3ZE2B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
469
structure length
469
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 115
structure length 469
sequence length 469
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze2B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze2B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze2B03
3V4PB 4G1MB 1ZOOA 2I6SA 3GXBA 3IBSA 3HI6A 1JEYA 1SSLA 1BHQ1 1QC5B 3ZDYB 5E6RB 3AFCA 3Q3GE 4GZ8A 1M2VB 1U8CB 3VI4B 4K3JB 1L5GA 1SHUX 3NIDB 4WK2B 3HXOA 1OLZA 2VDQB 4MMXA 1CK4A 1M2OA 1RRKA 3ZE0B 1FE8A 1AUQA 3EGDB 3AL9A 1PCXA 3EH2A 3PPYA 1SHYB 1AOXA 5E6SB 3OKWA 3PPXA 2VDPB 1YUKA 3M6FA 3EGXA 3EH1A 5HJ2A 4CN9A 4C2AA 3VI3B 5KYXB 4NENA 2VDKB 1M1UA 3FCSA 1XUOA 4CN8A 4O02B 1XDDA 4IGIA 3AL8A 1MHPA 1YVPA 1TYEB 3IJEA 4Z7NB 1JV2B 2X5NA 1ZOPA 1AO3A 4UM8B 3K72A 3ZDXB 1M2VA 1SQ0A 2ODPA 4M76B 3ZQKA 4FWWA 4MMYA 4O3UB 1ATZA 1PT6A 1QCYA 4G1EA 2WINI 3EFOB 4WFQA 1UEXC 4PN7A 5KYNA 3NIFB 3OL2B 1RD4A 4IXDA 1MF7A 3EGDA 4HQKA 4C2BA 1MQAA 5KYWB 2NUPB 3BN3A 5E6UA 5E6SA 1N9ZA 2XWJI 2NUTA 1M10A 2ODQA 4F1JA 3N2NA 4MMZB 2UZYB 1V7PC 4NENB 1XDGA 2I6QA 1RS0A 4JX0A 1IJKA 4G1MA 4WK0B 4UM9D 3TXAA 1SHTX 1JEYB 2VDMB 2IUEA 4FX5A 2WW8A 3NIGB 1U8CA 3TCXB 1PD1A 1T0PA 1DZIA 1T6BY 1U0OC 3RAGA 3K71B 1RTKA 4Z7QB 5BV8A 3ZDZB 4CNBA 1JEQA 2XWBF 3NVQA 3K6SA 5HDBB 3T3PB 1Q0PA 4HQOA 5KYWA 3ZE1B 4UM9B 1MJNA 3ZE2B 4HQFA 1U0NA 3E2MA 1IDOA 2NUTB 3EOBI 3TW0A 4O02A 2ADFA 5KYUB 2P26A 1MQ8B 1PD0A 5E6RA 1IJBA 1JV2A 2VDRB 2VDNB 3K72B 4Z7OB 3PPVA 2XGGA 4XW2A 2O7NA 4MMXB 4MMYB 2VC2B 3BQNB 3EFOA 3OKYB 2QTVA 4DMUB 3T3MB 1JEQB 3PPWA 3F74A 2VDLB 2I91A 3EOAI 5KYYA 4NEHB 1M1XA 4IHKA 2B2XA 5E6UB 5ES4B 2NUPA 3EGXB 1DGQA 1MQ9A 5KYXA 1IDN1 4MMZA 3EG9B 4HQLA 3TVYA 5KYUA 3EG9A 3AL8B 1QC5A 2VDOB 3IJEB 5HGJA 1BHO1 2P28A 4O3TB 4HQNA 1L5GB 1NA5A 4BJ3A 1FNSA 3HXQA 1ZONA 3BQMB 3V4VB 4A0QA 3F78A 3K71A 3QA3E 4C29A 4G1EB 4WK4B 1N3YA 3OL2A 4JDUA 1YVRA 3K6SB 2NVOA 4WJKB 2M32A 5LN1A 5KYYB 1M1XB 4F1KA 3FCSB 2ICAA 1LFAA 1OAKA 3FCUB 1CQPA 1JLMA
chains in the Genus database with same CATH superfamily
2Q5BA 1I7UB 3CG4A 4DKFH 2OL3L 5HYIA 2JWHA 4PJ9A 3RDTD 2G5PA 2VUTA 3IE2A 4BATA 4U6VL 4BVHA 3HRZA 1HWWA 3WKNA 4RZCA 3IAUA 4O4LA 1WV0A 1V1MB 1VI5A 4PEVA 3VXNB 4M0MA 3HXTA 3MV01 1J8YF 4TQGA 1OI2A 2NZ9D 1EGMB 1Z4MA 2QZQA 3CFJA 3MGOB 3H42H 1NM5C 1NKGA 2XG4A 4UHHA 5AICA 2G80A 4OJCA 3BE1L 5F7ZA 2YMXH 3L7IA 2CDAA 2E6UX 3COOA 1ZDMA 1A0QL 3WLMA 1S9KC 4P4LA 5E1DA 2X6CA 1T83C 1IFHL 2HT2D 4DN3H 1PW7A 2VABB 2YXBA 5C2BL 2Z93A 5TR9A 3I5XA 1FAIL 1HHGA 4JR9H 1HWGB 1EAPA 1R4AA 1REIA 3MRQA 5L88L 2Q07A 2QSTA 4FP8H 1PBTA 3HKBA 1GA4A 5ULLA 1YQVH 4CVWA 2WLYA 5FWXB 4O0MA 2WVSA 3V1UA 1ZD2P 3LA6A 2HPAA 3V8OA 5AHXA 3W2GA 1I33A 3LNFA 5DRZA 4NJMA 2Y99A 3O45A 4JLOA 5KYXA 3CW2A 1RY7B 3CE6A 5DZOA 3VV2A 3WJ7A 4Q1DA 1DFBL 4XXWC 1RZJH 1PZ5B 1J0CA 1XJWA 4U7DA 2VPXA 3ME0A 3MRDB 4Y88A 2PQMA 2Q0ZX 1AKRA 3JWOL 1GCAA 5KNBH 4BV9A 2BY1A 1ZBQA 1S9XB 1CQWA 1UMDA 3EF7A 2EXYC 4NBUA 1AACA 4MA5A 4U1GB 5DW3A 5FM4A 1SDAB 3OAWA 2ID8A 3RREA 3FSAA 2V3FA 2QW0X 5B6PA 1UPXA 2IXFA 3QHZL 1DJYA 3KDPA 3SYNA 1DAOA 1LI7A 2WQ8A 2F7IA 4G5ZH 2BSTB 4JKKA 2CLHB 1I13A 3JV5A 2HW8A 3OU2A 2ES4A 2JFNA 1QVZA 5EUKA 4X8JB 3U44A 2H2DA 4YA6A 3AT1A 1KN2L 4A7QA 2ATVA 3X14A 4U1HB 1NVTA 3R0VA 1CDJA 5LQNA 3OTOB 1HLDA 1P8AA 2OL3H 5IBQA 5KVAA 1TUIA 2D3LA 4LLQA 5LJYH 3WDKA 4LCWE 2QX8A 5KEZA 3HR5B 4O59O 2QRUA 1UTDA 3NP4A 1FL5A 2HP4A 1CY6A 4M3HA 4R96B 3GJXC 3VZDA 1BMTA 4L9DA 4N0CD 4N28A 4WDQA 3LKPB 3SJVA 3I3EA 1YZYA 2BP3A 4HEA1 2C1PA 4DA0A 3L5HA 1X7WB 2I9TB 4KMMA 1O58A 3NSYA 3SYPA 1Z7WA 2ZBRA 4F11A 1HXMB 3RHZA 1SZDA 2BK8A 1YASA 4RVGA 3RRBA 4IZIA 2PKDA 4NGHH 3WYFA 2P5WE 3OT5A 1CICA 3DXAB 3RIXA 2I4NA 3BIOA 2VDMH 1U42A 1MSPA 3ZSSA 4QWWA 3OKDB 3LZFL 1SM4A 3IDOA 3TVTA 3OXSA 4H27A 5G3ZA 1AN0A 1JF1B 5DRWB 1TGYA 3EYAA 3M86A 3OH8A 1WO2A 2D8AA 3GN1A 1FZOA 2Q1YA 3BAYA 1PZEA 4IR7A 1R9MA 3C2AL 4J3UA 1GCFA 2WD9A 2GT1A 5EHZA 2VG8A 1R9FA 5HGHA 1KDJA 2EJVA 1D6SA 3HFFA 2A9RA 3QLJA 4NC1E 3WEXA 1NVXQ 3ISWA 4X1IA 5MEOA 1TSRA 1YMUA 2VHJA 4P9HL 3IA2A 3VGJA 2HJHA 4Y6RA 1ISMA 2E7BA 2WVHA 4RX4D 4L9RA 1KSFX 5EUCA 2ARJB 1JPVA 4ESVA 1PEKE 2MOVA 4P35A 2VK8A 1NRXA 4PGMA 2BKLA 4WSJA 3RA7L 1TTAA 1I7PA 1Z8FA 4JFQA 4XYMA 4JFSA 4ZTOH 1PJZA 4TKVA 3OD3A 4QGYA 4MKFA 5ITFA 2PKXA 3U26A 3O11B 4HUCA 1HDEA 1ONSA 3RYFB 4ONHB 3IX7A 4P4KC 5LBUA 3QUYD 1RSFA 4Z1OA 2WTXA 3QUGA 4PS8A 1MNNA 1UP4A 1I7RB 1AI1L 1XCQB 2DQHH 1BHO1 3M1AA 2TRSB 3D2LA 3LKNB 5E2TH 1RP7A 1CUIA 2LGNA 3BMOB 2C5LA 4MDHA 3C5XA 3CFEB 1S5HA 3KHKA 1NQBA 2E1PA 5KQRA 3CSPA 5AUMA 3H9SD 5BZWB 3FUHA 1P0IA 4MJ5B 2JIMA 3ZTJH 1PZUB 4YHNA 3EW3B 3Q3GA 4HUXB 4HAOA 3UAZA 2P9FA 4LZZA 3QH3B 1P7WA 3L4BA 3IMTA 4X0KB 1NI5A 4TN1A 5G4KB 3CZFA 3KVQA 1ZH8A 3KW7A 4PJCA 1G5TA 3FF1A 2F58L 1WHTB 3MRSA 2J5KA 1JV5B 3OC8A 3BPNB 5E8PA 5E6UA 1Z15A 3RZCC 1ZUIA 4D79A 1VYUA 2XG5B 1NBVH 3DZBA 3V4RA 4P4SB 1W44A 4WUUB 5HHME 2BVQB 2IYPA 5CJOH 3KS0J 2VXSL 5E8JA 3QBTB 1MC5A 4XI5D 3U25A 5L4FA 2L2QA 3OECA 5J1SB 5GGVL 1ABFA 2ZROA 3WG7B 4EJ0A 3RVWC 4NKMB 1AY1L 4MA8L 4YQZA 3WJMB 4CL8A 3HG1D 2DUWA 3LP8A 3L3IB 4GH5A 3QPQD 1XTUA 2JI1A 1L7RA 5IB1B 1GZHA 3UBFA 2PP8A 3SJCA 1WLSA 1KZGB 4X8LA 3WK4A 2XY1A 2BEWA 2G70A 1YB7A 2HIHA 4EAQA 1MCIA 2QPTA 2PX5A 3EPPA 4JUBA 1I4TD 2OMUB 2H1FA 3TU6A 3C39A 1NMEA 3USES 4KNSA 4GX2A 1LDGA 4HX5A 4DFIA 2R5WA 2OS7A 3ILVA 3U36B 1E9PA 2R6FA 1S7GA 4JGIA 4HVBA 2QR5A 4O9HL 2PMDA 3GQBA 2JQAA 4KUEA 2WNXA 2WLTA 4ON9A 4ABWA 4Q9DA 4AJNA 1HINH 4FXOA 2DFVA 4DAGL 2HCTA 4JJ7A 3AREC 4R8RA 5EAIA 3GMMA 4GLRH 2WT4A 2P9ZA 4J03A 4NCDA 1FXUA 1KDPA 3CZMA 2L7QA 5GZNC 4PJHA 1LM8V 1YPZE 4DR3B 3O8BA 1CX9B 4X6LA 4YFVA 1F7VA 3GSVB 3WDMA 4EFDA 3BAXA 2R7KA 5B21A 5KQLA 2PTUA 1RWWA 1KFBB 2ZNXA 2MYNA 1L6IA 3WGOA 3LC0A 3AS1A 3GLKA 3UDWA 1DVFA 2FSVC 721PA 4L6CA 3TCTA 3IT3A 4Q2ZB 3ARVA 2CUZA 1SCDA 4OXNA 2FE1A 4PJFF 4F1SA 2DVMA 5MHSD 2H1WA 4H2AA 4IBSA 1DEKA 5I66A 1WXGA 4BWGA 1A6ZB 3G6AB 3UB4A 4ZODA 1MAVA 1YYCA 1DKLA 3LY9A 1NKRA 4XVHA 5KNCD 4RH3A 4KI5C 1F5NA 2QT9A 2Z92A 2GH1A 3D05A 3LFHA 3B48A 5DUMH 1RQXA 4MA0A 4UOQA 3NCEB 2NXZC 5I6PA 2H41A 2P9JA 3D8SA 3UP1A 1KBVA 4LHSA 3RU7A 3NFNA 1JXAA 3G1UA 1L0XA 2I6SA 1RZFH 1F1GA 2DLHA 2CUHA 1L7PA 1ORIA 2GVNA 1P1FA 5E24E 1UKZA 3EAQA 1CF4A 1MEXL 5I75B 2XSZA 1UZ8B 2ONJA 1ZGZA 5AVXA 5F1KA 4C06A 4X6XA 3DJFA 4DPMA 2PWEA 4KWCA 3ZYCA 1L7MA 1OAYH 2XUJA 1O0BA 5AW0A 1R8YA 3F8WA 3KYDB 2XRYA 3L08A 4EX6A 1HX7A 4U7KA 1QVVA 4KKLD 3GJFA 2XUOA 2NX5A 3ZSTA 5CAEA 4JL1A 5EZ5A 2WU0A 3V8EA 2P4HX 4LFAB 1XL1A 2WLLA 2W6NA 3GFQA 3VVVA 4B4UA 4DOHE 2AWNA 5GJSL 1VKOA 2FKAA 4B34A 4D74A 3PGCB 2MNWA 1NA8A 2KL6A 4Q9RH 2L4OA 4L8LA 4NMLA 3QIUC 2HN9A 5FTWA 3K0AA 2A57A 1G9EA 1TU2A 5C08B 4BE7B 1KI8A 4AY6A 4KK3A 4S2SB 1DBAH 5D72L 1FC2D 4M1TA 4FKHA 4OLYH 2E3VA 2YBRA 3OVUB 1R74A 4XMKH 3A1VA 3LEXB 1D7AA 3ZUPA 1AUVA 5EEGA 3V48A 1W85B 1PR5A 2W98A 4GPBA 5KYUA 2RC5A 3L1OH 4NT6A 4OKDA 3W3AA 4HS3B 5I8CA 4NATA 5DLML 2I1WA 5LU8A 3BBLA 2BGLA 2BI8A 3UAWA 4CLDA 3CFKB 2QB5A 5TQ0A 2WVGA 1KN4H 3SPHA 3FRHA 1NFDB 1ABEA 4IBZA 3A23A 1KRXA 2YFHA 1IE3A 1KXTB 5LN8A 3QX8A 4GT0A 5IOPB 1JT9A 3T7IA 2I2BA 2PEZA 3CWCA 4DLLA 4IJKA 3SC2B 3DUUB 5IT2L 5MENE 4RTOA 2XECA 3DUSB 1NWPA 5LO7A 1AGRA 4RPCA 4XOUA 4NZJA 1DBKH 3L81A 1BE1A 4POUB 4FFPA 4KTVE 4CL0A 5DZJA 1ZGLM 5HRUA 4YK7A 1Y6QA 1G3IA 4DEYA 3QZMA 3BGFC 2AB0A 2FCRA 1XLVA 1M0SA 4K8RL 4A7GF 3LS4L 2GC4C 1PGNA 5KHLB 3EARA 1BTOA 1J2JA 3NVQA 3FIJA 4ZWNA 2LKDA 5HI3C 4M9UA 4E88A 2HFFB 4M6NH 1USGA 4RE5A 4M98A 1YDFA 3MRRA 1KF9B 4JFFE 1H8HA 1CSEE 4H7VA 4Z0BH 3T2QA 1UXOA 1YUNA 4QR7A 4UYQA 5DNYB 3LRPA 3HUFA 2PR9A 4PRBB 3IGFA 4PRPA 2J3DA 4EO4A 1L9NA 3FKUS 2X8JA 2NUPA 4MI3A 3WAJA 3DKVA 2EGGA 1D6VL 1SPBS 3VGHA 1U0GA 1VSCA 1UENA 1J0AA 4B43A 1MP0A 4ME6A 3H3KA 4URZR 4S1SL 4KPGA 2JBAA 5JNSA 4HX9A 4RJLA 3TWCH 3OIDA 1UXLA 2C9AA 2JB5H 3UT5B 4Y6PA 4N0UA 3S7ZA 4GKNA 3QUMH 2E6PA 3AVWA 3NDRA 4XC1H 3AACA 4HNRA 1ZNXA 2ZITA 1S2IA 3CZQA 5A43C 3QI7A 4LMPA 4Y7OC 2BZSA 4G36A 2O1AA 3QM1A 2A7BA 3EQ9A 4FHEA 1KG0A 2ORVA 1XEWY 1RQGA 3U9UB 2AHRA 4DCMA 4LSGA 2FPIB 3RFCA 4YXKH 4JO4H 4L9LB 2LR0A 1B0GA 4NZFA 2F1JA 3CHYA 3II3A 4ZUSA 1BW9A 1RJLA 1NGPL 3GDWA 2WTAA 1Q84A 1Z4KA 4QGSA 1J88A 3R06A 3BXPA 4ZZFA 2M26A 5DK2B 1NIAA 4YRQA 1UBRS 1ZJYA 2GSIB 1XEUA 2XUAA 5FPPA 3CLFH 3GNMH 1FPTH 2G9VA 4PLJD 1XIVA 2FFQA 4MIOA 3B51X 1G7LB 1V3KA 4ZOQI 1R18A 5F6IC 3TJEL 4UE3S 1ONNA 2W0SA 1O5PA 5GS0C 3PX3A 3CB4A 1U8OB 4NO3A 5D5MB 3CVUA 1N2XA 2VC2H 2Z5VA 4ZW5A 2AG8A 3CISA 4Y0NA 2ZB8A 4JUTA 4ODXB 4JSRA 3QJHA 4PJGA 1HDRA 4EGJA 2BP8A 2GB2A 4PW0A 1I3KA 2HHLA 1XEDA 1MCPH 2ICWJ 4NKDA 3WK9A 5K8IA 5BN4B 3ATEA 2L7UA 1W5SA 1TOXA 5LWQA 1Z6AA 4NO0D 1JZ6A 3HMXH 4OU5A 1AZWA 3R9XB 3PEYA 3D4OA 4HKZA 1A1MB 2XN1A 2X4UA 1OSEA 1V7NL 3V2IA 2YQ2A 1PFUA 2WF9A 3EW9A 4F7CB 1FNAA 4X93A 4F9EA 3DLQR 1W76A 3BYZA 3DV0A 2HXYA 1AQNA 3ULUL 1W30A 3U9TA 2ZAIA 4JANB 1JA9A 3CZJA 1LWNA 4XCYB 4KLZA 3AUUA 3RUHA 1DJPA 4CV0A 2A1TR 1N25A 1VOTA 4YYEA 3L3BA 1KYZA 3DVFA 4QUAA 3GBLA 4F85A 1GGTA 3H04A 4RFOH 3L8FA 3ASYA 5FR2A 2ICES 4WBSA 4PSUA 3EFFA 3KHTA 5IYZA 2DERA 5JDIC 1NMBL 1JEQB 2JFXA 3WJLA 2C98A 2ZP1A 3EFDL 4E9WA 4H7IA 2B6HA 3QVVA 5LNK1 1CULC 4CVUA 5BYJA 3VKFA 2VCHA 1Z08A 4I50F 3PXBA 4WTOA 3IR5A 1ADWA 5KOJB 2GW5A 1GNSA 3K70B 4F3CA 4EQ3A 4XOIA 4QFMA 2Z65C 1ULAA 1KK1A 1IQWH 3CFDB 4D0CA 5JXEC 1UACL 4F5CA 1CIPA 4MUEA 3VDCA 2COEA 1XMPA 1F1BA 4PJEA 4PYJA 4Y4HC 1VG0B 5AVUA 3DDGA 3MRBA 3N1PC 4JFPA 2GQHA 1QIKA 3SE7A 5K8TA 1W1IA 1I9IL 4IIDA 2ATAA 2WE8A 5BVJB 1FZKA 3HM9A 1WBYB 2WK1A 2WTMA 2CFTA 2QWXA 5AM4A 2W8BA 2ZJBA 1WFIA 3DX3A 2J0QA 1S2OA 1HEYA 1LW6E 2QN8A 5JNLA 3IS0X 4MHSA 3ESRA 1XZHA 4DIUA 5KWJA 3HN8A 3RILA 2XCOA 1IM3D 1MI5B 3PIQA 1SUPA 3MRGB 1EXNA 3L4XA 4D7BA 4HVCA 4TYUA 2QEQA 4CUJA 1YKGA 1XEXB 3D2UA 2AT1A 3ABSB 1PSZA 1FJGB 5DGQA 4KGVA 4WXHA 1IM9A 4P07A 4D0BA 2R87A 5CINH 2YV1A 4WOJA 3QEAZ 4NM4L 3A1WA 2MQCA 1NYLA 3IUBA 3E35A 5HVWA 4D8XA 4TV3A 1GPMA 3B9BA 1P69B 4A1OA 1WMEA 1JVLA 1GILA 4L3CA 3U7WL 3Q5TA 3FRUA 5ISMA 2XZLA 1NL0L 2FWJA 2F1EA 3UTTB 1A4KA 3N59A 4BN5A 3UW3A 4N82A 3JAKB 3BTSA 2X0DA 1NNLA 1QAQA 1IFGA 2IOFA 1N2OA 3U4AA 4G6AC 2Z9BA 2I80A 3MQFA 2XVYA 3YASA 3D3VB 1A6AB 4J7AA 1NLBL 5DDHB 1Z13A 2OOKA 2AHIA 1F2UB 4D3ZA 2ZIEA 2O14A 3LJKA 1YBVA 4EF6A 4IRSA 4PJHF 1NBMA 4BO3A 2O8EA 2CLVB 4ARZA 2F53D 1O97C 1UB5A 2JF1A 1TQ2A 3PHOB 1COWD 2PY6A 1RQLA 2YEZA 2O7QA 3SLRA 5KTOA 3KH4A 4L1HA 4EGSA 5GAJA 5IZCC 2FBOJ 3PJSA 3FHCB 3KVPA 4MJ7A 4JFFD 4RESA 3EHBD 1CXZA 4WFIA 4UF7C 4IKNA 2RGRA 4KACA 1SXBA 4KMLB 1P8JA 4C78A 4RA3A 1EGJH 1IQWL 2BMKB 3FUCA 3NHBA 5I15H 3WK7A 2E9BA 1GQOA 5ESXA 3AWIA 2WZCA 3FNKA 1ZMXA 2A5DA 1KLFB 3F05A 1U4FA 3FVTA 4FGMA 4OCSH 5HE8A 4ZUWA 1OKKD 4EPWA 5IMOB 3LUDA 3HJNA 3CZSA 3C2SA 4FMDF 5ETUB 1G7IA 4EBQL 1T21A 4WLUA 3EG9B 1WTCA 1PBYA 1U0FA 4BUCA 3L3DA 3JQGB 3LPMA 4C14A 3T5AA 4K55A 4C55A 2R7EB 3BUPA 2FIRT 3EDMA 2VLJB 3QCVL 1XCPA 5ALUA 3UJCA 1F2XK 3T6KA 4M8RA 2SODB 2NQ3A 3R1GH 2BP7A 1R64A 3ML9A 3NIGE 5HHXL 1E50A 1Y9EA 3RFZA 1M67A 3RW9A 4DO6A 2XBMA 1Q92A 3G7NA 4HFNA 4MQ7B 4XN5A 4PJCF 4JPVL 1RQ2A 3V4VA 2Q1EA 4A2GA 5C46F 3BJMA 2R23B 1YCSA 2QAGB 5AJVB 2VPIA 1S89A 3JQFC 2WT9A 3DL0A 4IS6A 5JXHA 4H2DA 3VH1A 3BFJA 3FT0A 4MW9A 2WNHA 4AYDC 2NO4A 4N40A 5A7EA 3OZEA 4XB3A 1IJ9A 2IADA 1WP4A 4NO2A 4AV0A 4OQZA 5BW5A 1JA0A 4FQ7A 4MAYB 1RD6A 1GPOL 1EEZA 1D4OA 2O72A 2PKQO 3ZNQA 3PHQB 3OE7D 3NHPA 2I91A 5E9JA 3AM8A 3QIWC 1QQ5A 4O2BF 1W59A 3FUDA 1HDMB 1NN3A 3NP7A 3D8MA 2JW5A 1N6VA 1E2ZA 5JQHC 3US0A 1IIRA 5KVDE 2JFFA 1T1YA 4B0MM 4QPJC 3F7KA 4ZZ0A 4UAHA 2GYWA 1R0SA 1VPDA 2EO7A 3IDXH 2I3DA 3K1AB 1UWVA 5IFHL 3FCCA 2NT0A 3KJZA 1TVEA 3MLRL 2AYZA 2P6PA 4FFYL 1GFWA 4BQNA 5FLYA 2CXTA 4FTVE 3RWFA 1RDFA 4J2TA 5E4AA 2XH8A 4Z76B 1JQAA 2Q1TA 2Q62A 4TLEA 1AKYA 3F98A 4EMUA 3MVSA 4O4JB 2ZIAA 4XR9A 4CJ0A 3QXCA 1AGYA 1T1WA 2AXGA 4DPRA 4R69A 1QYGL 5DNAA 3F1LA 5DCYA 4L4TB 3VFOB 3RWMB 5D84A 1O3YA 2YKLH 2QA5A 3UP6A 1ULBA 3VFNA 4KH9A 1JVKA 3L4VA 2NW2B 3DXFA 3HEAA 4L5JA 4LUCA 5U4XA 1H0SA 1S7VA 1BXRB 2JHPA 4UDOA 4V38A 3OZ7A 5DJ0B 1TZOA 3LPFA 3ESOA 3D3VD 5EU7C 2FGZA 1W0WB 4A2MA 4P7GA 2WIDA 3HNRA 3E3NA 2ROXA 3HNOA 5HDOA 3PT9A 1QLWA 5EE3A 1RIHL 5JHDD 1IFRA 1PEAA 2Z2JA 3T0XA 2ZR0A 3FSEA 4XPHL 5F1OA 4O4JF 4JBHA 3F67A 5JLAA 2VDVE 5HGAB 4QBHA 1P39A 1ENZA 4HRYA 5C7IO 2GZMA 4DV4B 2FYTA 3BQ9A 1B0IA 5G5DB 5KVVA 2WUGA 1J7VR 2J6WA 4WJZA 3VHRA 4Y2RA 1KH3A 1MT0A 5LXTB 2NXCA 4WHTA 3A14A 4OFYA 1AKPA 1GZSA 3BP6B 3EIFA 1ED3A 4FC3E 1QSEB 3H0KA 4IXNA 4Q4HB 3LBFA 5KVEL 1D5WA 4D5EA 1RPZA 4G8JA 3ARDB 3U4GA 4K3UA 4TNWF 4JD5A 3MD0A 1XDUA 3GLIE 4R4FH 4DGYH 4K9EL 2QMHA 4I48A 4B79A 5BV7A 2XTSA 2WSBA 5AZEL 4O2BB 4LC1A 2PPEA 2Q6KA 3PG5A 2I62A 1JHAA 4LMQI 3L4EA 5FO9B 1YQ2A 1ZHNA 4ZI8A 1L9KA 3EGOA 1HOCA 4JI1B 2NSQA 3KXIA 2XVKA 2Q1WA 4B1FA 5D2LF 4E13A 1FF9A 3EZGA 3HNTH 2Z7UA 3ZOZA 4PTYA 1ZRSA 2FWPA 5AKJA 5KNBD 4BOYA 4Y5VC 3I02B 1W72L 4NFHA 3S2FA 1RKXA 1K6XA 4E08A 2X10A 1S2EA 4Y5XC 4H0GA 2G7MC 3R3WA 2PSHA 3W8FA 4Z7UA 3L7OA 5HKKD 4KHXL 1Q9OA 3UC2A 3N3EA 3LY7A 4NYMR 4UAOC 3ULUE 1PBNA 1ESNA 4YFLI 3K9HA 2PX8A 5CD9A 1KJ2H 1ZANH 2XKNA 3FOMB 4FJYA 4N9GB 2QPAA 5CEEA 3R3SA 2IOOA 1NASA 2A38A 2OMYB 3MBWA 2W8ZA 1E7YA 3WFHA 2O8DB 3ZWYA 3AHHA 2DYSB 2VDJA 1ZD9A 3EEIA 3MXOA 3AXHA 1ZMOA 3MJVA 2PLNA 1VBKA 2J44A 1H6BA 1WNFA 4DMFA 1BQ3A 2CGRH 1PJ9A 2X1HA 3FMPB 4M03A 3V4VL 2WQUA 1CFBA 1A0OA 4U3JA 1Z37A 3QVSA 2XQIA 3QEOA 1UJ5A 2EQBA 1HKHA 2P7HA 1F41A 4JJGA 3BIAX 1UBEA 4QYXA 1WPXA 3E5HA 2Q6WB 3O8CA 4ZFGH 2YWHA 5ESAA 2OXCA 4RWYL 4XI9A 3PU7A 1GYVA 1P81A 5HIIA 4OATA 2ZYIA 4EVQA 4G6JL 3T2NH 4GL2A 1SBSH 5KG9B 5KSZA 5CJQH 2BZCA 3JVFC 1BFVH 5FF9A 3H1AA 4HAVA 3W5UA 2IUFA 1RQRA 5EUBA 4WUUE 4K6GA 1KB5B 1T0NA 1YL7A 4QQKA 3STUA 3H11A 1J0JA 1FLRH 3BZ4A 1MNUL 4P4KA 4BO8A 1MCCA 3G2KA 2D5IA 1KTDA 4AQ1A 2YRBA 2PYFA 3IS1X 5C0AD 4LAFA 1F4AA 5JAUA 2FW8A 4LISA 2QUHA 1NNUA 3DI3B 2YW2A 5HFNA 5CJBA 4FFVD 1IV8A 3KDPB 3RIAK 3G2NA 1Z7YA 4JVUA 2Q7YB 4OOFA 5EIXA 3O0RH 3MCVA 4PANA 4BMCA 4OLXL 2FZ3A 3NJMA 3ES6B 2VERN 4DVBB 4HMQA 4ZZIA 4ZCMA 3AJ9A 5HQ3B 1JHZA 4IJWA 1U8ZA 1YIDA 1QEWA 4M2LA 2W80C 4IBTA 5D9SA 2ECKA 2L17A 2BEVA 4CF3A 3MUGA 2YUIA 4DK6A 3EXG2 2WZ5A 5C35A 1W9XA 3JSAA 4GRLB 2P62A 3FRIA 3VGEA 3ZDZE 5CITA 1EX0A 5JJBA 1TJGL 4A6DA 1OIXA 4U1SB 2P5PA 4K3JH 5E2UH 1RI3A 4NCC1 5AKHA 3SDCC 1Y6FA 5EZIH 1MJGM 1Q3KA 3ECUA 5H4HA 1EFKA 1TT7A 2D9CA 2XT1B 4EHKA 1V3UA 3WFBH 1IDOA 1E5AA 2B8EA 2I22A 1WAAF 4WTWA 3L7JA 1JLSA 4ZCQA 3NR2A 4E1AA 1N9PA 4S1RL 4F33B 1NVKA 3WL3A 3SN6A 4PLPA 3Q3CA 3NTCL 4FHBD 2PT7A 1TMQA 4HBGA 1TR7A 2SEBB 1E7UA 3HJAA 3H2IA 5T64A 5JORB 2AMYA 5AKKA 5IEJA 2A5JA 1JRHI 5CD5D 2IFTA 3PWZA 2HHHB 5D1XD 4LSSL 4WT7A 1JHTA 1KBKA 5A3RA 3PXCX 2BZDA 3SE4C 4FWBA 5EYPB 4UIKL 5TMEA 1OPOA 3LGXA 2AZAA 4PLHA 2YO3A 4MVJP 5H9VA 3OX8B 3BGVA 4YT2A 3D18B 2CK3A 2IPUG 1X5MA 4TLAA 2IBGA 1C7IA 1CW2B 3OJLA 1DBRA 1Z3GH 2V7XA 3WYGA 1OT1A 3GUTB 5DHFA 2QE6A 1BQHB 3IQZA 2FHSA 4WCFB 1JE6A 2RCYA 2KDGA 3TN0C 2F67A 4HZUA 1QQBA 5CFAA 1AURA 3FUFA 1SJMA 1BRTA 2V96A 3KPOB 1XPOA 2G9KA 1TTBA 1UL1X 1NGPH 5BPFA 3L7DA 1E4WH 3V1LA 4IS3A 3T0FA 3DBHA 4WEEA 4JG1L 3GXOA 3PAYA 2A86A 1DIRA 1OE1A 1WG8A 2ZBVA 4EKEA 3EY4A 5FPQA 2R11A 4YL4A 3L7FA 3UAXA 3ISVA 2J20A 2QYOA 4GNKB 2X4RA 4WSKA 1X9RA 3D4BA 1V3QE 5BZXA 2OMXA 3L6FB 1DUYB 1T22A 5FGBA 3DNFA 1RC8A 5ADWA 2YHGA 4B3XA 3S96A 3LPWA 3B3AA 1BG9A 2E4XA 4V0QA 4D9NA 1DYZA 5JHLA 5KREA 4N6RB 4P3WA 4DUYB 2X14A 1CQJB 1GSHA 4FQPA 5BW7C 3L7KA 1I2CA 4QXRA 3PAZA 4PJDA 5JSZA 4YE4H 1HHJB 2GBGA 2WABA 1HSAB 2AEIT 1QUNA 1Y3AA 4JI2B 3K5HA 4Y6SA 2VDLH 1ZK2A 1RUMH 1CL7I 1R0LA 4F3FB 2C4NA 2OV6A 1SIOA 3KPQA 3IMCA 1UP6A 4Z4GA 1NCGA 2WHPB 1P73A 2VF2A 4HOWA 3ZWKA 3PDWA 4FONA 4Z49A 3EFBA 2GHQA 2XT0A 1M5TA 3FDFA 2G2PA 1JWSA 5JY6A 1FFPA 1BLNA 4NKQB 3L17A 3OA2A 4G0XA 4AW4A 2HJVA 1CUHA 2KBGA 3NZ8A 3CSDA 1ZUNB 4KK9C 2ZCZA 4OVUA 3PRZA 4XPBH 1WHTA 2W0MA 1TKWA 4C3OB 2OC4A 2D0PB 2RBEA 4OAWB 3B13B 1XRMA 4FL4B 1A6VH 2B4RO 1B6UA 2QGNA 4XMZA 3GJZA 5E7QA 1I1HA 4MQ4A 4Z53A 4KHPB 4P3YA 4DM7A 3HZMB 2JFGA 1CR2A 1FX0B 1MCWM 3UG5A 1L7NA 5EBWA 2E0IA 5JALA 4RK1A 2FX3A 2I55A 4Q15A 1Q50A 1JZ5A 5I1DA 1FDIA 4PLCA 4P8QA 1YEHL 4PGEA 3FUEA 2FP4B 1NTOA 4JYCA 3TDMA 1K3FA 4N86A 5J1SC 4H6XA 5HPOA 1VZ2A 4U2KA 3U19A 4ZUVB 2PUEA 5TF0A 1BJ1J 1XSOA 2Y1ZA 3C7TA 3QU7A 2P90A 4RLQA 4NBRA 4OSOA 4WEUD 3GH1A 3KPRA 4Q9RL 2JAPA 1E79D 4J76A 3GRCA 2ANCA 4WA8A 3ZE2B 4DKFL 3AWEA 4PTTB 5DBHX 4Z4EA 4PIMA 1I82A 2VP6A 1UEYA 1U2RA 2UY6A 2FDRA 4OLYL 4OSEA 5T57A 2G9UA 4B5KA 5K1ZA 3TZVC 5TGTA 4D9QE 2CDRA 4OLVH 3FBGA 2MMGA 3TH3T 1RC1A 2QHRL 5CX1A 4YMIA 2Y1KA 2PQ2A 4NV1A 3W9YA 2MCAA 5FOSA 4MARA 4K5MA 1DIAA 1KYDA 3V97A 4C29A 2IQAA 2GZ3A 3NIDE 3WNCA 4ELMA 3RI3A 2HQ1A 5IT5A 3FI0A 4BO2A 4ALLA 1OXXK 1RJYA 4LXQA 4AIZB 4DLWA 5I5RA 5JDJA 1F6WA 2LW7A 3KQWA 1SFHA 2JFYA 2A5LA 2AAAA 2DQTL 1XU4A 1QO7A 3V80A 1YONA 2ERJC 3AZQA 1N3BA 2WAAA 1YVLA 4PYLA 2Y1DA 3MJ8B 4MVCA 1C9KA 2QTEA 3U7EB 1DBKL 4BSWB 2IBTA 3VD1A 4A2PA 4Y5XB 3J2PA 2JJMA 2Z57A 3UC5A 1S7SB 1CUJA 1Y48E 3PLRA 3BILA 3CQPA 1UM8A 5DU2A 3UV7A 4XN7A 4N5DA 1AKWA 4KAFA 2PYED 1RCFA 4M36A 3RX9A 4ED9A 1J0HA 3TF7C 1DXQA 2VRKA 2D54A 1NC1A 1A2QA 2G0TA 5LZ8A 4FD3A 1Y89A 5CXSA 2KLTA 2ZAOA 3E8UL 4QNPF 1J39A 1V1MA 4J8QA 3GLHE 3Q40A 2XNHA 4KKNA 1R5IB 3SGDI 3E2PA 3QFRA 3ZJ4A 1LMIA 1JZ8A 1A9BB 1XVUA 1JWBB 2O4UX 2UZ0A 1NCCH 4EVNA 4AYMC 3L41A 1XTKA 1RJCA 4X5LA 4KQFA 3MBEB 3PE9A 1LJ8A 4JH0A 5TDNB 3VSAA 2A9CA 1VFNA 3Q7QA 4N65A 1UADC 5CLWA 1L1FA 1KFJB 5JJ5A 1EAPB 1JQ3A 2HPZA 3KSRA 4ZV4A 1BPLB 3B2DC 4U1HA 4N6OA 1Q20A 2ADYA 3BMXA 5A4IS 1SU7A 3NJRA 1KOLA 3CBJB 2PLWA 3L8ZA 1TE2A 2K87A 2CGEA 5JR1H 2YHAA 5LBSL 2R1TA 5E00B 1TSHA 2PIAA 5IJ0B 2F43A 2BGGA 1XUOA 4INAA 1JZDC 4YDHB 4TNWK 2YQZA 4DLXA 4ZJZA 3K72A 2CV1A 3ED1A 1P4IH 5ED4A 2HF2A 3LXRA 5J47A 3OEYA 4R2KA 1JWUA 4JKOA 5GRYA 2EYSA 3I0MA 1JAHA 1SHTX 4R7XA 5DQDH 3B5TA 2FTKE 13PKA 3ZZNA 1ZT4A 1J1PH 1NGYA 1YS7A 4M83A 3SDBA 4XO3A 2ZBFA 2H5EA 4XE0A 2G6BA 1JR2A 1UBKS 3ONWA 5C09E 2IYVA 3I64A 5AYUL 3KL4A 3MUOA 2JJ1A 5EUOB 5AKVA 2XJ9A 2WG2A 4BQBA 3ILXA 3K9QO 2YEVB 1SZPA 4NQRA 5TQ0B 5DVNA 5E5LA 2QG9A 4GGOA 4QPCA 3HA2A 1VE5A 2ZSVA 3MSCA 3OY2A 1WP9A 4LKCB 4FLQA 2BBWA 3DWTA 4NOJA 3FONB 4HG4K 5ISZE 2OB1A 4WI3A 5GSVB 4RMUA 5IROA 3FKSD 4ZTBA 4XUDA 4Y1TA 1FSPA 3PC2A 3JYPA 2C07A 3R8CA 4P58A 1J1OL 5KNDH 4JT8A 3LN5B 3VFTA 1PN3A 1O8CA 4MQEA 1FP4B 5EOTB 4JHAH 3ANMA 3FYDA 2NY2B 5EU3A 3LPNA 3JQOB 2BOBB 3QNZB 2FR8A 2PX2A 5HS6A 1HH6A 1E8MA 2YWCA 4IRJA 3WKBA 1QHHA 5FEUA 4YO7A 3ZKAA 2RCSH 5LZ2A 2OAGA 2DY2A 5I5JA 1RAHA 4LL4A 4DDTA 4U1GC 3C6SB 2C2KA 4JUAA 2P80D 2I4RA 2QN7A 1HDCA 1QSFD 3UTSA 2OMEA 2DQEH 2YAMA 1QTPA 2WVUA 3LGAA 2QXYA 1G4AE 2R1VA 4BB5A 1E62A 1R7RA 3SBQA 3OKDA 3PL6A 5HJ5A 1KENL 3BRDA 1A8PA 5K0LA 1XZFA 1JR3A 3EXEA 4WJG3 4IIJF 5IVHA 3GSRB 4NMMA 5FUXA 5D5MF 2MSNA 3K81A 4CL7A 1SVCP 1U8MA 5L2KA 1XVLA 4GI2A 4B9KC 3V0IA 2VW4A 3U4QA 4XSGA 4WGWB 2PUTA 4L5IA 2QUKA 4YXHH 3FFCB 1IILE 1W48A 5CIWA 1KTLA 5HI5C 5IWLC 2AWOA 4HQNA 4O4IA 1EJOL 3PIDA 1DLHB 1OF2A 4A8PA 3NVKI 2YMQA 1Z07A 3QFDA 5IW6B 1LFDB 3I9AA 1T8YA 3ZVLA 2RFLA 3WIDA 4ELMF 3TLCA 4QATA 3P0VL 2QHXA 4UEWA 3BD9A 1NAIA 3Q98A 3UV6A 3ZNNA 4RE6A 5DLDA 1QGYA 3WKMH 4Y2TA 4ESKA 4U6SA 1BECA 1ASPA 4CM1A 3O2DH 3VUFA 1Y1DA 1WLHA 4XP4H 1KGWA 4LU5H 1Z06A 4CDNA 4BLQA 3A1TA 2RAMA 4RJ2A 1I8MB 2JD0A 2VCEA 3MBOA 2Y36L 3IHLA 5THKA 5KUMA 4WD3A 2UWEF 4DSZA 4GOLD 4N0QA 3ZK0A 4ZVPA 1W72B 3E0GA 1HRKA 1T0JB 3I61A 4RJJA 4XBGB 2OPBA 2JC3A 3V0HA 1VAHA 1IBSA 5HYJD 3RO7A 5JXGA 3E22B 3TP4A 1JPSL 3DHJA 2GO1A 2ZTHA 1F14A 4LGMA 2PUDA 2E9JA 3Q8AA 2GN9A 3WY9A 1QH1B 1DKMA 1HCFX 1M05B 3RWCB 1AHWC 3D3WA 4CQLA 2HWZH 5FA3B 3ICOA 3BVDB 3MRKA 4HPYL 2JFHA 4E41D 3P40A 3MOBH 4XCEB 3G7UA 3ME5A 5KZMB 2DF8A 4ZX6A 5IKOA 1TVHB 4TKWA 1GY2A 4GLJA 4E4YA 1OX4A 3AP2A 3NWJA 3V32A 3W2FA 3ZNOA 4CM5A 3U2JA 4ZOLF 1U4OA 4JGGA 1M34B 1XAHA 1BEYH 2XXGA 1XGPA 5SWQB 2C0PA 4CMEC 4IZ6A 1M2JA 4YX2H 3PHAA 3C98A 4ZAWA 1H3GA 3EQZA 7AT1A 1A5FL 4KFZC 4RY8A 2J59A 3H5AA 1EFRD 5BWNA 1MG0A 4JC8A 3MB8A 3SAJA 3ARFB 4JOBA 4URHA 3T15A 3NXKA 4JDEA 5EPMA 4TPRH 4AM0B 2ZSIA 1TYAE 4BZ2H 4GDMA 1NM4A 1X6LA 2WJPA 3WNMA 4YHIA 2ZUVA 1L4LA 4EHDA 5CG1A 5E4TA 2IPTL 1S9HA 4UTNA 3RK4A 4JZJB 4R7NB 2Y06L 2QZPA 2JGRA 1CJBA 3W2DH 4LCWB 3CX4A 4YAQA 1PZXA 1XCOA 3HJGA 4DP0X 2HJSA 2JKLA 5I1AB 1W5TA 1UDWA 1PX3A 2R44A 1XXFC 2ZYUX 4HJSA 2OP1A 4Z2YA 1M2GA 3WLIA 5DHXB 4PRKA 3ARGC 4POOA 3IP7A 4ZDWA 3PIIA 5JMWA 2UKDA 4E21A 4JS0A 3EC2A 3HA0A 2V17H 4L5FL 2HRPL 2C5DC 1H2EA 2XU9A 3WUZA 3T77A 5E8DL 3QQ3B 3QKTA 1C41A 3FT4B 3GLVA 1CYWA 4FDVA 3DMGA 1QR1A 2G1JA 2FPMA 5EEVA 3R5XA 1A3LL 3PWNA 1AHNA 1C5CH 3IUYA 2C54A 5T5FH 2P79A 5JZ7C 3GI8L 2KLBA 4X6EA 4PGBA 1ZOXA 5FUCC 3O45B 4OVKA 3VFGH 1Y8QA 4MEBA 1X9HA 4E0BA 4DCGA 4C4OA 3D31A 4X5PA 2PKYX 4PG2C 1A3ZA 2TSYB 1HMYA 1LBSA 4TM8A 1RRKA 2IHZA 2NVUA 2NXYD 1QFPA 3KJFA 5IHHA 1KCRL 1XKXA 4KJYA 3VI3B 1JUFA 3UXMA 4R9VA 5LGYA 4MUYA 2XDHA 2XZQH 4QMEA 5F51A 2P5ED 4RGOH 3I6LE 4KQEA 3I74A 1EK1A 3VQTA 3KKPA 5FKJA 5A40E 4UUBA 1J9RA 4MAYD 4XODA 2EXTA 3WLTA 2QTFA 3ZCVA 5FBQB 2A9AA 3FFWA 1JGVL 2NRDA 3RKDD 2UZYB 4W9EC 3A9RA 3FZEA 4H1VA 5JPDA 1L9OA 2VOTA 4ZZKA 5KSBE 2R0LL 4LCIH 2IHKA 2RB5A 4OHUA 4S1DC 3RY6A 2PZBA 4XNMA 2WAOA 5LAXB 4L4VD 3M8OL 1N8OE 4JREC 1THCA 3OZLA 1Z33A 3A1SA 4BZ2L 2E87A 4CKBB 3SQOL 1K27A 3C7CB 1G5HA 3K7UA 5CP3H 4ERSL 2HVKB 3M5WA 1KPVA 2QTWB 3ED5A 3FWYA 1TU3A 3T0EC 4LDJA 3TKYA 4DL9A 4FCCA 1U2EA 4G7YL 4HETA 4E9TA 4LKXB 5MHSE 4WLEA 2PR4H 4PG6A 1Y37A 2D2XA 1CRZA 1XFDA 3BQMB 4Z3JA 4XXHA 1PS9A 5EOCL 3JATA 4OK3A 3QUBA 2A0KA 2C1PB 2XWTA 3FSVA 1T7WA 2G8LA 4LEOA 3ARFC 3ESXA 5D96B 2BEUA 2Z6VA 3TSYA 2QTGA 2OSVA 2VT2A 3MLUL 3AYZB 3W5HA 1I6LA 3EPLA 3O91A 1P7YA 1ODUA 2IPNA 4ZDJA 4MRBA 3BT0A 1PQWA 3VFUB 3D5EA 3FWHA 2CXPA 5E2AA 1YFJA 3GS7A 2VABA 5CGMA 2FMXA 4RWZA 3SDAD 2WXMA 2J8UB 4HIIA 1IOLA 1LP9F 4PNEA 4FWTA 4NBLA 4BYMA 5BZZA 4Y16B 4ZAGA 2R84A 1MWOA 5JPNB 2VN8A 1RIVL 4GDFA 4ZVSA 2X9QA 3AK4A 5KMGB 2GBIA 5I9TA 3R77A 2V3WA 5H8DA 2EACA 3UXEA 3GEIA 3NEOA 2PX6A 4DNXA 3ZJTA 4XUGB 2VC2L 4ZNEA 4M1DH 1SC3A 2GPTA 3GJSA 4R16A 3TEFA 3QZUA 5L2JB 1Y33E 3ICEA 4XPHH 4KAAA 1YN6B 4XCNA 3RVJA 4YDZA 3NTLA 4HEMA 1B14A 2R2EA 4KO4S 1KVUA 1ACYH 1DC7A 2FH8A 4G72B 3SKMB 1OTXA 5GGXA 4TYNA 2EYUA 2RBLA 5ITFB 2QORA 1L1QA 3W0WA 4ONHA 1GZHC 2BSSB 3TWOA 2JIRA 3WDLA 5KZCD 4XASA 1W4ZA 1WK0A 5HHQB 4NYJQ 2YGPA 3CSBA 4HP5A 3P20A 4RORA 1UM5L 5G41A 2RHGB 3STHA 4NBNA 1JI2A 1SYVB 2FLKA 4P4RB 4U6XB 1Z5UA 3O6LH 2LV8A 1M9WA 1YK0A 4IGBB 3ZO0A 3LBYA 4U7JA 3VU9B 3IDNA 1AF7A 4AC9A 2BM0A 4ANUA 4DA6A 3VR3D 3ZIAD 1P9RA 4QE3A 4PJBA 1RK7A 4CVXB 4QG7A 1QP0A 4IQ4A 4UINH 4HDOB 4HJGA 2AGVA 7GPBA 3SP1A 4LC0A 2GK3A 1QWHA 1TMKA 4AUNA 4J0JA 3RC1A 5AVTB 2FQQA 4RNRB 1NMSA 4O2AF 4U1LB 4TMXA 1C12B 1RPUA 1T1EA 2C3PA 2IW3A 3U81A 1E9AA 1XGQB 5C3LD 3C8ZA 2M1ZA 3V6LA 4X4ZA 3ONFA 4F7KA 3HU3A 4XQ9A 4RFSA 1DG1G 2DBLL 2WNIA 1CY2A 4OB6A 1D2RA 5DC0A 4GPD1 4GXUN 3KYKH 4D26A 5DTEA 3GLFB 3EO9H 1MJGA 1OAXL 2DWXA 3UWKA 4K9KA 1BYIA 4PZLA 3UMCA 2RFXB 4MB2A 1A8JH 4ENZA 2BS8A 1NM9A 5IEKA 4TMTA 4G5OA 3EULA 3HVUA 1A1MA 3QFGA 1IDN1 4OTXH 1R50A 3L4TA 4QFDA 2YY7A 4OZIA 1QPGA 1AKJD 1N19A 5C3IA 3PFGA 2IHBA 4J0IA 4RZ3A 4BN4A 4LLYB 4BU1A 1F0PA 2X76A 3L4YA 2QVYX 1H0HA 4QIRA 4XNQB 3ZZQA 4DKEH 3DXXA 5CSBA 1F4YH 1NATA 3D59A 4XCYA 4B9CA 3KPNA 3SF0A 2DDQH 4AWBA 4ARUA 5IDXA 5L7XH 2DQFA 5L6MB 5KSYA 1INLA 1OLZA 2EUZA 2W65A 1UKCA 3IVGA 4FKEA 1I3RA 2P9GA 5CMAB 4KBYA 4Y2PA 1EVEA 4BZWA 3MOSA 1ZSHA 3NHYA 3QQDB 4EYSA 5MEOB 1Z63A 4CCWA 1U7TA 2IUUA 3JZMA 3F6SA 4QO8A 3BPOB 4W1QA 1Z5PA 5FUZL 1M4KA 3CFNA 4EABA 1EFVB 3QTTA 3CVOA 1CDIA 1JRHH 2BI4A 4DG9A 4BNLA 3BRGC 2G25A 2PSEA 3G8BA 2APVA 3WTXA 2KB0A 4DGIH 1IJFA 1UAGA 3UO8B 1U41A 4GD3Q 2VP0A 4OGQC 2FZWA 1BBDL 3ITDA 1HL9A 2YQGA 2AJUH 3D9AL 3JW8A 2CCVA 3O1LA 3C5ZA 3BT2L 1UYWH 3OQPA 1FQWA 4TL6A 1XCQA 4O4YH 5DI9A 4E36A 2X2UA 4PLVA 1MEOA 2UZIR 1F4VA 2IH2A 3IJSB 3UAJC 1YEJL 3AUSA 3IU4H 4BH7B 3JASB 5JNYB 5JA9A 1H6AA 2Z5GA 2KI6A 4E9QA 1RWVA 3Q0EA 3TH5A 2OLDA 4JN6B 4H88L 1I4LD 1A6ZA 3G6AA 4AV4A 1QVRA 1IH8A 3AVXA 4EZEA 4EDWL 1C4WA 4FS8A 4F92B 3PL6C 1MLDA 1C7FA 1K0UA 5LOVB 4Z7NF 3GVHA 4OLWL 1KBPA 5B3LA 3PXHA 1DMSA 4RPKA 4O2BA 4I9XA 3ETSA 4LXHA 3LFTA 1KPHA 4Z9XA 2BJMH 4TULL 3GSWA 1MX5A 1SEVA 2BMJA 2IG2H 3GA5A 3D2UB 2V2XA 3V79C 4E5NA 3MLXL 4XIFA 1YHZA 2VMDA 3IFNH 2JVJA 4X7TB 1QE3A 3I6LD 4EZKA 2C84A 3P30H 1ZVNA 1U3HD 1HKFA 5FF6B 3AXLB 2AQNA 2OHFA 1HU8A 2R7MA 3IAM6 1ZV5A 1QXSA 1DAKA 4L73A 1JOIA 4ELME 1YJAA 2BUCA 4F12A 5JJIA 1L0QA 2QRHA 2NUAB 4NWUH 4AUJA 3GU3A 5C8VA 1E5DA 2ZKYA 3BQUB 1QACA 4PJDE 4JJFA 4L1LA 4DCVA 1XD9A 3ZD6A 2EDFA 3O0LA 4AJYV 2CCLA 4MS8C 3KLNA 3LMJL 3OOWA 4CTOA 1ORHA 2KDYA 2VYCA 5TEWA 5CTAA 5BVJA 1EZSA 3JV4B 4L9SA 5I9IA 2WGXA 2BDEA 2EGHA 4PB0L 1DL5A 4IFEA 1E8NA 5FM8A 4FSDA 4I08A 4OT1L 3JTBA 4BFZA 3S4SG 4HWKA 4UZEA 1IHUA 5C6TL 4WHMA 3DHUA 3AI2A 1TZ8A 1ZK4A 4F8JA 1WBXA 3FQNB 2HNBA 5DS1A 4E2ZA 4CMHA 4IOLA 3RGWS 1UANA 1DFBH 3GTTA 3H9SA 3L4BC 1FNLA 4YJHB 1NJ6A 1EJBA 3L6UA 3KYCB 4HXAL 1QD0A 5F3RA 1NFDA 4PCUA 4ZVQA 4AENB 4PWJA 3KV1A 3H0CA 2A0XA 4JJKA 2EEDA 3OX4A 1XF3A 1A8IA 5AYTA 1WDMA 4IK7A 1LQTA 3OTIA 3BP4B 1Z0KA 1QCCA 4M5ZH 2AUTA 4BFJA 3EXHB 2H48A 5CHEA 5LDGA 4ND5A 4FCAA 1MIEH 5C8ZA 3HUUA 2EJWA 3HHSB 5IAEA 4I2XE 4LBWA 2KQUA 4RIRA 4O2RA 3UPRA 3MMNA 2FWRA 1I7RA 4CBPA 4BBZA 4WWOA 1U5BA 3JYBA 1TA4A 4JN2B 1L7EA 4M1CC 3QVJA 1RLMA 3BP7B 1KTJA 5KAQG 1UZ6E 3WNVA 2QGDA 4A39A 2VDLL 3AONB 1PQYA 4DJEC 4J4PA 3DOSB 5E9DB 4HB3A 1E6OL 3Q8XB 4ELKB 4XGNA 3LKQA 3C3YA 4B0PA 4MJ5A 4N2CA 2FZ3B 3RPEA 2B1OA 3F2IA 5G1NA 2DWCA 4XA8A 4G0PA 1QSEE 4OGLA 1AGDA 5JQ6H 1BAFH 1DE0A 2IHJA 2KLSA 3PGJA 1F9AA 3E9EA 2XXCB 1D03A 4Z7VE 1QU3A 5DYWA 1WA1X 3AQIA 1ITCA 2XE7A 1ZM4A 3OG4B 4MV7A 3R3YA 2CZNA 1A2YA 5E2VH 3L8YA 5AIAA 4IDHA 5DHEA 3EVTA 5IBCA 3U1SL 2CB0A 3VD7A 1UH3A 3ABQB 4UUOA 3SFZA 3MI6A 4AY4A 2CRZA 2OCIA 5E6ID 4NI5A 3BH0A 4ZX4A 1KVSA 4ALMA 5CDTA 1FO0B 3ZCRA 3HAEG 4A92A 2N1MA 4O2FA 1NVBA 3CUEF 2E37A 1V7PC 3HAEB 3MNFA 2AC2A 2WXHA 4H13C 1HTWA 1FUYB 1ZKDA 2DLGA 1UA7A 4RHEA 5KQSA 1L7TH 4RVDA 1PU2A 4ZJUA 3PWLB 2X15A 1HTTA 3LNCA 2HPHA 3UFXA 2PSFA 4TQHA 3D7SA 4LLMB 1MJ7L 3OPUA 4PJEF 3JYNA 3AY7A 4JBLA 1FNEB 2VDNL 2ZJ1A 1G9NL 4B7UA 1TZBA 1RR6A 3DXAD 5HR5A 4OQ1A 2PMBA 3GBDA 2LT9A 3DBVO 5K20A 1BA3A 4YQXL 4LHYA 1H9AA 3MWKA 3E3LA 4ARIA 1T1IA 2WUWE 4V0ME 3LT2A 2H11A 3IU3B 1QA9A 4EGCB 1NCDL 3NSCA 3UJIL 1CETA 4HY3A 3H9QA 3EFEA 4YRTA 2IAMA 1FP7A 4DEPB 2UYHA 4MW1A 3D34A 4E15A 3WLBA 2PZJA 1CPUA 1MFMA 1P5UC 2XZAH 3FSGD 2BP8B 5E6RB 5ITBH 1QYCA 4M93B 5J89A 1XK7A 1ES0B 2DQTH 4PM4A 3WIBA 4WEOA 4MHHI 1JKJA 1T1GA 3WG9A 2HT3C 3CX2A 3DDFA 1QBLL 3KAJA 3BZUA 1PJ4A 2RAUA 3NJLA 1JEJA 1UINA 2B2CA 5IAGA 3I6GB 3LCVB 1ZNZA 2HHCA 2O52A 2PZ8A 4IV5A 1M2EA 4X1OA 3CCFA 3DVAB 5EWIL 1UEJA 3WHIA 4XCXA 3S2AA 5I1IL 3NPSC 1P1ZB 1U8EA 3N0TA 4HGZA 3WKAA 4Q1VA 3A9VA 3N2GA 3WLWC 4U1KB 5ERGB 5FH9A 1K6MA 4R0MA 3MBED 4UQ3B 2V5YA 3ZE2F 2ZP9A 1A7OH 2FECL 1YEGL 1T4DA 3OGCB 4MCHA 2F74A 1P9OA 4ENPA 1HEIA 3V5HA 1MX9A 1GNQA 1QHEA 3EZ2A 3OWOA 2XG4B 5LQSA 4XM0A 2I5YH 3ZVRA 3WK8A 1SUHA 3BUYB 2VXOA 3PX2A 4MXWL 3GH3A 3KXLA 3OICA 5GINE 4PJ6A 5EOCJ 3AC0A 3I2JA 1PSKL 4UU9B 3O75A 3B3GA 1E30A 4XC1L 4UQCA 4OM0H 4Z95L 2J72A 3CCBA 1JNHB 3UTTD 2I9PA 1IUPA 4J16A 3IAQA 1HHGB 4KZPA 4LAJH 4PGCB 3SLKA 1CCZA 2YRLA 3DROA 3FQTB 1ZIOA 5FOXA 1KELL 2VO8A 3FZYA 3CXHK 1T5WA 2DWEB 2IHNA 4MB6A 3MSXA 3I2GA 1AUQA 3N7AA 2HR1A 1MPAL 2NZYA 1N32B 4H7PA 3VNBA 1FL5B 5CEZH 5FV2A 3BXOA 4UMVA 3V5NA 2GK4A 2QX6A 2WYVA 3BF7A 4KKQA 3SGEH 2ECFA 4H1LG 4G6FB 2PYDA 2VRAA 1T2CA 3OL2B 3WXBA 3ADPA 5D87A 1J5IA 4CU5A 1UKBA 2JB6B 5KWYC 4DO4A 4LJAA 4RWYH 5T1MB 2NT1A 4X3OA 3R9KA 1J1PL 2VSQA 1KARA 3WC4A 1DN0B 1MRSA 1F4LA 2QSJA 4ACTA 3BUBA 3E3QE 2QRKA 4H1LA 1WBYA 3VXMD 1RACA 2X19A 4P54A 3ECBA 3V9PA 4OHCA 3QUZD 5AW9B 1A88A 1PTZA 5KSUA 3O3NB 1DOZA 2V1UA 3IVKA 3V8NA 2DQUH 2VDRB 2HXSA 4AGOA 5T1LB 2I4LA 1EDQA 1SJEB 2B4AA 3N2EA 3QDGD 1QOQB 2GXQA 1M5UA 2KS0A 1JH8A 3HBNA 4WESA 4RIFA 4GMHA 4HD5A 4GLBA 5LNEA 3U7HB 4EATA 3HMXL 1QATA 2AFRA 4S0TD 2WPNA 3WISA 5FOQA 4MW7A 4P33A 5JHHB 2XF8A 5CMLA 5EU6E 2DC1A 1S02A 2QTTA 4PC3A 1MFPA 1LP9B 4GSDL 4WDIA 2KJQA 2OCPA 3U80A 4DIBA 1HSOA 2VTVA 3SPCA 5C1MB 2YHIB 2E0PA 2WU4A 4O00A 3QXTA 3PRHA 3CFUA 3CVHA 3FPJA 3BRFA 2FUTA 3ZE0B 2HXAA 1QMPA 1ZLEA 1DN2A 2VJKA 3N2KA 1NUPA 3FTEA 4CW7A 4NESA 2O5VA 3RQIA 3DKKA 1IN6A 3LQYA 4FGUA 1A04A 3HDHA 5EBLB 1BZ9A 3U2SA 1BQUA 4JVMA 5K5EA 5HTSA 5K0GA 1JP5A 4D9FA 3FRJA 4KE7A 1FBTA 3WO4B 1D1QA 2H4JA 5DVKA 3O3DB 4MUXA 4ZOAA 2Q5IA 2IBMA 4CZ2A 2MCFA 2WI8A 2I33A 5I8WA 1MEXH 4MAZA 4E46A 4MXVE 1T2XA 4K3JL 3KR3H 4HDKA 3E3MA 2DOCA 3EFFB 1XF4A 4ZVTA 3OMLA 1GVIA 2YPLA 1EA5A 1EM8B 2ZR9A 1IC5L 1DJHA 3P9KA 3DKPA 3TVDA 3D39E 4V2UA 1AGCB 1AH2A 1W2HA 3WFBL 4G7QB 4UD2A 5DISB 4OSPA 5BZWA 5BMVB 2VPTA 3QFFA 4OI8A 3VZSA 3R3HA 4NPCA 2B59B 2Q3FA 3C8KB 4BVBA 2C9QA 2CXUA 1R0XA 2XNDD 4K6CA 4MQMA 1CFTA 5ACZA 5AK5A 4A0QA 2YRPA 2YZGA 1N59A 5E8EA 3ENZA 2AEQL 2DQGH 2H6PB 4LEXL 1UQSA 2RK4A 4I2XA 3AR6A 4MVJG 5B1IA 1J8KA 3UTZA 4K03A 4L3AA 4WK2B 4LHUB 2OHVA 1MW2A 1L3CA 1QH8B 1O9HA 4DGVL 1TZAA 2FX7L 4XWOA 2FQWA 1J5XA 4CG3A 3NEXA 3UGEA 3ZTTA 5HI3D 4YV0A 4P2RD 5F77A 1HZJA 4TSBL 2YTZA 4J3NA 3LWDA 7MDHA 3QZBA 3ZBUA 2ZYHA 4H40A 5AWNH 2IP4A 4GSUA 2EZ4A 4PCSA 3UQYS 4AMUA 1G7LA 5F78A 4TUYB 3IUPA 4B3GA 3TZVA 1P2TA 1GR1A 4LPVA 2OCFD 2ABWA 4PYNA 2FLWA 3T61A 1B0AA 3N2YA 5KVFE 3ZO9A 2HJGA 2WICA 5CM2Z 3L3JA 4KX8A 5G2OA 2CVQA 1SOQA 1EVQA 4HOYA 1BMDA 2AANA 1GKIA 3WNQA 3ZI0A 1T36B 5LQUA 3QNYB 1YT5A 3KXPA 1V0JA 4WASA 4L3CB 2IPOA 3PUWA 4OFDA 2DJUA 1ZC4A 2Q4EA 1XBRA 2IK8A 1C2TA 4B44A 1ZJWA 5E8PB 5E6UB 3L6CA 2MTPA 1FNCA 2FPPB 3L2NA 3NH7H 3FY4A 1OZHA 2W6JD 4P4SA 4I8DA 1I8LC 2JLQA 4HDRA 4PNZA 4CG0A 1Q5PA 1ZHKB 2NGRA 4OSUH 2LD4A 4GNRA 3NGBB 1RRCA 4ENRA 1XCGB 4C5BA 1XIWB 4XYGA 2XQYA 4AM0Q 2CALA 1CFVL 3E7WA 4R8MA 1AIFB 1GS8A 1ADQA 4PGJA 3ADDA 5I4KA 3KJEA 4L9LC 3R7WA 3IV6A 3M6FA 4FNLL 1SF5A 1J7KA 1J10A 4AUKA 2I69A 4JA0A 3SDXB 3QO0A 1DEDA 2Q49A 2FMIA 5I8CB 3HCAA 4LJ4A 3PQFA 4HN4B 1Q0XH 5EERA 2ZKHH 4PJFA 2CNLA 4FLSA 1OLUB 5D1XB 4OKNA 2GN2A 1NCHA 5A3ID 1M10A 4C7VA 3FHLA 5AM0A 3SC3A 2CFCA 2XGSA 2PT6A 5D86A 2A14A 2HFJA 2QX7A 4NNJA 5BMVF 4HNHA 3RJQB 1TX4B 2ZANA 4Y9EA 4C0LA 4TT8A 1LK3H 2K9UA 3PHCA 4K9QA 4GUDA 3I0NA 1A3RH 1VEPA 4GG6F 2GEDA 4UHKA 2JZOA 2ZJ0A 3MMEA 3VTTA 1CDOA 2AJVH 5HGBB 4AIRA 2FATH 1GHTA 4UTVA 2ERCA 3QMMA 4FYRA 1ONQA 2LCQA 2IWGA 5B4MD 4LIQH 1HOXA 1XN1A 3UYKA 3FO2A 5EQTA 4XCFL 1EVTC 2F54E 4F93B 5EU6D 3EOBA 5I3CA 3HBZA 5E99H 1IK6A 1K9SA 1Z66A 2IGLA 1FDRA 3UHJA 1A4IA 2WP3O 4PHHA 4FA7B 3OOSA 3ZI4A 4OHZA 3IDGA 1XSKA 2A3TA 1RAAA 2BMWA 5T4BA 3RTQA 1C9SA 1F8TL 3CO0S 1QO9A 4WO4B 2ZCKL 1C5BH 4DKDC 4NRDA 3PNOA 1QLFA 2VIRA 2OBFA 3FU7B 2ZOLA 1N7MH 2YRXA 2G2NA 5D1ZA 3VZCA 3SMVA 4ER3A 5CKGA 3P77A 1IN8A 3AQ4A 1M1NA 4GP8B 1I8UA 2NU9B 1P72A 3ZN2A 4FHZA 4TOYL 1CIJA 1DU4A 4N8CH 4XH2B 5DC9B 5FPHA 4Q58C 1WIPA 3KNBA 4XP1L 5IP4A 3NDYE 3LZQA 2XN9E 1ZUHA 3FH7A 2ZRCA 2WYWA 2C1ZA 4GMDA 5IZCA 3KFXA 4GICA 2Z8VC 4MW0A 2VOJA 2WNGA 2IE8A 4FF9A 5DMKA 2MQ3A 3HMXA 4X90A 4RH4A 3BVUA 2P69A 4B3RB 1BMGA 3RBAA 3X12A 3QITA 4LCIL 3QEQA 4U1RA 4YUZA 3S3JA 3OEHA 3QQ4A 1XCBA 4UUMA 3AIIA 4ZV7A 3G3LA 3TE6A 1J8HB 1KBWA 1T66D 3G5YB 2DLEA 3N70A 4Q18A 1M83A 4RAUA 2XN0A 3B7SA 2P4QA 1MABA 2DYPA 5A2LH 1ZK5A 3ICPA 1A7BA 4PRDA 3NC4A 3A6FA 2GHZA 1N18A 3KIPA 2C3OA 5KSAD 1JNJA 3GCZA 1PFYA 5ES4B 3VC2A 1GS7A 4BRWA 4P82A 3TLRA 3WS6A 3OFSA 5EKXA 3TIXB 1UT1A 3EJZC 2XW6A 4GBMA 3GO1H 3L7EA 4V33A 5EWMA 4RFOL 1E2FA 2XOTA 4MFHA 5CLJA 1N5IA 4Y6QA 3SE0A 3VTFA 3B1XA 3S3DB 2K4WA 4UU7A 1LWHA 1Q0EA 4A26A 4YSOA 3FQRB 3A28A 4PTTA 1C7QA 1KQOA 1TYJA 3VFPA 2Z2IA 4GUPA 5DEGB 5JCJA 3MN8A 2XQKA 4I3GA 1FNGA 4QGGA 3U5ZB 1YE8A 1O0VA 3GLHA 4C4YA 4AL8L 4DW2H 4F2ME 2ENJA 2EH8H 1CU1A 3GHYA 3FPGA 3NM5A 3B5EA 1WWWX 5F7MC 3UYOD 1Y18A 3VWKA 3WOHA 2HK7A 2QD1A 2FWOB 1P4LA 2QSQA 4HUJA 4FFWC 3ZJ5A 4KQKA 1ECZA 4JFEE 4YMWA 1KCSL 1E1MA 4F5ZA 4E2WA 4ODSH 1AGBB 4MNGE 2D5BA 4L28A 1I4WA 5M2QA 3SYQA 1FYWA 3L93A 3U1VA 5HPMA 3BLBA 2XTJA 5K51A 4JCOA 1RI8A 1BWWA 5BSUA 3W77A 2EDHA 2OK0H 3JQBA 1IZZA 2F8VA 2BF4A 1FZOB 5F8RC 1N9GA 3O3AA 3EIXA 1AZBA 3S3CB 5IREA 5ETUA 5DF0A 1IRAY 5GZOD 2FP3A 4LQ1A 1DARA 1DDTA 5H59A 3MJ8A 3QWIA 3DX2A 4GJTB 4MLZA 5LHDA 2GN1A 1KEKA 4D9LL 3ETNA 1MH5B 4ZDHB 3LKOB 1Q0HA 5IK2D 5DC2A 1WW3A 4KOAA 1Q2UA 1QIGA 3KKQA 2W48A 4N3GA 2OYRA 2BFFB 3KD3A 2KPWA 2JXMA 1OW0C 4KGXA 4LCJA 2AK4E 3QNFA 3T0EB 1MCBA 5DX1A 4TLUA 2J1LA 2PFGA 3ABMB 3WSQH 2CBZA 4ZUSB 4ADIA 3PLNA 1CERA 3KQNA 3WDSA 4M6NL 2C5SA 3WVNA 3IJYB 2ROYA 3OMNB 4ONOA 3LHAA 3NIDB 5EZ6B 1KP2A 3ET9F 1OILA 2DQMA 2EIXA 1DRWA 4O4HB 3CFEA 4PYHA 4U5XA 1H4QA 5LP6F 4IK6A 4EF5A 2A33A 5DWVA 4XPFH 3O6FA 3E7PA 4TQ8A 1RWMA 3QLVC 3F5WB 1KGJA 4B3JA 1I1QB 2DU8A 1S2GA 2OV4A 4PEEA 4AJKA 1ZL2A 3K35A 5DTJA 1FYXA 4YHNB 5MEQA 1NFQA 1RJWA 4ZGGA 4XNMB 1PS3A 1U2SA 1WDWB 1C5DA 3HC0A 2CR3A 3DFKA 4XO5A 5SV2A 4XP9H 3D0KA 2DQEL 3TT1H 3LIPA 3T1OA 4OY9A 2WA2A 1X86B 4NKIH 5J5EA 5KANI 5KYKA 2YXEA 3OKPA 2NYRA 1ZIDA 1KVRA 1JFQH 4BV3A 2JTYA 3ZHFA 2K6GA 4CV2A 3TBHA 4MQEB 4WUUA 2FX2A 5IB3A 3GAFA 4FZJA 5FYDA 2AS0A 1KYWA 3B9DA 3VKGA 1CNEA 1HETA 2WHVA 2XJ4A 4NFYA 4J3SA 1DGQA 1YL6A 4HK4A 1KXVA 3IRVA 2E4TA 1TXKA 1VGEL 4YUXA 4OQXA 3FTDA 3LO8A 3UENA 4LDNA 3G6JF 3TOVA 4N0YH 1D5ZB 2WV3A 4K71B 2G9QA 3PHLA 1MMFB 2ZWKA 4OFKA 4FXGA 2REXB 1WFJA 1KJWA 4FFMA 4WI2A 3CLFL 3GNML 5HHVL 5JROA 2ZG2A 4C2AA 4QJ3A 4CFSA 5AXDA 4D45A 4M1GL 3OHSX 3S2IA 2VSYA 3K0SA 4MO9A 4NMHA 2XB2A 3QYJA 2XN2A 4JQOA 4J3OF 5AOCA 3Q9SA 5J11C 4MJLA 2VQ3A 4JJ5B 2BFDB 3ACCA 3JBG7 5B38G 5C7YA 1P4GA 2A5GA 3N43B 3AZOA 5DVOA 1FLNA 1EH5A 4DUGD 4RPHA 4B5EA 1R6XA 2JI8A 3AHIA 4Y2DD 2CFRA 3VBEA 5CW1A 3DTVD 5DTRA 3KE9A 1M7HA 4CE6A 3CUVA 3JY6A 1P1IA 2NUTA 4NFDA 3FVWA 2WD0A 2VRWA 3K2BA 1ZWKA 5FGRA 1R6VA 1BKSB 3CT6A 4P3DB 2RI0A 4NNPA 1VLJA 1CQXA 5DRYA 1PW3A 1VFAA 1DUIA 5K6AC 1SC6A 2NW3B 2D3JA 4XRCA 3UDWC 2XKJE 3BX7C 3OESA 4ZD6A 1BWPA 1UCBL 1GTSA 4FDWA 1SOWA 5BR1A 3ZJUA 3GZJA 4R1QA 2FN3A 1HTBA 4TVOA 3MOQA 5AUQA 3V1MA 3P4YA 3F9IA 2YSSB 3L3GB 4KKAC 2JI4A 3N7UA 4HTFA 4E5MA 3NFPA 3RUAA 4N2BA 1T3GA 2BOVA 4L48A 4RGNE 4N6RA 2P9YA 1H3PL 2Z3ZA 5A3SA 3MWFA 3ARGB 2QT6A 4EG6A 3MRNA 4Q89A 1W75A 4U1IA 5JD3A 1SYVA 3H7BB 3Q87B 1CEEA 2PV0A 1EE1A 1AO7E 2GZSA 3UJJH 5FORA 2OHGA 2EC8A 2ZWPA 3GZKA 4JHUA 3PNWA 3F7MA 1IVSA 3TJHC 1XNRB 3B7UX 1EO8L 3N87A 1MW0A 1X6NA 1CDUA 2NY7L 4RNRA 2FAXA 4A23A 1OIWA 4NNOA 3G89A 2C3UA 1IN7A 4CQLB 3P4MB 4O58L 1WM1A 2H1HA 4OMUA 4EARA 2QQKL 2G08A 4N0PA 3MA7B 4QKTA 4LBEB 4PBSA 4WWKC 1FFOA 4EG0A 4GXVH 2GCOB 2DY1A 3EVGA 2EQAA 2JCVA 2Q76A 4AJVA 1JBKA 3IFPA 1MWAA 1VL0A 5KX5F 3RAFC 3APDA 5AH0A 2VLRB 5CSZB 2ZWNA 2EP5A 2I5PO 3IJPA 1NVMB 3IMSA 3M46A 5EZOL 2Q3EA 4A91A 1G3UA 4KWTA 3R6LA 3Q5OA 2QPSA 4PS4L 3CTTA 3CBRA 4DKXA 4XT1C 1D5BB 4ZVRA 2JLPA 3EPHA 5L53A 4GM4A 1JZJA 3QY0A 3ARFA 5HDQA 2WKQA 3GPSA 2C1XA 4J0DA 1WT5A 4ZDKA 2X4OB 3PWJB 3CFJB 3LX8A 4QUBA 5D7LD 5AVWB 4YV2A 4X8GA 2E27L 5K9KB 2PG3A 4WZAE 3DONA 2WYOA 1KJIA 2I34A 2PCPB 1WF6A 3PSHA 3PPEA 3PJSB 2J3JA 2D2EA 4TN9A 3LRKA 2A9PA 5GIRB 2CLEB 4ZUTA 3PFHA 4LSPH 4NUQA 5GJCA 5D7NA 4O02B 2JKJA 1IZ7A 5DBEX 1LI5A 3T4AC 4BSVA 5JV5A 2OCAA 2H1PL 3GRZA 2GF9A 1MORA 3IEXA 1NTRA 1KBGL 1P17A 4ALNA 4ENUA 1R12A 5IJKA 1OXSC 1NG9A 4MO2A 4EJ6A 3BORA 1EG7A 1G20B 5J2UA 3L0PA 4D4KA 3RC9A 1HL4A 1K63A 2IJ0C 5DD5L 4YAUA 4BSWA 1JYNA 5KBYA 3TUZC 2AK3A 2AV7B 3CE9A 2L8AA 4OXKA 2IH8A 1OU0A 1LW7A 2FOXA 2JIBA 4XEUA 4EENA 4PJXE 1NZDA 2JIPA 3Q9NA 1LXCA 3L4CA 1BZ7B 5ID0B 4WN3A 4UMFA 3JWJA 4OMFG 2FGWL 3CJQA 1GS6X 2IQ5A 4DR5B 1U3TA 1VMEA 3EGWA 5ILTH 1LUAA 2Q7YA 4I1IA 1V71A 1EHNA 4NRXA 4UOZA 4MICA 3INRA 4UBJA 1ZXLA 4YSAA 4G0NA 1Y4DE 5I0WA 1XLTA 2GETA 3LNHA 5F9MA 4NFBA 4BZ1A 1X5FA 5DYGA 3W5CA 1TCRB 4B9YA 4XCVA 2X9YA 3SD5A 3L3HA 5J3HC 1IZ8A 1L4KA 1VLHA 3HG1E 3EE6A 1I3UA 1TLKA 1NKVA 5EP1A 3KYIB 5C0JB 1UOOA 4WW2A 3T71A 2R85A 3ZY4A 3BC9A 2AJXL 1JGIA 1DQTA 4C6SA 2CWDA 1EJ6A 1DQYA 5LAXA 1WCV1 1EXHA 3PWPB 4CN8A 4KN6A 1TTRA 4ZUVA 1ZK1A 4W6XB 2ZTMA 1G6VK 5KPJA 4PS0A 2FI1A 3E6AA 3O4OC 2F8LA 1IYZA 4JPSA 1I0IA 5TGBA 3LF2A 4G67A 1GFZA 5ECDA 3WS7A 3VH8A 3OMIB 4M7LH 4QVIA 2ZJ6A 1RU9H 3TBVB 2ZSAA 2I9TA 2JKNA 1NGSA 2AHOA 5DCWA 1OAQL 1ECCA 5KWVA 2FJ0A 1LQSR 5K09A 2OUKA 1JGEA 1UURA 4PU2A 2OMVA 4F7PA 4FFBA 3ZWPA 2FPLA 4QYIB 3GF4A 1H4VB 2B25A 2HLDD 4ZI5A 2DG2A 3SGKC 4QGFA 2G0NA 4KVAA 4ZO6A 2EJBA 5JWRA 1FB5A 3K96A 1L5SA 1G5GA 3BE4A 2OTWA 1J5PA 4Q9KA 4KGDA 3SGLA 1RULL 4ZKEA 4NEHB 1NKOA 3T2NL 1G18A 2NTNA 3HE6B 3X14B 5FYQA 3ANXA 1ZCAA 1QC5A 5GS0L 3IJEB 5CRIA 4O9HH 2K78A 3GD1C 4MJXA 2UXDB 2V8BA 1X7ZA 1IE5A 2DKFA 3KWFA 5AHWA 2NYVA 1C9NA 4GW4B 4HRAA 3GYGA 1CZHA 2F6RA 1EEQA 1F3JA 2N46A 1BSVA 4PR5A 2VHWA 4K46A 1MAUA 4IM7A 4YDRA 1D8AA 2VN7A 4ZXBD 1U81A 4MWSA 4RGQA 3TD2A 4YO0B 5HVHB 1VE1A 4BX8A 4B7CA 1FNSH 4BL5A 3DVNB 2VDPB 4P99A 4CN9A 3ZWOA 2WP0A 2PUFA 1PL0A 3FT3A 3EOAA 2OJEA 1KBBA 4LSTH 2O1EA 4XYBA 1DDGA 1NDMA 1VBMA 3ZPDA 3VRIB 4N8UA 4PYKA 4OLXH 5CB8A 2CCGA 2KPNA 3MBWB 4BH8B 4PXSA 5L2JA 3STLA 4JFDB 2R68A 3VVMA 5AO9A 2VBCA 3ROEA 4KFUA 4FB4A 1SXJC 4WTQA 3P0YH 3E9UA 3KR1A 3MRFB 5IN5A 5LBIA 4ER6A 3U40A 3FBQA 2IALB 4IRSD 1XR8B 4I4NA 3Q8LA 5E95B 4R71A 5AK3A 4J6IA 4ZALA 4HDNB 2WLJA 2YOAA 4KN5A 1F0KA 1AE6H 1UXWB 1IY9A 1OTHA 1HX0A 4LZOA 4X97A 4JNCA 2IXGA 3KK0A 4RIIA 1MDTA 4HOMA 1Q0TA 4MXWH 4P4RA 4U6XA 3CTPA 2GC7C 3QJVB 5CILH 2POCA 1GD1O 3VU2A 2Z35A 4JHWL 5EU4A 4JZOB 1H8EA 3T9AA 2AE2A 1ADCA 4UDYX 2OGWA 1PQZA 4K3DH 4H8HA 3ROPA 1CDGA 2VP2A 4FQLL 1ECPA 2YVLA 5AW7B 3RUIA 3LVQE 4JLKA 4KDCA 3NBUA 4YPVA 2CNNA 5AKXA 2IGBA 1N77A 5IBTL 1GJRA 4FXLA 3QBTA 3WL5A 4DLTA 4UIMB 2V7NB 2IU6A 2VB5A 4BXOB 5DP2A 1LV7A 1H6FA 5SX5K 1N6RA 1SQ0A 4FZVA 2G3YA 2Y07L 4UVHA 3BN9C 1NGYB 4Y19B 4M4SA 3I6MA 3HC4H 5DA4A 3WGMA 4GRDA 4FADA 1TM5E 3GNSA 4PFJA 2ACWA 3AUVA 1WZLA 4TNFA 2MFNA 1A3CA 2UZ1B 1R19A 1N4DA 4NOMA 1ORQA 3KTAA 1VFBA 4HJ0D 4ENVA 1RV6X 3LK6A 5HQ3A 4Y1FA 1S6NA 3SKXA 1ODJA 1BVNT 2HKHH 2WTBA 3TJEH 3V0EA 12E8L 2JJ2D 3UWMA 1F5SA 4WFFD 2IQAB 1J8HE 1WDKA 2IXDA 1G7MA 1C0PA 4JDVA 5AI0A 3MU3A 3GN2A 2AF3C 4OGFA 3NGLA 1BDIA 5FCDA 1IVTA 1X38A 4BBJA 2PH3A 3T34A 4XCEA 4GG6A 3HADA 3MYJA 3RWGA 1QASA 4CU8A 5IJBC 3G9XA 3LD9A 1Q19A 4P2QA 4EW6A 1AE6L 1EFDN 3DVAA 4QTHA 3DV0B 4UDUA 1I4FA 5CFNA 4ZX3A 3N9GL 4MKRA 1QRND 4D7PA 3TFQA 2J48A 5IB2B 2WWIA 4NE2A 2JFOA 4FRWA 1P7VA 4UT9L 4GC5A 3OJFA 2GSMB 5FTLA 2I4MA 4J0FA 4G3YL 5IVPA 3HB1A 2AK4A 1E5BA 4CFZA 4OGGA 4YDLB 3RC7A 1E7VA 4A2CA 2WZ0A 4DILA 3WIHL 4X3PA 4H15A 5JNYA 3PABA 3S8MA 2QEJA 1TZMA 4N5MA 4HUUA 4BV8A 2FHCA 2XMBA 1S8NA 3KBHE 1XVAA 3UK2A 1KI7A 4L4VB 2Q99A 2VJQA 5DSZA 4LCCC 1CB0A 2WU1A 2FJHB 4OJKA 4HIPA 1GTFA 4AJPA 2DPMA 1NMCC 5DYNA 4C04A 1XRPA 1OLSB 3PG2A 1OTTD 3LMJH 3WIEA 3TZ6A 4OHXA 3DECA 4JLSA 4UTZA 2WM0A 4JE0A 1U11A 5FX2A 4HGWB 3S5LG 3AJ8A 3NIWA 4Y9SA 1MHTA 2BINA 1CD5A 2L69A 3UJDA 1QG4A 3CDGB 1UATA 2AFHA 4R9UC 2PQ6A 4YJGB 4TXLA 2W88A 2E5FA 5ALEA 2QN9A 4PFSA 3TBYB 3QJTB 5I1LB 4PSRA 2ZVPX 4JFOB 1X87A 3BLKA 4OJDH 4KVPA 2FR4A 5L8JB 3FB7A 3LF1A 5EZSA 1B26A 4M29A 4CMMA 1KCSH 4UHBA 1HSAA 3M5PA 1IAII 1AQIA 3QQ9D 5TJHA 1GGCL 3MXVL 1F58L 3FHOA 2P9EA 2JB6A 1AU9A 2C9YA 3SE8H 4F3FA 3S37X 3SDAB 4I0WB 3VKWA 3IMVA 2JFVA 3NT5A 5I1JL 1TJYA 2WVVB 5CF3A 4MS8D 1I3GL 4NNPL 3RVWD 3AH8A 4GHWA 4KMQA 1E2BA 1UHVA 1P6FA 2HCBA 4HYEA 4C1NA 1ZW1A 1K8RA 3O3CA 4B85A 1NIPA 1ISPA 5I0ZA 1EWRA 1R4MA 3BRSA 2PR2A 1EVYA 5G40A 2DKMA 4Y8AA 2QVCA 1UOEA 1FTYA 5ITSA 4FJ2A 3BZEA 2AK1H 1RKUA 4JRXE 1DP4A 1GRNA 2Q10A 4PBXA 4LV6A 4WZBB 2PSJA 4OL0A 1AHHA 1XNJA 4HLNA 5CJOL 5E1AB 4F7EB 4D8OA 1T20B 1LVHA 3H9ZA 3WY2A 5AUPB 4EN3D 2GSDA 4K81B 1KRWA 2CBTA 2WR8A 4L4VE 1ML3A 2LLLA 3CVHB 2HSJA 1P0SE 3TCLB 4AH2B 4JDEB 1AFVH 4ZRDA 3TVMB 4WNAA 2WXRA 5BQOA 1IZYA 4IOFC 2E3JA 1E9VA 1WA2X 5LOVF 4H3SA 2PXXA 4LMRA 2VSKB 4RA9B 1IGFH 3ORHA 5EKDA 1H5UA 1IQUA 2XQFA 2J1WA 2F61A 4OH7A 1ZMTA 4F2MA 2ED8A 3QDMB 4GINA 4I9GA 5I9NA 2CLZA 5HHNB 1OALA 3DV6B 3O41B 1MWAL 1T0PB 5C5DA 2X8WA 2VXBA 1NMAH 2BPOA 2B94A 2G5TA 1WXIA 4NHCL 1RRMA 5CIYA 1A1OA 1BMFD 2H16A 4I0CC 2BMVA 4R0LB 4UM9D 5FS5A 2V7WA 1J49A 2YDYA 2CUIA 2X0JA 5IK3A 4XBEH 2A9OA 2E75C 3EOTL 4ZK2A 3KKNA 4Z5RA 2X0FA 5EEZA 1ESZA 4F9PC 2EBFX 1AD0B 4JQXC 1BP3B 4RHTA 3TMYA 2FW9A 2FO4B 1IIBA 1SVOA 3P11L 1PD0A 5TF1L 2J4CA 2P4AB 4JK0D 1MRFL 2JA1A 4F5CE 3ZGIA 4FQJH 3I92A 3LQ1A 3RVTC 4I3SL 4I4WB 2JJUA 1N8TA 3O83A 1L7VC 1ZBDA 3E7XA 3ECQA 4KKBC 1SXSA 3T1FA 3TBTB 1IHOA 2YC4C 3HXMA 2JKZA 5JJLA 1RADA 3RIAF 4RKYA 3N55A 2BHTA 3G7SA 3K8QA 2OVFA 1KO1A 1OA1A 2Q20A 4A0RA 3CLUC 2LXNA 4G81A 5FBHA 3LBHA 2AJZB 1BSIA 4RFNC 4G09A 2X88A 4AWJC 1USVA 4Y2JA 4BE9A 2QGBA 2OR7A 3EH1A 1C8QA 5AVOA 3P3RA 5ITVA 1NSNL 4RY0A 1MO2A 5DIZA 4G97A 3P0IA 1S7WB 1SN0A 1TLTA 2VHEA 4B4WA 5K7SA