3ZE2B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
469
structure length
469
Chain Sequence
b'NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 115
structure length 469
sequence length 469
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze2B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze2B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze2B03
3V4VB 1JEQB 3EG9B 2ODQA 1SHUX 1JEYA 2NUTB 1TYEB 4MMYA 4O02A 3OKYB 3F74A 3BQNB 4WK0B 1UEXC 1IDN1 1JEQA 3N2NA 2VDRB 1AOXA 1MQ9A 5HDBB 1T6BY 2UZYB 4NEHB 5E6UA 5KYNA 3ZE2B 3ZE1B 4K3JB 1FE8A 1MF7A 3RAGA 4C2AA 2VDPB 1U8CB 2VDQB 3TW0A 4WFQA 1IJBA 3FCUB 4IGIA 3PPWA 4JX0A 3Q3GE 3FCSA 1N3YA 1IDOA 1XUOA 1RS0A 2M32A 2VDOB 3AFCA 4G1MB 2ICAA 1JV2B 3VI3B 1M2OA 1PCXA 2QTVA 4A0QA 5HGJA 3GXBA 4IXDA 3EOAI 3M6FA 3AL8B 3BN3A 3OL2B 3EH2A 4C29A 4MMXA 4WJKB 4G1EB 4O3UB 4IHKA 3T3MB 5KYUB 4F1JA 2WINI 3HXOA 3EGDB 5KYWB 3EFOA 1FNSA 3IJEA 1V7PC 3EG9A 1XDGA 3QA3E 3VI4B 1MQAA 3NIDB 4UM8B 3K71B 2NUTA 3PPVA 1BHO1 4BJ3A 5LN1A 4M76B 1PT6A 2P26A 4DMUB 5KYYB 2VDKB 2NVOA 2ODPA 3HI6A 1BHQ1 2NUPB 2XWBF 3HXQA 1M2VB 2ADFA 4UM9B 3T3PB 3PPXA 5E6RB 5ES4B 4GZ8A 4HQLA 3TXAA 1U8CA 3OKWA 1M1UA 1L5GB 4UM9D 3AL9A 3BQMB 5BV8A 2VDLB 2VC2B 1Q0PA 1OLZA 4NENB 2WW8A 4FX5A 4G1MA 4MMZB 1JV2A 2P28A 2I6SA 1M1XB 4CNBA 1NA5A 1SHTX 3AL8A 3ZDXB 1ZOOA 2I6QA 2O7NA 4HQNA 3OL2A 1DGQA 4WK4B 4Z7NB 1QC5B 3K72B 4G1EA 2X5NA 1N9ZA 5KYUA 5E6SB 1YVPA 5HJ2A 4WK2B 3EGXB 1ZOPA 3ZDYB 3EGDA 3TVYA 3ZE0B 4PN7A 4O3TB 1IJKA 1LFAA 3F78A 4XW2A 5KYWA 1RRKA 5KYXB 1PD0A 4HQKA 3K71A 1MJNA 1AUQA 2XGGA 1QCYA 3NIFB 1JEYB 4O02B 4MMYB 1RTKA 2VDNB 1T0PA 2I91A 4JDUA 3IBSA 5KYYA 3EH1A 1U0OC 1JLMA 3E2MA 4Z7OB 2NUPA 4HQFA 1ATZA 3V4PB 3NVQA 1M2VA 5E6UB 1YVRA 5E6RA 1MQ8B 4CN9A 1SSLA 1YUKA 1L5GA 4C2BA 3K6SB 1AO3A 1RD4A 1M10A 3EOBI 1DZIA 3FCSB 4NENA 2B2XA 3ZDZB 4F1KA 1CK4A 4MMZA 1XDDA 1OAKA 1ZONA 3K6SA 3ZQKA 1M1XA 4Z7QB 4CN8A 4FWWA 1SQ0A 2XWJI 1PD1A 3TCXB 1QC5A 2VDMB 3K72A 1CQPA 4MMXB 2IUEA 5E6SA 1MHPA 4HQOA 3EGXA 1U0NA 1SHYB 3NIGB 3PPYA 3EFOB 5KYXA 3IJEB
chains in the Genus database with same CATH superfamily
2CW5A 1DBKL 4KSBA 3JQ8A 4ZZ0A 1X1QA 3TEFA 2CIKB 2Y1LA 2I62A 1Q94A 1X5HA 1I2DA 1KTLB 3M17A 1JMVA 5EUKB 3MV8A 3ID6C 1V2HE 3C3AA 2EG9A 2BSRB 3AT1A 2H3KA 1KP3A 1EFPA 1HF3A 3LA8A 4IDEA 2WVJA 5F7NC 4W9FC 1RI2A 5JTWA 1LBEA 3EKCA 1RJYA 2VR1A 1KDRA 5AJYA 2C7OA 4HCJA 4H0GA 2JEZA 4IIQA 1XWVA 1PZFA 4D9GA 5T33H 3BEVA 2C95A 5EC2B 4QFMA 1F3JB 3IVAA 2XQKA 3LY9A 1H22A 3H8JA 3BSHA 3CZSA 2NTJA 1CK0L 3MELA 2OD2A 5FYLL 1YI0A 4YDSA 5JSHA 4OFQA 5IC4A 3ZKMD 43CAA 5JMOC 2QGNA 1ZEAH 4LF6B 4R3NA 3SGDH 1JPSL 2LVEA 1W5BA 1Z7WA 4KQXA 2OCGA 2VN8A 2HX8A 1D2MA 3IVGA 2F1IA 4AX3A 4EDHA 1R6AA 2GAFA 3KDSE 3U44A 3TBTA 4JW3A 1E69A 3LNHA 2XDQA 3HI5L 4Q14A 2ACKA 4IVRA 2VDNB 3HLKA 3KT8A 1BLIA 2A0YA 2O8EA 3QDJB 3AEUB 1RXLA 1P17A 1RYBA 3RX8A 2HZBA 2NMVA 5KB3A 4R6UA 5JO5A 4V02A 3NHBA 1DBBL 3EOBI 3GQBA 2DM2A 1A4KB 4J8PA 3MINA 5I1HH 3SD5A 1COWA 5EPOA 1V7ML 3DEZA 1INLA 4B75A 1G9MH 1KYTA 4ONOA 5DPMA 4ZMPA 3RF6A 3HYTA 3S5LB 2B5WA 5LA6F 1H6AA 3AR3A 3JATA 3GRWH 3FCBA 3T0GA 3RE0A 2K3HA 1TQUA 2GSGB 3TTYA 3LUKA 1DSFH 3RIFK 3BZUA 3H9BA 4PPGA 1KB5B 4XPAL 5CHEA 1EMTH 1V37A 2FF5A 4TT8A 2C34A 3C6LD 2IC2A 1BN7A 2DBQA 2NR6D 2LUOA 4WLCA 4AUUA 2A83B 3WLWD 5F3HB 4M1CD 1ECYA 2WHYA 1QGUA 4ZS7L 3E3NA 3HB3D 1DE4B 3IRCA 3Q11A 4N65A 1V1RA 2XWJA 1CPYA 5HPMB 3T7KA 4PTUA 3LJKA 2CUIA 1BYNA 2HREA 4A2PA 2LWIA 3K9WA 4D96A 5IUJC 4QGSA 4F85A 2WF5A 4XASA 1RHHB 3PL1A 4XNYL 4DF9A 3NHJA 3FT3B 4M8IA 1ZK2A 3O6FC 2VK1A 1N2CA 4Y0GA 1TZGH 1GG8A 1AKNA 4W8GA 3QGMA 5REQA 1QHHB 1UURA 2VKWA 4NQDE 1AIFA 4HISA 3TXXA 4WZZA 1YEJH 5KVEE 2F3UA 5IAJA 1HE7A 4BXOA 3STZA 2HLAB 3GRCA 1WISA 1TXKA 4PZ0A 2PUTA 1ETZA 3GV0A 4YAOA 1MRSA 4F9TA 1X7GA 4XPFL 3D4LA 1JVSA 1KPGA 2OCAA 4O5OA 4KROB 1ZM7A 3OQBA 3UJ8A 2FFBA 5DNWA 4N5MA 3NXKA 5IN4A 1WHSB 1OPRA 3QSYA 1DJQA 1W59A 1FLTX 2ZSAA 3FDWA 4FMFA 3E38A 4WGKA 4B96A 5JA8B 4JVOA 2QJWA 4L23A 3QX7A 3LIZL 3IRPX 3L1UA 2WMDA 3BZ4B 3VGAC 3WN5C 3J07A 5FOJA 1OFIA 3ROOB 4CLHA 2BY3A 2XVGA 5J11B 4UHEA 4U6XB 1SXQA 4OV6B 3IDMA 2XKNB 1BVLB 3L4WA 5BNZA 5HMMA 4ODWA 3TR5A 5DC4B 5JOPD 2R85A 4OBSA 1CS6A 4S3MA 2NX5D 3IUEA 1GC1C 1AZWA 3ZNQA 1Z0DA 1B0WA 3WKNA 3GPLA 4I5GA 4DV5B 3Q9NA 4KHXH 1HHJB 3FQ2A 4X5WB 1FNGA 1I8TA 1CUWA 4MVJM 3DJFA 4LRYA 4ZI5A 4Y1AD 2JFFA 1W0JD 2H4XA 4KQ9A 3F84A 2DWEB 1YU6A 1FNDA 1S78C 1OF0A 4CMHB 3N9GH 4NNJA 3L4XA 5JT1A 1JIQA 4S24A 4X91A 3K2IA 3LCCA 1A21A 2ZONA 5BUAA 2CN1A 3T5PA 1HQRB 1PFQA 4U6VL 5LB1A 3VPGA 5A7HA 1P0SE 4D43A 1GYCA 4XXCC 5J2UA 4FI7A 2PEYA 1B4RA 3S3TA 1HE5A 1C14A 3TSOA 3OESA 4JB9H 3FQXA 3DV6A 3HBQA 4N8CL 3FFWA 1BE8A 2YZGA 5C52B 4E9YA 3ZCPA 1U9IC 4KC3B 4AF8A 3ON5A 4E03A 4JM4L 1W4RA 1F1AA 4OYHA 4WXEA 1TU3A 2WBJC 1ECBA 1P9OA 2JKNA 2OORC 1TADA 3PWKA 4YY3B 1NVAA 2H4ZA 5EFZA 4YHKL 2F59A 1ZR4A 1DRVA 3S7TA 2EIMB 4HULB 3QDGB 2Y3AA 3AHHA 1Z4OA 2HLDD 3VDRA 3CGTA 1Z13A 5EU3A 3S3BB 1Z4IA 5JLAA 5MDHA 4ZT2A 3ASWA 1EP2B 1UAGA 1QW8A 4IX9A 2J55A 4M53A 4XBPA 4HTAA 4LX8A 1IGMH 4BA8A 2WXGA 1AOZA 4GZ5A 4V1CA 1L8OA 1OY1A 1L7VC 4JP3A 1KY7A 4MHHG 4QTTB 4Y7OC 3IIIA 4FG0A 5AHKA 4HOXA 5C5IA 4BFXA 1OAOC 1MKYA 2XPCA 1JYEA 1YACA 2E59A 2V98A 4FQXD 5FTMA 5GIPE 3RAJA 4ZJYA 2PJDA 2J3HA 4Y6OA 1H5UA 5E5MB 2O2HA 4AW4A 4E30A 2C9ZA 4JLKA 3EZNA 2IIJA 4CSZA 4RBPK 1DN0A 5E1AB 3ZVKA 1VHDA 4UDOA 4JGJA 5E2TH 1XDTT 1Z0UA 2C1PB 2EH7L 5AALA 1U9KA 3DRTA 4ACPA 4W1PA 2IU0A 1V45E 1DVXA 1OXXK 1FFTB 5I47A 1PGPA 4G3XA 4BNXA 4R5MA 1VG0B 2LBPA 2EP8A 4EN3A 5KQSA 3X1JA 2F1HA 1DHKA 5HTOA 4OY9A 1A5TA 4C29A 2B3DA 4Y19A 2QYSA 2D13A 5LQJA 3HYNA 4UTCA 3ETGA 5THKA 1CB4A 3FNKA 1S5HB 2F3RA 1JZSA 1U95A 3U56A 4JAMA 4QRAA 1R7RA 5KTNA 2AXPA 3N0PB 3PHGA 1F8UA 1ZANH 3HFSA 4UT6L 5I1EH 4IJMA 2DQTH 5LNEA 3FU6A 1EDDA 3HCCA 5FF9A 1IMOA 5EXSA 3TFKC 1QHOA 3ENQA 3G6JB 4AS3A 3E6HB 5I1CH 5HZGA 1YVLA 2XB2A 2PPEA 5GY7A 1E1NA 3LNDA 3U4EB 2OXFA 4WDQA 3LC1O 4LL1A 4G0VA 4HHEA 4K8RL 1K5HA 4M1TA 4NHUA 2BFCA 3MC1A 2BTEA 1NP7A 5J56B 4OT1H 1ZJWA 5BXFA 5J1AB 4HAFA 1YMVA 5ALBL 4OZHE 4TPRL 4JCWA 1N2BA 3R9XA 3ZE0F 5FEBA 4DNLA 1T6VN 4FOMA 5CX1B 3B2PA 3TH5A 3OLYA 4IIJB 3FUWA 1J9SA 3RGGA 4G01B 3NK3A 4TTRA 1NM5A 1I7QB 2J67A 3RFRA 1CQJA 2Y1VA 1RZ3A 1J6UA 5A9TA 3ZVMA 4BLUA 1XD2A 3QJ5A 1UJ2A 3V7YA 4HJXA 4D74A 2BGJA 1AYOA 4FBGA 3RGVA 1OGJA 4GAYB 2MCMA 3ZIMA 1UMCA 4M49A 1PT8A 4R4BB 1XI2A 2Q9AA 3FFOA 1MQAA 1SOMA 4TXLA 1NFDB 3VPFA 4YALA 1JHMA 2Q7XA 2NSYA 3BSZA 1K8IB 4KXZI 4GQRA 3UGXA 3GP5A 1MJJB 1YRHA 3MUZ1 1WWCA 4NP4L 3RQSA 1EZVX 1HHHA 4O4JF 3P73A 4EG0A 5AK4A 1YMUA 4XMZA 1GGEA 4PJIB 2PS0A 4MQ6A 2X4NB 4KUGA 2I1VB 3S1SA 2R6FA 3PU6A 1WULS 1HDOA 4OA5A 5EIOA 1R0XA 3PKJA 5FQNA 2WHXA 4FG6D 4JL6A 2EFGA 1THAA 4E5NA 1SR8A 1SKYE 3CZAA 3AWDA 4B9IA 3JV5A 1R0LA 1HQYE 2ZKWA 3RAPR 4G84A 5LAXA 4NWUH 3S6CA 3LDAA 2V6FA 1WITA 1BX0A 1OYYA 4JYMA 3S1AB 3NC4A 4H0HB 5GGVY 3KS9A 1N7MH 3ZKQD 1JXQA 4PCVA 3MMZA 5KVQA 5IQ7L 4C20A 1CTQA 2OBGA 4QT4A 4ELMB 3QWFA 3G02A 2PAAA 2D54A 4MWDA 3NC1C 1D07A 3INOA 4KX5A 2FJ0A 4O2AA 2ZJ2A 2D1SA 4IGIA 3S4YA 4L3VA 4GVXA 5FTKA 1XGQB 5SZIA 3GLIA 2XN9B 4ALAH 4HXBL 4AT6B 5EG5A 2GZMA 5ENWA 1GGVA 1IM5A 1PJZA 4TVPH 1I7LA 1PZ2A 3OG9A 3SE7A 4C9BA 1GOGA 3O31A 5C51B 4U6TA 4TTQA 1A72A 3WNKA 1M42A 2E0PA 1B2RA 4GAJL 4ME6A 4NMXB 4TYWA 3NIFE 5CRIA 5BNWA 2H1LM 2R6GA 4X8HA 1U3UA 3DOSB 3DUFB 4YRFA 4Q3CA 4F8TA 5JMPA 3NI2A 2IYYA 3F6BX 5EIQA 3FUXA 2BBWA 3OR7B 4HLUA 4PJAA 3MMEA 1LQ2A 2XPGA 4LLAA 4GQBA 2I4RA 3MWDB 3KG2A 4Z7NF 3PGVA 1CZLA 5LXTA 4LJ8A 4QUHA 4PGZA 3B7PA 2HWZL 4UHJA 2AQPA 4PHFA 3RSZA 4KY1H 3VNQA 1OZAA 4M02A 3F6SA 2VBFA 1TKWA 5IVXE 1TRKA 2PD3A 3B48A 3L0YA 2IW3A 4IEEA 5T6BA 3L40A 2IPAB 3R0ZA 1D7CA 2ZJ0A 3AF2A 1U8CB 1I32A 4FXKB 2KL6A 5KNLA 2YD5A 5KVEL 3SMQA 4H59A 5I8CA 5MEPA 1XU7A 1T7ZA 3DGCR 3LGSA 2Y36L 1JZQA 4C3UA 1U3HC 2NXZC 5IQ9B 2P2ZA 2YZNA 3QU2A 4GC5A 4HGQA 4TWBA 3TQTA 1QLEB 3B38A 3V97A 3S34H 4JFEB 2WIAA 5AYUH 4AYBA 3M82A 4P2RE 5CUQA 4TVOA 3FTZA 3HKCB 2IZ5A 3HE7D 4HEPG 5KO2A 1CTNA 9LDTA 3AI7A 3UMBA 4C88A 4UEQA 3W78A 4GLFA 2DGDA 3P5SA 1QSGA 1UFKA 4MUAA 3MOIA 4G7YL 4OCNC 3UMJA 5F98A 2DT8A 3OFVA 1KLUA 4QLRA 3S40A 3IJ8A 4A6YH 4PV9A 4ZUSB 1JPNA 4JI0B 3G82C 4TLDA 1F2UA 2I8CA 3GJYA 2C5DC 1WU7A 5HBRA 1JE0A 2QY6A 5JSYA 4Z1MA 1KY6A 5I8ZA 1RFDH 3QZPA 2FQYA 5FUOH 2EGHA 1VLXA 1MFCL 2VJMA 3WIDA 3QPXH 4PX5A 5SWZA 1QE3A 5DBFA 3EBAA 4UOJA 3JWOL 3VGAB 3WN5B 2GHTA 2Y68A 1E4JA 5SX5K 3DTVA 2HFFA 3Q5TA 3I61A 4G09A 1RPZA 5JDJA 1Z8FA 4JNXA 1JPGA 4Y1AE 4G11A 4WN9B 4BNLA 2ZS8A 1YNTA 3IOEA 4BELD 3N06B 3HABA 2HWYA 3N86A 2GSIB 4UE3S 5FWNA 1T10A 4IZIA 4LBEB 5I75B 4Y67A 4ZV9A 1Q38A 4O4LB 5EORL 4K26A 3K8QA 4XOBA 3RTQD 2ZKLA 2ZI5A 4TZ0A 1E8WA 1KYUA 4L29A 1QRSA 3GFGA 4E14A 5HGBB 1NKTA 2AG8A 3PGA1 1HAUA 1NIPA 4YMGA 3LY8A 1HNXB 3TVMD 1NCDL 2BOLA 4KTVE 4Q9DA 5DEFA 2DQDH 2JZNA 1E4WH 5LJIA 2VXBA 2J30A 2JJ1D 1MV8A 3VU9A 1N8ZB 3GRFA 5DHRA 1K7FB 5AYQA 4PO8A 3CN0A 5D87A 1RZFL 2YD8A 5D7SL 3OJDB 1AZRA 2ZLBA 1ZTMA 2GN4A 1JZ2A 3V9EA 4ODVL 5T5FL 3VQLA 3TBVA 2H26A 2R0LL 1MOEA 3RSFA 3B9AA 1XOIA 1MGPA 1QABA 3MRXA 3SKJH 4Y30A 1J5CA 3GFOA 3RVOA 3LVQE 1Q4NX 3MACH 3CY6A 1G84A 3I53A 1J5PA 3WYRA 1I94B 1P6XA 1AGYA 2Z57A 3VSVA 2YXEA 2NYZA 5DLLA 4PLGA 3C3WA 2WBJB 2JLAA 3DO7A 4YHNB 2EYSB 5EEYA 5CFOA 3O4GA 1VFPA 2VQTA 1NMYA 3WMFA 2X9VA 1OZUA 4ND8A 3K7UA 3WGUB 3QJYA 5SX4I 2HCTA 4YRDA 3PZBA 5D3MB 1U0SY 4HETA 3QF7A 2P6UA 1P4SA 2NO0A 2OECA 1HCZA 3BJIC 2EAUA 1D5BB 5IB3B 5F7FA 5JZ9A 4DARA 2ZUVA 3PE6A 3FA2A 1JQEA 3DMMD 3HRKA 1IIIA 2ZT7A 1S7XA 3F3KA 1AKPA 3KX2A 4F4DA 4NESA 1NBYB 1D5WA 1F1DA 4LOEA 5IEKA 2F7IA 4LTNA 2X7HA 4FYHA 3TBKA 4K7PY 3N3AC 3PDOA 1VOTA 2C2HA 1PJSA 2AKRA 2QM3A 1J5IA 1E28A 1G7IA 4MQSB 4WU5B 2R7KA 2WWRA 1NT2A 4WXHA 1JHKL 1FRZA 1PLGL 4JL1A 1PL7A 2UUOA 3CN2A 3GKWH 4ROSA 5FUCE 5IB4B 5IVZB 4D9LL 5HGHB 2BP7A 4QRBA 4YQZA 3WOVA 2O6DA 1WA0X 4YJHB 1X19A 4ORZC 1FFWA 5BOSB 1PD1A 5E5RB 3UYRL 1XGPB 4RMRA 4O0MA 4YRGA 2N1BA 1IPFA 1PV2A 3UGUA 4H3HB 1A0QH 1IZ8A 3FYUA 2X7JA 3K6RA 3ZPDA 1E8XA 4P35A 3PYLA 1FFBA 3GRAA 4D3XA 3PGCA 3H7IA 3HB7A 3L81A 3B2QA 2WMPB 2ECKA 4DCVA 3FB5A 3I0NA 4L1KA 4RTRA 3UDWC 2H4YA 4YCNA 1PR2A 1RK7A 2MPAH 3DRQA 4ZQIA 1M75A 1JILA 5D70L 2C98A 1B6RA 1CGWA 3CCBA 3TZVC 4HIJB 3DO3A 1GITA 2VLJD 4KZDL 1NCUA 1GYPA 3MTAA 4AIEA 3GRGA 4DA8A 2ID9A 2R5FA 5IVHA 3VSUA 2A59A 3PAVA 2ZD0A 1JXJA 5EE5B 4BDTA 3P4OB 5IP4A 3PC7A 1BVUA 3DQZA 2VH5H 3ZWPA 4YRJA 4V03A 3GAMA 1OALA 1CG9B 1DKRA 3ATDA 4KVGA 1AQKL 2AOTB 2HU2A 1LE5B 3OLVA 3K0EA 3DDUA 5KOYA 5ICSA 2AQNA 1E1KA 1CICA 4NJ9H 5ENVA 1DKPA 1WXXA 2A73A 5EC1A 4PTTA 4QOEA 5CCEA 3DHEA 3NP4A 3EFBA 1J9GA 1SMAA 2Z5LA 4QM7A 1E2NA 5K4GA 2AV7B 32C2B 3TJEH 3L9WA 4MAMA 3GJ0A 1QHNA 1T0JB 4E22A 3LG2A 1Z5WA 1YOVA 2F53A 1GTMA 1NFIB 2OC4A 1BX2B 5TVGA 3PHIA 3PHBE 4LGSB 3P5BA 1IAKA 4CILA 4N0QA 5GZ6A 4KUZH 2WKOF 4ATTA 4XPIA 3NG5A 1UT5A 1HZHH 1Z32X 2YC2C 4DNXA 2PGNA 2X2PA 3IAHA 2XRAL 3C8HA 4ZJUA 5HRCA 4PJFB 1QVRA 3QVWA 3U31A 3PWJB 4FYSA 3UEZA 4JPQA 4JR9H 1IAVA 3F58H 2WQVA 2PUCA 3PC8A 2JFYA 4EIZC 1YZUA 1U8HA 3FNQA 5CWSB 1W8OA 4OKSA 1GR1A 2L7QA 1W1UA 1WR8A 2X77A 1VG1A 4QA9A 4OHUA 3ULUC 3KS0J 1QC5B 3D85D 2ESRA 3P4MB 1ZUHA 5GJWC 2IALA 3R1GL 4MRSA 5DVNA 4PJ7B 1NBMD 1P7KB 2V6BA 3MRTA 5AKKA 1P3DA 5H94A 3H1PA 2OK0L 5LGKA 1QRNB 2OSLB 3GLTA 1VKRA 4DKXA 3KPSA 4A2GA 2ZSWB 4HTFB 2J3KA 1XELA 1ABBA 1N6IA 4DIXA 4ELKB 3QU5A 3UBTA 1IH8A 2WY3B 4PTLA 3HJRA 1N7GA 5B22A 4HO1X 1WNTA 3CFNA 1HURA 4H4DA 3WGLA 4I0KA 2CK3D 1Z9MA 3K2QA 2D06A 3O2VL 4N9GB 4BLTA 1Y1RA 2O61A 4EYEA 3MLWH 3PHCA 1ZXQA 4X6FA 4Q0XL 1AMXA 1KN4L 4UU9B 4YBLC 2X2OA 1C12A 1Z8HA 2FCAA 2ZI9A 2ESVA 5FI3A 4MXWL 1JLLB 1GSHA 3MCG1 5EUBA 4X4ME 3LCRA 3MRKA 1DAHA 1J1XH 1JLHA 2Q76A 2GTPA 1BXGB 5H2BB 3MTDA 4OB7A 3U6RB 1OFHA 3PGLA 2M6SA 5GRXG 3K94A 4N90D 4ZTUB 1YR3A 1JGUH 4HZLA 5F9DC 2VJDA 5CINL 1SU6A 5FHBH 4ZMBA 2R1UA 2Q8BL 2D4DA 3OJXA 3I9MA 3AO0B 3RRMA 1DGQA 3KEMA 1F0NA 1SN7A 5CUSL 4RNDB 1DOZA 1NMAL 3RYCB 3DZIA 3RDPA 1DTUA 3OCJA 3ZY4A 4M1WA 4TQIA 4QCIB 5AJHA 4DRZA 2C9CA 1XGTA 2A5GA 1XZAA 2OV6A 1W29A 5HJEA 5DMKB 4GUDA 3M0EA 4KXNA 3ER8A 3WBJA 1GGBL 3KL3A 3AKDA 3EWAA 1IXZA 3CAFA 2OCKA 1GGJA 2EERA 4EY4A 1IVSA 3K8ZA 3L84A 4N0UE 3EF7A 2GEVA 2NU8B 4OCYL 5K9QG 1U3HB 3U7QA 4OLVL 4V38A 5BQ3A 3F7VA 1J0YA 4N4AA 5JAIA 3IXTA 4FW8A 2PBFA 1Q1BA 1UK8A 2GBPA 3UHAA 1QOZA 3LNFA 3KBHE 3ZN2A 4KDVA 2P47B 1ZQ9A 2APTA 1X86B 2RALA 5EUOE 3M2PA 3Q8XB 4XGNA 5KKAA 4ERSL 2ZYDA 4RYDA 4PRLA 4M1QA 3TPFA 5HJGA 4L8GA 4M55A 4OV6F 1H4SA 2OHHA 1G20B 4G25A 5F71A 4UYPA 4I4CA 5CLFA 4YHMH 1S9HA 4PWEA 2JNZA 1AB5A 5CEXB 4KKBC 4LDJA 4FQJL 1YQVH 1XZPA 3DLPX 2R2CA 4KC0A 2J6CA 3LUJA 3PDIB 2PQ0A 3MKGA 1CIUA 2OX5B 3AEXA 4N6NA 1VA9A 2I3AA 5IV2B 2ACVA 2V7NB 4B82A 4RIGA 1SYVA 2FPRA 4NUGH 2JJTA 1V10A 2GN6A 1RCYA 2FSHA 2FO4A 3VFWA 3EYOA 5DVMA 3AC0A 5DCYA 1UMKA 3UW3A 1ED3A 3MLUL 2PWGA 3GKZA 3VCLB 2WHEA 1YZ3A 3OKEA 2JI7A 1MNNA 2RIRA 5B3JF 3BAWA 1UC4B 2C2KA 3F2VA 1UP7A 1DC7A 3OUZA 2C9YA 4BMXA 1RVFH 3BWZA 1OI4A 1EX1A 3DO8A 3BIOA 1EJ8A 4IXMA 1J10A 5CDYA 4K5MA 3VGPA 2GWHA 2AMFA 4KAJA 4QT5B 3BMCB 1Q7RA 3IPLA 4UW9A 1PF7E 2YS6A 1O6SA 4NOMA 1MPTA 2MSPA 4I1UA 5DQDH 2VOTA 2BT4A 3M9XA 2C7RA 3C2AL 5I0ZA 3SYMA 4X9GA 1FO0B 4JFDB 3UGEA 3DWTA 4QJ4A 4YFVA 1SBCA 4R3UC 1BWQA 4N48A 4EPXA 4MP3A 1ZK9A 2AD5A 4HH9A 5IG2A 4W9IC 3OT4A 1HH6B 1QACA 1NGPL 2FRGP 2UVEA 2R6DA 3HAEA 2ZF9A 2WYIA 1T9CA 3A4TA 2YJ6A 3MHPA 2UZPA 4XH9B 3RKUA 4ZOCA 2ZBFA 1XEWX 4XN2A 4G4GA 4GFTB 3BHBA 4JDVB 3NJJA 2JHFA 3KSAC 1IL1A 3HW7A 4IV0A 3KYIB 4TM9A 5KG9B 1Z25A 4KH1A 1QH8B 3H5RA 2IQAA 2E5EA 2D2IA 3BGWA 2XADA 2JKVA 1R33A 2XWBA 4QRQB 5C7ZA 3ZGIA 5JJLA 4ZHQA 4J3OG 4OGYH 1YCDA 5HHQA 3P0RA 3S96B 4TLMB 1KGIA 2ICCA 3HHSA 3CFTA 3QQ3A 3L1EA 3V4PB 1VKZA 3NBZC 3IFLH 2JKRM 2CBPA 4JHUA 1IGTA 4F7EB 4TUYB 1AFVL 4H8WC 3T8XA 2P1ZA 5I19L 1AZCA 4LVCA 2C8LA 2XDYA 3ZHUA 4M3NA 4C56B 5DNVA 4YHZH 4EF4A 3NHFA 4AJ4A 4TKVA 5GRJL 1TCUA 1CT8A 2I22A 4QQ8A 1ZJZA 1XR9B 1Y98A 4ZS6D 2R15A 3PFNA 4EJFA 1WZUA 1YQQA 1MO4A 4U4IA 4J03A 4GQ9H 2Q3CA 3A0OA 5FHAL 1P5VB 2QL5A 2NM0A 3DX8B 4M6ML 5EZJA 2FHCA 2VJOA 2IXQA 5SY4A 5FYJU 4BCXA 1ZBDA 3ZHBA 3VYWA 5EPEA 1XGUA 3IEIA 1TMGE 3ER6A 3BJMA 1PJ2A 4L5FE 1A8SA 2GPYA 4IQ8A 4HV8B 2W60A 5C7LO 3ZHLA 3T3GA 4WLVA 1W36D 4S1TA 1Z74A 2ZTUA 3UHFA 2ZZNA 5IESH 3CGWA 2RAVA 3ROEA 3PCTA 4HJRA 2CGRL 4ABTA 4PLPA 3MA9L 5FV1L 4WK4B 4TMTA 3ETCA 3TOSA 1F0YA 2WVVB 2Y71A 4JOSA 1V5EA 3T06B 4MS4B 5I7WA 1JEYB 3SYAA 1BHGA 3SQDA 3C45A 3G6JF 1VL1A 1A4JA 1XZBA 1MRFL 3ETBF 1USUA 1FP5A 1AZVA 2KI6A 3EYWA 2IADB 4AMBA 3BK1A 1XDUA 2P46B 2VLJE 1E0SA 4HB3A 3IDIB 1SY6L 2YY6A 1N5DA 2B8TA 4C47A 2YWHA 2YOHA 4FOOA 3ICOA 1NVBA 5DYFA 1XV5A 4Q4JA 1SXNA 3VI3E 5BR7A 2ODQA 3C6QA 4XVUA 1TT7A 1Q1EA 3HI4A 5FR1A 4RAQA 2B37A 3TZVB 5E6UA 4JI5B 3UOWA 1EERB 5DUBA 4KX9A 2NIPA 5ELIA 2RQ8A 2DPXA 2QW0X 3VRIB 4QUKA 5GZND 4HSQA 1G98A 1N6OA 5EJEA 3G5WA 1GTNA 5AB0A 1W0KA 1NLBL 3NFNA 3LGAA 1REIA 3SZKC 1BW9A 5KU1A 2P8LB 1I80A 3IMTA 2EEFA 4Z7VE 1N6QL 1JK8B 1RULH 1YDGA 4B3TB 5L4NA 3RX7A 2AOWA 4N7RA 3EISA 2OR7A 3D30A 4XQGA 1NFDF 1GOTA 2VLKE 4MWGA 4TL7A 4G24A 2ZAGA 3L0OA 4LZWA 2ZG3A 1H2XA 1CFNB 1PAUA 4MA3A 3L7DA 3HZYA 1ZOOA 3IB6A 5EQTA 4Z9KB 3ZZUA 4JJ8A 4X0EA 1MQKL 2UX7A 3BRCA 3TSAA 1KBWA 2CHWA 4Q7EA 4YT5A 1N2EA 2OMXA 5AKRA 2J5BA 2CLEB 2WDZA 4B50A 2Z8WC 4OCRH 5C8VA 2GAJA 1OCZB 1RRVA 4GH7B 4MSUA 2WLLB 3V2IA 3NCBB 4G6AD 2CY0A 3D0RA 4AQ1B 2JA2A 3LEYH 3NH7H 4LXQA 1TO5A 3UQYS 2B99A 5HYSB 1E66A 4EJSC 2B2XH 2R29A 3EQZA 1S9VB 3T6ZA 4ENSA 4LNVA 1NWHA 2BM9A 5I1JH 4KQHA 1ZPLA 2PG3A 2CHVA 4UASA 4L9SA 4O58H 3QPCA 2K5UA 4DLVA 3V7MA 4YAKA 4R54A 3U4QB 2QX9A 1CD8A 4EO4A 5BVJA 1K9TA 4QFBA 4O02H 3VWJC 1YUHB 2NNAA 2YPKB 2PWHA 1LMIA 3JV4A 2RONA 2HJGA 1YBHA 4ELMF 1NBME 3W39B 2Q99A 3QNXA 1PEZA 1U8MA 1NQOA 2IPUG 1SXPA 2CCJA 2HFGL 3HPJB 1N1EA 1DEEA 4N47A 4UTBH 1RE1A 1SMOA 1C3OB 1RVDA 1Z66A 3BZFB 5F6IB 3KVYA 2NXYC 4Z9YA 1DT5A 4JO4L 3WLSA 4Y6PA 3C3MA 4CXMA 1H2BA 1F6DA 2EC9U 3Q7IA 2Z7YA 1IUNA 1HEYA 2TMDA 1SZCA 4RFNB 2VSDA 5KSBE 1LK5A 1XF5A 1TG8A 1MAJA 1Q11A 3OEHD 3IDGA 1JGLL 1E1LA 2GPAA 4DPMA 1ZD2P 3SWWA 3CNOA 3SQOH 3IBTA 1RZKC 3IPCA 3PFHA 2Y24A 4MCYB 4GW4B 4QHUB 5ADVA 2AQRA 1XHFA 4PR5A 1M6UA 3PEWA 2PGOA 2YFNA 2WV7A 2W2QA 1UPXA 2MOKA 1JXKA 1AGCA 3LCVB 1CS4C 4KIWA 3V0GA 1CK4A 5T64A 3RNQB 1RABA 4KKPA 2GHWB 1A9RA 4N90E 1N0VC 3MG9A 2BEUA 3TDKA 5GONA 1FLAA 5J8OA 4YBLB 2XG5A 2ZRKA 4DUGA 1YA4A 4AUEA 2F3TA 2ZB8A 4ZCSA 3U17A 2DF3A 3D43A 2Q4DA 1U5BB 2RI1A 3MO1A 3OPYB 2EDOA 6CGTA 3HUUA 1TT6A 4QXVA 1EFHA 1SBHA 4OAOA 1QDLB 3CJRA 2HI0A 1DVRA 2ZIUB 1SELA 4A8JC 2HCBA 2Z3ZA 1X5KA 1EZ1A 1QIKA 3M9LA 3ET9F 1OM3L 4ZU3A 4OMCA 1T5HX 2NGRA 3ZWOA 3QVGB 1EEQA 1E5TA 4Z51A 1ZLYA 2GLUA 3L08A 3WS3A 4ZQGA 3X1ZA 2F9LA 4M1SA 1K6JA 1NC1A 5CGQB 4NERA 2AQ1A 4FDWA 1E64A 1I8IA 4R2GD 1JR2A 3ZU3A 4IOSA 3KEFA 3MBKA 1J05A 4Y2DC 3ORQA 4UTAA 1ORVA 3MRVA 2QPSA 3H42H 4GG6E 1SF5A 1LFAA 5E99L 4IMLA 5JCPA 1SIOA 3KSZO 1R8YA 4RTKA 1P2UA 3MRDA 4HQFA 4YDHB 2GFQA 3MF4A 1P7BA 3F6RA 3TECE 1HOCA 2Q5HA 5A4FS 4QVIA 4URUR 3KSDO 3M3DA 1AQYA 3CZMA 3NWEA 1FDSA 9MHTA 4CN8A 4ZXFA 2R00A 3F7YA 3GPDG 5KI6A 1OAKH 4I18B 3TEZA 1MFAL 2R2EA 4NBSA 1Y8ZA 3SVTA 2ZIDA 2ORWA 4GBJA 3MGOB 2LU5A 2V7QD 4TTIA 3DGGA 1D8TA 4I66A 5A71A 5SICE 4OXYA 1UWEH 4O9HH 1T2FA 3RYFB 2YQ4A 3PU7A 1CY8A 2X22A 3B2MA 4IRZL 4AENB 3QQ5A 3ADCA 3WKMH 4XSVA 1ZGHA 4MA0A 3P0YH 3VFOA 3EGDB 4AMUA 5CPFA 3D1VA 1YEWA 3OCYA 4O4LF 1TYBE 4G3YH 3ALWA 5I15L 3R77A 2IH1B 3V9PA 2BVPA 2GBIA 2VAJA 2ZWIA 1LHZA 2IP1A 1C1DB 4KSYA 5CGBA 5JORA 3JRNA 1E5AA 2B34A 1TEFA 3QVTA 4O59O 1F1JA 2GZDA 2B14A 1CRQA 1I8MA 3NPZB 5GRZA 4HUJA 4GI8A 4JFSA 4QXQA 5KSUA 4H1WA 2XYRA 5DHVB 4Z8XA 4DJEC 2PXXA 4YEEA 2R6CA 5EJ5A 4D4LA 5AVWA 2D3WA 4FCCA 2JK0A 2YY7A 4KZKA 3F9RA 1VA4A 4WCYH 1XP8A 3O41B 2ZQKA 1IX2A 3NCCB 2F7QA 1ZTXH 4CMMA 1K6IA 4IOLA 3KTAA 1J90A 1W34A 5DUML 2JLZA 4KR0A 1NMCC 4CGUB 1YH3A 2ZS9A 2JC3A 1WE5A 3PNKA 3C6BA 3GI9H 1Z16A 3AF6A 2Q3AA 4Z49A 3QO1A 3BJEA 4X7TA 1X5LA 2R6AA 2I67A 4R9UC 3W5HA 2M6RA 4HY3A 1MB4A 3R24A 3RCBA 2JNWA 3ZZ1A 1SXHA 4L0PB 4BMCA 4J9UE 4OMDA 1VFOA 5IOPB 2AQSA 2YV2A 2J5LC 3VACA 3RREA 4UOW1 5BRJA 3LC0A 1F6WA 1HK6A 5TPWB 2Z34A 2IH9A 1CF2O 4K7FB 4M8LA 4AW7A 2P27A 4CBPA 1SCUB 2FAUA 1UBSB 1UUFA 3CSSA 1HYQA 5JMTA 4NMMA 3E03A 2IOQA 1KJ9A 4PBDA 2YVQA 3LQ2A 3MT7A 5ALDA 4L5IA 1AG0A 1HKLH 4TSAH 2P78A 2DZDA 2B61A 3NSXA 1CRWG 1QM5A 4LCWA 1QSFB 5A3QA 2REXB 1GTSA 5T4BA 3X14A 1CVLA 3Q2LA 3PFQA 4F86A 3L13A 1PDWA 1ONOA 5HJ2A 3QUHA 4IG4A 3ZE0B 4UINL 1DJGA 3VH8B 3VYPA 2D7QA 3GBLA 2A3RA 5EWJA 4D0SA 4MUNA 2HA5A 4OSUH 1XKTA 1JE1A 2FPWA 5B64A 1F6AA 4LOJA 1AMOA 2CIIB 3T1HB 4DBVO 1LTXA 2XFXA 1REQA 1VI6A 5HK9A 1HBJA 4L5FL 4KJXA 5CT9A 2HXSA 1ETHA 3QYJA 4B2YA 3RVVD 3BH8A 3OLDA 2X1PA 4B40A 2ODNA 2IUSA 3CVHB 5HGXA 2XWJI 2DUMA 3T77A 5E9QA 1WBDA 1LXMA 3ULUL 5ANMA 2QGZA 3WL3A 1DRJA 3JQQA 2O54A 2R0WH 4CL0A 5EHIA 4XN1A 3GSNL 2Q5OA 4O4JB 1U2QA 1JDJA 2UWEB 5GS0H 3B9EA 2Y0CA 1KK0A 1PG2A 1T4KA 2EHJA 3QJTB 3BWDD 2KJQA 5JXGA 3LNIA 1PYWB 2AV6A 3T1VA 3TAHA 2P80D 5DD3H 3PFKA 3DPSA 4XO4A 2DJSA 4JO3L 4N01A 1TGYA 5CXXA 3U82B 2VP4A 2A86A 5L0QB 3LEVL 4E2ZA 4I9XA 2CJUH 1YN6B 2CLHB 4JPSA 4C08A 1VMKA 4YAQA 3HRZB 4JLUA 3PE4A 2UXBB 4QUGA 4GWKA 2O2GA 4N28A 3ERXA 1JNYA 3MRMA 2DKOA 4DW8A 2O7NA 3BGAA 3HDHA 1IKFH 2PO7A 3AM8C 3IUQA 4N8DA 4DJAA 5LQUA 2W2OA 3TBYB 5KWVA 5HHOA 1CVRA 4KMTL 5C0GA 5DD5H 2AI3A 3I04M 5FH9A 3ZWWA 2OG1A 1PR4A 1CGVA 5E8DL 1P73A 1U58A 3NANA 4CKVX 4IXNA 4C7OA 2FZLA 5FPPA 4QTYA 1XD0A 3B9KA 3MBED 1EFVB 5E2VH 4AV5A 1YVRA 3O3CA 3VJKA 2C77A 4CN9A 1DG9A 3JQRA 3Q1SL 5HSFA 2IQIA 3V7FA 1TFPA 3NRFA 2B08A 1V4VA 5E0KB 4QFDA 2IHYA 4J27A 3V6ZB 3H3FA 3PL6B 2W58A 3VAZA 2P6RA 4YV7A 3W04A 5FM5O 3BP6A 1Y4ZA 4E68A 5K99A 3N2NA 3AJ7A 1M34B 3PNOA 3QMWA 4X65B 3GLZA 1KYAA 1N5YL 3DMYA 821PA 4EZEA 1JG2A 3OAUL 4AQDA 2NY7H 1X80A 1SAYA 4C4TA 2BWDA 2MOQA 1KYVA 4RFOH 3HBPA 2V3DA 1AKTA 1QUNB 3T0EA 5AM1A 1KIFA 4FT2A 4RTJA 5IT4A 2AF4C 1ISFA 5IBLC 2FSFA 2XVLA 2KYRA 5LM3A 1V7NH 5CKAA 3APDA 2E4AA 3O3DB 2VAPA 1DSYA 2DQCL 2AI2A 4QHNA 2X70A 4PJFF 3X11A 3O26A 2N59A 4AGLA 2PUQT 3PY9A 2YARA 1L4UA 1WBZA 4L1HA 3CVWA 1F45A 1DLJA 3VR2D 3MREB 1O8BA 3WGIA 5I6NA 5GHWL 4EFNA 5HD8C 3DWGA 3EXAA 1D9KA 2FPXA 2HJKB 4RTSA 4WO4B 1UJ4A 3D31A 4HHGA 3EGOA 5IT9A 3L6UA 1PLAA 5L8VA 2BNUB 2NO5A 4XMLH 1Y5RA 2IEAA 1PHPA 3TBWB 2QDKA 4G4SO 4KI7A 5IM4A 4DGIL 1A7RL 4PJ7F 4FGMA 4GDMA 1TPXC 3SDAA 2EDRA 4IIVA 4PRPB 3SDSA 1YJBA 3QVLA 3Q9QA 3QUSA 3NTCH 4EZIA 1JYNA 4ZEOA 3KWJA 3UY4A 4DANA 2IPLA 3I5YA 1ZBQA 1JBEA 3ZU5A 3TW8A 5C0EA 1JI0A 3KPPA 4CEJB 4JG0L 4FONA 5EOVA 4ZK8A 4QO1B 2GJZA 4I81A 4FFZL 1BO6A 2W6JD 3BRSA 3LFHA 3ASYA 2E0IA 4G43A 1U8NA 4V1CI 4OX9Y 2HRCA 2H4HA 2R8OA 1A7QL 3Q2OA 5E8OB 1CNFA 1JMXA 4L2IB 4PR0A 1YE8A 4FT4A 4HUXA 1R5VA 3CGGA 3EJRA 3OQIB 3OTTA 4GRWB 4N0RA 2JFQA 4PS3A 3BORA 2CJWA 2Y1CA 5BOJA 4PYRA 3UZVA 3TONA 4X7BA 2HT2C 4ARZA 5JDIA 4MMXC 5IJKC 1ULBA 4FP8L 6FABL 5JPDA 3PV6B 3SKNB 2HT4D 3KKOA 1JHYA 2Y9RT 2QVYX 2A9BA 1WW8A 4FEMA 4DGQA 3G9AB 5GGSB 4JVSB 4BH8A 4PJHF 2WXNA 3BJZA 3CXHJ 4AJLA 1SUIA 4LG1A 4B85A 1T9GR 2Z0MA 1B3IA 1RUPL 3QXAA 2UZAA 4QYIB 2REQA 3OCUA 1PG7W 4BKPA 4ZYKA 1GT6A 2JRCA 2C0QA 1AKUA 1XIWC 2WWMD 5CILH 1SYSA 5DYOB 4BQEA 1TZIB 1HE2A 3RUEA 2C8NA 3M7IA 4PM4A 4Z77B 4UNSA 5EZYB 3T7AA 2R2BB 1T2EA 1QR6A 4GXUM 4MQMA 1AXIB 3KUUA 2H6PB 3OAYH 4NYIR 3DTUB 4A8JB 1I30A 2DY2A 4P4KC 3S44A 2R5NA 1SK9A 3WC4A 4LSRH 1E6EA 1JHQA 2BDNL 2VDPL 1SGKA 1DC8A 4MPRA 3B5HA 3ARBD 1JQKA 2Q4EA 5HP4A 5K7SA 4W5HA 3T8YA 3IRZA 4LGVA 3GJ3A 6REQA 2R7EA 4IV8A 4PN6A 5FDYA 3QELB 3DFUA 3CHRA 3T1OA 2R2GA 1DQLL 5D01A 3RVPA 2DKFA 2IZ6A 2ZPKH 2DBRA 3VNRA 4ASUD 3POCA 2ERJC 5T8KC 2AC2A 3UTSD 2VF7A 1CE8B 4C0LA 3D8SA 1VACA 4NT6A 1BOOA 5MENA 5IVDA 1A65A 3DE0X 5HG0A 4B2IA 2Q3JA 1EHCA 4KV7A 3UZQB 4GR4A 1EVJA 3L7JA 5KOIA 2VOEA 4I08A 1ODAA 5I8WA 3QNFA 2LV4A 3JT2A 1NY6A 5F89A 4MEBA 1V7QA 2PO6C 2OPHA 2CHFA 4M7PA 1LDNA 3M5DA 2WKLA 3EA4A 5DGCA 2HLFC 2XMBA 3AM4A 5D1XA 4ZW7A 4KXDA 1MKFA 2GEQA 1S2MA 4LS3A 4QDTA 2L19A 3MAAC 3WK7A 2F8SA 4WU7B 3VO0A 3IXMA 4HX1A 1KI6A 4JRXB 2DB3A 3DVNB 5EESA 2H9GB 3F7OA 2YQ3A 3ROFA 5ADWA 1N25A 1VDGA 3MYZA 2GRJA 1E8YA 1SEBA 1BVZA 4TM7A 1OAYL 2QAIA 4LP8A 3PDGA 3DOHA 3G5XA 2NLJB 1Y7VA 3A58B 1AS6A 3CZEA 4BEBA 5COAA 3L4JA 1Z12A 1KOLA 1KENH 1CETA 1MJFA 1MH5B 1HDIA 1JPJA 1KJWA 3GJXC 2A1IA 1WT5C 4M8RA 4WUKL 2QLMA 3JWOC 1XWFA 3PQ3A 4C7VA 3DURA 1KE1A 2OM5A 2VR5A 4LJSA 3SPIA 4RKFA 3RYIA 1FS6A 4G0OA 3R9WA 4Z7AA 5EF1A 4YP7A 4JLPA 2ZJ7A 3CU1A 4EPSA 3WEAA 4QOKA 5K0NA 1EO8H 2EYTB 1ORSB 5FLUA 4PZLA 5BQ7A 3Q3CA 4UANA 1Z6TA 4LYJA 3I28A 2ZAIA 3W2DL 4RZQA 3EFFA 1NMCB 4FFMA 5D1ZC 1U0RA 4V11A 4BFCA 4EDFA 3LDUA 5KOMC 1WTLA 3RSGA 1D5ZB 5DJ2A 3FSEA 5ICYA 1QFYA 1MQ8B 1CUUA 3RURA 4MW2A 1KGDA 4ZEVA 4P2CG 1ODFA 5KVSA 4HVLA 5BPFA 2RSLA 1T1RA 2ZJ5A 2YFKA 3RU2A 1MABB 3NAGA 3SDZA 1TITA 1SEPA 1VPEA 3G9QA 3KSMA 4TUYF 3OAWA 2CZQA 4OJFH 4G80A 4DIFA 3HA7A 4GXFA 3SIXA 2QUIA 2J5LB 1U8JA 2CXOA 2BFEB 2XU9A 2QJDA 3IDJA 4ND1A 2OFQA 3ICEA 4AKEA 3RJ5A 5B6JA 4FYPA 5IYZA 1EIWA 3JPWA 2OMVA 1Z39A 1ZOSA 3H2BA 3NJKA 1NYQA 4YJ3A 3CC5B 5BMFL 3O2WH 2XX3A 2LLGA 3O8DA 4DKJA 1KLFB 3WKYA 4OF6A 3I6IA 5B4UA 4F7CB 1CU1A 3VAEA 1GIGL 4ZTPH 3US1A 3RVSA 1NUPA 4X6UA 1S6NA 2EYQA 1VHLA 4D98A 4UQ9A 4RNRB 2XLCA 5JR1L 4AFNA 1GQSA 2NG1A 3ZHOA 5JAQA 4F2DA 2VYVD 4XB8A 1WX1A 4YGXB 1TQWA 2IJGX 3MOBH 3BL8A 3OKWA 2JKLA 3WU1A 3NIGE 4LCJA 3WIEA 1BJ1H 3T8MA 2QLFA 5JOFA 1MLCA 4D3FA 4BAUA 2OV3A 2XMRA 2WIIB 1I7TB 3HO8A 2A2QT 5GIRA 2CVZA 3RIKA 3PEFA 4Q15A 2YPVL 4ZO6A 2Q5FA 1LI4A 4LCYA 4RLQA 4PRHA 3PWNA 5I0DA 2CFRA 2PFSA 1HXYB 4EB8A 1MCWW 3QFJD 5FECB 1NXOA 2XSZD 1N2SA 4A6XA 4QRPA 1QHQA 2CPCA 4Q7JB 4WIAA 3F6LA 4GMXA 1GYVA 3KZCA 3MLSH 2MCAA 4PYIA 4OTZA 1MC5A 1TO1E 4ETWA 1FUKA 4MR9B 3COOA 5BT8A 2FW7A 4EA6A 1X3LA 4XP4H 3LUPA 2JCCB 4F33A 4F57H 2BS8A 5BN4B 2EINB 1I4FA 1PQPA 5BOVA 4JY5H 2OL3A 4FFVA 2VXSL 1C5CH 1KDYA 3BIKB 1UOEA 1UGKA 3VW3H 1IY1A 4DTIA 1OC4A 4BKOA 3SOBH 4EENA 3BPOC 4ARAA 1RZKL 3JUYA 4ESHA 2FSVA 3TPCA 4F56A 4C22A 2WXMA 4AITA 4MB0A 2DQGH 3S2AA 3HJHA 2VLMD 3IA2A 3IDAA 2X4DA 4TX1A 1ZEMA 3EPLA 2AEEA 3OHXC 1FMJA 4MDIB 2EC5A 2WYUA 4GXTA 4HJUA 4C3OB 3LRPA 4LISA 4CF4A 4NQED 1VP9A 2QRZA 1DMSA 1WBYB 2H7YA 4YRCA 2Y0BA 3LQYA 3IEVA 5MI0B 6TAAA 3BUBA 1CIVA 2ZR8A 5JBQA 5A9RA 5FBQB 5FFFA 4IHOB 2HSIA 5IMKA 4F5CA 3PSHA 1EA7A 1SCQA 4NZNA 5K6AC 3AETB 1U1GA 5A0FA 5GS2D 2VFAA 1JHXA 5FCSH 1WNFA 4JQIL 3EF1A 2EDMA 1SURA 1ZMXA 3EDQA 5FA4A 4HWKA 4EDWL 2GK0A 1MJ5A 2BBTA 2B8WA 3A32A 5SZJA 4QPEA 1J99A 1KMGA 2PQ2A 2UXGA 4ZZ1A 4P9NA 3H0EA 1SXJD 2QX6A 4X8JB 2ZSEA 3R3SA 2B4QA 2D8KA 1VFBA 4ZYUA 4XB7A 1A9YA 3MQ2A 2PYZA 4FIZA 3LXAA 5KVGE 4K8RB 2PUGA 4AL4A 4JEUA 4OLYL 2HVJA 3QIWC 3I74A 4HGNA 1E60A 4JO8A 4KWTA 4AO7A 3WY4A 2HSGA 4ZMQA 3GBMH 3H2KA 3HC3L 4C6RA 3K9LA 2CHXA 3QWNA 2CDRA 2ATEA 3QLUA 1OTHA 2BLFA 3DYOA 5EE9A 3G5ZB 3GEFA 4MVJF 4EIWA 1NVEA 4A04A 2PY6A 1T8SA 3I9LA 5J4KA 2WTOA 4KK8D 4J0FA 2PX5A 4M5ZL 4PREA 3F5SA 2AE2A 3GDCA 4A38A 4FHEA 2PUHA 1F6BA 4MR8A 2B1RA 1V25A 2QVLA 4FQCH 3QEHB 1QYXA 4WJ5B 3L4UA 1MEOA 2P9TA 2O6PA 1BQLL 3O4RA 3ULUF 1W4LA 4YLBA 4GKVA 1PG0A 1WFMA 2XICA 3RQIA 4NBYB 1IZ7A 2HU5A 3SPJA 1L5MA 1Z9SB 1TPXB 1Z9LA 4BGEA 3LPPA 4DUWA 3VXQB 4J4PA 2W4IA 4M8VA 3ZKMC 5CBPA 1HQKA 2VJKA 3RAFC 1KBGL 5M95B 3PEUA 4JJIA 3BQUD 2HT3D 1AQDA 4HEME 3KVNA 3LT4A 2CBGA 4XIFA 2LLLA 2JB9A 3H4IA 3NUQA 2W0MA 5FWXA 1YZQA 5SWSD 2MSEB 1U7DA 4TT3A 1CE1L 4C4RA 4PD4J 3S4SG 2YC1A 1S4IA 4HQOA 2QTTA 1Y1SA 4QECA 4NZFA 1UXLA 4LP4A 1ZIPA 1EFXA 1XMEB 4PJ9C 5GGTH 4ADGA 2TRHA 1VMDA 1NBVL 4OF8A 4FHDA 3TNMB 4Y5XA 5DI3A 5C6TH 5B58C 4X1KB 4JY6A 1JA1A 4CM8A 2FHFA 5I6LA 1T2CA 1EE1A 1EMDA 1AUXA 3REVA 1IM9A 3B8EA 1THGA 3E9EA 5FM8A 3AXIA 4HUNB 2YVAA 3AXLB 4QX6A 1OXYA 3HR5A 4L8BA 3WOHA 1L7IL 2H8PA 4JZOA 4LP5A 2Z6VA 3FZEA 4F9EA 4IZHA 1QZZA 1ZKDA 1XFAA 2G9UA 4DJFC 5ESAA 1KJ8A 2NR6C 1NQWA 4ZIRA 2BVUA 3RPKA 3WLWC 4M1CC 1YZZA 1Z34A 1E1RD 1ZZEA 4A2MA 3HB3C 2NY5H 3DXAD 3KXFA 1NGZB 3NASA 3HC2A 1GZPB 3FFCB 2HR1A 1VJSA 2FF7A 2FPIB 1QFMA 4H88L 3TH4T 1XMOB 1V3VA 1C08B 4I2XA 4P4KB 3WKQA 1IFHH 1MUUA 5DN6A 4QXUH 1I9GA 5B1EA 3AITA 5T3ZH 3WXMA 1P60A 3I3DA 4IJUA 4HDIB 1EEZB 3UBXB 3EVCA 3ILPA 1CXZA 3ILXA 5HE9A 1FVXA 2W2KB 4CLEA 3D6HA 3UTSE 1J49A 1XEFA 1Q16A 1DQJA 3GEBA 2JLCA 4IMKC 3CBRA 3CN4A 1X7QA 1PIWA 1YFJA 4GPD1 4ZQKA 4A67A 1Q1GA 2P6NA 2IBMA 1CD5A 3Q8FA 2P11A 3NQKA 5FOBA 2D1QA 5ESWA 3GBNH 2PTTB 3OGOE 5D93C 2FE0A 3RPIA 2ERJB 3ZK0A 3WBKA 4NZZA 4Z0BH 3QWAA 2H5UA 4IDBA 4CIVA 5FGBC 1GKKA 1Y5MA 5DMIL 3LK7A 4M7KL 1RURL 1I9RL 1HT0A 1BFOA 1S7VA 5F7JA 3HE6D 3TAUA 1E9DA 3SBEA 1L0BA 1QPKA 3KOXA 4YCJA 3WSTA 1P45A 2BY0A 4IFEA 4EKNB 1LDSA 2OVFA 4NJAH 1UZ6E 2V9TA 1YMHB 3FUUA 1UJ3A 4POZD 5GJVC 3DI3B 1WB5A 3W06A 3TZLA 2WXIA 2C2XA 1KVTA 4FFSA 3GGWB 1DVUA 1A8PA 3FRPG 1S7UB 3IIEA 5IVKA 1FCGA 2FP3A 2IYZA 1QKZL 3UT6A 5CCGE 1A98A 2DH5A 2HEGA 2V9CA 3FKQA 4CLRA 3FTUA 3IMFA 3UJHA 1PJWA 1M1YE 4FEEA 4W5QA 2C1EA 3ZTTA 1FGVH 3QI9D 2N42A 2CHUA 5E6RA 1EXNA 3GYGA 2XZOA 1TVBB 1BD3A 3ARQA 4QYWA 5G02A 4OXQA 4TL8A 3IOYA 3VHQA 1GXSA 1OBOA 2C2ZA 4PLYA 3C9NA 5FA5A 3E6FA 3UPRB 4OCSH 2VPWA 3JYCA 4EMBA 1L9OA 3RWEB 4KOAA 5IIEB 1HEZA 4C4UA 5KSVA 1KZYC 1JCVA 4X3OA 1XJWA 3QYAA 4R2LA 3BVTA 2BJMH 3ORFA 1MH9A 4RGYA 3W11C 3FZNA 3WE7A 1C8LA 3QXCA 1KY5A 4F9PC 4RHCA 2XUZA 4KVNH 3ZTEA 3UP6A 2ORIA 1A97A 4N9OB 2EEZA 3LRMA 1R8JA 2YW2A 1Y6JA 2J0VA 4XVRA 2V0GA 5D1ZB 4GP7A 2BW5A 2QOEA 4CIWA 4H6WA 3BUYB 5B30A 3CSFA 3UVEA 4IHJA 2I2DA 5JQIB 1QW9A 1MAML 2B69A 5AVZB 4O5LL 2XODA 1Y81A 2MMXA 1NGQH 5EIIA 1E4XI 6Q21A 4Y0VA 2F3QA 4A5SA 5DWVA 2B2NA 2CR3A 5DJYA 2ZPUA 2EILB 3K8MA 5T1KD 2B94A 4AMVA 2WD9A 1UANA 5AJVB 4NAVA 3WI7A 4ALJA 3OD3A 3ARDD 1XEXA 3B34A 3ZKND 4W5RA 3PF2A 1PL0A 1ZEJA 4Z0HO 3C5HA 4DAOA 3TF4A 1EEUA 1GGFA 4RZCB 5CS7A 2JGLA 5IFLA 2OZ4H 5HTKA 4Y8VA 4AGQA 4MI9A 2H32H 4D5GA 4HL6A 1OWLA 2RFLA 4H2DA 1L9MA 5FO2A 2HCRA 1HG1A 1Q1QA 4W4OA 4G0ZA 1YSOA 1ADJA 1X7TA 5LZ5A 3QVXA 3PUIA 3MODH 2D7DA 1UWXH 4KNSA 4QU5A 3A3KA 5C4IA 4P2QA 5JNYA 1GGKA 1FDWA 1WMEA 3FO9B 2AXEA 3RLIA 3SAJA 2QMZA 4HMDA 4FQXC 3E9QA 3HZVB 4E5UA 1KYDA 1ZCFA 3Q8CA 4E9VA 2K7PA 5F0PB 3LIIA 3LY7A 4C7JA 3V4LA 4NEQA 1CFQB 5HGAA 2P8MA 3QFJE 1TX4B 3LTNC 4KJPD 2UWEF 2X4OB 2ZRDA 3C4VA 3I4CA 1FFGA 1YHNA 5L6YH 2VUYA 4YWGH 5IUNC 5BQOA 1AUOA 1P2CA 1IT9H 2DBYA 2I65A 4D42A 5IAGA 3BUIA 3VGDA 5EGNA 4Z3DA 4EQZA 3RS2A 3Q44A 3LUAA 2FFJA 4YQXH 3A6FA 1NJGA 1WKBA 1H15A 1ZVYA 2FSSA 5FUCC 4YJ2F 1XGKA 1V3QE 3FN0H 2IVZA 1BVKB 4AYWA 1NOJA 3PPSA 4HJSA 4PX2A 3S3DB 1L5FA 2CHEA 1I8UA 1ZP6A 4MS3B 3AF1A 4G7RB 2VLME 4ZSOA 3MBXH 4JDZA 1BREA 3QPUA 4RQQA 4PJEE 4ONGL 2CNOA 3E5NA 2IS1A 3RWCB 4DA6A 3IHTA 5JHLL 3ZJUA 4X99B 4QRIA 3BPOB 1OWNA 4I77H 3OWXA 4OUUA 3SPHA 2NDGA 3BJRA 1T1SA 1DEXA 2I2AA 3THWB 4F6LA 1JUDA 1OAQL 4P3YA 1NBZB 4JO1H 2PKDA 1FVHA 2PNDA 2OMBA 4S1SH 3ZT5A 1WA2X 1E1QD 2B35A 1K5DA 4YQYA 2VDWA 3RS0A 4B9ZA 1AKYA 4MW7A 1QYGH 1GNPA 4JEMA 4JY4B 2NTNA 2R83A 2GCGA 5JQ6H 1N6KA 1XAKA 3SKYA 1HTTA 4CUKA 1KL7A 4B7CA 1D6EB 3P0JA 4TLSA 1PSWA 3VXSD 4H1LA 2AFVA 1WHTA 1SXJE 3QPAA 3QUAA 1CFSA 2VDKL 3HDTA 1E5CA 2ZJ1A 5KVGL 1ZSYA 4JHLA 1RVV1 4DXAA 1G6RH 5F7BA 5IROA 5E8PB 5JUEL 4ZFFB 3LKNB 3QJHA 4J39A 3MX0A 4P80A 3FU3A 3MV01 1R9JA 1U3CA 3KJ6H 1RZRD 1RIFA 2P3YA 3WS7A 4LC0A 1TCMA 5DRNB 2GARA 2QSUA 1DXQA 1A1VA 1RUKH 4OK6A 3O6LH 2GCOA 4Y6QA 3CLSD 4QRRA 4APQA 4X6DE 3N8GA 3QIWB 1B8OA 4ZNCD 1ZW1A 4TOIA 3US9A 3K96A 1DCKA 1IKOP 4X80L 3CFBA 1ZK0A 5C8DA 5EZOH 3Q0IA 3KPRA 4JA0A 4AQEA 4HDRB 4DP1X 5HSGA 4OD2A 5E95A 5T3XH 4Y2TA 4KP7A 1U5CA 4X5XA 3EK2A 4O8CA 1XCPA 4NCC2 1KIQA 2V54A 1JKJB 2QTVB 2TMYA 3UCXA 1RWKA 4D8VA 5I8KL 5JNUA 2VF2A 4FG6C 5ED0A 3KAJA 1SHYB 4QC2A 3WLBB 3FQTB 3CTTA 5FW8A 2JWGA 4YSOA 3HBLA 2OAEA 1NUTA 4X6CE 1RXEA 3K5PA 3O6FB 2AR9A 5DJ6A 2DJMA 2EKLA 3O3EA 4CR7A 2PMEA 4H0FA 3WJ7A 4NFSA 3QXXA 3KZKA 3BFXA 1SKYB 3BWMA 4AJ0A 4MNTA 2CO1A 3E15A 4MD0A 5ALMA 1EDEA 2QPLA 1TJGH 5GMOA 1TYJA 2EEDA 3CPLB 5SWSE 4MAUL 5FO8B 5ES3A 5EYPA 4ODXA 1BVRA 4LWPA 5MHTA 2Z83A 1U0QA 4F6CA 4N8PA 2AJVH 4GKZB 3AL9A 4GRWF 4KXYA 1AM4D 4IRSD 3L7EA 3NVMB 5JOPE 3PE3A 3LNCA 3FG9A 3RS3A 1YMMD 3GLUA 2NX5E 3N85H 5TT0A 4J0HA 5JXAL 3CSPA 4TQEH 1FU7A 1UWGH 4JPKH 3W9DA 3F78A 4RLFA 5DJ0B 3R7SA 3SC2B 1PD0A 4XTRD 4O51B 3SODB 1KIAA 5K8CA 2VTDA 2NY2D 4BO0A 2WWKO 3CDGA 2X4PA 1U91A 1R4NB 4MYUA 2ZXAA 4RU1A 3CB2A 4K23L 4PJ9B 1DTWA 4OQQA 5F7EL 1M7IB 3UJTH 3L2LA 5C0JB 1KTRL 5JSZA 3RUGA 2YNMA 4KX8A 3ZY2A 4YO0B 1IBHA 3K1AA 1M6OB 3A14A 4XE5B 2L42A 3L7OA 4K4KA 1G5RA 4LLUB 3PP3K 5EZYF 4LOHA 5B8CC 2YJLA 2FKAA 1M2WA 3OJEA 4X45A 5AOVA 3Q3VA 3ESCA 3GRYA 3UG4A 2WWTA 4HCGA 4JJ6A 5K0LA 2DQHL 2P45B 3OIVA 1DEHA 1LQSR 4UE6A 4TKLA 1TETL 2Q9OA 3IXLA 3HU2A 1W2HA 1V3LA 4XP1L 2VI5A 4FQQB 2VSCA 1HV8A 3PB3A 1JIKA 2O4EA 3PXBA 3PXUA 4J7AA 3HB3B 3QY0A 4NFHA 4HS8H 2RH4A 1OB5A 1DZBA 3SZRA 1HWHB 1U02A 5IVXB 3CUPA 8GPBA 5HGDB 3INYA 3TT3L 2V9RA 3C1AA 1DANU 2IAMD 2PBLA 5I5EA 1CJYA 1GYAA 5I5GA 4JP8A 4L5BA 3M6UA 1I13A 3FCXA 4PAGA 3SEQA 4B3GA 3BMWA 1WD5A 5U4XA 1A22B 5C37A 1XVLA 2JMRA 2RK3A 4BB5A 4MD5A 4OBXA 3HE7C 5DTFB 2VLLB 3NOXA 4CVZB 1JNLL 4K2AA 5CITA 4L08A 4MS1A 4GYJA 3ZK8A 4KO4S 1JDAA 5D93B 4JI6B 3GMDA 3PIIA 5JXIA 4P2RB 3K4HA 1WXGA 5IXSA 1YY8B 4PCYA 5HCUA 1K1EA 4Z7WF 3KQVA 1FC0A 1ZV5A 5JNVA 1UFOA 4C78A 5F0LB 4FABL 4HLNA 1ZSHA 1KZ4A 4P3CL 3NYIA 2W9DL 2CDEA 1BWMA 4NHEA 1KOGA 4KRMB 1IEHA 1I9CA 4G07A 1IEBB 4LHYA 5KTRA 1MDBA 4MH0R 3JALA 3KJEA 4E42B 4PG9A 1HHGA 4PBSA 1RZPA 1ZT1A 3BE4A 3OLQA 2FMXA 5TFSH 1KEGL 4LJ9A 2EO1A 3HJCA 2V33A 2XUIA 3FO2B 2VNIA 5C0AD 1QO0A 2HK6A 3EHDA 2HTKD 3IJEA 3MA0A 4BRVA 1K98A 2PLWA 1OPGH 1LO3H 1BD2A 2WYTA 3AGVA 1ZCAA 3DVQX 2QUBA 2BMVA 4D9JA 3JWDC 5AW0B 1L4YA 3F8WA 3ADDA 5ITWA 3OEEA 4QGAA 3VA7A 2F5BL 4D8PB 2R1YB 3MK31 1VCAA 3MLZH 1A5ZA 1PSDA 4CTOA 2CFSA 3AINA 1U0LA 2HO5A 3RTQC 5BO5A 1TTAA 1AE6L 1MWAH 4PW4A 5DSXA 3VVVA 2M26A 3RS9A 2D31B 3VR4D 2XZDA 2UZ0A 1E5BA 3QCUL 4ALIA 4OZGA 2NZVG 2KC0A 1YS2X 3MRGB 3WMGA 3TVMC 4MNQB 1XL1A 1GPLA 4X5PA 1R5WB 4FGKA 3PJSB 1SSLA 5A6SB 4POUB 3U2IA 1N4XL 1YRBA 4UARA 5WRFA 3H2GA 3LRKA 2QWXA 2XACC 5FW7A 2A9RA 3RVNA 2A9FA 3VPBA 4JE0A 2Y1OA 5HHMD 1AIPA 4AG6A 3K2MC 3OLCX 5AOAA 1D4ZA 4RVBA 1YEKL 1W4BA 1VPOH 1R88A 2CXTA 3S98A 3A5VA 5FAKA 4N54A 1KTJA 3MJGX 3FQWB 1NXTA 1V3KA 3D6UA 3QZWB 5JANA 3UXHA 3HYSA 2JE8A 2XNDD 4NKDA 4ZQCB 3WFDL 5IW6B 2OMUA 4XP6L 1T3FB 4F7MB 2WZCA 5A2QA 4Q02A 5IJBC 2QVMA 1QPZA 4ZJ9A 2NAFA 3FJYA 4Y2HA 4L74A 3TO4A 5EEWA 3O93A 3U3OA 4FQ7A 3ZWVA 3DDNA 4ZX5A 1AHIA 1I4WA 3OBBA 1A8IA 2A6JB 1LJMA 3X2QB 1C7RA 2W2LD 2AJCA 1YS4A 4NC1E 4B76A 1DQDL 2IVFA 3M7OA 5CCKH 4LLDB 1XTBA 2J41A 5EIBD 4HDSA 1E3MA 4FSDA 1T80A 3GT4A 2MKLC 1A8HA 5DDHB 3KWVA 2P43B 2RIPA 2DQSA 4S1VA 1GFWA 5FORA 1M6VB 1MAWA 3H8VA 1SBBA 1RPJA 3P8ZA 1RRGA 1G7JA 2EX1A 4I1OA 4F3CA 3DMMC 1SUJA 3DAPA 1JEJA 2WA1A 1ZH6A 2AERT 3PJLA 4FZEL 1NXPA 2C9OA 4L5AA 4G9DB 3ACCA 3IT0A 4Q9RH 3WDHA 2OMWA 3OZ9H 4YSEA 5LQKA 2BBOA 2PUAA 4B95C 4ZUUA 2JGRA 3DKPA 2FN4A 2HN7A 3IJRA 4A73A 4OI2A 5IT2L 4AVKA 1XH3A 2BKVA 3FU0A 3FTNA 2L04A 1N5AA 1NW4A 2JCCF 2CSUA 4X6EB 3OOWA 3NHUA 2HBQA 2IXAA 2R48A 3HI1A 3N0RA 1N2OA 3IWUA 2DYPA 4Z3TA 3HMKA 4NQCB 2EWVA 5DTJA 3UT5A 4IAOA 5I8PA 1RFLA 5IH7A 2VNCA 1R9GA 5F96H 1H94A 3RWGB 2AXFA 4I13B 1QI3A 1WSBA 4IKKA 3HBNA 1SKBA 4QO8A 1IN4A 3BULA 2O3SA 3UTTB 4JFTA 3WLRA 3OT1A 4U7GA 3VFUB 3MMSA 3VD3A 4R7NA 1M1UA 3KYCB 2RKWA 2QD4A 4JJ4A 3MRIA 3GS7A 4C58B 4OLFA 1MD9A 4NFCA 4Y1RA 2CKBH 2EECA 3BWYA 2MOGA 4NS1A 2POCA 4NFLA 1KN2L 3VXSE 1R0AL 3MRNB 3QJFA 4AJOA 2POQX 3L1KA 1AXTH 4Z0PA 4GEJA 3FN4A 4F7TA 4XSGA 2AZUA 5KQPA 1P7QA 2JI9A 5JVDA 2YMXH 1TYDE 3CF4A 1T5WA 2AHRA 1FNLA 1JV5A 3VDQA 2A94A 5ECDA 1P29A 1R64A 4YR6B 4GIBA 4Q5IA 1IXKA 2JHPA 4OSPA 4F3FA 4XVHA 2F9BT 2W22A 1BG6A 1G3IA 2HHAA 2F4VB 4A7QA 3C3YA 3QBJA 1NRJB 2OJEB 2DQ6A 3PIDA 4LMQE 1ODTC 1BJ8A 3I23A 4KNWA 1CFBA 1IXSB 3KM2A 4ND5A 1Z6JT 4E0RB 4U8HA 3G2JA 3VTFA 1QATA 5DTMA 4PC1A 4PJHB 1C0KA 1KAEA 4S2SA 3MRQA 3EH2A 1X9QA 3RGHA 2B9AA 2KMWA 4NU5A 3N2GB 4MZRA 4I4TF 1DJMA 4LSQH 2NOAA 4AJNA 2B0CA 3AFHA 5GGVL 1G0YR 2DFVA 4FJ0A 5F0JB 1DBQA 1FFPA 5F7UA 1EWTA 2SKDA 2QTZA 3VD5A 5KNBH 5JQWA 4NX0A 2JPDA 1W72L 1NANH 3HKDB 1KEWA 2JJ2A 2KPWA 5BMVB 3CUKA 2AA3A 2CE7A 4HSEA 5FBLB 1LPBB 1E2KA 1TENA 1WV1A 4KQ6A 15C8H 2UUDK 2ZDQA 4EUHA 1G5GA 2DKSA 1EJOL 4R96A 2IA5A 2NXZB 5J2TA 1J1OH 2R1ZA 1H9VA 3P20A 4RF2A 5HZMA 3SDDA 1JZGA 3DYPA 2B2XA 4H35A 5H80A 2Z2IA 3V10A 4I4NA 3I2IA 2G9RA 5E0OA 2ZJFA 2HIHA 2OE2A 1MELA 4CADA 3HGTA 1NAKH 3JTEA 5EJ2A 4O02A 4JPWL 3HZKB 3NBQA 1YMME 1T1ZA 1MB0A 1U3VA 3IUJA 2MIIA 5KBPA 4Z1PA 1M2HA 2BFDB 3FMGH 4ZI7A 3B12A 1I4DD 1KF9B 3BP5B 2J1XA 1I7UA 2FQFA 3CQFA 4OCWH 1QKKA 3CZ9A 3U46B 2ZRQA 3L1OL 1IZJA 2QXUA 2BY4A 2PR4L 6GPBA 1ZNYA 3IR6A 4R0VA 2O6CA 4Y98A 1WMSA 4AV0A 1E43A 5DM2A 3HBAA 3RFXA 4MW0A 2VPXA 1CULC 1EEHA 4EMUA 1SOUA 1EHYA 5F78A 3ESPA 2FZ3A 4Y6GB 4AMKL 4NQZA 2IANB 1XN4A 2H0QA 2HY7A 1G43A 3WBDA 4AQAB 5FUQA 2R27A 2AYYA 3F12B 4NSKB 1T43A 2QAGC 5KUKA 1WS7A 3K0CC 4RM2A 3HMWH 1KPUB 3GYBA 3SQOA 4XBGB 4TSFD 1CY2A 2FJFA 5B8CB 4JQCA 2IE0A 3ZKWB 2FQDA 4NEGA 1EZVY 1YUNA 1AZBA 2EYRA 2HKFL 3GEEA 4W7HA 5EF2A 3JASB 2NMSA 4RDIA 1JWAB 2GEBA 4BE5A 3RWFB 3HJBA 4LCIL 1A9BB 2B21A 1U2DC 1RWWA 5BWNA 3KXIA 4ZO7A 1TJIH 3BISA 3VFGL 2TSBA 2HO4A 3WHIA 3CLTD 3S5LG 3P9RA 2Y5TB 1DVQA 4XVSL 1E9VA 5J5AA 1UM9A 3KBBA 4LEXH 2VHVA 4GPIB 2V5UA 1KRHA 3EYVB 1Y8RB 1IDOA 2JAUA 1KZ1A 3JQ9C 1BXUA 1MRCL 3V0DA 4QATA 4LF5B 3N8NA 3V9FA 1Z0NA 2NOYA 2GAZB 4X0KB 5CIPB 5LUBA 5I7FA 2V9PA 3VGGA 4F06A 1CQXA 2YPLA 4BV9A 3DDOA 1U98A 2XIJA 2QLTA 2G7ZA 5HK8A 4YGAB 1Z82A 3V9CA 4GX0A 2C3VA 3S48A 1FBTA 2BCEA 1CGSL 3ZPXA 2EF0A 5DU7A 3ZNNA 3QLTA 3BIJA 4KY2A 5JDSA 4G5HA 4E15A 5FDWA 3OKDA 3W5JA 4OGLA 1ZJJA 1KPHA 1PKQA 4PPYA 121PA 1QG0A 3RZCD 4RBPH 3JVIA 2ILVA 1DAGA 4CR8A 3HP7A 4QXGL 2QVXX 4GLOA 4TXMA 2PWPA 5I16A 2WYHA 3O2SB 3NJ4A 5I7OA 2VJNA 3T4YB 2XIDA 3ZVNA 4TUJB 3PNWB 5AD0A 1K6QH 1OA0A 1EGMB 4FQ8A 3U9UB 5JAHA 4L1DA 4NPYA 1W8NA 1XJQA 1H3NA 4XVJH 3UTQB 4P83A 1BMTA 1OAKA 1Z45A 3DYMA 2NU7B 4EH1A 2ZKHL 3NBNA 3GG2A 2P6PA 4PB9L 4ZW8A 3UIEA 1VSCA 3FQ1A 2R9HD 3ARFD 4HX5A 4NUMA 3G5YA 1YRLA 5DS8B 1U3NA 3JYHA 3Q6GH 1QAWA 3RYTC 4X8CA 2O2SA 5LCVA 4NQUA 2V7TA 4ZVRA 1XF4B 3L0BA 3GJ8A 3CFDA 4RRPM 1THMA 4NATA 4LYAA 1B6UA 4I4LA 1XX9C 2X2UA 3IDNA 1NYRA 4WI4A 3X1BA 2AEJA 1UG9A 5E6ID 4S2EA 5I4BA 3KPQA 2RHBA 5KUTA 3RTQB 3F5WA 1SVCP 4BVLA 1E4KA 4NWIA 4MNHA 4RMQA 2RB8A 4YSUA 5FUZH 2DQUH 2HVKB 1PZAA 5C92A 3I9GL 2GAAA 4RMIA 4LZNA 3H4MA 5HHME 4NCBA 1D5IH 2GBLC 1NGYA 3D0KA 3CZ4A 5I30H 4LPYA 2VLRA 5TSDA 1OHZA 2VO8A 5B38A 4DVBA 4OQXA 2OJZH 3SGJA 1F5NA 3OOSA 4JXKA 2VHUA 3JQAD 1RLWA 1XTPA 3JZDA 2J8OA 1K8RA 2XJ9A 3P77B 4FMKA 3TLAA 1BJTA 3HKEA 3EZXA 4LLQA 3NGMA 1KR5A 2EJTA 4J1UA 2P2DA 3PHQB 1ZCRA 2P8PA 1IMJA 5TF0A 4B7UA 4AS1A 3DJRA 4NNPL 4NG4A 5C70A 1PS8A 3ESOA 3L5WA 2Z64C 4X24A 1S9WA 1G2IA 1B23P 1VPLA 3QRGL 1WO2A 3KLLA 2FEOA 3BXOA 2ZX8A 2C8VA 4KK9D 2GD6A 4MMZA 1U3ZA 2O6FA 4YGVB 4JDTL 2NW2B 3LV8A 1RZUA 2PIDA 4LPUA 1MPXA 3HY4A 2QG9A 4GL4A 3OLIA 1HQCA 1T0BA 1QOPB 2VZVA 4F84A 4K7PL 5FTLA 4GUPA 4TZTA 2GPWA 1ROWA 3VB8A 3AEQB 4YSDA 2PO5A 1XJ0A 2X5XA 2V5AA 2F7RA 3IJHA 3DW1X 3SE0A 4KAFA 2I7OA 3A6DA 5BP7A 2Q5EA 1U81A 4E3WA 2PN5A 4Z0XA 1AP2A 5CZRA 3NA9H 4MAYA 2XMSA 4B5EA 3WLIA 3WLJA 2J9YB 5CD3B 1DX6A 4ZS6C 4FHGA 4JMNA 5BSEA 1APBA 6PFKA 1DWUA 1PJ8A 4ZTOH 1Z88A 1CR1A 2ZE5A 3DMMB 4B5KA 4K9NA 3ITDA 3LKRB 3ECWA 4EVNA 4YECA 3A23A 2X5PA 4R40A 1Y7IA 4HAWA 2X5KO 1AD9A 1JYXA 3D3NA 4JUBA 2O5ZL 1X4XA 5C0IB 1BZ9B 3HEBA 3IAPA 5G4MA 4K3UA 2CJSA 3G04B 1AA6A 1FSPA 3DB1A 1MFEL 5F8QC 3D59A 3CISA 4M9ZA 4CC4C 3E5HA 5BRNA 3P4NA 4U2FA 1GZ7A 3W0WA 4K71C 1TEHA 3I45A 2BLNA 1LEIB 4C6TA 1UT9A 4PLNC 1GPYA 2XXBA 3MRPA 4JWKA 5FKJA 1U8IA 4ZOQI 3F5QA 5L8JB 3BP7B 4YCDA 4Y5YA 4R9SA 3N55A 2ZRGA 4TOYL 4CU6A 4EIGB 4BDVA 2CRIA 4RCAA 1MFMA 4TSBH 1T7VA 2C3GA 4RVGA 2F54A 2VNSA 2DUUA 3MVEA 4CCSA 4LIQH 2PE5A 4UB0H 2GKGA 2JAHA 1WWAX 1L5WA 3PCRB 2AJXH 1R74A 4RACA 5GRYA 4X83A 2C4MA 3J7AC 4XMVA 4S1PA 5EA0L 4UI2A 1QTPA 2YV1A 3WBBA 2JLXA 4JG9A 4LEOA 1TTFA 4UJ5A 2CVFA 2H16A 5G41A 3TQRA 1IN7A 1CE6A 3GSNB 5DJAA 2OSBA 3J7TA 3N6XA 3HCNA 1DO6A 4ECNA 1P4JA 3ZDDA 1E3TA 4ZAGA 4R8SA 3QSGA 4FGJA 4UAVA 4LOLA 1AHPA 2BGKA 2QDVA 4E6EA 1WAMA 1BZ8A 2GJ4A 4W70A 5GZNC 3NR2A 2NV0A 1GA2A 3ULVH 3WLQA 1QSEA 1AGBA 4EX7A 4AZ8B 1J09A 5K9KA 5TE6L 2J08A 4WJLA 3T7IA 3VR3A 4DZTA 1K89A 3LKDA 2I7CA 4DFIA 4IGBA 2C8JA 2YA2A 2PLNA 3QBDA 4TLTA 2Y6TE 5D4IA 3U0VA 3QXTA 4WI8A 5DD0H 3MJFA 1WUJS 2CWDA 2Z8YM 1FQKA 3HI6H 1HUQA 3WK5A 4YRTA 2IWRA 3H4HA 4PRNB 1E2DA 2QN8A 4WFED 2FFRA 3R20A 3RFTA 1BOGA 1VRCA 2CO2A 4HFMA 4Q9QL 2VO5A 4G9FD 4UZFA 2R56L 4RDQF 4U3CA 4HFUH 4LLWB 2H6UA 3AY4C 4DGSA 1E50A 1X87A 2CBXA 2VNHA 1P6FA 3I01M 3ZLVA 2VLKB 4Z7JA 2CJTA 3VVCA 1NV8A 2IT1A 4CKXA 3SSAA 1FZJB 4G6AC 1JBKA 1PGRB 1EBUA 3D7NA 4Q00A 4CQMD 1JWMA 5BYJA 4XH2B 3QNZB 1GAQA 3MJ4A 5LVEA 4DR4B 4GT0A 2HZ7A 2IXTA 3QZOA 2RJNA 4OJCA 1TU2B 1CI5A 4GSXA 4KTDH 2ICEA 2R4SH 2YKGA 4X4XA 2VK4A 2H41A 3MJ9A 5EERA 1YZLA 4JFHD 2Z91A 5K39B 4KVCH 5F21B 1CYXA 2SEBA 2P9CA 4RGBA 4S1RH 2WP8J 4NLAA 2H1PL 5EO0B 1N2GA 1SDDA 3CH6A 5IAEA 2YQGA 3QR2A 3O90A 2ZIFA 3FH0A 1B74A 4LLMB 4NX2A 5D2NE 3KEQA 3TWCL 2KUTA 1Q0EA 4GOXA 3OKNB 3VBEA 4AXWB 4EIUA 5BY2A 1OKEA 3BVUA 4J16C 4LRUA 1U7ZA 2J6BA 4YE4H 1AACA 4RE5A 3KR1A 3ZD7A 3WY2A 1EEYB 4JI2B 2GO7A 4KXXA 4R2HA 5IEHA 2HDWA 3X1FA 2QRMA 3JWDL 3KDAA 3L54A 2XZLA 1XZ8A 4RIIA 4LJ7A 2GDZA 4BUHA 4KQGA 4U1KA 3MCZA 4PHGA 3WK4A 2WLYA 4IMRA 4DMMA 3W2EA 3NJ8A 1AH1A 3MNZA 4G6JL 1XZWA 2VQ3A 3D06A 3HVUA 1JU9A 3K09C 2GFBB 5C07A 2CJFA 3EASA 4G82A 3I4LA 1Y80A 3N2ZB 4ZMZA 4FINA 3F5DA 4QUBA 3H65A 3HC4H 5E2JA 2LTAA 4NQSA 2Z7WA 1QH1A 3NIFF 3P26A 1K8QA 4KQ0A 4TM8A 4WWKA 3HFRA 2X9YA 3TCTA 4L48A 5JISA 5K01A 2P75A 4BNDA 4NHCL 4EHLA 3DVSX 1CLZL 1LD9A 1DIOB 3IB3A 3U60B 3ETNA 5DYGA 3O4JA 3MS7A 3RDTD 1D7DA 4YCCA 8PAZA 2B82A 4FYRA 1OCWH 2Q2WA 4BBAA 3P9LA 2BGTA 4EF5A 3TQHA 4ZT1A 1ZJYA 1NCAL 4DMUB 1VL2A 2I2FA 4W7SA 2I3BA 5AKYA 4EJ2A 2PR9A 2G1JA 4GE3A 1L9KA 4BO8A 2E9GA 4AVYA 5IVXF 4LAQL 2FRDA 5CBAA 3V4ZA 5HGGS 1ACJA 1Z5LA 3QEMA 4DW2L 1GMIA 1MCIA 2WM8A 4R2GC 2X1LA 1XYGA 2DMCA 3GQFA 5KEZA 4FEIA 4OLHA 1UKCA 2EH8H 1BWRA 2J88H 4YNBA 2X4GA 5HIKA 2AFNA 3L5XL 4D0BB 3P19A 1AZTA 4ZUVA 4RKEA 4HS6B 1RKUA 1CJSA 5DQ9B 1LO0L 3DZGA 3CRW1 1D04A 3R3YA 1MUJB 5T1LB 4YIQB 4XC3L 1IG3A 3D0LA 4CGYA 4RMWA 2VW6A 3GEMA 1U8XX 4NYIQ 4Z5RB 1Y8CA 4X66B 3HDQA 3HCFA 1XR3A 3C60A 3QMPA 4F2MA 3D3EA 5JNRA 1DDTA 4GG6B 2CMFA 1W8IA 1L9XA 3WMPA 2VDPB 1XGYL 4BWGA 3CX5K 5F9OL 5AUNB 1UEIA 3AXTA 3QUZA 4NE9A 2G75B 1ETB1 1MCRA 3VFRB 3TO2B 3MGGA 4GIOA 5CDGA 4ODSH 1Z4JA 5AKHA 4GQIA 4YBZA 2PCPA 2JARA 5E2BA 4B53A 1ZUNB 4MJHA 2NVOA 2HUNA 2EIXA 2G67A 3VQTA 2AV1A 3PVCA 4M43L 1GUAA 2G1KA 1L7TH 1NF8A 3MD0A 3GJ6A 3WHPA 5IHPA 3IP3A 4D0CA 2AK4B 3OIDA 3X2SA