3ZE2B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
469
structure length
469
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 115
structure length 469
sequence length 469
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze2B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze2B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze2B03
1L5GB 1SQ0A 3OKWA 4GZ8A 3IJEA 4Z7QB 5E6SA 1QC5A 4CN9A 4G1MB 4WJKB 1PD1A 4O02B 4C29A 1MQ9A 3EGDB 1ATZA 4Z7OB 4F1KA 3F74A 1ZOOA 5KYXB 1T6BY 5LN1A 3EG9B 3EFOB 3AL8B 3ZDXB 5ES4B 2NUPB 4HQOA 2NUTB 1DGQA 1M1XB 3EOBI 3FCSA 3TCXB 2VDMB 1PD0A 1JLMA 2XWJI 3BQMB 3PPXA 5HJ2A 3M6FA 3PPYA 3EH1A 4CN8A 3HI6A 3Q3GE 3OL2A 3EOAI 1M2VB 2VDKB 4G1MA 4C2AA 2VDPB 4HQLA 5KYNA 1BHO1 3IBSA 1LFAA 1IDN1 1V7PC 4WFQA 3IJEB 2P28A 1FE8A 1RRKA 4CNBA 5BV8A 1QC5B 4MMYB 3E2MA 1U8CA 4WK2B 3OL2B 3EGXA 2NVOA 2ICAA 1JV2A 3OKYB 3ZE0B 1YVPA 4K3JB 4WK0B 1U0NA 2I6SA 1M1UA 2X5NA 4A0QA 3AL8A 3K72A 2NUPA 5KYWB 4IHKA 3NIFB 1N9ZA 1IJKA 2VDLB 1AOXA 3TW0A 1MHPA 4MMZA 4NEHB 1NA5A 2XWBF 1OLZA 2P26A 3EH2A 4M76B 5E6UB 1RS0A 1SHUX 3BQNB 4UM8B 2NUTA 4PN7A 3K6SB 2VDOB 1U8CB 2VDNB 3TVYA 1JV2B 1AUQA 1PCXA 2O7NA 3EGXB 2VDRB 1SHTX 3T3MB 3NIDB 1RD4A 1M10A 1SSLA 2ODQA 4C2BA 4F1JA 1BHQ1 1PT6A 3VI4B 1IJBA 4JDUA 4IXDA 2I91A 1JEQA 4MMZB 2ODPA 1FNSA 3V4PB 1T0PA 1AO3A 1YVRA 1UEXC 2IUEA 4HQNA 5KYUA 3ZDYB 4IGIA 3EFOA 2UZYB 3K72B 1MF7A 5KYWA 2XGGA 1CK4A 3TXAA 4UM9D 1JEYB 3VI3B 1QCYA 3FCSB 4UM9B 4O02A 5KYYB 1U0OC 4DMUB 1YUKA 2VC2B 4HQFA 1OAKA 5E6SB 2WINI 2WW8A 3K6SA 3HXQA 4O3TB 4BJ3A 5E6RB 1XUOA 2B2XA 4G1EA 2VDQB 1SHYB 4MMXA 1CQPA 1ZOPA 1RTKA 3F78A 3NVQA 5HDBB 1MQAA 1L5GA 3ZE2B 1M2OA 1XDGA 1ZONA 3NIGB 3QA3E 1TYEB 1IDOA 4HQKA 2M32A 3RAGA 1XDDA 5HGJA 1MQ8B 4O3UB 3ZQKA 3N2NA 4NENA 4Z7NB 3K71B 5E6UA 1M2VA 3PPVA 5KYYA 1N3YA 1JEYA 1JEQB 1Q0PA 1MJNA 3GXBA 3AL9A 4FWWA 3BN3A 4JX0A 5KYXA 3EG9A 5KYUB 1DZIA 3AFCA 1M1XA 3HXOA 2ADFA 3EGDA 4NENB 2I6QA 4MMYA 3T3PB 4WK4B 3V4VB 3ZE1B 3K71A 2QTVA 3PPWA 4MMXB 3FCUB 4XW2A 3ZDZB 4G1EB 4FX5A 5E6RA
chains in the Genus database with same CATH superfamily
3P2JA 3ZHXA 1HK7A 1XXHE 5EQTA 4K5LA 3H6AA 1W59A 3DF9A 3PIQA 2Q41A 3AHJA 2XZCL 5AW7A 2HKHH 3GXFA 2K4WA 3TMAA 4F3FB 3LN5A 3D3WB 35C8L 4PJ5E 2IXTA 3QU2A 3AITA 2CR6A 3VAEA 3F0TA 3LEVL 3LQAL 4M1CC 5IHLB 4Y9GA 1D0IA 5TNXA 4PJAE 2C92A 2Z04A 4MUXA 1AGPA 4P3DB 3ULVL 1L4GA 2FPWA 1XAJA 3SZLA 5G0UA 4KGJA 5IEHB 4NQDE 1HSBA 5L7WA 3EJPA 3V5DA 1LVGA 1ZA3A 3WY9A 3MRKB 4PJEB 3UC2A 1XMSA 3QYCA 4XMPH 1T1XB 2C3OA 3A4DA 2QYHA 3M7FB 4PYKA 2Z2ZA 4MCYA 3I52A 4W9FC 4DQ0A 4WXMA 3U37A 4NMLA 5JBIA 1LS6A 3RWEB 4WXEA 1JU9A 3UL4A 2HBRA 2EVFA 3WL5A 2OEPA 3LH9A 4E6PA 4R0MA 5KWIA 5L3SB 2E5EA 2PUWA 3CPJB 2H1OA 1Q44A 2DBLL 2FZ3B 2Q5OA 1OAKA 3LP8A 3H2QA 2ICWJ 3ICEA 4DDHA 3IDFA 2J0SA 3FJOA 2O93L 3T0FA 1L4LA 1BAFL 5SWZE 5A0VA 1MLDA 1WMFA 3MQ2A 3ENZA 3T6VA 3WNOA 1CZHA 1NBHA 5T4HA 3KKZA 3FO0L 3QFHA 2IKQA 3HXOA 3QK0A 4X7FC 1EK6A 4JU9A 5FOSA 1YV9A 4FCWA 3BP4A 2IMNA 1PGRB 2ZJSH 3P73B 2H51A 3TBBA 2EEXA 2ZJ2A 4JEIA 4HF7A 4D25A 2R6R1 4OHOA 5KBMA 3VGEA 1OXYA 1HDEA 3CFDB 1JYXA 4BL5A 4C4TA 1A8PA 2UUPA 3E4CA 3WSTA 4MP3A 1Z12A 1XAKA 2XIIA 3VYSB 1E4JA 4AF7A 1I3UA 1FGNL 1HZZC 5M3BA 3VM6A 1DKMA 4Y9TA 1FE8A 4G5FA 2YZ7A 3SE9H 1O5IA 4RGNE 2OM5A 1X3LA 3UAFA 1GFSA 2XKSA 2XA9A 4QRTA 1E3QA 3LDBC 3B5TA 3OV6A 3N28A 3TO4D 4JC8A 4D0SA 2QVLA 2AZUA 1AUQA 3MBWB 2OFWA 4ZRDA 5A62A 3MWEB 5DVPA 3NN8B 1E4KA 4QTZA 1W5FA 4WH0A 4Z9XA 1Q1EA 2R751 5KDDA 3RVXC 2FJFA 3RWDB 1LPNA 3HW7A 1ZWLA 3DCIA 3MUFA 1PZFA 3MYYA 1TJIH 1L4BA 1EJBA 2G40A 3VFNB 2ZIUB 4YWHA 3M49A 1DQSA 3RVWD 4EL0A 3FO9A 1OIXA 2WOJA 2B1AH 4DRYA 3SE8H 2QL7A 2HO5A 1ZTMA 1MX5A 1QLFB 3AUAA 4BP3A 2NXEA 2XBTA 1CY7A 2VA8A 4DP2X 3WTXA 1U8PB 4Z9KB 4HQ6A 1DBQA 1Z22A 3A6JA 5AUQA 3UAZA 4XW2A 2YJQA 3P4NB 1S8AA 3HE7D 1X86B 3C3XA 4PI2A 4IDFA 5I9NA 1DVQA 3DJFA 1EESA 3C6SA 4RS3A 1HE4A 4F7MB 4FZRA 3IUEA 1XMJA 2I7CA 3DRQA 3ZZSA 2HBYA 3OC0A 4DRXB 4IIUA 4F8PA 1UG9A 2AV7B 2FKNA 1E9PA 5LKAA 1S8DA 2QTTA 4DP8X 3BN9D 1L7MA 4DK5A 4CVWA 2ONZA 1SUFA 3UGKA 4I9NA 3MNFA 4U3JB 2XRAL 1CBVH 3A4LA 4M62H 5I2IA 4HIEB 4KXWA 1O6FA 2NYUA 1HQYE 2V5AA 3TV8A 1OBOA 1W0YT 1ZOLA 4PCUA 1PS0A 1RBMA 1VJRA 1USZA 3LDAA 2W42A 2BIOA 3E7JA 5J1AA 3AEXA 1F8YA 5F96L 1G63A 3FLAA 4P8QA 4KO9A 4JROA 4BMXA 4LOAA 4LOKA 4Q1EA 3BESR 3MAWA 3M7OA 3PQ4A 1Y4ZA 3LRPA 4ZAZA 3PNVA 1JEEA 1OAKL 3BAEH 2WKLA 5FRDA 1QTPA 1JYNA 1LDBA 3BL5A 1U0OC 2CL7X 3LZCA 4WN9A 2PR4H 3N2LA 4Q6BA 4X45A 3HR7A 5CFMA 3D5EA 4KH0A 5EOVA 3SQBB 1UXKA 2IPKB 3O9MA 2H1SA 3U19A 4GP9A 4CKBA 3PNKA 3LPLA 3IE0A 1ZSDA 3VVLA 5KNDH 4KK6C 2XZOA 3Q6GL 5I0ZA 5CZXC 3C8KB 3QFDA 1CUSA 1GYUA 2OGWA 4FI3F 4JDPA 4ETQA 4XOBA 4H2AA 5DFVC 3OSUA 1BKSB 3ZXYA 3BISA 3TLEA 1NUUA 1Y7LA 3OMNB 4GLLA 3PE4A 2F1RA 1JP5A 3OCWA 3EVZA 3C3AA 3W6UA 4MIKA 3DUHA 1XMIA 2YW2A 3BSSA 4FYVA 4AECA 4NE2A 4ZQFA 1XZLA 3F9IA 1ODSA 3QPKA 3M3PA 5CIPH 3DL7A 3F6RA 4LIPD 4YMUA 1AG0A 3JTMA 4FC6A 2DKMA 5L2KA 3MLBA 1NF2A 4GKLA 3RAPR 1E1CA 4PJHA 2FQDA 3MTBA 3DDSA 1HH6B 3PLRA 4LCCA 4DUWA 1E2QA 2FF7A 4OXIA 1PBYA 4G7RB 1CD0A 1A4UA 4PV8A 1SXCA 3FTZA 2ORVA 4CGUB 3RHWF 3JT0A 4PSAA 1IE4A 5HHOB 2YXNA 3QX3A 1OFUX 3H9YA 5LUMA 2OCIA 4B85A 4JYZA 4BQOA 1S9WA 1CJKC 4HBZA 3HIZA 3GFVA 4R0NA 3N7UA 2VJMA 4D3SA 2WMPA 2QE7D 2P80A 3G0CA 1ZD1A 2VJXA 2R4UA 5AEAA 1QGDA 1AXSA 4AEHL 4XN5A 1XFDA 3WJJC 3WLHA 1EB8A 5LDGA 2NZYA 2PUAA 1YECL 3TCTA 4OV5A 1P1BA 4MJXA 3KO8A 4FFVD 4H08A 1TOAA 4DA4A 5L3RA 1Y7PA 2YPVL 1WHTB 5ALKA 3ZKMD 1C2YA 3WHKA 4ZYYA 3RANA 4X7BA 3HB5X 4OQTL 1SZJG 5D7IE 5TS2A 1NWCA 5JAPA 4PLWA 3NH6A 1GLNA 2B7LA 5JJBA 3S40A 4TYQA 4HWSA 1NGPL 3C41J 2ZJ5A 3Q13A 1IOWA 3HZHA 4AZ3B 4YUXA 1QEWA 4QUAA 5HKBA 5GS2D 3PITA 3TW6A 4GMSL 1PX2A 1GKOA 5J57B 4GUQA 1GPAA 2YK1H 5I1LB 4XA8A 3OPUA 1URPA 2EYTB 5IMBA 1OWMA 3VU9A 1F0NA 2ZXBA 4KPUB 5E4JA 1F7VA 3PX7A 4X60A 2KKQA 5AB9A 1VFOA 3AI2A 4K9NA 3RI5K 4Z99A 3Q8MA 1SKAA 4WJLA 2XMQA 1O2DA 4EUNA 4ZYLA 5C0FA 2OFXA 2AXGB 1GZDA 1QNIA 4RGNC 3ETNA 4PREB 1KEZA 5AM3A 3KZCA 2JKSA 4MQXC 3PQ8A 4X50A 5G2OA 1IQ0A 4ZZ3A 4CADB 4Z18A 1R9NA 4Y30A 1JZ3A 3RUFA 4NCJA 1SYVB 3URKA 1KFJB 4XIIA 1NUFA 5GJCA 3NXKA 3V9FA 2IPOA 1O54A 5IJXA 1JK8B 3OF5A 4H1UA 4V2IA 2NPLX 1MA0A 5AL0A 4LNAA 1ZCAA 2VLRA 3WWPA 3N2NA 1UC4B 1XC7A 3PXDA 5AKKA 3O3AB 5EJIA 1SKUA 1KCUH 3QXDA 1UT2A 3A4VA 2VXSH 2MNJB 1NL0H 1VFAB 4G8FA 1PBNA 4XGRA 3WBFA 3BUSA 4GSKA 3KP1A 1WJ3A 3ELYA 1OHHA 1XD2A 3HEAA 4PZZA 2VHZA 3IX7A 5AZEH 4LXGA 1YL7A 5BQXA 1XMWA 3KUCA 2ZXFA 4G9FB 1LBTA 5E8EB 2GK7A 3KCQA 3BT2L 5I1DA 2CFSA 1MZZA 5AW1B 5AB2A 4BE5A 5IKOA 4ZYVA 2PMDA 1GA6A 5AW3B 3CFNA 1C12B 4FA8A 2GVNA 1E1LA 4QDXA 2HQ1A 4ZMNA 3KSDO 4MQ5A 4B60A 4DAEA 2O30A 4CCYB 1KGIA 5A3SA 1D6VH 1Q14A 3U80A 1XCWA 3TIEB 5BYBA 1S8NA 4MAYB 4ZK6A 3POHA 2D13A 5D2NB 4ALJA 3KPRB 1Y3BE 1G20A 1R5WB 3T4XA 1TMQA 3ZKSD 3QZLA 4C58B 1F8TH 3I73A 4U4BA 3CN3A 3FB6A 3H9EO 2N59A 3LUHA 4MV4A 1NGXA 3WXWH 1BX2A 2J7KA 4L2YA 2WABA 4FUQA 3ENEA 4B3DA 2A0WA 1TLTA 4KHZA 4FG6C 3VNYA 3PG5A 4GQQA 3T3ME 4QY8A 4LE0A 4KMRA 3CRMA 1Y6NR 4IDEA 1H2WA 3V0EA 3OCXA 1WZUA 1FYTB 1AURA 2HCZX 4YMWA 1MZVA 3P3RA 4J0DA 4CL0A 4LLVB 1E4XI 3V5HB 3BH7A 1ZK3A 1PIWA 4CKCA 1NN5A 2YAEA 2H5UA 3BERA 2I8CA 1XBRA 3SDDA 5D1XC 3OQPA 9GPBA 2FO4A 3SIWA 5JZMA 4IX9A 5CFLA 2IWGA 4R54A 2Y0BA 2XDYA 4LV8B 3NCYP 1G98A 3I92A 1FQKA 2HJFA 3VD5A 3O26A 4X3PA 2QX6A 3U9TA 4F7CB 3M1LA 1SBCA 1MAUA 5AUMA 1H2AS 3EXG1 1C8PA 2R69A 3GJQA 4B33A 2E82A 3E84A 4OJEH 4L7VA 3MJRA 2C8VA 3TO2B 2DFLA 4LF8B 4JFEA 5F1KC 4YHLH 5K20A 1CFNB 4OSUH 2PNFA 2XT6A 3VNRA 2DGDA 3JVIA 2FD6L 2CUZA 4Y2NA 4JW3A 4YT5A 1SPXA 4W9RA 2L3BA 4D81A 3RDJA 1RJLA 1WZ1L 1AKWA 4B7LA 1IAIL 5JATA 2GGSA 4NZJA 3V1LA 4YIHA 3IHLA 5LDHA 1V26A 5LP6B 4ORGA 2C26A 2V3VA 1THGA 3PIIA 4E30A 3IEAA 4P31A 3ORFA 4CM6A 2IHJA 4OCWL 1K06A 1PCXA 3FFCE 4UEOA 3TO4B 2PEYA 3HPJA 4AIOA 1RKXA 3U61B 3P97A 5EIAA 4OKNA 4PJXB 1XT6A 3KQHA 2CC2A 3A8TA 2XADA 1Q6YA 3QB7C 2ZSHA 1HHIA 3ZZMA 3U46B 1PUIA 3S96B 1CUGA 2NAFA 3PV6A 2W92A 3N44F 4U6TA 1VECA 3AHDA 5THXA 2HVKA 2QI9C 2FYYA 4MVJI 5JY6A 1CQPA 4KNSA 3IT2A 3ZPDA 1HYRC 5DFAA 2E4ZA 4LOIA 1QO3B 2DQIL 2VDWA 4J0QA 4ZU3A 4AQZA 2DWQA 4XP1H 4P4LA 2Q99A 3HNPA 4QG7A 2Y69B 1C0IA 4Q9NA 1LI7A 3HBAA 2VITA 2D2CC 1WP6A 3NT4A 3UAOA 3WGUA 1O0BA 2RARA 3EYFA 1ES9A 1RZRD 2GY7B 1LBEA 3KBFA 2P2SA 1H3FA 3W3ZB 3EOZA 1DJNA 1JHMA 3FR7A 1GC1L 2V3CC 1VPLA 2EF1A 3PX2A 4I46A 3QOWA 1CE1L 4EW2A 2NYYC 3JU3A 3S36L 2A92A 1HZHL 4JDTL 3WC4A 1H2BA 4UBIA 5FNVA 3ROMA 3U4GA 5L6YH 4GI8A 4ZJ9A 2XHEA 3BEVA 4XO8A 2HRRA 2O2DA 3WGZA 4PQYA 2R79A 1V16A 4EI6B 2VK8A 2IITA 2COUA 2BRUA 2QMYA 2DWPA 3O2NA 3EH2A 3M6DA 3ET4A 1A4AA 3TN7A 2D4FA 4B6GA 2GBIA 5LB2A 1MNNA 5IEJA 3HC0A 15C8L 5I8OL 2LU3A 1ZITA 1B4RA 1OCZB 2DQ6A 2F3QA 4RDQF 5JVDF 1NJ8A 1MKFA 5F3BB 5I30H 4L0MA 6CGTA 2GFHA 3N2KB 2LD4A 4RA6A 3SD7A 5FLKA 4NOMA 3MMEA 3ZK0A 5FWNA 1MFAH 2ZJ1A 1F6AA 2TYSB 2MYNA 1YOVA 4C4KT 5T1LD 2FH8A 2XRMA 1ZGZA 4KV7A 2O8NA 1R6DA 4XVRA 1HZLA 4WXPA 1OIOA 1F56A 1HL8A 2O3UA 4IS2A 2EUXA 1J0AA 1H8EA 1E9OA 3CLRD 3RAJA 4FVTA 1DC5A 3IDIA 1XT5A 4XMLH 3O9WB 5HCNA 2OHJA 2PD6A 2NZ9C 2D7JA 3D39D 3GSWA 4PHXA 3BICA 3QVTA 4A27A 3KYMA 2WPDD 3P0VH 1M33A 4BMOB 1EFPB 2ZIZA 2PXXA 2CNBA 3LEYH 4HV8A 4JJ5B 1TEZA 3WLBA 3ISJA 1PWEA 3QPAA 1KUMA 3BRCA 1CEQA 4K6FA 4CIBA 1QMPA 3RYFA 3P94A 4MO9A 3DUUB 2FZKA 2PO7A 2JD1A 5E8OA 3UJCA 4DRXA 4QGHA 2QL1A 2WNHA 1Z75A 5LOVB 3TURA 3WOHA 4YDNA 3RVTC 2ICWA 1ZBDA 3MTDA 4R6WA 1NUPA 3HNSL 1MI5A 1U5BA 3CE1A 4UNUA 2ZSIA 4RNCA 3NB0A 3ZIDA 3AUUA 3O4LB 5BMFH 1IUOA 2B0SL 2CFIA 2KBGA 1QLRB 2NRDA 4M1QA 1SEPA 2J3JA 3LYUA 3DETD 5F9JA 2FJ0A 4LEXH 2R1VA 1EXUB 2V8BA 4GAJL 3LY7A 3LRHA 1QA9B 1LD3A 1KLFB 5HYVA 3DTYA 4HGZA 3O82A 5F88B 2B1GA 1WYJA 3GEWB 3QNMA 4C47A 3PXBA 3AFNA 3VM5A 2QWXA 3BCFA 4HJUA 1PAZA 4F5DA 1RK1A 2AQRA 3SE4C 1J97A 5CH3A 2ZCKH 2ZWYA 3CX5J 3I8OA 3WKAA 2HJKA 1HDIA 5EMKA 4F9LA 2AJYH 3F8SA 3MG9A 4TYPA 5ADHA 2ZRNA 2X89A 5FO1A 4TQEL 1E3SA 1F6LL 1XEUA 2JJSC 5DSTA 4XCCH 1VGRA 3IQWA 1RUMH 1WLYA 1ZVHA 2YGQA 3ZWDA 1Z8NA 1GGVA 2Q6WA 3BSWA 5AJUA 4AX4A 3N2YA 4RKFA 2J32A 1MRFH 2GSIA 1QNZH 5JD3A 3KPPB 3TKYA 3B9QA 2V0GA 4ARIA 3O7MA 1V7PC 2EU8A 1BN6A 4JDVA 2ZOKA 1WXFA 1IJNA 3D51A 4KRGA 4FDWA 3HN2A 4PAQA 1EJ8A 4ETNA 3ER8A 1Q0QA 1Y5IA 4LSDA 4R41A 4C4KO 3V5KB 5KZCD 4CUCA 4ND7A 1A50B 3OT1B 5IS2A 3CMGA 3PLYA 4HH9A 2ZBQA 2WG2A 2DLCX 4U2BA 3NNSA 1HBJA 1S2DA 3AHCA 4N12A 3R1GH 3IMEA 4KNUA 3ACCA 3QBEA 4I08A 5HF5A 1WRBA 3MK31 3MI6A 4Y88A 4ZKDA 1QKZL 1PZ2A 2XH8A 1N2RA 5IB3B 3E3MA 1DFHA 4RFLA 2EEZA 3V5NA 2B4KA 1YDMA 1XQ4A 2DMCA 5UKDA 3DMMA 1VMAA 4ZK8A 4KIWA 1JPGA 2BY0A 2XYBA 1NV8A 1XWIA 3WKPA 1VL5A 2Y06H 2VN5A 3DMRA 1Z2CA 3DE1X 3MRBA 1YQ2A 3ZLQC 5E3IA 1URIA 3VGAC 5EVCA 1BIHA 2HKFL 2X2UA 2I3DA 2IZ7A 5EDSA 1RJDA 3BE1L 2OAEA 5C8YA 3AHFA 3ZE7A 5HKKD 4I85A 3PWKA 5EU5A 1GGBH 1ZDMA 1F3DJ 2C4NA 4NKMB 1E2NA 2FWAA 1X3SA 2BVOB 2IF7A 4R97B 3KLHD 1HWHB 1X2BA 3FAZA 1A96A 1KU6A 3V8MA 2ZDHA 4MUAA 1SOMA 5BWBA 1DQMH 4RAVA 3VA6A 2C3XA 3INOA 4R8VA 5DZPA 3UOWA 2CKBA 3RTCA 4C07A 2QAGB 3B2EA 3VJMA 2CMGA 4X4ZA 4MS4A 1FZOB 2EZ4A 3RARA 3T0VA 3TX2A 3ZVLA 4EA8A 1HXHA 4PJCF 3T9AA 3COWA 1U91A 5FOBA 2JDID 4RK1A 1VKXB 5FO7A 2NY6B 4ES9A 1QBML 1JLLB 2F43B 3SDAB 4JJHA 5FHAH 3PBKA 1UT1A 1WVGA 2CUTA 2ATIA 3KUXA 4W5OA 1PGOA 3B1TA 1YMUA 1KI2A 5BOSB 3Q2IA 2UDPA 5KWEA 4XZ3A 5LVAA 2I4OA 3FTPA 2OB1A 3T4AA 4GW3A 1T4CA 1P1RA 3BUPA 3L4TA 3E23A 2CFCA 4QECA 3WNQA 3C1OA 5SZJA 1OF2A 1Q12A 3CXDH 4R01A 4MA8H 1J0JA 1KELL 4QYTA 3U3JA 3WEOA 5CYPA 4WGVB 3LLMA 1B0RA 4Q3OA 2XWPA 1C1YA 4B3FX 5LNGA 4QPJC 8FABB 2YWHA 1TT5A 2FDXA 3ZGVA 4JIMA 2PX4A 4JKWA 5FPTA 1XDDA 4WW2A 3LT4A 5DISB 4LSTH 1LRLA 3BD8A 5EP1A 2VDPL 1D0VA 2VYNA 4B4VA 2CLDX 4FHBD 4XWGH 1CQZA 1TTBA 1FFCA 2QBYA 3UBXB 3QYAA 4AX8A 4OZFB 1RUKH 1YS1X 2WSBA 4WFEE 2QX7A 2VBCA 4HRXA 4IUYA 4XNQA 4XX0B 5HVHC 3PWUA 3WIUA 1YPZE 4NPKA 2JLXA 4HUQB 5C2JB 3K3PA 2GRAA 4ZEMA 5LQDA 5AAPA 2XCLA 5AM4A 1V39A 3WMWA 5CEEA 3GXDA 5K9JH 1FJXA 3F9RA 4YB8A 1QR4A 1E96A 1BBJB 3ZJ5A 3D3VD 4C05A 3L13A 5DEFB 2OHGA 4AQAA 3ZU4A 4KK9D 3V0WL 5LDSA 2JNWA 5EN2A 4KQ0A 3NWBA 4YUWA 4GRWB 4MEAA 3UAYA 3BQUD 4I2VA 3PY9A 2IVZA 5FKJA 1N26A 3I9GH 3THWA 1SCAA 2J4WH 5F64A 5BN3A 1AHWC 1AGNA 3R5XA 4ZQEA 2Q07A 1E9QB 1V5EA 1XF2B 1HOEA 2OY0A 4HZUB 1E69A 1IAOB 4AENB 2GTQA 2PTVA 3RNQB 1REIA 5DD1H 3B3IB 3V4VA 2ZE7A 4S3MA 4B35A 1J2YA 1JTTA 2ADFL 4BNHA 2GF9A 3W7VA 1X5HA 4BBAA 2BKLA 1JF1B 4GQ9L 2O05A 2BVNA 4H20H 1JX6A 2CJUL 1OBCA 1RUML 2IXDA 2VQSA 4TS9A 3K5HA 3L4JA 3HFMH 3WGYA 5IK3A 2FN7A 4D43A 1NCBL 1WLSA 3QFFA 3EGDA 3QHTC 1A8QA 3DHVA 4JUIA 1SQ0A 1DAHA 1UP4A 4XX5A 1R0LA 1NXSA 4MROA 4ZFQA 1IJFA 4DP7X 1N1EA 4W5NA 4WAFA 1QBGA 5KMGB 4E36A 2FUG6 5C2UB 1KR2A 2VN4A 3INGA 3ZQ4A 1CQXA 1FZMB 2JJVA 3F3YA 4L4SA 3WLEA 2YZ2A 1NY6A 1RI2A 4TXJA 3Q3VA 4XE5B 4J8RA 4JZYA 3WYGA 2APBA 3VOBA 4EBFA 1P5UC 3FMFA 4XWYA 3C7AA 4JI8B 5FF6B 5E8EA 2XTJE 1YB2A 2XUAA 1K8RA 2VQ1A 3WB9A 4GC9A 5C0CD 4ND8A 5CEXA 1NYTA 1NQTA 3QIUA 3I9OA 3T1NA 3VV3A 3NJIA 4AY3A 3H4IA 4QBHA 1SJ9A 3WIOA 3QX8A 4OQMA 3QUZA 5HHNB 4GT0A 3VC2A 3KJ6H 1UK6A 3EDDA 3AEQA 4RKWA 3NHJA 4U2GA 5LVEA 3CE6A 5CX4A 1UZMA 1J2UA 4ODWB 4Y6SA 2IAMC 3IBOA 1A7OH 2VRAA 4JHAL 5DTFA 1I0IA 3WKBA 3DE2X 1AF4A 4E41D 2JI4A 1S9XA 4RDXA 1YCGA 2V5TA 4I9UA 5FUWA 4YXLH 3PHGA 1IM8A 1KCWA 1BVHA 4I50F 2OA9A 2MSEB 2OXFA 1YB4A 4QUJA 2YBRB 4MYPA 5K39B 4DZZA 4ZTZB 2R4QA 4AMUA 3AFOA 4AY6A 4Z7OF 5HJ7A 5DUPL 4TTVA 1W4ZA 4EQ3A 2B7CA 2FW1A 3GNSA 1TSHA 1E89A 4FIZA 1GUAA 3P0HA 4AZ0A 4EO5A 3MLUH 1P39A 2PYEA 2ZU6A 2CKBB 2D3JA 1Z2DA 1DN0B 4A7TA 1T43A 5AOZA 5BOPA 2B25A 4HDKB 2XA8L 1MFAL 5AUNB 3H2PA 3CNEA 3VX1A 1NWOA 2I1VB 4O2RA 5ICGA 3L6OO 2MSLA 3QUYD 5F1IA 4EUEA 1ZIYA 2H0JA 5CZVH 4LFHG 2V1UA 4PFKA 3O3OB 3BSYA 4A73A 3VQTA 3LBNA 2VWPA 5JHAA 2UAGA 4GLBA 2JXMB 2FTAA 2BJWA 3HGMA 5CCXA 1YR6A 2MOQA 4PJHE 5IWCA 2DJSA 3I0ZA 1PV4A 5DTJA 3DX2A 4MB4A 5E38A 4WVFA 1CDJA 5KBYA 3KRTA 2OC9A 2AEQH 1DQVA 1E2PA 3FWNA 4ZJZA 4YGYA 4KZEH 3NIWA 4CUJA 1XD1A 3N8GA 4FFWD 4HDNA 4KROB 4XMKH 1TQ4A 3OG6B 3KZMA 5IHHA 1INLA 4EVIA 3LCCA 4DCMA 2P75A 1QWSA 4PB9H 4E9LA 4CF6A 4K6GA 1DSSG 4JLBA 4MSUA 3GMDA 1EJFA 1JHKL 1T25A 3GB7B 3K2QA 5TV2A 3ETGA 2BI7A 2NACA 2OD9A 2H16A 4KLRA 3SPVB 2IFGA 4TNFA 2G0TA 5JXED 4K3JL 3CR7A 4AS1A 2WFZA 4PJBB 5KQPA 1NVDA 5FOQA 3RBSA 2WCSA 4PSPA 3RS4A 4PZCA 5I1JH 4DQLA 4FXGA 2MR6A 2FPRA 2I67A 4LPWA 1ZT1A 2RK3A 3NJXA 1DG9A 3U3RA 1FVDA 4D4LA 4D0NA 1J06A 2VR1A 3U2JA 1JR6A 3UJ8A 4LVOA 3QIUB 4OJAA 4JYPA 1HDCA 4S1VA 1G21A 2G77B 2F62A 3OZTA 2XQYK 3SE0A 2X2EA 2XCSB 3FFDA 3SDYH 1ISPA 1M57B 1E9OB 1X0XA 4J0FA 3U1TA 1T4BA 5ETJA 3VD7A 3CV5A 2VSDA 2RH4A 1O9GA 1VHJA 3W8NA 4NUJB 1OE3A 3AEKA 3CF6R 4BNVA 1EGQA 2IG2L 1ZLYA 5CZXD 1RQXA 4YMGA 4XYEA 4R8WL 4M76B 1DCMA 1U0BB 3GPDG 3U2SB 1CDYA 1M53A 1K2WA 3UJ9A 3OZEA 1OP4A 1U7XA 5E2UH 3BGFB 3R3WA 3L1UA 2GABA 4HDQB 1AKJD 3PHCA 4DPMA 2O20A 4PBRA 1O9ZA 1BGWA 2HKIA 3QI2A 4HKXB 3VD1A 4HLEA 1CB7A 1OAQH 4Y5YA 4FOLA 2R1WB 2I29A 4DCGA 2YVKA 1MCNA 3QA3B 3HC0B 5E9AA 5CTJA 4CTNA 1S7WA 5D1QC 1UFUA 4JITA 1JSYA 4J4PC 2H07A 1PKQB 2ZYAA 5IC6A 1SVLA 2FB4L 1V27A 3IBGA 1TFUA 2J0UB 3C6LC 5M5BA 5CFZA 1HR0B 2C20A 4MR7A 4M6WA 4UREA 2IHTA 2UY7A 3MGCA 4TNGA 3KXIA 4KK3A 3CMOH 3M1BB 4HP8A 3R7AA 2MOVA 2CBPA 4AG5A 2VCYA 2HWXA 5FYDA 4FJZA 3T2OA 4MI1A 2C1OA 1JE0A 3SCMC 2HR1A 3FB8A 2VF5X 3SEPA 3PRZA 2APXA 1BNCA 1M42A 2Q76B 5DZOA 1NXOA 4JUBA 1OHZA 3SM9A 3U4QB 2GQ0A 5DNDA 3E8UL 3O9WA 2QQKH 3OU6A 5I0DA 3UKJA 1TLKA 4B84A 3ED5A 1BSVA 1EAYA 3ESZA 1NOAA 3L1VA 4HNUA 1UATA 3HBFA 4HEME 3ZYJA 3OM9A 2O2HA 1TEXA 2WCPA 3AEQB 2XTAA 3X1XA 5D1ZD 4AVKA 4OPMA 3MT7A 2SKDA 3NH7H 3ADPA 5ALOA 1T9CA 4PJHB 4DPKA 2EAUA 1COWA 3B6IA 4YLCA 4MS8D 1UQUA 4PRDA 1E27B 2KZBA 3MD0A 2X7XA 1K5PA 4FKBA 4LRIC 3MWJA 3IESA 1OILA 4L6IA 2F9BT 4QRPB 3ZLUA 2WC7A 5EIIA 3O6VA 3AB0B 4A92A 1CR2A 3LXBA 2BMKA 3NCBB 3P4YA 1MF7A 4R0LC 5A7HA 1JB9A 4O4HB 1UUFA 4CMAA 4U3SB 3U7WL 1QIMA 3GDFA 3ITEA 4KAXA 1Q0EA 5ILQA 1KYFA 5IHUH 4XRGA 1I33A 4ZN6A 2QKIA 4NX0A 1FDTA 4R5VA 3KAAA 1U2ZA 4J4TA 4RCYA 1FYTD 2RGYA 1AJ7L 4H1WA 3DGEC 3V0HA 2HGSA 4MS3B 2QSCH 2QU7A 4M99A 1JFVA 1DBKH 2FSHA 3PC8C 5AK3A 2FSVC 1JVNA 2DHDA 3CFTA 1K4MA 1V25A 2FHBA 1E6JL 4K88A 4KJXA 2QA5A 3ARBD 1INQA 1BMTA 3ZHTA 3ISRA 5I8EA 3IUSA 4WD3A 2IBGA 3R6DA 1SQFA 2BZGA 4YXWD 2Y0CA 3U83A 5I5GA 2WJPA 4K3GA 1XTJA 3STTA 3HVKA 2GEJA 4TT8A 1F4YH 3CH7A 1XRJA 1KY6A 1MJGA 3X2QB 4A1FA 3DYPA 3AF5A 3W4KA 2XG4B 2E4YA 2NY1D 3FFCB 3OD3A 4PB0H 3O4VA 5F7EL 3C97A 4LPCA 3QDME 5C0AA 1RUAH 1P5RA 3RU7A 3THOA 5AW8A 4PGDB 1PZDA 3W0WE 1E8ZA 1Z38A 2X5PA 1L9PA 4ZO8A 4DLLA 3Q9SA 2VDRL 4IJ3C 5E24E 2Y3NA 2YD0A 2AVDA 3VXKA 2YJ5A 3UGJA 4GPZA 4C7VA 1UCTA 2WZPA 4ACTA 1QLEL 4RGMB 5FO7B 3RKDD 4FYWA 5CNJA 3HNSH 4ID9A 1JBKA 5G0WA 5JCOA 2B8NA 2JFNA 4JMPA 3OETA 3IMUA 3ADDA 4GW4B 5JIIA 1BG6A 1FY2A 3VR5H 1XZMA 1DLHA 1EFRA 1A4BA 1RWOA 3L1GA 4X6BB 2GZ2A 4L4RA 4Q7KA 2Y71A 1K8ZB 1DUZB 4N3NA 2FZGA 1FNCA 4PLKC 4H1TA 4KLCA 4PRBB 1AN9A 1UA6H 1JGLL 2NXCA 2E1RA 1QFZA 4TVPE 3TEJA 1JVOA 1ZKMA 1A2BA 3EZGA 1OIVA 3P52A 3GUVA 4H20L 2ZYVX 5KYXB 4ONFH 1VRWA 1FGVL 4YMTA 2GAOA 1UWKA 1WCIB 4X84A 1WBXA 4A7SA 2I5YL 2QQNL 4UT6A 2VLME 3UPCA 1V6CA 3AHIA 3BPCA 1AZCA 1ADYA 4UVIA 1IH8A 5BRAA 2VXUL 2ADMA 3MV7D 4MYCA 3VBCA 1GZ6A 2IVFA 1GCYA 2A57A 2A6JA 1DTEA 1FX0A 3KZ1E 4IJQA 5DRNB 4BGEA 5K5EA 4RSVA 3NMUF 3ROFA 3N6YA 2XQBH 4MB2A 2Z95A 1BEYH 2GCEA 5GS1A 4ZT1A 1TEYA 1PMYA 4G6JH 4PONA 3AW5A 2XKKA 2AQ1A 3DMTA 1N9PA 4IMJB 5LXTA 1ZJZA 4DM4A 4C9BA 2FQ1A 5CILL 1U0FA 1PLBA 4C4SA 4FFVA 4U0RB 5BSUA 2I4MA 2O26U 3DAOA 3IBTA 5B38G 1MH5B 4QLRA 1VGQA 2ODHA 3C6MA 3FT9A 4M1TA 3H7AA 2JI8A 3TRHA 4CWAA 1WZNA 1X1RA 3MRJB 3MRFA 2EXYD 2YMOA 1IM2A 2R97A 3LPMA 2RAMA 4CMIA 2R47A 3DX3A 3BMOA 3PK0A 1H0KA 4UVHA 1D2MA 4YHKL 4XUDA 4PLCA 4GPD1 1YFJA 3B85A 1V9SA 1YHYA 1ST2A 1I0LA 5KB3A 2WV3A 1YNTA 2YMXH 3FOFC 3QIBC 5LLIC 2CBZA 4B0PA 1J49A 5IHZA 3Q12A 4X7PA 2H4YA 5B1EA 4N5UA 3IAM1 3M2PA 4W5HA 3MRPB 4ACBA 3HZYB 2B8TA 5E23A 4DWOA 3PKIA 1UR5A 3TXYA 1PUJA 4MR9B 3ORQA 2MOKA 3BULA 5J23A 2B59A 1D9XA 3T41A 4OMDA 2KPOA 1TUBB 3O45B 4XXCC 1EVLA 3VVCA 3JV5A 2H48A 3D31A 4GUCA 2CNNA 4WWKC 3QVGB 4XPGL 2AJZB 4LRXA 2HX1A 3DIFB 2CYBA 4NE9A 3EDJA 5KTEH 5LUBA 1E63A 3ROTA 4ZMBA 3FOMB 4WFJA 5C80A 4RHUA 1A9YA 3FNFA 4KQ9A 3BFWA 1O58A 4EF4A 3EMKA 3F2IA 1N2OA 4KBYA 3ZNPA 4B7UA 4HOMA 1XGRA 4Z7UF 1LSOA 3IUNA 3DUSA 4HK4A 2CLLB 1XQ1A 2CSXA 4MV3A 3ECSA 4UQBA 1FZJB 3JWGA 5BN3B 3L95B 4NBSA 6CHYA 1I5RA 2DMBA 3WWEA 4Y1SA 4D7PA 3N58A 4DF9A 1JYWA 4BB6A 3GUYA 2PWZA 1HLPA 1CY0A 1EJ6A 3GBVA 4QAJA 3IP9A 4IJ5A 4Y4FB 5T41A 3ZHFA 3APCA 1PZEA 4UBKA 1ZGLB 1Q7EA 4EI7A 4ODWA 1ESOA 1HESA 3KD2A 3OE5A 3HL4A 1SN0A 4CYMA 5BW8A 5EAIA 2COEA 4DNOA 1M8FA 5E6RA 4YYZA 4HJ0C 3STXA 4IOSD 3AB0C 2RK4A 4UPVA 1IAMA 1NIJA 1NC3A 3EB9A 1NBCA 5I1EL 5HIMA 3CX8A 3U7QA 1ZXQA 2AV1A 4EIWA 2J7LA 4Q0XH 1DELA 4BNFA 4CVXA 5DCUA 1X8LA 3LHFA 5ICCA 1RKQA 1NDUA 2DCUA 5GOZA 1M7GA 4BXSV 3OJDA 5IFJB 1E28B 4JLJA 2C0CA 2X1VA 2CLKB 3IGAB 1YO4A 3FQTB 1CUJA 1LMIA 4P7FA 1SMAA 4HWRA 1SVMA 1QG0A 3SLKA 2D2FA 1Q2XA 4DY4A 4EB8A 2WLIA 2VWQA 3QC5X 3P1VA 2Y07H 2I07B 2JK0A 4OYHA 4JFQA 1YECH 2Q5CA 4N8VG 1EWHA 5E8NA 1H23A 2WK1A 3BG5A 4OB6A 3R23A 4KACA 4WN9B 3K8KA 2Y66A 2MHCA 3QXVA 3SDDD 4PRNB 1HEZA 4BWVA 4JJ8A 1R3HB 4Y1AD 2AN9A 1L7TL 3LQQA 4FBGA 3O2WH 2BSED 1NOLA 5IMMA 3CH5A 1H3UA 1M7IA 4Q05A 1HDXA 4MS1A 1YVLA 4LSRH 5CAYB 1VE6A 1OKKD 3CIAA 5DM70 3N43B 1TT6A 3NPMA 2JIPA 3SMQA 1MJJA 3JAWB 5IXSA 5DVOA 4FW8A 4DRZA 4A91A 2WIIA 1QUEA 4K7PH 3BPNB 1KJ8A 3UZQA 1FJ1A 3X1GA 1KERA 2Y22A 2BNQB 2F74B 3ARBA 2V2XB 3MRLB 4O2EB 3UXYA 1GQYA 4RVDA 2O6PA 2PH7A 2JG3A 2HD4A 3BEOA 3BGFC 4YDZA 5K39A 3GGPA 3W1ZA 4Z0PA 1IY8A 1UPBA 1LB1B 1P4JA 3AUXA 3F7QA 3L7MA 3SYPA 1ZE3H 4WUUA 1XGRB 5FL7D 2IEZA 3SHVA 2FPPB 2LDXA 4EHBA 2PSJA 2B8OT 5JOFA 2UYOA 2DLGA 2A38A 2V7UA 4NO2B 2L0DA 4H8WC 1XEAA 3KHKA 3QQ9C 2HZ7A 4HUUA 3SYNA 1CO1A 5AKEA 2BZDA 4Q47A 3S37H 2E87A 4L1DA 2ESRA 1FDLH 2VZTA 3NUQA 3Q4GA 2HJGA 1S7RB 1BWQA 5J9FA 1NNEA 5IROC 1MIMH 1TEGA 4RZHA 2D7CA 3AQZA 3VGHA 3RB7A 3PWVB 5MENA 5DP2A 1N64H 5FHAL 4H8UA 1AXGA 5C8VA 3LJKA 4CDHA 2IEPA 3A3NA 4ZCMA 4J0KA 2IOHA 3UBFA 4YUZA 1X19A 4IDJH 1Z5LB 3F4KA 5D1QE 5J11B 1RZQA 2ZQKA 2WNSA 4XN2A 1X9LA 2XKNB 4G7SB 3G6WA 3KVOA 5HS4A 1G6Q1 1NI3A 1N4XH 1XZJA 2XDAA 1KJZA 2J67A 4DV0B 3MUGB 3ESMA 4G97A 1KDOA 3ZBTA 4JBHA 4KI5E 1KV7A 2Q7NA 4B9EA 3GSUA 4L5AA 5JCJD 3N5CA 4LCJA 3JD4A 1L3CA 4LDEB 4LSTL 4AW4A 2QPTA 4PJFE 3I8XA 1MB0A 3MCZA 3CPLB 5ANRB 4L9DA 2ZBUA 5HWSA 2AF3C 1UEMA 3JWNE 3C3MA 5HVHB 3H84A 4LWQA 4E70A 1HT3A 4FDVA 2BCKA 3VSQA 1T6WA 5T5NG 3MF4A 1MOPA 3AUTA 3R5HA 4KYTA 2GJ4A 4MLCA 5KNLA 5T1JA 3NVAA 3M17A 4U2EA 2DB3A 4HFWB 4ZEVA 3NTXA 1SY6A 5ALSA 1D8TA 3ICCA 4P7KA 2G9VA 5T5FL 4G5OA 2F53E 1W4CA 3ZVRA 5EC2B 3UT5B 4WW0A 1CXKA 3JRNA 1U95A 2XKJE 3WELA 2JJUA 1CIPA 2IDMA 5ANME 1AB6A 1A22B 1GKYA 3K4ZA 2JIXD 1UQTA 2VZLA 4ND4A 1UD5A 5DYWA 3QZUA 4UIKL 3ARDA 3GHEH 1TYDE 4DILA 1Q8MA 1X5MA 4ZREA 3KSRA 5LG6A 1RRPA 3FETA 2BS71 5HDWA 4MJHA 4MCYB 4EJ1C 3B6MA 1TYBE 3PJLA 1C08A 2ZK7A 3JWEA 4TWBA 4WUKH 3WRXA 3QU9A 2VDRH 4A7GA 1XXHB 3S1LA 4FZ3A 1ECFA 2VF2A 1P4GA 3FGOA 3VDAA 3BKML 2GK2A 4U3SA 1GPYA 3HWRA 1DBPA 2A4ZA 5CEZH 3QYJA 4M7KL 3O92A 4RLHA 2TECE 2Y1KA 2QPUA 1LJMA 4JT4A 2NTJA 1SPDA 4XPTH 4EN3B 5K3AA 3VWKC 2XXAB 2V17H 1ND0A 3W4JA 5C09B 2WXPA 3NDIA 3V1TC 2H1RA 3P73A 1SU8A 5TE6L 2H3NB 5DM4A 4H7IA 5LNK1 1UWGH 3GLQA 1N5OX 1OPGL 1J1UA 4AMGA 1WULS 4G5XA 3HLAB 5CGZA 1RY7B 2L42A 1K1EA 1GO2A 1XTUA 2AKAB 5JANA 1GARA 3MJWA 3UYKA 5EUKA 4PW4A 3DAFA 4WZAB 2FW0A 2J1ZA 1ZA6B 1T22B 1UKAA 5DYOB 4JQIL 4FOMA 5IHBA 3LP6A 1W6UA 1PJWA 3KJ6L 1YEDB 4IMLB 2Y3IA 3RJZA 1Z6PA 3DCNA 5BSGA 2OX5B 1AR1D 5IDVA 4EPSA 1OAQL 2XIJA 1K8IA 1KJ2A 4OCXH 3P9QA 2F8VA 3MJHA 3UENA 4Z6AT 4U2YA 3FN4A 3D1VA 2DH3A 4EGSA 2FPPA 4QDKA 5LIPA 4HVTA 4OSOA 2ISQA 3F7LA 5E95A 4O4HA 2YKKA 3SGEH 1DRWA 3QZWB 1UEYA 3L77A 2L18A 2H3XC 3SO3C 2ADIA 2MIZA 4CFYA 1N2IA 2I6GA 3P0GB 2R8PA 4OL9A 1U4SA 3Q6FA 4NK4A 4HSCX 1QFWH 3QJXA 2VHEA 2A6IB 2QVZX 3BMNB 4N18A 2GBVA 4KXAA 3KGRA 2XEDA 3KL2A 3HA7A 4I1NB 4PZEA 4AM0B 2ECQA 1KZYC 2D7DA 3ZKNC 4BDVB 3SKMA 1GAEO 4BNDA 3OJFA 3AGPA 2P8MB 3CZFA 4LFHD 5TQ0H 5C8ZA 5J4YA 2YQGA 2TSBA 3KTDA 4QRRA 1LC0A 3O3NB 2ITDB 1UANA 1LF0A 2Q3LA 5LKRA 2ET6A 1BJ1H 3CVIH 4J29A 5CR9A 4DPRA 4BN5A 1CF8L 3C3PA 2A14A 3LHSA 3QQ5A 1U2DA 4X9HA 1DIHA 4A37A 4QDOA 5J1TB 3NRPA 5D7EA 5JYDA 4NP4H 3OKFA 5L8KB 1CGVA 3NK4A 2YA1A 1XH0A 1CF4A 2W2VA 5JISA 1F41A 2A0KA 1YIAA 3I8SA 1UGNA 1CDDA 4KAQH 2XNCA 4O4LA 3OCZA 3E80A 2OZ4A 3C75A 1BH2A 5DA4A 4BKLA 3FIUA 3FJYA 4ATNA 1WAAF 5E0FA 1W0VA 1X1CA 4IRZH 3MFYA 2Y25A 4UKDA 1X1BA 2YXLA 3FCSA 4FEEA 1AJ7H 2JDIA 4KI5C 4F2MB 2QJDA 1IQDB 3KOZA 1CYGA 4HWOA 4TSAL 1QZNA 2E59A 3H2YA 4PC1A 4ZS7H 1WAAA 5AKGA 5IANA 2MKLC 1OAUH 1OWPA 2A59A 4RMNA 2QVCA 4LDAA 3DSNB 4RLQA 1ENOA 1ICEA 2AXNA 1UJ3C 3N1UA 2E76C 2AVGA 5HYFA 1CR6A 4E0RB 4UIKH 1EVKA 1BXRB 3L3DB 4TLUA 3MMXA 4OIAA 4LY6A 4LT7A 2Y5QA 3CNKA 3BZ5A 2ZOOA 5GSRB 2XECA 2R8BA 3OX3A 1RXUA 2AK1L 4KUCD 1NZFA 5IXJA 3FYIB 1KDRA 4KRNA 2PR2A 1T5OA 2F1OA 1ETJA 2ZP9A 2BY2A 1YO6A 2JGEA 4FHEA 3U36A 2IPLA 4DN6A 3X17A 4M7KH 4NQDA 5D70H 2H0EA 1Y8AA 5H02A 5FYKH 2VO5A 2HXGA 1K7XB 3EBGA 1ZH0A 3NT0A 4QASA 1IHOA 2EDNA 1V3QE 2OMBA 2VQTA 1KTLA 4E1BA 2B4RO 1I3NA 1RZVA 3QQ3B 4R2GB 1OROA 5IPFA 2G71A 1G6RA 4J1SA 1KK0A 3Q1KA 2AN1A 4Q93A 4MA4A 1M1YE 2E9WA 4X85A 5CUSL 4IKIA 4LEIA 4G8FB 3GKWL 4UUJA 1SMOA 4RD4A 2XOKD 1TM5E 3ZTCC 2MTBA 2VM3A 4FLMA 4ZCQA 1DGQA 2VZ9A 1MTZA 1IC6A 3U1VA 5A40E 3G6DL 4ODBD 1NVEA 3WO1A 1T21B 2HUHA 3CNHA 4FHZA 4YDQA 4WKOA 1FVCA 4AC4A 4HGQA 2OZLB 2XVYA 3G9TA 5AW1A 2QSVA 4HDNB 5JXAL 5HHMB 2F5AL 3O8XD 4ONGL 1YE5A 4FHGA 3NATA 1NMEA 1W72A 2F4VB 2AOUB 1I9IH 4EI8A 1O9WA 3AF1A 4QXGL 1K0UA 5HI4D 1EANA 3NDZE 2X4OA 2Q6IA 4UTVA 2W60A 2ZSWA 3JYQA 1JH8A 4PNPA 1QIJA 3T94A 1RZJC 1P4BH 1GAQA 5E7JA 3HRZB 4MAYA 4KNWA 3MKKA 3K74B 2BHFA 5SV3A 4XSHA 3IXTB 3WICA 3H2IA 1W8DA 4OHYA 5DWDA 2JIBA 2HMWA 4E31A 4CC4A 5D9SB 2QUZA 2FWLB 4AG6A 3QWOA 1RK1B 3W90A 2J5BA 2EDDA 1JZDC 4PVMA 3MYJA 3E61A 3ZGXA 4O00A 4CKZA 1E5BA 1I8MB 1TSRA 4MW5A 4R2GD 1HAWA 2EDXA 2CGZA 4X8OA 3UXEA 3N76A 4WCFC 4X54A 1T5XB 4M93C 1HORA 3VAYA 4Y1FA 4BVBA 3ZZNA 2VXVH 3HFGA 2FU5C 2OJZH 4HIIA 4KO4S 1E2WA 4TRPH 1LILA 3VWJA 2DQTL 4UEKA 2IUTA 1AGRA 4NCC2 1A72A 3GZOA 1LJUA 4X3OA 1AR1B 3FJ1A 4WU5A 5C52B 2YMXL 3NBMA 1N75A 3BTVA 4GSXA 4BQQA 2Q8BL 1N2CB 1V7QA 4DZBB 2BP7A 1LDNA 2OK0H 1ZE3C 5FT9A 3HYSA 4WWNA 5DHUA 4OI2A 2EYSA 1RM0A 1B3RA 1FDWA 2NN3C 3KDMA 3A67L 3V95A 5DNCA 1VZ2A 3AG3B 1BAPA 1NC2B 1ND5A 2Z7WA 5LBGA 2H9GA 3X1JA 5I5MA 2WP0A 4F8LA 2EZ0D 1TLMA 3HN3A 4HH0A 2PR4L 3M1YA 3O7WA 4D44A 5JARA 4B8YA 4UPEA 1ABBA 2XVLA 4DAGL 1PZUB 4ID3A 1TQVA 3ULVC 3OLGA 3EQZA 5AQ1A 1R3KB 1LPPA 2UYHA 3BWMA 5KYWA 5EBWB 3NOVA 4U6NA 3IOBA 1GW0A 5D6DC 2D54A 5F9WB 3DRTB 5G4OA 1AQNA 2AMGA 3U4MA 3NBFA 3HE6D 3KG5A 3LMKA 3FQXB 4WHTB 2PUGA 2BEUB 2IP1A 4Q4IA 4GI9A 3UBXI 1T1WA 3QVVA 1H2HA 1U04A 3P30L 4K9QA 3WBKA 3CRVA 2XTLA 5MENB 4LY9A 3SSMA 4WCYL 3LC2O 4V1DE 1NR5A 3HG0A 1L1EA 2EGUA 4W1TA 2GBLC 4NHUB 4PJ5A 5C4GB 4X44A 3WYBA 4DDKA 1CG9A 4MJ5B 3V1UA 4Z7QB 3BT0A 1RUPL 4E1AA 2CBOA 1A1NA 4CT4B 2VAPA 1XA3A 5DS8B 3BYZA 3DWTA 3KHTA 1VHPA 3L2MA 3KKMA 2W4MA 1F90H 3MIIA 1Q0TA 5CN2A 4PC2A 1PI3A 2R96A 3DMFA 2ACWA 2CL0X 2G5GX 5EZQA 2RHMA 5G3YA 3CH4B 3VXMB 4IM7A 2CO6A 5BZWB 4B17A 3BWAA 5D7JB 4E41B 3NK3A 2W59A 2A7QA 4IW4C 4ZV7A 4GMTH 4B87A 1XKTA 4GO6B 5JBQA 4MDYA 4OHZA 4TM9A 3AZQA 2NCEA 5DK3A 1EAQA 3VXSA 1AOXA 4X6DE 4RMQA 3FPGA 3EF4A 5SZHB 1AB5A 1VJDA 1YMMB 4Y19A 1W9MA 1AV7A 2JS7A 4Z51A 3L6BA 1FJ2A 1KCVH 5E1AA 2IHBA 1S01A 3CA8A 5GJWC 3VXQA 1A0QL 3C6LD 2A77L 5FUMA 4JUCA 3EXAA 5CA0F 3U9LA 2OV2A 5LP6A 5MHSD 4IBYA 3FRPG 5EU7C 4QUGA 2V9ZA 3HL0A 4MGXA 4X97A 4U6XB 1LV8A 3FO1A 4Y8VA 2DD8L 5DD6A 3S9DB 4X5OA 1MX9A 4LSMA 2BGUA 4ANWA 5IC4A 4BWFB 4FT2A 4LOFA 4LYEA 5C08A 3ZKAA 5FYLH 4JJKA 3NCYS 1N2EA 3HDVA 1YB1A 5KANI 1JVSA 2OO3A 4ZXPA 2GARA 4M9ZA 2NQDA 2XDQA 1KXTB 1VZGA 3SP1A 2N4IA 4K2HA 4YQYA 4HB4A 2BJVA 3N59A 3NHBA 1UXIA 4UDXX 2VF4X 3IMSA 1OI7A 2UXDB 4MWFA 4ALNA 1EPUA 3GEFA 4PJAB 4QRIA 1NBME 3T5WA 5JD5A 4BZ2H 4DGUA 3GD5A 3ETBJ 1LK3L 2YYZA 1FAIH 2WQSA 3VC3A 2QT0A 2X1PA 1RKVA 2QL6A 5CD5D 1QV6A 2JF1A 2X4GA 2CKBH 4LLYB 4AIXA 1JZFA 2Y36H 3HCVB 1YQQA 4JHAH 2R39A 2X9XA 1DAGA 2BCKB 3FTSA 3HNOA 4GI1A 2YJNA 3TV3H 4NN5B 1JMYA 1ELOA 3SX0A 3U30C 2REOA 4UE2A 4M61B 1MO6A 2WLZA 3EJWA 4UE6A 1F4XL 3AINA 2HREA 5IJKC 4B3HA 5IYZB 1OH6A 4KGZA 3I2FA 2OSYA 4MA1B 3GGGA 2C57A 2YV2A 1CD1B 4FTVD 4PMFA 3GIZL 1ROWA 1NLFA 3L6FA 2K78A 1UT6A 1E8MA 1RYMA 1Z5ZA 1MDBA 1A64A 3TX6A 2C1PB 2ZPAA 3TTVA 2Z92B 1ET5A 2EE2A 1K27A 2EE6A 2OCGA 2QMQA 1O77A 1NCAL 3SZ3A 1CQWA 1XJQA 4KKZA 2PA0A 4UE3S 4N86A 3HP1A 2HLAB 3EG9A 4AE0A 2K3HA 1CZUA 1GR0A 5DRXB 3AR3A 1X7ZA 3V1MA 4DEPC 3ISTA 3UUGA 1KBZA 1QRUA 3MD9A 3IB6A 2B08A 3OLQA 1QRNB 1J20A 1H3GA 3UMSA 4G9DB 4G4SO 3C45A 3KT3A 4UEJA 2LKCA 1CYEA 3T3DA 1P7KA 3BCDA 3B48A 1DTWB 4XCYA 2AH5A 3HE7A 1GMIA 1XYGA 1U2CA 4ND3A 1L3NA 3I2IA 5E1AB 3D8HA 4ZX6A 4Y9DA 2WGXA 3O8XA 5HZGA 5CJQL 3IGUA 2GZMA 1WXXA 4AN0A 4Y4KB 3I6IA 4M3JA 5CSGA 4C0AC 1NM9A 1RPKA 2HK7A 5BQFA 1CY6A 5JNSA 3AUYA 1S9WB 2HH0H 3WK9A 4PCTA 4PIVA 1L4MA 3OZIA 5T1DH 4Y5YC 2EH8L 4JM2D 1S9KC 4YO7A 1E3JA 1IOZA 4XPBH 1FU7A 4L4VE 1MHHA 2KW5A 3U5ZB 2BOCB 1H19A 1A97A 2R2EB 4LXIA 3PHOA 4NBYB 1K3IA 1ACYL 3OEHD 4KXLA 3PE3A 3IO3A 2XD9A 1RQ7A 3K8OE 1MFNA 2X09A 4PS1A 1Y9AA 5HTOA 3ULVE 3WBBA 1SHYB 3KPOB 3NJLA 5AOVA 2JWGA 2W6QA 1RAHA 3OTTA 1EK2A 2FQYA 3R4RA 4Z4GA 3KDPB 1W4BA 4N5ED 2ZRBA 3OZBA 2XBUA 5JSZB 4FMCB 3VDRA 2BF4A 3QUXB 2NSHA 4QRRD 5K33A 4D0GA 1K6QH 3BKXA 2YFKA 1FFNB 4XVQA 5DX8A 1A8ZA 3HCVA 1TB4A 1T6BY 3QY9A 1WBDA 3I1YA 1LK5A 1BQ4A 1BQSA 4Y2LA 1N5IA 2AJSL 1HH6A 3W3BA 2QY6A 2AXHA 2P9EA 3S5ZA 4F9TA 4GOOD 1QVZA 3KCPA 1RQPA 1GL7A 4Z7WE 3DP9A 4YSDA 1UZ8A 1YFZA 2ZTLA 1WHPA 4POAA 3HEMA 4B3VA 2H3KA 3W6OA 1RUQL 1CS4C 4O51B 1JDBC 4AX3A 3G1WA 5DCLA 2ZXQA 3S2ZA 5E5MB 2N7SA 3E22A 5E8PA 1SHMA 2R2BA 3MNZB 3K8ZA 2HI0A 2IWKA 4DC9A 3ZU5A 2XODA 3P96A 4RV4A 3EPKA 1V10A 4HFNA 2BHTA 4LCYB 3TZHA 4N39A 1P4IH 2PYEE 1MU0A 1VLZA 4HUXB 5FV1L 3GN1A 2BY3A 3TT1H 2B34A 1Q0LA 4EAQA 2Z83A 3DWFA 4RA9A 2UVEA 4FYJA 3T5PA 3VD9A 2H6PB 2H85A 7REQB 4GMSH 2AXWA 1MW0A 4RA0C 1KGWA 4P83A 1UP6A 3VH4A 2E4VA 2VLJD 3DG9A 4UATA 2GC7C 3O6FC 5BQ7B 5EU7E 2EIJB 1E7YA 4PCVA 2P4UA 4AMYA 1BFUA 1UCFA 3NC1C 2QTRA 4CLRA 1R5OA 1T0HB 1PSDA 3QCVH 2XGOA 1U6JA 3E8UH 3CDZA 1I3KA 2FG7C 4Y4FD 2MWMA 1MCPH 2DT8A 3MINA 4BQRA 5L4FA 1Y34E 1Q9OA 3IXQA 2I6UA 1IQWH 4TMZA 4G23A 3LPAA 3TMKA 4Z7OE 4I50A 3DIVA 1N3NB 3GKZA 4OTXL 2BFEB 5F78A 3GH1A 2Z09A 3NCFB 5D3MB 5CEZE 3D85D 3EZNA 5DJ8B 1YDEA 4YXKL 4MVCA 1XZHA 1NINA 1WUTA 1Z74A 3QXWA 3KLSA 1PZAA 2QXTA 5BWNA 2ZZNA 1ZK1A 3CVDA 4I88A 3F7YA 3VE0A 2F55A 4P3KA 1M0EA 1PT8A 2XKBA 5JMOA 5AW2A 2F53B 1YY9D 2PZLA 4S1OA 2MWCA 1SOSA 5JOEA 4Q7JB 1ETB1 1PR6A 4Y0NA 3HDTA 3CWQA 3WLAA 2C9DA 2CHEA 3R75A 3GLFA 4OI1A 1G94A 2WLIB 3PNLA 5TDPA 4U1IA 3BFQG 5B22A 2OFOA 4KAAA 1AZSC 4JFHD 2QR0B 2PTGA 3QRWA 1PX8A 4L8BA 3OHMB 2G25A 3V55A 2BSTA 4DSUA 4JOCA 4CG2A 4RD0A 3IMFA 4MPRA 2IALB 4LHXA 3OKDA 1ETA1 3NM6B 3EW9A 5CB4B 3CX5K 3EXHB 3MV7E 3RU8H 5JW4N 5CCGE 1SIWA 5BO0D 3SZOA 2UX6A 2V9TA 3G59A 1IRAY 1YBVA 3L1OH 2ADFA 3IULA 1BDHA 4KGVA 3O3DA 3O0RL 3PEFA 5I8CA 3VYUB 3L8CA 2H2SC 4HOYA 1R10A 2DQKA 1WB6A 2CBGA 5CSZB 4I0PB 2VOEA 2H0AA 1Q0RA 3LPPA 1QO7A 4TSCH 3ZDXB 4GGMX 1RSFA 3TIXB 3UADA 3IHWA 2JELH 4BV1A 1UUNA 1JFFB 1HMPA 1LBQA 4C2AA 4PJDE 3QELB 4N0RA 3SGKA 5E1GA 4GVLA 3KQYA 3QLUA 2JLPA 2VAAB 1JDSA 2H7CA 3AXTA 2EDHA 3MJSA 1UYWL 2WXJA 5FIEA 1FLTX 1RLUA 3HZ3A 3K2UH 3OPMA 3WEAA 2PNJA 1D3AA 2BVEA 4PANA 2F8SA 1V8ZA 4MVBC 3QPBA 1SUIA 4NXMB 3FNIA 4LCBA 1AP2B 4XGZA 2YD9A 1X7XA 1YS7A 2ABWA 4G7VH 3O6LL 5JEDA 3DKHA 1OTYA 1DN2A 5HYQA 1GAFL 2YD4A 1NI5A 4JO2L 2JKYA 4CIYA 5K59E 2VTVA 3ENWA 5GZOD 5K59F 2Z65C 5T5FA 1J8HA 2FX5A 4R7VA 1ENPA 4FKHA 1CRZA 4AZ8B 2WVVB 1M71A 2N1MA 1RBYA 3GJFK 1D5XB 3HKBB 3SSAA 3PFKA 3UUWA 4MHHI 5F7FA 5KYUB 1AM4D 2CV2A 1A0QH 3GJFA 1E5UI 5AW9B 4JFFB 4EN3C 1BQEA 3T2NL 4WK4B 5F1OA 1FC2D 1R17A 3MWEA 1IGCL 4YDIL 1ZVQA 1GYQA 3DKIA 4QC2A 2JEOA 4EMUA 2H9IA 4QO7A 2AWOA 2Q3CA 1LQSR 4CMMB 4PJGB 1JHPA 2ZSFA 1FL6A 5GGTL 1PQZA 1HL7A 3FPSA 4QOJA 2XWJI 4HDSB 4K6KA 1GNSA 1AFVL 2MCPH 5JCZA 1QZ3A 4AMWA 3O4LA 1J56A 3WMXA 1URZA 3IFNH 4WFED 4P0TA 3RB8A 3QHFH 1RRKA 3EGSA 1FRGL 3FE2A 1YLBB 4HJ0D 1AHHA 4RYDA 4L8BB 4XC3L 1B4TA 4YDLC 3BUYA 5IBLD 1IQPA 2WVSA 3T52A 4FHCA 4WCFA 1IB5A 3KD3A 3OKMB 4JM2A 3NM5A 4PGCB 4OOEA 3T7RA 1I01A 1HILB 1X9IA 4KZDH 4BK5C 4PIRF 3GJSA 3Q3CA 2NV6A 1BQHA 2L7UA 1KCUL 3DOFA 1JWUB 2FZ4A 3GDCA 3N3AC 3VXSB 4GM0A 2V7NB 4UINH 1M2OB 1RJYB 3Q85A 1DQIA 6Q21A 3CHOA 9LDBA 3CJTA 4HS8L 2D3NA 1NAKH 1TAGA 3SPVA 3S36H 4FA7B 1R3KA 4AYWA 1G8MA 4NQEE 3I12A 3LD9A 1RJZA 1JRHI 3CZCA 4NU8X 5K6AA 4OM0L 3GROA 4ZT6A 3STZB 1XNQB 4II3A 3KBHE 5BV7C 3JZYA 2I69A 4JDVB 4UZUA 1P0PA 4Q1DA 1OAJA 5DMIH 4PLYA 2PCXA 3SEQA 5JTUA 2ZSDA 1BQRA 3A26A 3VGJA 5T6MA 4BPRA 1BLNA 3IILA 5DEOA 1O5OA 2Y1LA 3GFBA 2AG0A 2GEFA 5DWUL 5J58A 5LNDA 3LX8A 1BF5A 2VJ0A 2PGXA 4TS6A 3QQNA 3WY1A 1F02I 4UB0H 4XNXH 4P5TC 1V55B 3KZNA 2J85A 5ETUB 1MCBA 2AMYA 4QPPA 2DBJA 3BEDA 3F6LA 1C0EA 1ZANL 2R51A 5K51A 1L4HA 2GEVA 2PXAA 1P0FA 1A3CA 1DJHA 4DWWA 1QDUA 1KELH 4Q02A 5EHZA 1ZXXA 3US9A 2PUCA 2WWRA 4X4ME 3D18A 5EQJB 3LH5A 1XTZA 5JPIA 2R7LA 4AJHA 1BLIA 1N6HA 4GR9A 1Z15A 1EDOA 3A70A 4OVKA 1A6VL 2XOXA 2B3DA 3T34A 1HT0A 3FFXA 4F72A 4ZT2A 2OGSA 1L8LA 4LFAB 3RIKA 3VVMA 1OF0A 2ZG1A 4Y18A 4YDVA 4CT5A 2JELL 4FOPA 2YAMA 2BBWA 5JO5B 2UXFA 2LGNA 1YHPA 4A8JB 3CZGA 1NPJA 1E2ZA 3QUZD 1HQDA 4G9FD 5DHXB 2PXHA 1TU2A 3WL9B 2BIPA 2OW6A 2HSDA 3JQGA 1XRRA 2V33A 5EJ8A 1NCDL 3OZGA 4M9SA 3VOSA 1WXIA 1CP3A 3BJMA 1J8HD 5SY6A 3LBHA 3VR0A 1RZIA 2W38A 1QHSA 1R3UA 4TV9B 2NZ1A 2HDNB 3ZHOA 2P48B 5JS8A 5L45A 1N18A 4HT3B 1CIDA 1U3JA 1IBSA 4OI8A 1WBZA 3W7BA 1E8DA 3AWFA 4UM7A 4I18B 4HALA 1CSEE 1ESMA 4REMA 2FT8A 4RZKA 4IMPA 5AICA 3FSJX 1XLUA 2X4IA 3VXOB 2YXMA 1UQSB 3TYXA 2NY6C 1ZICA 3L1KA 2A78A 1EUZA 5D1ZB 5DWVA 2GN1A 3FT2A 4N7JA 1I8KA 3G23A 2J5LC 1KJJA 1D7OA 2EX0A 3S5LG 1QFYA 4XAWH 4PZUA 1EWRA 1B6GA 2HF7A 3VDQA 4PRHB 4N2EA 4TN9A 2E7LA 4J1TA 4IJUA 4UQCA 3GSXB 2OI9C 2HRQA 3NUGA 1IBYA 1ECLA 1KE2A 2D5LA 4A0HA 3IFPB 1BXXA 5K6AC 4HX1A 3VTZA 3N8DA 3MTIA 3OHXC 3O0DA 1DVRA 3IDAA 4HAOA 4LXTA 4GW5A 3FUCA 4LU5H 2VDQB 3W78A 5A5DA 1OT1A 4HMCA 3THRA 3HE7C 5KJ1A 2G4CA 2VR5A 4IRJA 4XO5A 3LT5A 5C0EA 4EEEA 1MXGA 3IEUA 5TFSL 5IARA 3PWZA 4JI3B 2O3JA 3HG3A 1PVHA 1M83A 2OXCA 3O4OB 3RAJH 5FK9A 4NENB 5ICXB 3U30B 3KL4A 5EH1A 2WLTA 1P60A 4I1RA 5LBTA 4K0OA 2AZDA 3K9WA 4XNMA 1I7UA 4ZAKA 4J49A 1XB2A 4DIXA 5GRUH 1PR1A 2ESVB 4JGNA 2YFHA 3HUEA 5ACZA 2GESA 4E9WA 4F37F 1JKIA 2XX3A 3DMNA 5U4QA 3LSOA 1JLRA 1VLJA 4TUYB 1JN6B 5LDUA 4V2UA 2OJZL 4PJ8D 2Q8AL 1ORIA 1GUYA 4YN3A 1R24B 4OGAD 4J0CA 2Y1AA 4LSGA 4AC9A 2BGWA 3R3ZA 4HG4K 4L6AA 3O31A 5ESAA 4LBVA 3WJMB 1C1HA 4X5PA 3DM9B 4F37K 4G6KL 4WWKA 2NLJB 2VDUE 1LC3A 1NKVA 2X23A 1Q19A 1B9KA 5JW4Q 2XYHA 1C1DA 5CLWA 4NDZA 4ZPJA 3B2MA 2VS1A 1ZJWA 1CY8A 4ERXA 1VTKA 1IY9A 3PCTA 4GXQA 2MCFA 1OB5A 4Z53A 3T7AA 1NCHA 4TL4A 3QUZC 1BXRA 5B58T 3K05A 4Y1AE 1H1LA 3KNBB 3TEMA 1TQSA 1NXWA 2WVGA 3W38A 1SRDA 4E5DA 1YJXA 3JYLA 2V7EA 4W68A 4IXMA 3TV3L 4WW2B 4GZ5A 3SOBL 2CDGA 1LEKA 5KAPA 1A47A 1Z5OA 4R2IA 4AIZA 2V2XA 1KAQA 2J9XB 3L7AA 4OZGF 1KGDA 5DEIA 1ID2A 1U98A 1JEYA 4X00A 3RY4A 1W1UA 3F47A 3RYHA 4C6TB 1QORA 2MEJB 1V4BA 4XNQB 3RS8A 4X6BA 2BVYA 3H1GA 1E66A 3IMGA 1KAMA 5I30L 1F2TA 2ZETA 4S1QH 1Q9WB 2GUYA 4AP9A 2QXUA 3PAZA 3GBSA 4UQEA 1RXVA 2O3QA 3SE7A 2NX5E 2YCLA 2EUVA 4JI6B 4HHEA 3VAAA 5J12B 3O21A 2WUBH 1KAOA 5FKAA 4TSBH 4Z7UA 2IIQA 3EYVA 1U91B 3KLDA 2NR6C 3MQIA 4PRYA 4PVDA 4RVBA 1F1BA 4DJEC 1V8BA 3S68A 4MQ6A 4PBDA 1QI4A 3KHQA 1E4YA 1JFTA 4PG4A 2NYVA 2WM2A 1R6UA 5HDQH 1A9TA 1Z1WA 1C1XB 4FR2A 3K2KA 5I1CH 4Q14A 3FBTA 1UBMS 3OHXA 2WZPD 2FN9A 4TKUA 5FWXA 1WW3A 3U0WL 3TESA 2X9NA 2PO5A 2PBLA 4P82A 3NEOA 4DKEL 1L7EA 2P7TB 1JHVA 3OQVA 4G0MA 4MAYD 4P5SA 1BWRA 1AGDA 4C4XA 3O3BB 3TFKC 3FZEA 4DW2H 4U2FA 2C2KA 4N5DA 1VG8A 5KOVC 2E49A 1SC9A 5C46F 1LI4A 2FMIA 1XTIA 4YNYB 4L4VA 3SS9X 2G80A 3FYDA 1Y8RA 4I1SA 2D6FA 4JJOA 1YEKL 1Y8CA 2H1VA 1BA3A 1EO5A 1GU7A 3DI2B 1IQRA 2PZAA 4U1KB 3Q7RA 3VFMA 2YQ5A 2N75A 4QNRA 1Y1TA 5F2KA 1VACB 3IAM6 5C0GB 3V7AG 2P6OA 4NYJQ 3CSBA 4I7EA 4E5KA 5FI5A 3A14A 1P0IA 3BYYA 3OGCA 5L8VA 1G6OA 3K7UA 1XLTC 2WYIA 4U6VL 2WSPA 4LGMA 4G42B 3VTTA 2CMHA 2E0PA 3NRJA 3H7BB 3V4PL 1RPTA 1PT9A 1JGUH 3MRPA 4IRJD 3L48A 3BB3A 1MJ8L 2R1TB 1EHIA 1DARA 4QXPA 1WD9A 1OFIA 2JLBA 1LX6A 2GN4A 3I4LA 5K8CA 4WKXA 4URFA 2M8XA 4INPA 3K0AA 2HU7A 5JUEH 4N8DA 4YRDA 2IH3A 4RL6A 3VACA 1RI3A 2XNHA 3H1PA 5GGTH 1G84A 3DJSA 1U3YA 4Q6IA 1UMBA 3PSHA 3SHFA 2XTJA 3HCCA 3PC4A 4NXKA 2DQJH 2JCXA 4AJWA 1QK4A 2QJRA 3OLXA 3BFVA 3QHPA 3WK8A 1NP6A 5IUNC 3DGCR 4PYMA 1Z37A 2HZBA 3ZUCA 4ND1A 1XGTA 1ADQL 1VGKA 3QDMD 4KXNA 5HBBA 2RIRA 1TTGA 3W0WD 1JSXA 3D8RA 1N8SA 4HNVA 3D2TA 3VE0B 4MXQD 2CV1A 3RRXA 4DIBA 1TQ2A 4WW2C 4JLRB 3QP3A 5IKCA 2CPCA 1VLMA 3EO1B 4XP9L 3IDMB 1NBQA 4DP4X 3S8FB 5FM4A 4X7MA 3NHLA 4U0KA 4UDUA 1WBJB 1NCAH 4JR9H 3NCXA 4A2QA 1HPLA 4Q03A 1OYOA 4XBGB 1HKLH 2X9YA 1CW2B 1Q7GA 1JD7A 3JQAD 1KEGL 4RVOA 3BH9A 1PD0A 3C6KA 3LB6C 1OLSA 1ZN8A 2ZT9C 4OJYA 2VQ1B 5AFAA 3IDZA 1D8AA 1PYGA 1F6AB 4WI5A 2AXPA 1NE2A 2VJNA 3LT0A 4YGAB 2J31A 5I6LA 2JGLA 3L0PA 1RHMA 4MNQB 2WWIA 2QZ5A 4X6UA 1H15A 1U8FO 4FW9A 2W0FB 4AJ0A 2Y9PB 3EIXA 1ZRNA 3PFHA 3FFAA 1N2JA 4QZVA 1A4IA 2LV8A 4X7SH 4A36A 3KPSD 4HDIA 5CCBA 3JVEA 3E5RA 2G3MA 2ZYDA 3OE1A 5FB8A 3AFGA 5H4HA 4MMZB 2O07A 2EJVA 3HS0B 2WUFA 3QE0A 4AEEA 5FDWB 1CFQA 1L8QA 5F1YA 4S1RL 3DDGA 3H5NA 1UXHA 1DRJA 2QW1A 1HEZB 5FPPA 4LQLA 1B0IA 1IZ7A 5DYYA 2Q0QA 5AQ0A 1VCIA 2W9DH 4PJ8C 1M9NA 4RSHA 1Z08A 5ENDA 3BX7C 5BZDA 1E5LA 3RAGA 2OQJA 3WRYC 4KB5A 4B31A 3UJ3X 2IYZA 1RYFA 3A9UA 4YDMA 4YX2H 2ZP0T 1XR8B 2HA0A 3AOEC 4TV8F 1WT5C 1QOPB 2Q5FA 2WBXA 1RXWA 3JWOC 4GLOA 3GT6A 3L1JA 3LUDA 3LQ1A 4P23B 2UZ1A 2VNSA 4P3DA 5TGDA 4PGBB 4JT2A 3GDHA 1S7UB 3RP1A 3AG1B 1X42A 4QGSA 5EXSA 1UAYA 4AT6A 3V1KA 4P93A 2ODTX 3AVUA 5ADWA 4H8VA 4EW6A 2OZNA 4XNBA 4HNAA 1UVQB 1RZ7H 2B99A 2NVWA 4GRLC 2A30A 4B44A 2IH8A 3CIOA 3TN0B 3IMVA 1DVFC 4GG6F 4KO5A 4K6OA 3K9LA 4RPIA 1T0BA 4U2ZA 3UJIL 3NV9A 2G63A 1MFCL 3JV6A 3EJCA 3MN1A 2CSPA 1IVYA 4OHKA 5ECWA 3H65A 5F97E 4OQPA 1NUGA 2YRFA 3GT7A 3HY6A 4A8HA 1YEHL 3V3KA 3T1QA 2PMZA 4OBRA 4FC7A 1NUNB 2NNLD 3UJPA 1SSLA 2YYYA 5J3HD 2ZUYA 3EO9L 1T2UA 4DGYH 4KVZA 4NIYE 3PQYD 1P7WA 1IC4H 4BN0A 3EAKA 3AWDA 3KVRA 3IE9A 4EGJA 4V1CB 4Z4EA 1A3LH 2E6KA 2XWQA 4H8WH 2F7RA 4NSNA 1KPHA 3B2QA 3BWCA 1H2ZA 4H1LG 2Q7OE 3BH0A 5KZMB 1J05A 3SC4A 2Q7XA 3V4UH 2IBZY 4HF5L 1P4IL 5CP7B 2GEKA 4FE3A 3L8YA 3R4DA 2ATAA 2JLSA 4ER3A 3MZ0A 1E79D 2FMFA 4PU0A 2E9JA 5I2IB 1J1PH 1KP9A 4L16A 3C5XA 2SODB 1OGIA 4G83A 1ZKDA 1YC8A 2Z92A 3V9CA 2WKGA 3DM5A 2CUAA 4N22A 3ST7A 5TD4A 8FABA 3KV1A 1FEZA 4ZI7B 1C9MA 2OKGA 2BEVA 3FWZA 1R3LB 4P2OB 1XH3A 3F5QA 3RZCA 5BN4A 4EGFA 2ZWLT 4D94A 3RYIB 4GRWH 3GAZA 4LHUA 1JDBB 1KEWA 2CJSA 2O0KA 3PYMA 2OJEA 1CY4A 4YY3B 4HCGA 4P8RA 2HQRA 1XNJA 5FI3A 3ZT5A 1IEVA 2BNRE 4CEIA 2QR3A 4V0OA 3LJ3A 3OSVA 3FUVA 3A6DA 5DSXA 4J7CA 1MHEB 5HQ3A 3QRBA 2AG8A 3UFIA 2Y5EA 3HKCA 2FJPA 1U8LB 5GS0L 2F3TA 1ETHA 2IXQB 2CUIA 5EEVA 3F4BA 1I36A 2B94A 4NZYA 4KIUA 4KDCA 3O6KL 2BEWB 1AANA 1Y3FE 4ZUWB 1MLBB 4YH6A 3P9ZA 1ZAYA 1UZLA 5I66A 1GWNA 1DJOA 3QHAA 1YUHB 3M5DA 3VU1A 4E5XG 4UAVA 5B53A 3QIVA 3AQIA 3CZMA 4HQFA 2QGBA 1GPBA 3GXUB 4WZBA 3MUHL 1G2OA 1W8EA 4KH1A 3QVWA 3FU7A 4RFSA 3RKRA 1AUVA 1BZ9A 2BNQE 1D5IH 3JWPA 4RU1A 2YPKB 3JTEA 1VSCA 1G5GA 2I6QA 1R4ZA 1QHOA 4RVCA 4NNYA 1JVKA 1P84K 4KQIA 2FNAA 3MVEA 3BFXA 3KKQA 3BCHA 2QTBA 5KSYA 4MYHA 3B89A 3LRXA 1UDCA 4YMLA 3KBBA 2NUPB 2X0UA 4RSYA 4BFYA 4ITUA 1QDEA 5A7EA 1EE1A 1W72B 3KPNA 4MDJA 2E7LC 5DHAA 1KRHA 4L29B 2LDBA 1WA5A 2AFNA 5J2TB 2GXUA 2NV2B 4UQ2A 3ARED 3EARA 1ND0B 5K9OB 12E8L 1ZM4A 3WNCA 2X4TA 2X5NA 3R6LA 3MTAA 2G70A 4OK6A 5IVXA 2IU6A 4RAUB 2MFNA 5A4JA 5CBEB 1ZGLM 1D2NA 2O1EA 3EWIA 1HT2E 4X5XA 1Y98A 2CCVA 3C8DA 2FFJA 2BFVH 5IVXF 4BMZA 3QEAZ 1J7JA 4JOQA 1P2CB 4Z0BH 5H82A 1C7FA 4YCJA 3MOBH 5D1ZA 4JVSB 4Z9YA 3TINA 4KR3A 1ZSHA 5E2AA 5L53A 1A4KB 1UBNA 1PJ9A 4Z8FH 1NFKA 4BMDA 5BYKA 4CJXA 1TM7E 5AOAA 5ISZE 4ZVMA 2WT4A 4K9EH 1B00A 3D6AA 4PV9A 1MCQA 1OFHA 3JQ7A 1UBUS 5IVIA 1FAKT 3R3XA 4A7GF 3TYFB 3BJRA 3OKOB 3IFPA 4BVLA 1CFJA 5BXFB 1ZUIA 4NBTA 4NAVA 3KNBA 3EGOA 4G8EB 1M7DB 2Z6VA 3NANA 4LZKA 2DBLH 3K71A 3CSDA 3HY4A 5I7OA 5IW8A 4ANKA 4ODSH 4YCSA 3ORHA 1G4AE 2P52A 5F3HB 5KVCA 1J9EA 4AXWA 4FC3E 4PREA 3F46A 2R7EB 4ENRA 1IE5A 4BYMA 1JHXA 3ESRA 2GXAA 3EEYA 1J33A 4PRPA 4N8UA 4DKDC 2OMXA 1XZCA 5D7LD 3TNNA 1ZISA 1PW3A 5KAQG 1MRNA 3GGCA 32C2A 5E2UL 2VR9A 5EZOL 1AIPA 3PIQB 1E79A 1SVNA 1JK8A 4K8RH 4QT0A 8AT1A 1BD4A 1PLGH 1N4DA 4JFYA 2IAAC 3KJIA 4Q37A 5KCZA 3EXFA 5F8RC 4PO8A 4DSNA 4MRVA 2H1XA 4JSRA 1P1VA 4S2SB 2YL2A 1W15A 5K1JA 16PKA 3NEXA 4QKXB 3TBWB 3HVHA 3PFFA 4CTJA 1HSBB 4GX2A 1PNCA 3BFJA 1CLUA 4YALA 4N76A 2ZUVA 2PMFA 1N25A 1IM3A 3HYRA 3CFKA 5ABDE 5EP3A 3Q15C 2J7PA 3V0VB 3GAFA 3K53A 2B9AA 2F59A 4KZDL 4KWEA 1M2HA 4ZGGA 4RZXA 1PEAA 4YPJA 4H7KA 1KOGA 4LLMB 5HGJA 4JFDA 5HJDA 2BSQA 5LC1A 1CJYA 1I4FB 4X9IA 4P2OC 3BJZA 4TMYA 1DKUA 3T8VA 5J2TA 3F49S 4NCKA 5BPHA 2JH3A 1EHLH 1I3MA 1XEDA 2G4GA 4KVGA 5AZ2L 3WGJA 2Z8YM 1LK7A 1V6SA 3A4IA 5JORB 1MG0A 4FNLL 3CO0S 4YS6A 1A5ZA 1GGCH 1I9GA 4FNSA 5A5VA 3MGTA 4YSCA 3NJ8A 2ZE6A 1YMQA 5JHMA 4K2AA 1RLIA 3A6OA 2GPJA 3Q41A 1B43A 1LPAB 2JI6A 1ZHLA 5IJ9B 4L4VD 3HDGA 1QP4A 4P2RD 2F6AA 4QELA 1RFGE 4ADGA 3EO0B 4BRZA 2JD2A 3LVBA 3PXUA 3DEYX 5MEOA 1AYOA 2ZWMA 2PMKA 3TQQA 1HYSC 1FRQA 1Z4QA 5DVMA 2HK8A 5CIPA 4XDZA 2ONJA 1E6LA 1Q9WA 3BD4A 5EIBD 4BFCA 2AJUL 4IDNA 1Y6KR 4KR9A 1LRJA 3DGGB 4XN9A 3OQRA 4NJ9L 2CHDA 2VC2L 4RQQA 3B7UX 4XVSH 3IETA 3L8FA 4QQKA 1QCYA 2X1MA 5JMRA 4XKJA 1J9ZA 2WW8A 5FR2A 3U7IA 4CQNA 3FZQA 2QENA 4KJYB 1JE1A 2E8ZA 1G7IA 4YPGB 2QVGA 3ZQKA 4DUGD 5D3KA 4ZT4A 1UTDA 2C4KA 2QRMA 5I1DB 4NQRA 2UVPA 4PJEF 1X6VA 3UBHA 2PK3A 3D54D 2PO6A 4LDLB 1DIAA 2O5NA 4XM1A 1RD6A 4UOW1 5FNZA 3ORSA 1RHFA 2J1XA 2TMYA 3O3BA 1G9EA 1IL0A 4JFFA 1S9VA 3KOOA 4UUJB 4QEGA 3L4BC 1LDPL 2R56H 4I9WE 3GHHA 1A3ZA 1FV1B 3DOUA 1J0DA 4MXVF 3VGAB 1ULAA 1A7RL 5LU8A 3A6ZA 2ZKHH 1CULC 4QOHA 5MI0B 4Z3OA 2G04A 5JAHA 3F71A 1GZPA 4HI0E 3LG2A 3SD5A 1DV2A 1UACH 4X7RA 5L9AA 1K9VF 2D4DA 2GJAA 3KC2A 2J88L 3QW2A 4XB7A 1HE1C 4TNVK 3FB7A 4JHVA 3BAZA 1CXFA 1HU8A 1M7IB 3CH1A 2PT7A 2JKIS 4NZ8A 1E0AA 3Q87B 2B8WA 1QR1A 4QNNA 1V05A 4AKIA 2GBUA 3JWOH 5FH9A 3JWIA 1U93B 2HN7B 2DUWA 5I1KL 2XIBA 5C0BE 3TPKA 4NQEB 3UJJH 4D79A 1MH1A 2FLVA 2WYVA 3D33A 3JD1A 5JCOC 1CT9A 2HSGA 4L3OA 1Z3GL 2Y24A 4YHZL 4DLZA 3EO9H 4A6DA 3GLIA 4I4NA