C8XA 3EBIA 4RHUA 4INZA 5FL7A 4OHVA 1JHUA 2NTJA 1NCAL 1IEHA 2FWMX 3HHMA 1LEGA 1O57A 1YQGA 5HVHC 4M8KA 3MLYL 1PSDA 3QNYB 3CNQS 1QA9A 2CDEA 4NULA 3Q3CA 4KPEC 1PS0A 3ZZTA 3EPKA 1J99A 2BELA 3CZFA 4EIBA 3FH7A 1MJJA 3RDJA 1HEJC 1NHWA 4MB6A 4KWTA 4EBQH 3BAYA 1TU2B 4BO9A 2FUTA 2GM9A 4G23A 3MGTA 3LUCA 3D8HA 4LCVA 1E2QA 3QTBA 5DK0B 4F2GA 3GGWB 1JG6A 3WMXA 1MW3A 2F3RA 5DM1A 1Y8QA 4C83B 3TB4A 3MGBA 3BVNB 1QASA 3KDPB 4ZO4A 4Q03A 3AWIA 2J87A 1WW3A 3ZWPA 2A9ML 4ITVA 4Z3KA 3B2UD 3J81A 5LBUA 4RS3A 1RULL 4I50A 3PLYA 1QDLB 4Y4KB 2FB4H 4INOA 2Q3ZA 4UBDC 2GPBA 4YWHA 1NG9A 2ZOWA 4PN3A 2YA0A 5GQSA 2O1EA 2PN1A 1CVLA 2B39A 5IJCC 4HWNA 4ZNCD 1XSEA 1OE2A 5I71B 2JCWA 4W5RA 3A1NA 1Q0EA 4KMMA 3MSXA 1Z7JA 1MENA 2O52A 2YXLA 1URZA 4L1LA 5IJWA 4APQD 5HHMB 5BW5A 3OT4A 3OU6A 1TW2A 4R9UC 2L18A 5LNK1 4LMAA 2XWXA 2CQVA 3KLAA 3HJEA 1Z38A 3OQVA 3R75A 4G5HA 1OAKL 3TA4D 3C4QA 4G8BA 1RQ7A 2HHJA 3MJTA 3O73A 2I55A 2VMEA 4QYTA 2A7QA 2EJ1A 4IFBA 2DHEA 1NVMB 4XWKA 5I75C 4PJ7F 2P41A 3EJTA 4J2HA 1LQ2A 2JELH 4JM2A 3B3GA 4WW2C 1X7YA 1PO7A 5ANME 2XZAH 3WEMA 3BQUA 4C21A 2FHBA 3M88A 3CFMA 5AAPA 3EUWA 2BSXA 3RVTC 3D6VA 3DLCA 5JNYB 3O1HB 2Q76B 5AYTA 4HOZA 2PSJA 5JSUA 3CLVA 1ZDQA 1UFGA 2NLJB 5FFGA 1CY8A 1V4VA 5F0JB 2HF7A 2QJDA 4ZALA 5C0AE 4O5OA 4RVSA 1BJMA 3HHRB 4N8DA 2GFIA 1M42A 4P58A 1WB5A 4Y2UA 3FFBA 3VXTA 2MU1A 5A4IS 3NIGB 3AR3A 5CURA 3RWHB 4J3JA 4TQEL 3VO0A 1SY7A 2DQDL 4DC0A 3CX5K 3DNFA 3K3PA 4Y2QA 2BRRH 1CGYA 3ZGVA 3UPRB 1JPJA 1SBBA 5ERWA 3KOUA 3ZVKA 1V39A 3QLTA 3ZUCA 4WK2B 3W5SA 1MDTA 1G6VK 1XGKA 3SBEA 2DMRA 3WO0A 2IODA 4XMZA 1QYIA 3L9XA 3VD9A 1HT2E 2NY4B 2LHAA 1YXMA 4DERA 5DMHA 1QH8B 2EFJA 3S27A 3H65A 5JAPA 4DV5B 2R6R1 1KPUA 4M9SA 4ZMBA 5K8UA 4W7IA 3UC0L 2FE1A 1JVBA 1QR2A 1U2DA 1NQVA 1NGXA 3H3JA 4HBCL 3DTXA 3MBOA 4EYQA 1HDOA 2WYTA 3VOTA 1QUNA 1WRFA 4GSUA 4YHNA 3WA7A 3FKSD 3G0DA 2JKRM 4Z7QE 1JJFA 3WTUA 4DDHA 2VXVL 2W07B 1O96B 2AA3A 3G7UA 5ISMA 1F6LL 2BHSA 5C0RH 3BGWA 5I6KA 2JVUA 2DGDA 5KYXB 1DNPA 7REQA 5IIEA 2ED9A 2V55B 5KTTA 1QRSA 5HPMB 6REQB 1ZT7A 3L1HA 5H16A 2O3JA 3CQ9A 5CD9A 3O4LE 5AW4A 3NT2A 2GN9A 1BQUA 4F1SA 5ECJE 4PJ8A 3PV6A 4RWYL 3QFSA 2V0NA 1T5IA 1GAEO 1UZ8B 1DVSA 4IXNA 4KH1A 2LAGB 1SHJA 3LW7A 1G2PA 5JW4N 3QK0A 4GEJA 4F5CA 1KH2A 5JADA 3LIZA 3NEEA 3D3VD 5IQOA 3WA6A 4A91A 2HFJA 4RA0C 4HEA6 2ATCA 5C07E 2RHCA 1P7ZA 1QFJA 3GJFK 3MYJA 4I18A 4ODHL 1MDFA 3KTAA 2E48A 4CHTA 4KQWA 2JJ2D 3RWFA 2WTUA 4WFHD 4A7GF 3N8GA 4XB7A 4MVWA 1L7TL 1UM9A 1TQ6A 5KZCB 3A1FA 4C7OA 3WJ2A 5ADPL 4ETNA 4OCLC 4WHCA 4K2HA 4KHTL 3L7YA 3QMMA 3ZDCA 3QVXA 1KR2A 1IGJB 2ADFH 3OXSB 4S0TD 1GR0A 2GJ8A 1Z5YD 2NY3D 4M37A 1U2RA 3ANNA 4XSGA 1BCRA 5K6AA 4P0PB 3GPEA 4EI2A 4NCHA 1MA3A 4S2SA 4HK4A 3E0GA 3K32A 8AT1A 1AD0B 3E3QE 1N7JA 3HSYA 1IAKB 3IFLH 4IU2A 1G6KA 2BR5A 1UOKA 3ZE2B 5D2NB 3NZSA 1Y1DA 3L8YA 3DUUA 4WKPA 4BFGA 1TECE 3VDCA 4AN1A 2MMGA 3ZOKA 3V80A 2XZPA 2JJUA 4X98A 4OQYA 5IDQA 1OAOA 1KJ2H 2ZBVA 3DYIA 1QBLH 4CT4B 2XCQA 1QZUA 3I2HA 4NO0B 4F21A 1JBEA 5F97E 3ZTJG 3D81A 3RUGF 2VR6A 2YD0A 1QVOB 2VCOA 2HKFH 2EDWA 4U2GA 4DN4L 1WSST 3EZ2A 2GOYA 3OEHD 2RGNA 2CH8A 3OLDA 3HYRA 3D2TA 3OQNA 4DG8A 5J06A 1QWNA 4XNUL 2CMDA 3R7WA 3A67H 1MI5B 3ZZMA 1SVKA 2EBWA 1N1MA 3N70A 5AW5A 4FG4A 5DA0B 3DMRA 5JO5A 1TT5A 4JVLA 3WKQA 4L9AA 4MQ7B 3DAPA 5FW6A 2XE8A 1OSZA 4IIEA 5F4ZA 4IDPA 2Q3EA 3A4IA 3MR9B 1ZK2A 4WNCA 4HR7A 3VW3L 1R5WB 5BW7A 1W30A 3B37A 4L8LA 3RY6A 1NJ6A 1JJAA 1EUTA 4QTIL 2DQTH 2XYVA 5DQJA 3KZMA 4MXDA 3QEUA 4JG1L 5F2FA 1B8PA 4M60A 3UERA 1SHLA 3ULUC 5IKOA 1XDWA 5BNZA 3DVFA 2IPNA 5DISB 4IHJF 1JGDA 16PKA 1OI4A 3SE6A 1E99A 1HHJB 1HFWA 1RC0A 2YAEA 1VG0B 1WHSA 1YNKH 1H69A 4L29A 3ISYA 1TQCC 1QV7A 3VRLE 2FYVA 2D1SA 2WSLA 3MA9H 3WGYA 3GRGA 3L9YA 2Q5OA 5B5SA 2GM5A 4TT3A 4IIYA 1QLFB 5GGYA 3HJ0A 2ZTVA 5IOPA 2EHDA 1QLWA 1AMXA 1FU8A 1F11A 4JNKA 3EY4A 2BO0A 2VBGA 5HHME 3KKPA 5GZ6A 1IRAY 3CXDL 4ZYYA 4XD7A 2A58A 4K94H 4P2AA 2L3BA 2WIBA 5INDA 1TF2A 2HRHA 3IAXA 3NOQA 2NQ3A 4D81A 2EEZA 4TRRA 1IOWA 3CSTA 5D5MA 3VC2A 4BEJA 4WTWA 3I6IA 4CAGA 5K3DA 1P91A 3CCBA 3DVAA 1UPXA 7AT1A 1LYQA 4ILDA 1Y7LA 3RR2A 2ADGA 5CAEB 3P54A 3IX7A 5ILQA 5E0KB 3LIUA 1UADA 4J0GA 1KY7A 5BT8A 2IBZY 3P26A 3WLHA 2FN9A 2RB4A 5IREA 4GAGH 4NYMR 3VBEA 2MDTA 3P94A 3QVAA 3KL0A 4BCYA 2ECOA 1N3NA 4TYMA 2J3MA 3ZRFC 5EL0A 4P23A 3BGFC 4X6DF 1UPCA 3NIGE 5KQGA 1MG0A 2V3VA 1XD1A 2IWFA 5LNK6 1NA5A 5F5LA 4GM0A 3PD7A 2QRMA 1PWHA 3S99A 4RD4A 4LMPA 4HEPG 2JRCA 1TI7A 1ZA3B 4A6YA 5GJVC 2W7TA 1I6KA 4U1KA 4AJ2A 4E3WA 2XLBA 1N32B 5HD8C 1J0AA 2F53B 2AQKA 3SSAA 2BIIA 4ZW8A 1OXXK 4E5XA 5CEYA 2UYHA 3ZSTA 2KZ1B 2BKVA 5FFLA 4YO7A 1BS9A 3N5KA 3TCLB 2KDGA 1X42A 5GGSA 3U7EB 3ADBA 5DUMH 2RGBA 2VYFA 3I0NA 3NZ8B 2PO7A 2PH5A 2MINA 5E9DD 5JIIA 1A4BA 4EHLA 5KAQG 3HWRA 1R3HA 1SG0A 3ZEIA 5HZHA 3DKHA 4TKMA 3K1KC 1TVKB 3TR0A 1J8MF 3OJCA 2FLMA 4HXBL 4K73A 1X39A 2BOBB 4FHBD 3WXMA 5IVIA 4W1SA 2VQTA 1K89A 3FM9A 3RG1C 3DBRB 4PJ5B 4QHPA 4EDWL 2GJSA 1WCXA 2WZDA 1T1RA 5EU6A 4XVCA 4TMWA 2FP4A 4ZFNA 1KXTA 4ZOEA 4B9PA 4Y0GA 1H15A 5DRXA 4ZQKB 3MNDA 3GRUA 5ELXA 1XXHB 1DWPA 4F58L 1G60A 2CLZB 2CDGB 5REQA 1EESA 4WO4A 2Q2VA 1KXHA 4NO2A 2YXDA 3WIIL 3IQWA 4IHOB 1U98A 1VYVA 3FONA 4NUJA 3E9EA 4ZCMA 5E5MA 5FC9A 4ZZ1A 5KVEE 2NYAA 5ERYA 1IBBA 4G6ML 3UAVA 2XECA 1DAKA 4RBNA 3HPJA 3CLEL 2VLKA 3KWFA 4ZOLA 3FTEA 3VXMD 4PRIA 1MUJA 4LUCA 1KWKA 2H1OA 3KDMB 2BD0A 3GSUB 1TCMA 3U30C 1E6UA 1KJ8A 2VQSA 2AZTA 2DLDA 3QKWA 3QUQA 4URFA 1G5IA 3IXAA 1NCNA 2R8YA 3SVZA 2N3JA 2BNRE 3CT4A 2VWQA 1U8EA 3WL3A 3A6BL 3RFTA 2GKGA 4YAGA 1EGJL 3AG2B 2XUGA 4BP3A 3HN3A 1QPXA 3T52A 4DQLA 2UYOA 3MXVH 4GRLD 1WF3A 1KRHA 4OGQC 1NVTA 1RXCA 3S4SB 3QJVB 5T3UA 4MAYD 3DYVA 4K9LA 5HVWA 1G9XA 4FGSA 2E47A 4JZKA 2R29H 3EG5A 3DTVA 4AEHL 5DS2A 1Y1PA 1TIKA 5A5VA 4G01B 1WAAF 2I9LA 5ACLA 2O59A 5BPHA 3ZE2E 3QUKB 4ZJUA 3E8VA 4MWFB 3UYPB 2IZ1A 4IK7A 5IG7B 1FLVA 1JHKH 4N28A 3BMOB 2QSYA 4Q5IA 3DOJA 4ENUA 3G8BA 1UMDB 5FOBA 4QELA 2XFXA 3DL7A 2BSDA 5LQUA 1J9ZA 5I5JA 1EJFA 1B0GA 1KCUH 1DO6A 3NTOA 4HH0A 5CEFA 2FN3A 3K5PA 1PZSA 1N0IA 2I6QA 1FEZA 2OT3B 1E2UA 2WBWB 5A2IH 2HNAA 1I3KA 3E8MA 5BN3A 2WHXA 3DETD 2C2WA 5IWLC 5SZKB 3SBWA 4PHCA 1E90A 1MI5E 1MCZA 4MRAA 2ZOTA 4IRSB 5LMCA 3UQZA 3GI9L 3OJ2C 1P4IL 1Q9OA 3C41J 2NIPA 4MJ7A 4HUQA 4YXHH 3HMXA 2W22A 2CIKB 2PR4L 3KT3A 1SUFA 3L7IA 1XN1A 1P9MC 1F38A 1SUIA 3QKUA 5KSAA 4QJ4A 3U3XA 2IOOA 2EGHA 4APXA 3P71T 1HINL 3Q5EA 3OEWA 4NKDA 1WFNA 3MUUA 3TZQA 2BTQA 2Q2EB 2HI0A 2G9HA 1TAUA 3R5TA 3P4NB 5BUSA 1ZANH 3H83A 5CB4F 1NX9A 3QDGB 3A70A 2I99A 4H88H 1JPGA 4DLPA 1MC4A 3FUCA 4DVBA 5K0LA 4XP6H 4PR0A 1ZCRA 4AY3A 2GUYA 3TOCA 2IEPA 1DQJA 4Y1SA 2CNBA 3LS2A 5DJCB 4RD3A 2EJTA 4WGKA 4WLNA 5A2AA 1VCIA 3MOIA 1FJXA 3L49A 4AQAB 3PTZA 3HV2A 1E3DA 1KCRH 2XVYA 3TZVC 3V8EA 3UFXA 4IIJA 4K81B 4FQLH 5E8OA 1U02A 4NRZA 1WNFA 1MCPH 4BK8A 4R7DA 2Q46A 4XSHA 2CW5A 3WLEA 2MNWA 5CX1A 2YNMD 4XPZA 3QYPA 4I48B 1BX2A 3PDOA 1OBVA 2FUG1 3H8SA 5C9KA 3G5XA 4LCCC 3UT5B 3F58H 1YDEA 5I45A 4B09A 1ZVQA 4ZT4A 4KGZA 5FLXA 5TE7H 1Q8MA 1P5ZB 1FS6A 2XBDA 4ERXA 2UX7A 3GT6A 1ADBA 3LY7A 4ORGA 1P2VA 3MCG1 3B9VA 1QFWL 2ZT8A 5KOVC 4UIKL 4L27A 4KJWC 2WQRA 3LJ3A 5I8CA 1HE5A 2OJZH 1I9JH 1FIGH 1EFTA 3MLWL 2YIJA 3O3OB 3T1HB 5KOJB 1JR2A 4TVPL 3L1OH 1KULA 2XUOA 2FE4A 5EU3A 1MKYA 3ZY5A 2JXMA 1JTFA 3P30H 4YDKL 2WXGA 1V7NH 2NY7H 5HJEA 2F9LA 3BQMB 3TYGL 1U11A 2PT5A 5EJ2A 3AILA 1FSKB 4W5HA 3N55A 3GSNA 1HEIA 5EKXA 5IB4A 2Y66A 3T5CA 1Y7TA 3IEUA 3GT7A 4Q8BA 2NQ8A 2WWOA 1O03A 2G1PA 2Y99A 1G0XA 1AY1H 1ZY9A 4HLJA 3AREB 1HSBB 4ALIA 4DJ5X 1TQVA 1P2CA 1TU4A 1CF1A 4C56D 1DBBL 1JQLB 4HS8H 3SF8A 5CNKA 4CSZA 4RLQA 1AE6L 4Q4JA 4LGPB 1RXEA 2C2MA 3D64A 2IYYA 4FU0A 2FWNA 3NU1A 2OMTA 4ZXBB 4IQ4A 1CE6B 4D4MA 5D1QC 1E2GA 5JCOC 1RMTA 2VWEE 2Y06L 3RWJA 4G0QA 2O2EA 3K1TA 4P3DA 1CG6A 5DW3A 2GM4A 5F7FA 2UDPA 2FJGB 1KS9A 3G8DA 4Z3IA 5E9WA 2JH9A 3HVDA 4IOMA 1UT2A 4Z4EA 2AB0A 4YDVA 1JQEA 1JEEA 4MWTA 3B1YA 3ABGA 5FNVB 5CCKL 3ZJUA 1T6ZA 4PJ5E 1KBVA 1J9RA 4IJTA 1FUIA 3BWMA 4HBZA 1T4CA 1N5AA 4R97B 4X9IA 3PNKA 2DC1A 3KBFA 4OOEA 3WQHA 3HMKA 4ZQEA 4W4NA 1XXHE 3I75B 3MUHL 1F4YH 2PT6A 5DHDA 1U2PA 2VDLB 2I4TA 4NERA 1IAII 3B8SA 2C3PA 4MAFA 3TINA 2XNHA 3LH2L 1BQHA 1G8KA 1Y1UA 3CW2A 4DCSA 2EYRA 1MIOA 3EGEA 3VSUA 4NZZA 5AAWC 1QLJA 3UWSA 1TIUA 1OH7A 2E82A 1CX9B 1GV1A 3BL8A 1JDBC 4WW0A 3WTSA 4GBGA 1BFSA 3L2LA 3CLWA 5DUPH 2ZX7A 3CGTA 2R65A 3CEPB 4WD3A 5BOJA 3PRKE 7FABH 3BGMB 4RF2A 2A0XA 2C3MA 1HK7A 2XD4A 3BIKA 2JKWA 2QZ9A 4H7VA 1Y37A 1YR9A 2J1KA 2CO7B 4BSVB 3EEFA 3P77B 3L6OO 3ZHLA 1D4ZA 5C0BA 4YVUA 1V37A 2NY0B 2V8MA 3IXTA 5AMXA 4DW8A 3FMOB 5CVDA 1IJKA 2YMMA 1IGCL 2Z92B 4M1YA 2H6EA 2ZOUA 1I4WA 3GRWH 1NIAA 4F3CA 3CRQA 1RC8A 3DBIA 5BR8B 4FOPA 4ARUA 3TA3D 1SUSA 1PW5A 4MVJM 3ULVL 2WQVA 1ES0A 1Z5LA 5AM2A 1XIWD 2LPMA 4U4BA 3WNPA 4M5YH 4Z7WF 3OZBA 3V2HA 3EGWA 6YASA 1VIYA 2LIVA 1GEEA 1U8IA 3MV7B 3V5DB 3AS0A 1JLLA 3CZEA 4B9JA 5I9LA 5BYAA 2YLKA 2ZOLB 1TJPB 4P98A 2OK7A 1CYEA 3JZFA 5GZND 3OKNB 5LOVB 2E4YA 4HIHA 4N87A 4R81A 4A7VA 4BO6A 3L7AA 3PP3K 5A16A 2FEJA 5T3ZE 4E0BA 3V9FA 3T12A 1HH6B 2M2DA 2WMPA 3NUGA 1VESA 2AW5A 2PVCA 1VLQA 3ENZA 4X94A 3LFUA 4ONOA 4C3UA 1MO2A 3REWA 4AM0B 3A6JA 1YBAA 4Y1TA 1II8B 2JVKA 4FOTA 3ARBB 4HU2A 4XP9L 5CMAB 2EKDA 4I4NA 2C9RA 4AQ8C 1CDCA 3UJ7A 5IW8A 3LTEA 3O1LA 4Y16D 3QXTA 2ACEA 3FTGA 4R2HA 2P3OA 1R6TA 1S4QA 3DK0A 4HGOA 1U3HC 1TO6A 1WCWA 5I0YA 1XQ9A 32C2B 5IM4F 2PUDA 4F37F 3N39C 5FLEX 2AQ3A 1JWAB 3BFQG 3SDAB 4ONGL 1YHNA 1PG7L 3K73O 4UU1A 4WUUA 3BIWA 4MICA 2XBUA 4A10A 3SDZA 4FQHB 4BKMA 4UXIA 3C7AA 1H9DA 2GX6A 3R6WA 4EF5A 4Y5YB 4GQAA 2F8MA 1OX5A 1ZU4A 2HG5B 2IHVA 3V1LA 3ET4A 1WXGA 1NMCC 5FCUH 3DSNB 4AKOA 2ZXFA 2QGDA 5C7ZA 4M9QA 3ZR6A 3CUSA 4J0CA 3M6UA 1MVUA 3BN9D 1NBWB 4FTWA 1PPIA 4ODSH 3CRVA 3NNSA 3JQGB 2NY1D 2OMUA 3QYFA 2Y92A 3A27A 3P9IA 5C0IA 1LDEA 2VZLA 2X0DA 1R1CA 4Q4AA 4JVUA 4Z7UA 4IHQA 1FFOA 8PAZA 3RUPA 1UMBA 1U0LA 1B0RB 2XHNA 3HJTA 4B34A 4UUOA 3QELA 5LYYA 1UGNA 3IT3A 3MGCA 2I7VA 1OGJA 4F8TA 3MLEA 5GJSL 4F9GA 1V4NA 3LDBB 1VL0A 1FAIH 3GLQA 3NHJA 4PWEA 4NENB 1JNHA 1KOLA 1FO0H 1G7IA 4LYJA 1M05A 1U30A 1Z5UA 3WMRA 4ZCSA 3OJDA 3LKPA 1F2QA 2P6OA 2QMYA 1NJ9A 3X14B 4BFJA 1Z9SA 4UI2A 3MFGB 2IZ0A 1N9GA 5BXYA 2BEUA 3AHJA 3JD0A 2X1PA 4KVAA 4I3SL 3MCYA 4XVTH 3W9DB 5IB3B 4D6PA 5E7IA 4U7FA 2C92A 4OFBA 1PYWA 3MMEB 4RH4A 4D3DA 2JKIS 3INYA 4MW4A 2QQFA 4AUYA 2AJVH 1L0BA 2FUG6 2ORED 1VGEH 5FBZA 3RYIB 4Q19A 5JBNA 1YR7A 4X7TB 2D03H 4PPTA 3F90A 4FTVB 3U7YL 1W8OA 1IIIA 2BOLA 3BDYL 5FUCE 2C7RA 5JYDA 5DS8B 1COZA 1JALA 2GI4A 1G84A 2IH1B 3O3DA 2DZEA 3L5WB 3QORB 4PHTA 1EO5A 4M7PA 4OSUL 3C3XA 1HLFA 5CGQB 3BT2H 2PYEB 2D7OA 4Z4IA 4LFAB 2L42A 2FW9A 2HLDD 1X5HA 3ARTA 3I61A 1AKQA 3PF8A 3SZ3A 1IVNA 5AL8A 5KVGE 1YUBA 2W2NA 4NBNA 2JL1A 1B26A 2JHAA 5DHYA 3QKIA 5IBTH 4LAQL 3N28A 4LE8A 1A8UA 1YBMA 4G82A 3KT6A 4N2IA 2BVQB 2G28A 1QA9B 2CDEB 3ID6C 1DIBA 5GRWA 1JIVA 4PXAA 4HJIA 3V0VB 3M4ZA 5GZ3A 3AKEA 5AQ1A 1U2QA 4N0CC 1DARA 1MJJB 4I46A 4MYUA 4UAJA 2X9WA 2JFNA 2AK4D 3M81A 2CO4A 3RAJL 3QLUA 2FU5C 1OY3B 2BMFA 2WABA 2ILLA 1FOEB 3CPEA 1UQRA 3TBBA 4PVMA 2Y6SD 1N3IA 2GPZA 3PAVA 2WSSA 2QUAA 5CNIA 4V0ME 4MIKA 3YASA 3MGTB 1QHIA 4M46A 5CD1A 2YVKA 3CLTD 2YGOA 3ULUH 1BWRA 5T64A 1XZ0A 1N59A 1XEFA 2DH2A 4S1DD 5BQFA 1NCUA 3T7CA 2WB2A 3ZHKA 3STUA 3MRQB 2X7LA 1N2CA 3C5ZC 3QUYD 3E9MA 2J5LC 5TTRA 1RAAA 2D4AA 1VPTA 1SVUA 1VCBC 4WLEA 3D4YA 1LEHA 2F5AL 1HG0A 1DEOA 5AOMA 3ZRSA 5AUMB 3ORHA 4U1GC 3OPYI 2ZAGA 4FSDA 3HJNA 3FPXA 4MQEA 3HH8A 1W15A 1EZ4A 5EO1A 4KIGA 4MYSA 3KV3O 1TSHA 3T2OA 5JHAA 5ALWA 3BRGC 5I1LA 4M83A 4QSHA 3U0PB 5T5FH 4Y89A 2W81C 3JS5A 4NU8X 5KYUA 1M83A 2OFOA 3LSYA 2XKSA 4JN1H 3FU3A 3D59A 4I9WE 3T5PA 1OXSC 1PR3A 2PYDA 3DXAD 2GJAA 2BHRA 4KBYA 4UJ5A 3ZCQA 1WMFA 3ILSA 3I6ZA 3KLAB 3STYA 2IZOA 3VMOA 3B3JA 3MV7E 1F2DA 2F19L 5LQBL 3OIYA 4YYEA 3UMMA 3GNLA 3BH8A 4OR1A 3DMMC 2NOYA 3V42A 3O90A 3WBBA 2E4AA 1X7YB 4NDAA 2O0LA 1YSOA 5HP4A 3BQUB 3UJAA 1VKZA 5IQ7H 4BY9E 4JK3A 1NPTO 4K07A 4WU5A 3GWJA 4TKVB 4DV4B 4RETA 5TGDA 5KNBH 5JBIA 2GETA 3LN4A 1JYXA 5C09D 2VSYA 3ES9A 4NFCA 5JS6A 3HZVA 3ETNA 2KQNA 2JI3A 2C97A 2ZTHA 4IS3A 3KAKA 2Y3IA 2NXZD 3VXTB 4C58B 4AOFA 4NK5A 3ED5A 1JDPA 3ONWA 4CFZA 4KQ3H 5IN4A 1N0XH 1JAIA 2CLOB 2WOBA 1BMGA 3VKHA 4PWFA 2BEJA 2V3CC 2H3EA 3GLZA 5CXPA 3U7FB 3EWSA 4DTIA 4URHA 4AIOA 4I0WB 1PUJA 2ZJZA 4LYHA 4GQZA 5ERWB 1ZTXE 3BC1A 3N41B 4QNPF 4NESA 4WF7A 1WXEA 3PY9A 3QNMA 4YHZL 4M5SA 5DJYB 2B34A 3K2IA 3MWJA 5AW7A 3ZCRA 4LSDA 4G71B 2JAXA 3NJKA 4TN5A 2K87A 4B8YA 2ITFA 4BASA 4HNUA 2EGGA 1MFCL 5JYCA 1NYTA 1GGEA 1TENA 3IDQA 3HB9A 1KPUB 3BP7A 3MS2A 2IQAA 5KI6A 2PW2A 3Q1LA 4BNFA 3NCYP 3UWKA 1MB9A 3WN6A 1NUNB 2WWTA 5ILOA 4GIBA 3BJEA 2VDML 2I07A 1D5WA 1NGXB 3D43A 4O1IA 3DTXB 2AZMA 3EJRA 4GG6A 1QUNB 1FF5A 2GTIA 4YHNB 4ABQA 4J0EA 4HIJA 1FE8L 3OKLA 1Z5ZA 1XHHA 3AKZA 4GQ9L 2PYIA 1PG2A 3QCTH 4DMKA 4NBKA 4FLHA 5F33A 2QN8A 3N91A 3MLAA 4HQ6A 5IIEB 3UTZA 2IV7A 7YASA 3OIFA 1SJ9A 3FCYA 5MHSD 5IKPA 3ECSA 2ZP9A 1FIEA 5LKRA 4KC0A 2AQPA 1JGVL 1I8IA 3PNBA 4PJ8B 3PV6B 1RPKA 3OBAA 1PL7A 3WJLC 4CKYA 1ZS2A 1TT7A 4GW5A 3OPXA 4O4JF 4GRWF 3AQDA 2FEEI 4Y1AD 3TR5A 5KSOA 3TS1A 2G4VA 1JZ7A 4ZXFA 3AJRA 3MYJB 4I18B 3KTAB 4CL0A 2PPFA 1ECCA 3NOXA 2EZ0D 2H47C 3GLTA 3RWFB 1ODUA 5INCA 4CDMA 5IZ4A 2OC4A 4C7OB 5D00A 1W8EA 3U4BH 4FJ1A 3WB2A 4JELA 5AK4A 4PPFA 1I8LA 4LQDA 4FTVE 4FYIA 1VKHA 3LMJH 2XE6A 4RJ2A 4DR6B 1BCRB 3JQRA 1DKNA 2XT6A 4QM6A 2RJMA 2Q3DA 4S2SB 5L3RA 1BXUA 3FRUA 3LH5A 2V7HB 3HJCA 5KVFE 1WZUA 2FETA 1ZMYA 2V7BA 4L8FA 1AHWC 1I4FB 2ZJ5A 1OXVA 2HXGA 1IOLA 5H3LA 4PJDF 1LNUA 3D0OA 3MOAH 3DUUB 2R8EA 5IT0A 2PYEE 4FDLA 1KY2A 2E1PA 1E8MA 3HG1D 3FQYA 2NAPA 2HWXA 2DDQH 2KSQA 4X98B 1H0KA 3AB3A 2JLZA 1T7WA 3GBNL 3KPRA 2W6CX 1GPAA 3BOVA 3GDBA 4A55A 2C82A 3VD0A 1FTYA 4CIDA 1ODKA 3O0RH 5SWZD 4QFCA 3U3RA 4QU8A 3AQZA 4PVBA 3QUXC 2FQDA 1IVLA 1KJ2A 2QQKH 3ENVA 1IYZA 1CXHA 4BZZA 1EINA 4JP8A 3F7TA 3R7WB 1TQ8A 3OJWA 4PPYA 5AW5B 3M83A 3W5CA 2XQJA 5BYJA 3O8XA 4YCAA 5LBTA 5C3TA 1U8HA 4J6FA 5DYIA 4N48A 1OSZB 5DRYA 1MQKH 3KUKA 2VF5X 3FCAA 4EH1A 3K4DA 4OFVA 5E8NA 2HJWA 5HHOB 2VK2A 3QB7C 4YRCA 3QUMH 3M33A 2DD8L 1QPGA 5DN9A 4GKSB 1QHYA 2JIPA 1PU0A 1SDAB 3DURB 1WZMA 4BLSA 1VL5A 2I03A 3LF1A 5DQJB 4N8SA 3QEUB 5HTSA 1G8HA 2XNSA 2B0SL 1RM4A 2DJUA 3T6WA 1XH3A 1SMOA 1JGDB 2HH0L 4G7QB 2HSIA 5F7XA 3KUUA 2VAVA 2H31A 5KTEH 4N9GA 1QPBA 2ZUCA 4BAUA 1WHSB 1R6DA 5EORL 1J90A 1JIJA 1BVNP 3G5TA 3SDYL 4CIAA 3VTTA 3UJNA 3VR4D 1BP3B 5E5RB 5EXTA 5AOIA 4LAJH 3EOAI 4ZQBA 5AOVA 5FYKH 1FMJA 1JAXA 5IOPB 3R9WA 4UVDA 1F11B 1MJHA 2HEIA 3IRZA 3O3CA 4BAZA 4B9EA 2DM7A 3CV3A 1L7MA 5C0CD 4PM4A 2P6NA 3LLSA 1E2NA 4Y9DA 2X4SA 5INDB 4L0YA 3DP7A 3A9TA 5THKA 3OZ9L 4JGJA 1OKKD 3IDZA 1G18A 1LV7A 4RORA 5ACMA 3DVAB 2AN1A 1V11A 3R7NA 5DPMA 1CJBA 4WAUA 3EYSL 2QQNH 1B8VA 5BSGA 2XMCA 1YEGH 4TL4A 3PGFH 2XQYA 3CC5B 1HESA 3LQQA 3ENQA 2V6MA 4J23A 3BSZA 3DBOB 4JQZA 1UCFA 4PYRA 3U4QA 1N3NB 4F9FA 1GQFA 4P23B 2AX4A 3MWDA 1I1YA 3GK3A 1E63A 1JIBA 3AL8A 1TPXC 3R0NA 4C3VA 1M2WA 4BFCA 4G4SP 3CR3C 1QH0A 5LIPA 3L1EA 1FFHA 4PXYA 4G41A 4X7FC 4GP9A 3RPEA 4RV4A 1MIEL 1J0CA 4IRJD 3H99A 5A6LA 4XOUA 4Y2OA 3KYAA 2G2NA 4C1BA 3AM5A 4U1KB 1MDAA 2WTBA 3QA9A 1TMQA 2BVPA 3TVYA 4E5XB 4X60A 3O6FC 4NYIQ 5HQTA 4C7KA 4CC0A 4FGKA 2Z7YA 3QZPA 4JYCA 3HN6A 5GGSB 1VL8A 2MINB 4WINA 1IC5H 4Q9DA 4PS7A 3AGPA 2VHJA 1GGHA 2XWDA 3ZR5A 1Z7GA 2LT9A 2B4QA 2EQ5A 2YPLD 1U91A 5J13C 3RUCA 4WAFA 1DWQA 5EU6B 5FBQB 2FP4B 1DSWA 1KXTB 4JDZA 1YYML 4MA1B 3HL0A 3W57A 1EA9C 1H15B 4G6JH 1ZMBA 1JT9A 4MDEA 2Z8XA 4U0RC 5DK4A 3RTLA 2P9YA 4HSQA 4WO4B 1QP4A 3CE9A 3KVYA 4NO2B 2R5WA 1T7VA 3GD7A 3RL1B 4H26B 4GW4A 3RGVC 4OHPA 4R2KA 3FONB 4NUJB 4PGGA 3G0CA 3P69A 1F5NA 1XTMA 1AUPA 5E5MB 2ZFUA 4EI9A 3IP1A 2JBAA 4A2MA 5JHBA 1N0WA 1BJ1J 1QEWA 4G3YL 2C5DC 4J9UE 3R06A 1E66A 4Y9FA 3MV9A 3HPJB 1QHEA 1I3RA 4MQMA 1MUJB 3F7LA 1RP9A 2ZI6A 4AFNA 3KWWA 4WY5A 4IICA 4JAMA 4E5VA 2X8LA 2DHCA 3SE4A 1A4RA 3RVMA 2R4SL 4F5CE 1ZH8A 4OL0A 3IXAB 4TTDD 1YVPA 3LGSA 5K6TA 4I4WA 3RRQA 1P80A 3D0LA 2EYQA 4ZFOB 1GKOA 3OSVA 2HMYB 4OM1H 4QSMA 4F9LA 3HRZC 3DVIA 4NYLB 4ADGA 4XCFH 1KPRA 2IEDA 3RTCA 4CC1A 3HC3L 1LD9A 3UZVA 3VGFA 3QQ3A 4B4UA 1MVNA 2WYIA 4L4ZA 4NAHA 1WA0X 1M7GA 2MSPA 4OJEH 3DTVB 5AYVA 3NSCA 5C08D 2XMSA 2I9LB 3P4MA 3R18A 1DJMA 1KNOA 3QJXA 4F9TA 4GIPD 5CFRA 5DEZA 1NQAO 1WB4A 3P27A 4PBXA 4CJ0A 3TMKA 1E2IA 1ZGLM 4R16A 3MRVA 2BMAA 1DCEA 1YS1X 2ZJOA 4LYYA 3MCWA 5FOBB 1FTNA 2XFXB 1XWFA 2EC9T 2VDPH 5AW9B 1B0GB 2CLDX 3IP5A 4IIQC 2FBJH 2QLVB 1B0IA 4QVIA 1TCBA 5J3JA 3J7HA 5GZOC 2GO1A 3BDIA 4QRRB 2C7BA 3SZKC 5GHWH 4GBXC 2FCRA 2Q9CA 3CVHH 5B4MD 4XCNA 5DQ9A 1XXLA 5BN3B 4ONEA 3LG2A 4E9VA 1W8NA 3QW2A 3NH6A 5AVQA 1MAAA 3NMEA 2GG1A 2A1TS 3BFOA 3JYCA 4JB9L 1MMFB 5IFJA 4URKA 2OG2A 1Q9OB 2HA4A 4EKGA 3TN0A 3HC4H 1XU7A 2ZUVA 3K9HA 4HUQB 4ETQA 3B9KD 3KW7A 5IAAA 5LGJA 3L3IB 4RMJA 2ZEJA 5J4MA 1ZVMA 1H0DA 2HAZA 1ZK3A 2O7SA 5KSAB 1NQ5A 4APXB 3EIOA 1NU6A 4GLOA 4MVJI 4NKDB 1CICC 1Z5PA 2AYXA 4DVJA 2OZEA 2EO9A 2Y7LA 2WXRA 4LMQE 5FUOL 1QQ5A 1JPGB 5JVDF 2Q3BA 4DVBB 1YEKH 4MJIA 5CP3H 5TY0A 4BP1A 4MB5A 2AQSA 1XB8A 4L5FL 3IAAA 2LBPA 4J7RA 4NZUH 1WW8A 4PSDA 4QUBA 2OSLB 2CPCA 3UFXB 4JHWH 5C8VA 4IIJB 2J6HA 2WXOA 4P59L 4UQDA 3HQ4O 4US1R 5E8OB 3Q1EA 4NRZB 3LZOA 3GFQA 4HS9A 5T3XH 4R7DB 5LJIA 4M02A 3E23A 4O29A 3IAGC 2PVPA 5CX1B 5JT1A 3ZU6A 3FOZA 1BX2B 3PDOB 4XAWL 2O6CA 3KG5A 2XPGB 2O3QA 3G5XB 4CM4A 3FFAA 1A1OA 1ZIYA 4KRGA 1L7IH 5DZLA 2CBZA 4R7XA 1R4ZA 3KBBA 4DMHA 4K3JH 1TADA 3WS6A 5D5ME 3NQ41 1ZOIA 4FDMA 3BYZA 3MSCA 2IADA 9ABPA 4ORGB 1X5IA 3RTQA 3CZQA 4HWEH 3HR7A 5LP6A 4XH9B 2RJ3A 2Y0PA 1RCFA 3WWYA 4IO0A 4WO0A 5I8CB 2KZWA 1QMUA 5JLZB 3OU2A 1CLYL 3RASA 3PFNA 5C97A 1FDSA 2DP4E 3MJRA 4R0LB 3KR2A 4YJ3F 3CZKA 5EU3B 2JXMB 2IW1A 3UV7A 5KYKA 4GEIA 5KNCD 1E9BA 4ZQGA 5L4SA 3GZNA 3CAFA 1ZT1A 1C5CL 2P28A 4E7OA 3TJMA 3QTTA 1ISSA 4N8UA 1W4BA 3GSNB 3CZ9A 3WV0A 1YI1A 2VYQA 5HYFA 3TRJA 1Z2OX 5IB4B 2PR2A 2DEXX 4OP1A 1KXVA 2V3WA 3C3EA 1CR9L 1A6WL 4BFZA 2OCDA 4CJXA 3VSAA 3FGPA 4M5ZH 1RHMA 4KKNA 4MA8L 4KQMA 5KANI 1P2CB 3DMFA 3PPVA 2Z31C 4QC2A 3SF8B 2QTEA 4G5ZL 4XB1A 2DFDA 4FWIB 4Q4JB 1TO4A 3X2EA 3H42H 1K4KA 2OMTB 5K4AA 5CO1A 2OD2A 4M7RA 1H5QA 3DGEC 2B7DT 1UB5A 4M1DH 3F00A 3A4FA 4FQ5A 1T1GA 4P3DB 3NJVA 1XXFC 3QZBA 4CKCA 4NBXB 1AGXA 5JDJA 4EY5A 4AK9A 3MV8D 3BZDA 2WIJA 3JR7A 1Q74A 3N50A 5E1IA 5FS5A 1TZ8A 4FJZA 3UAWA 4YDVB 4XPTH 1I4EB 3O0LA 4HOYA 4ZMXA 2N7BA 2N1KA 5EU6E 3BOSA 1T4CB 1N5AB 3UTQA 1OLSA 5GRUH 1L5MA 4IHKA 3QDMD 3OFJA 5K05A 5AENA 3EC7A 4GI2A 3MOQA 2J09A 3KLMX 2PXYC 5I74C 2VK1A 2PG3A 1AKNA 4CGZA 4LVNC 1BQHB 4J6EA 3M6VA 1CG9A 2EYRB 3C2AH 2W9EL 3KW8A 1MIOB 3RBAA 2BFDA 4BN0A 4W9ZA 2HU7A 1SK8A 4MKXA 2YOHA 4YLEA 4XRCB 1QGAA 3IGFA 2VLKE 4WLOA 4WFQA 4PRIE 1OZUA 4LGRB 3OJFA 3BKYH 5F1OA 3GRFA 2GCOA 4CM9D 2RHEA 5E4OA 2OI9B 5BVPL 4M7LL 2XJ9A 1S78D 3BIKB 1P1HA 5SX4H 4WZBB 1KBQA 2DQJH 4YHHB 2ZIDA 4GSQA 5C0BB 3T3PF 4KXZI 3AM3A 1BLIA 1H6FA 3IXTB 3O83A 5TXGA 2WKPA 1C7SA 2ITCA 3FCCA 5H59A 3ZY4A 4DABA 5FW8A 4B7AA 1ZHOA 4J0KA 3PU7A 2V9UA 3WENA 2MMXA 1REQB 3GV0A 2XGGA 4AVIA 3SYCA 3F8TA 4W6ZA 5AVYB 1ES0B 4CSTA 1Z5LB 2AP2A 2UZAA 5LVEA 2ZJAA 1GPUA 3GRWA 4YT5A 5DBGA 1C8LA 2HRPH 4X1YB 4GKNA 2J48A 3DROA 3RE0A 4YI3A 2PCYA 5GV7A 4QUEA 1U8IB 1JLLB 1MFUA 3EH1A 1I2BA 1E50A 1FP1D 4UU8A 4J3NA 4CG1A 2AXGA 1AIPA 4ZGBA 3A6ZA 3MGAA 5DTEA 2JWYA 1KO7A 1NUQA 4HIHB 1MCWM 5A16B 1UA6L 4TVPD 4OKDA 1J9CT 4D3ZA 1T24A 5GXBB 2WUDA 3ME5A 5CD5D 5B64A 2GD2A 1YB7A 2WPGA 3VH1A 1OROA 4R41A <