3ZE2B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
469
structure length
469
Chain Sequence
b'NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 115
structure length 469
sequence length 469
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze2B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze2B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze2B03
3FCSB 3PPVA 3IJEA 1DGQA 1MJNA 2I6QA 3GXBA 4F1KA 1PD1A 1N9ZA 3OKWA 5KYUA 3ZE1B 3QA3E 4HQFA 2VDMB 4GZ8A 3EG9A 4G1EB 3T3PB 1RS0A 3EGXA 3IBSA 3IJEB 2IUEA 4MMZA 3K72A 3BQNB 4CN8A 1AO3A 5KYUB 1RRKA 5HJ2A 3T3MB 3EG9B 4C2BA 3EGXB 4PN7A 2VDKB 2VDLB 1ZOPA 4JDUA 3V4PB 2UZYB 4FX5A 4MMZB 3K72B 1BHQ1 1XUOA 1IDOA 4A0QA 3BQMB 2B2XA 5LN1A 4NEHB 4HQOA 4F1JA 4IXDA 1DZIA 3K71A 1PT6A 2ICAA 3NIGB 3ZQKA 3ZDZB 2X5NA 2VC2B 3V4VB 1XDGA 3PPXA 1QC5A 1SQ0A 1MHPA 2QTVA 2NVOA 3K71B 3VI3B 1UEXC 4UM9D 1FE8A 3NIFB 5E6SA 3EH2A 1NA5A 4O3TB 2WINI 3Q3GE 3EFOA 4HQNA 1ZONA 5KYYA 1QC5B 1PCXA 1L5GA 2XWJI 1IDN1 1ATZA 1IJKA 1JV2A 5E6SB 3ZE2B 3K6SA 2VDOB 4Z7OB 1OAKA 1Q0PA 3F78A 3N2NA 4C2AA 1YVPA 3EFOB 4BJ3A 3ZDXB 5ES4B 5KYYB 3AFCA 3ZE0B 1SHTX 4XW2A 1L5GB 4MMYA 2M32A 1JV2B 3HXQA 3K6SB 1TYEB 3VI4B 3EGDA 4IHKA 3NIDB 1MQ8B 5KYNA 4JX0A 3M6FA 4Z7QB 3TW0A 2ODPA 3TCXB 4MMYB 1JEYA 3RAGA 1LFAA 1ZOOA 5E6UA 1CK4A 2XWBF 1JEQA 3NVQA 3EGDB 1OLZA 2VDRB 4M76B 3TVYA 3HI6A 1YVRA 4O3UB 3AL8A 1QCYA 3F74A 3AL9A 1M2VA 2P28A 1AOXA 1JEYB 5E6UB 3FCUB 1JEQB 3PPWA 1YUKA 2P26A 4CNBA 5KYXA 1IJBA 4CN9A 2ODQA 3AL8B 2NUTA 2O7NA 4WJKB 1M2VB 1N3YA 1M2OA 5KYWA 1BHO1 4UM8B 1RD4A 1AUQA 1FNSA 3OL2A 1JLMA 4K3JB 1T6BY 3TXAA 5KYXB 2XGGA 1SHYB 2VDNB 5BV8A 2NUTB 4HQLA 4DMUB 1MF7A 5KYWB 1M1UA 1MQ9A 1RTKA 5HDBB 1CQPA 2I6SA 3OL2B 3EOBI 4O02A 3ZDYB 1U8CA 4NENA 2WW8A 3E2MA 5E6RA 4WK4B 3OKYB 1U0OC 2NUPA 3EOAI 2ADFA 4G1MA 1PD0A 3HXOA 4MMXA 1M1XA 1T0PA 4WFQA 1M10A 4WK0B 4UM9B 1SSLA 4O02B 3BN3A 4C29A 1U8CB 3FCSA 4NENB 1XDDA 2VDPB 5E6RB 4HQKA 1SHUX 2I91A 2NUPB 4IGIA 4G1MB 3PPYA 5HGJA 1U0NA 4MMXB 1M1XB 2VDQB 4Z7NB 1MQAA 4WK2B 1V7PC 4G1EA 4FWWA 3EH1A
chains in the Genus database with same CATH superfamily
1I4FA 1MLCB 1RURL 4LV5B 3Q5GA 4Q18A 4C56B 3IQHX 1SK9A 2Z6AA 1OXUA 2FW6A 5AESA 3QE4A 5TQ0A 3WNIA 3WRYA 4KXQA 1YQVL 3QIBB 1YAZA 3FWKA 1EQAA 4NWIA 5BO1H 3F5DA 1G6OA 1I9JH 1PR4A 1KGCE 3TRHA 4MRAA 2QLBA 4NZYA 4CMJA 2E7DA 4WEMB 1T2EA 1MWOA 4J3VA 3AW5A 3C3YA 4LHVA 3TZBA 5KKNB 1UCBH 1T5XB 5E7JA 3BAJA 2WJPA 1KYOJ 3ZDXB 2V9ZA 1WABA 2ALAA 2G9QA 1TM2A 2NW2B 2E18A 4YVUA 2XE8A 2N7BA 4GG6A 4HU2A 5JS1A 4Z3FA 5K3FB 1B3IA 2XNCA 1DJGA 2P1ZA 1IXSB 2C88A 1BRTA 3UY4A 1FVFA 2ACEA 1L3WA 1Z0UA 3PWKA 1CVSC 2HVJA 2G0NA 1JW9B 2P26A 4CG2A 3PGMA 4INJA 1LD3A 2PSEA 4HC4A 5D7IE 5SV2A 5FIUA 2BNRA 1W47A 4L8BA 3KT6A 1FIGH 2DZEA 1PWXA 3ELQA 1TFUA 4FJ2A 1SBTA 3ZE6A 4FKMA 3K4HA 4FNOA 2CLMB 3GSQA 4JKNA 3G5VA 4MKXA 2G5GX 2CWWA 1W0YT 1UH2A 2FEMA 1SEBB 2VLKB 5DR5H 3VB9A 2JI7A 2PH7A 4YSRA 2QMEA 4HKZB 3L1OH 4HIQA 4GS7B 3ETGA 2ATEA 4M6NH 2X87A 2OX5A 3HU1A 4YALA 2JFZA 4PO8A 3FXAA 3C7CB 1S89A 5F23A 1U3VA 3CH8A 4YZFE 2Y1FA 1QFPA 5KYVA 2ZCJA 4A2MA 4ELMF 3EZNA 1U5BA 5TE6H 1F3LA 4XCXA 3VO8A 4BJHB 1RZ8B 2Q76B 3JVFC 3KQHA 5I3CA 4NOFA 2WWTA 2YWEA 4JM2B 3IAM6 2C8NA 5I1HL 4O4JA 5GS1A 3H8JA 2QQ0A 3EYQD 2XWEA 5C0IA 2CFSA 4UJ5A 4FG6D 5CR9A 2XWJI 3CW8X 1PY0A 3O2NA 4UBOA 3QUML 1P7CA 2MFNA 3JWJA 3WFCH 4DIEA 4QRSA 3B2QA 3L8DA 2DEWX 4QBFA 1RLTA 1V3JA 3QA9A 2IX3A 1FSSA 5L8VA 1QIJA 3MU3A 3E3LA 3V2HA 3S6JA 2BKVA 2LRHA 4E6EA 3BVTA 3F74A 1BAWA 1F4XH 4G42A 2GW5A 4LO9A 4P2OA 1FNGA 3CVIL 1A9XA 1M2VB 1F8YA 3OZDA 2EYTB 4AX3A 3HI6H 1C3OB 2LGNA 3P0IA 2D59A 4DW2H 4Y1RB 4IAOA 4PGGA 5AVVA 4Q66C 2B59A 2JI8A 1TQHA 4MIKA 1ZGJA 3BD9A 2X6BA 3GIWA 3ZI7A 2YEZA 2ZIVB 4WJ5B 1SXGA 5LPNA 4NATA 4U2CA 2J1ZA 3F9RA 1AG9A 3BPOB 3N41B 2CH8A 5JMOC 3PPYA 1M73E 3HVIA 3KNZA 1WEKA 1A50B 4B95C 3EB9A 1S3RA 2X9NA 4NYJR 5EGNA 4OAOA 1ZNQO 2QVCA 2A9ML 5HI3C 1EX7A 1G7JA 2NSYA 4PN7A 4V2IA 5DVPA 2PL1A 3KOUA 3S2EA 1GCYA 5IW1A 2W71A 4LXGA 4BVAA 4G7VH 1E0OB 3W6UA 3E6FB 4FVTA 4CN1A 4X4MA 5C08B 2QV0A 4OM1H 3V52H 4JJKA 4UMDA 1LSSA 1WU7A 3K6FA 3JQ7B 4UTBL 1XWWA 1AACA 1SJXA 3IDGA 1NNEA 3HWSA 1RR6A 3QJGA 1T6NA 2LD4A 1QO9A 1JHXA 2YHSA 3LVEA 4NC1C 1DEEB 4RJIA 4P6VF 1UKYA 3TQOA 3ROTA 1U8YA 1RIHL 2BIOA 4CR8A 4PJIE 1HZHH 3EO9H 3EOBB 3W9DA 3S8MA 4KIFA 3LQ4A 1P2VA 5H35A 2RHJA 3A6EA 3AT8A 3HO6A 5KMGB 4YIHA 1OF0A 3DJ9A 1PLGL 3VD0A 1RI4A 3F8SA 3C7AA 4HVBA 1U6IA 1O0SA 2W0KA 5IIEA 4X7SL 2DCMA 1CDCA 3S34H 1CY7A 3WS7A 1NX9A 4ESVA 4KUHA 3T7KA 5FM5M 2QD1A 1C9YA 5IXYA 1FDTA 4FCWA 2K1MA 5CDSA 4RVFA 1R33A 3OBIA 5IBLD 1Q20A 1G7CA 4ALAL 2AN5A 1PGQA 3DO8A 3B60A 4W7HA 4UBDC 3OM9A 3ZY2A 3VGAB 3STUA 3Q6MA 1M5RA 5KQGA 1MWAA 3BGIA 4Z1OA 4OL9A 1A5TA 4JPKL 3QKUA 4Q7EA 3O0DA 4YV1A 2KKQA 1TVKA 2X4QA 4Q9QL 3CV3A 2Q0HA 4ZTZB 3H84A 4RGMB 4G67A 1RI8A 4Y4HC 4APXA 1RI3A 5EP1A 4QM6A 1KB9J 1IARB 2XVLA 1IJ9A 4XWGL 1F8GA 3QY0A 4CBPA 4QF1A 5CCBA 4LU5H 4X98A 1NDMB 2V96A 1UKBA 2NT1A 4N0MA 3W4JA 4WLVA 1H2RS 2EF0A 5SYMA 1I80A 4TRRA 4HLJA 4WNYA 4L8GA 3OPZL 6AT1A 4R51A 3QUYB 1I1RA 3T77B 4BNFA 4KJZA 1OAYL 1C7IA 3IVGA 1E58A 2YJQA 3FYIB 3PPEA 3RVKA 1Z4MA 4JLJA 2MSKA 3BFJA 1ZOSA 4JG0H 2BFDA 4EJMA 1QR6A 3OMWA 2V7HB 4RISL 4C7OA 3EWSA 3D02A 4J4PC 1P2SA 4OZGE 5BMVF 5B30A 4N0DA 1ZW6A 4X6DE 6ADHA 3NDBB 3RVQA 3T1NA 1FVCA 1F2UB 5IEKA 1CETA 3RTDA 3QJHA 2VUKA 2ZX9A 2AQTA 1EBAA 4NFLA 5IF0B 4LCWE 2K7PA 2ROXA 4OMCA 1WISA 3KSUA 3ZXSA 2H51A 4AL8C 4B6QA 5JXWA 2VHQA 3K92A 3D4BA 4JLNA 1VYUA 2GLTA 2YA1A 4L3WA 5TTRA 2NYUA 3GZOA 5E03A 2ASVA 4RE6A 1TNDA 3NN8B 3RJOA 3CFDB 1NMAH 5I7HA 5C0RL 1RZGA 1NGQH 1O2DA 1FC1A 5AKHA 5CA0B 3PDOA 4WXEA 4DP6X 4QT0A 1QAQA 4TT3A 4UU7A 2NLJA 1T36A 5E2WH 2R6HA 3CT4A 5SWQB 2QEQA 1MCRA 4LLQB 1PG7X 3ARDB 4KI7A 5DZJA 3F7PC 5E5MA 1E27A 1R6VA 4DESA 2QM3A 1DFIA 4TLCA 2JFXA 4D0BB 3V80A 3O8RA 4UUQA 2Y1AA 3ZRCC 2AQPA 4LRNL 5DUML 1RQRA 2TYSB 4YPOA 4Z7UA 3HH8A 1QSEE 4WI3A 5C07D 3QUYD 4ZFZA 3OQVA 4JPIB 1JR3A 3ORRA 3HLAB 1H22A 5CFMA 1NW9B 3L18A 3SDCD 3VFTA 3BJRA 3ZMNA 4MNGE 2FGKA 2ODPA 4RQUA 4KU4A 3NFPB 1GXEA 1ITZA 5CYPA 4GRWH 3ZV7A 2IYAA 4OHZA 5AWFC 3ASOB 1G94A 1QFUL 3EULA 5B2ZA 3D33A 5AOCA 3H1TA 1KFJB 4DGSA 4ZQTA 2Y1YA 3T1YB 1D2CA 2NY0B 1CLEA 3IXMA 3LKBA 5LAXB 4WCYL 5A40E 2OZEA 2WF8A 3FD8A 3H1PA 1IY1A 1URLA 3BD3A 2QZ9A 2HYIC 2HT4D 1HZZA 3E3AA 2AMGA 4DP0X 3STLB 3PHCA 1MREH 4XYLA 3DEKA 1L4FA 2LW3A 4FD0A 4R0LB 4R6WA 3BO8A 5KJ4A 3OT1B 2C9OA 1DKRA 4RPCA 1UBJS 4JB2A 1FL6B 3BRCA 1DQZA 2WIIA 4WLFA 4KPHL 3TAUA 4NESA 3UACA 5FUCE 3RURA 4KXZI 4Q7DA 5IMLA 1NC1A 2AJXH 1KIUA 1QKIA 5DWQA 1FP5A 4JUIA 3TLAA 3AEQB 2ADJB 1NTDA 1UC9A 1GTG1 4B6EA 3IS3A 3E7DA 2O5NA 1TCBA 2YBEA 3FT4B 5AW7B 4OFQA 4K88A 4XBPB 3D0VA 1U7TA 3QC6X 2QI9C 1Q57A 1JIBA 1ZKAA 3GA0A 1ND0A 3PWSA 3E8XA 2GK3A 3Q8XB 3B56A 2CXXA 4XMLH 4KGJA 3IDJA 3VB8A 5IVPA 3M81A 2QLTA 1DUVG 1CQKA 4G8GB 5ANMB 2FLVA 4WQMA 2ZDGA 1OIOA 3PUHA 1F41A 4NT6B 3RL1B 3NX4A 4KC0A 4L5CA 3DZGA 1U2ZA 4MS1A 5EIIA 2QHRH 3U1QA 2VZSA 5IULC 5KSAC 5CMAA 1M5UA 3W5NA 4ZDKA 2PT5A 2WMPA 2NXYD 4OBRA 4NO0D 5IT2L 3KUCA 4XVRA 3HI1A 2YD7A 4L8VA 3W0LB 1EAOA 2ZAMA 4ZT1A 1OAJA 5LZ7A 5IUKC 2HX1A 2ZUYA 2B3TA 1EVJA 1Y5IA 3PXGA 4ZO8A 1CXZA 2FXIA 3WMGA 5FUYA 3GSOA 4M56A 5LBSH 3H1AA 3ARFA 2EOAA 3EC7A 2QQLH 3AUYA 4XLTA 2Y4NA 4R7DB 1OLXA 4IKOA 2R0WH 4FZ8H 3CR7A 2WAYA 2PGLA 4L4VE 4UVGA 2VDPH 4JREC 4W7IA 3ZPDA 5I9TA 5AKVA 1XVUA 1SO8A 1SXPA 3GPBA 4L8BB 1CBVH 3RYHA 3D4IA 3GPDG 4YJHA 3MCUA 1ZVSB 3MV7A 3X1FA 4DGIL 4K8OA 3WGVB 4RKWA 5EG5A 1Z9MA 3ELDA 5ID1B 4G8FA 5SWZE 3X13A 2WWHA 3S5UA 1IM2A 2QMOA 4M9RA 1WCBA 4FOOA 3NIGB 4P2RE 1IO4C 2FUNB 2FSGA 4RXTA 4DHWA 1J1XL 3IXTA 1IPEA 1ZK4A 1JHLH 4ZEMA 3PREA 1KSFX 1ZIOA 2O1XA 1X80B 4OXQA 1T15A 2H7XA 1I3GH 5AZEH 4DGYH 4AIZA 4DLYA 3AVEA 3N5AA 3QUSA 3SX2A 3H9UA 4GG1A 4M7JL 5JHBA 3CNNA 2NTYC 3U9LA 4DVRL 1AOZA 2FSFA 1IGFH 5A06A 5ADUS 4ODWB 4XPIB 4NN7C 3BRFA 1UJBA 1WO8A 2K45A 3TAHA 2R00A 4WFFD 2J67A 1JKXA 2G3ZA 4EHNA 1QDLB 1AXTL 3MDJA 1JNNH 2VRKA 4BSWA 1FW8A 4DZTA 3OB0K 1IATA 3TYFB 5T3XD 3GLTA 1YEHH 4BKMA 5D3MA 1SDAB 3WBKA 2NNXA 4ACTA 2DF8A 1A7JA 4RSYA 1VOTA 1E94E 1ETHA 3BRSA 3IMCA 1MI5A 5C0EA 1P8AA 2B5WA 2OOSA 4JRYE 3ZU5A 3W06A 1FQJA 3PNVA 3DXXA 3OAAA 3AF6A 3AC0A 5CZVH 2PLRA 3ESAA 4P2OB 1AO0A 3DM5A 1IBYA 1VE5A 4E1BA 4FFMA 5IB3B 4O0MA 1IOLA 1IKOP 4E5KA 1PBTA 4HTAA 1U8IB 1UD4A 4J3OG 1FH5L 1D5MB 4HCRL 4PJEA 1XJWA 3PHGA 4X62B 4EP1A 4QTUB 2GHWB 3KPRE 5E9JA 2L69A 4BWTA 2D7TH 2BNRD 2QPOA 2IUYA 5KTNA 4ZV4A 3TZQA 2BHUA 1U1IA 5DS8B 2OM2A 5T5FH 4FIDA 3D7KA 2CDNA 4EUPB 3MLAA 4DV0B 1W72A 1FS6A 1Q0LA 2LVCA 4HJTA 2JCBA 2XV0A 5I9IA 4DJEC 3NHJA 3L6DA 1OCEA 1YTUA 1MQ8B 2Y7SA 3KPOB 4LCUA 3QAZB 4NDNE 4JMLA 2WIAA 3EBAA 2PQMA 2EZ0D 1YU6A 4PYJA 3UROR 4F5CE 5IBUB 1KMHA 4MJ5B 3H3PL 2BBTA 4O25A 1MCPL 2V3WA 3NHYA 2H1VA 1M1NB 2WTRB 2JLLA 1UBKS 5DK6A 5GRJL 2EBHX 1XF3A 2Z08A 3LDBB 3V6ZA 4AYWA 5DYIA 4PJ9B 2FUCA 2A83B 1MHCA 3P73A 2FBJH 1KG0A 1WWAX 3JZ7A 2DM7A 5CD3B 1E59A 1SOXA 1LJ8A 3B7UX 2W2VA 2GPJA 4WN9B 3EZJB 3GG2A 3CWZA 1Y3BE 4YBHA 1JIVA 1QBGA 2IDTA 4LB8A 1REIA 1VFOA 1U93A 2AJZB 4LI0A 1BU8A 3MRGB 3CU7A 4NZUL 2F0CA 2VG8A 4FMCF 1FYTB 4OI1A 3QBJA 1YDGA 4DCJA 1E5YA 4P2OD 4DHLA 5C5EA 2A2QT 4TKZA 4JOBA 1PJSA 3OKFA 4WKBA 4N5UA 4N3CA 1QWUA 3LS4L 3ZHDA 1O7JA 5CAEA 5HVNA 5KAPA 3ZHVA 4ZCMA 5AW4B 2WO4A 4LX0A 4CGYA 3BKYL 3TBBA 5DMGD 1CT8B 1FBTA 2ZJSH 1C7ZA 2V6GA 4U1GC 1HI6A 3HB4X 1MF2H 2ZQ5A 4ML3A 1FNSL 1ZGCA 2ZIWB 2BFPA 3V0IA 2WM2A 4AF8A 1KXTA 3IFNH 4UQOA 3WY9A 1SGKA 4PREA 5IP4A 5HD8D 1E96A 3H9EO 3WSQL 1OT2A 4BFLA 4Z78B 4FNAA 3RYFA 1VIAA 5IT5A 3C3JA 3V8MA 4YQXH 4A2EA 2P6PA 4IDPA 1AN0A 3DX6A 4S05A 4YDKL 5BRZB 1FF9A 2R6JA 2N1MA 4Y9GA 2YR3A 3ORJA 4HOZA 5FWAA 1NAML 4NZNA 3M5DA 5JC1A 1ZHLA 3ZWXA 4IQGA 4J28A 2FUEA 4L7QA 4PJ6A 1CU4H 5ETJA 3BVPA 1P81A 4B0MB 3K6RA 3HCNA 3K5RA 3MRNB 3T1WA 3WWPA 1RJFA 3WGNA 4QI3A 3N0WA 1BIIA 1S4IA 5IROA 3V7FA 4ODXA 3VVWA 4HC1L 5FUZL 3CZUB 3KHKA 1KACB 3Q0EA 3R44A 1ZJZA 3KPUA 3KQPA 2DWDB 5HF6A 1JAIA 1WZIA 2AW3A 4OZHE 1ILEA 1CFNB 3ATDA 3UK7A 1N0LB 3IDQA 5CIYA 4AGMA 4NJMA 3SE4A 2OPBA 5DW0A 1FE8H 1QLHA 3K30A 1GR7A 1M0WA 1TF5A 1I6MA 1SCNE 5ICEA 2PGAA 3OJMB 4GZ3A 2WXQA 4B27A 5E4EC 1XD2A 2NLJB 1ZGBA 3NHKA 5CILH 2FBOJ 1TCUA 5GSVA 5BP7A 4KQMA 2OWEA 1QNZL 2HWKA 2DYSB 2JB5L 5FPHA 4HIJA 4RKQA 5FUMA 5G0TA 1KZYA 5AVUA 4ZUUA 1YE8A 1CDEA 4BBAA 4DXDA 3QSYA 2IH4A 3R8CA 2RE8A 5ETUA 5BW6B 3AUVA 2WWGA 1MIEL 2AA3A 4FDVA 4O3FA 4QD3A 2JEYA 4OQ1A 3QQ9D 3CWGA 3MLVH 2O0LA 5KQSA 2Q5FA 4DYVA 3TXAA 4OQTA 4E7PA 3PE9A 1OC2A 2Y9MB 3H87A 4EVQA 2JJMA 2VDQH 4Y2OA 1RYNA 4NICA 2KL6A 4NVRA 3JQPA 1C7TA 4KXUA 1AHKA 3RS7A 1NIDA 5ITVA 4P5MA 2E49A 3QX8A 4W1QA 4ADGA 1KHTA 4GXUM 1G41A 3FTZA 1Z6GA 4INOA 1JNYA 4HIPA 4Y16C 4DC1A 5EIOA 1WC7B 3ROLA 2BPBA 4MUKA 3H18A 1G291 3EDQA 4UCXA 1NN1A 1S7XA 4G0UA 4LKRA 1XJQA 1NKTA 3TOZA 4GL4A 2O23A 3THXB 1SVLA 2O59A 4A6EA 5K8JB 2OKMA 4MA5A 2BTOA 1ZN2A 1XR8A 1BREA 1JZ4A 4P36A 4YLYA 1UWCA 3Q9NA 4UU0A 4TMPA 2MNJB 2WLHA 2W6NA 3HKBB 1Z2EA 2AJUL 4J4HA 1NUNB 2NYYD 2OMWB 2UXFA 3ZZMA 3DMGA 4JU9A 4B3GA 2JLPA 1GAJA 3NVMB 1H3GA 4OFIA 3ZTDC 1T43A 2FGJA 3NTXA 4WJZA 4UNVA 3ZWBA 3WGTA 3HHSB 2KMLA 3SJVE 1EJ0A 3O0RH 4JJ7A 4B45A 5DEGA 1X6LA 2I22A 5MGNA 1O7VA 2FZGA 3QS3A 4TT3D 1BE0A 4QHKJ 2UYQA 2VSFA 5L53A 4YFYA 4TVPL 4CQNA 4N0EA 4A27A 5JALA 1JJFA 2FCRA 5JD6A 4X5WA 1EAQA 1A27A 5PGMA 4NYJQ 2CNOA 3CXHK 4BRSA 2JAHA 1VCNA 3IQZA 4HJEA 3FU3A 3LP5A 3TV8A 3ESBA 2O9JA 3VHXA 4MJXA 3GIZL 5C0CA 1R0AH 3EGSB 4BH7B 4I1VA 1OLUB 5C0JA 1F9AA 1JR3D 2OO5C 4MMXB 1E3FA 2E21A 5EJ4A 4HJ0C 3F5WA 1QLRA 2W07B 4BBJA 4RDBA 3FVTA 2H11A 3PP3K 1HINH 1GGIH 1ACXA 1KO1A 1RRMA 2O0HA 3TEWA 5EQDA 2HMTA 5K1NA 1XNJA 3MJWA 4YHOH 2PMEA 1JFQH 3K71A 1Q15A 4HCFA 2C7PA 4KAXA 3EWIA 1BAFH 4HG4K 1JDAA 3ASNB 3OXRA 4HWPA 3WN5A 4LHEA 4F3RA 3K0BA 3HG1E 1S3SA 3LQZA 2WHPB 5EB9A 5DYOA 1NDHA 1XEXB 4K9EC 4R8KA 4L3FA 4MAYC 3PE4A 4DV4B 5AAPA 4J90A 3GHBH 3CUUA 1YAHA 1P5UB 5LLSA 2JLSA 2W88A 1E4YA 3HN7A 4G8FB 5I19H 3L7LA 1OGTA 2OXGB 5LGKA 2H1CA 2RGDA 1OXBB 2JKLA 1EGAA 4LYYA 3L5WA 2WPGA 2N0SA 3QUQA 3KSBC 3DHVA 2ECPA 4CR7A 2E85A 2PNJA 1PG7L 1YEFH 4XVSH 4PRKA 2H2FA 3MWGA 3TOSA 3B7RL 4OKVB 1FAIL 2CVOA 1BAGA 3PD0A 1NW5A 1U9ZA 4XDHA 4Q02A 4RMJA 2ZP0T 2A2ZA 2L42A 2WLTA 3KTFA 1M1XA 2NZXA 3F8UB 4JDEA 2GRUA 5L45A 3KLLA 4D25A 1J2YA 1DAIA 4IGIA 1QSFB 2FUTA 1NLZA 1WXXA 4FFDA 4JFTA 5EWMB 2DLDA 4JKMA 4W4OC 2ZTVA 4H17A 4XP9L 1LDMA 2Z9DA 5BMOA 1E9CA 3NS7A 5CHEA 5FUXA 5JSZA 1PJTA 3BILA 3WYAA 1VBFA 3A0RB 1GARA 4Q74A 2ZYRA 5E8EB 1LP9E 2WJ3A 2CR6A 3DTVA 3DBOB 5KJRL 1V11A 2C3MA 2XKJE 4HUCA 4OJQA 3LWZA 4BLWA 3U4EA 3RNOA 1IAOB 2DMGA 4MUGA 4BEWA 3EYOB 2AQ3A 3RFUA 1DUZB 5LOVB 4DR4B 1PJ2A 4QL3A 4L3EE 4XB7A 3UGEA 3HDVA 2CK2A 1BDBA 3ARFD 4L2IA 2JWYA 1CF2O 3SS9X 2WTMA 2Z5GA 4CM5A 2ZAYA 3CUSA 3I34X 5EE0A 2AUTA 1P18A 3W79A 4HHGA 4UQ2A 2QYHA 3IODA 4EIWA 4KY2A 4JVLA 1SOSA 4L1DA 4S2UA 3LC0A 4YRZA 3WKBA 1PGJA 3OQIA 3ARUA 4HEHA 4F8QA 1TIUA 4NUJB 3MV7D 4RVNA 2X0RA 4PI2A 2Z91A 4GRLB 2WV3A 4OP1A 3RVJA 2PO6A 5EU5A 2GHTA 3IAEA 1JZ2A 1PWHA 1GLVA 4JQVA 3WUWG 4XO4A 1LVEA 2CDFA 1HFUA 3KP1A 5ENVA 3WQRA 4C05A 2J1LA 5I0ZA 3HP1A 4JOCA 3NAGA 3D3WA 3NJXA 4Y5YA 1CUYA 1YD7A 4I13B 2VZOA 5ALZA 1TENA 2Z4QB 3ECVA 2Z8RA 4LI3X 3I6KB 1FXWF 1KZHA 1P3JA 2HMIC 4GMKA 3QIAA 1Q1ZA 3O6KH 3CFYA 1E92A 5HIJA 3L3JB 1XF3B 1T6YA 3OZVA 1YZUA 4W6WB 3OKEA 1NFQA 4WL0A 4QTHB 3EJCA 1C3LA 4P5DA 1KG0B 4XX1E 4MHSA 3U83A 1XZKA 1KIAA 1Q3KA 5I76A 4MDFA 1YNKL 3P30H 3ADPA 1TQCC 4XZ3A 1GDTA 3RROA 2X3CA 3FTEA 4OOEA 2WZ5A 1SKYE 3LNFA 2XKUA 2HHHB 2LDBA 1MI5D 2RB4A 1P7HL 1SU4A 5C7YA 3PWJB 4ND3A 1SG6A 5BN5B 4UWQB 5DEFB 4FINA 1Q7TA 1CQYA 4L3CA 2HW8A 3MYYA 3OAAD 2VW6A 3BQVA 1H6AA 1PQYA 4YHPB 1EUYA 2R7EB 2WTUA 2BRRL 3D08A 5E0QA 4KLCA 3TCXB 1O6SA 5E8NA 1KVTA 4K5QA 3PJLA 4JFRA 3MNFA 3KU1A 2X4RB 3TD9A 1X4XA 1D5XA 1LV8A 4HDKA 4PJDB 1YUKA 3G9ZA 5LU9A 3L2OB 1L4GA 3RUFA 2AKYA 5TDOB 2MDTA 2AF3C 3PWLB 2BGUA 4OCYH 1NIBA 1G8SA 2QMHA 1C5CH 3APDA 2G4VA 1B16A 1PZ3A 5I4KA 4KO3S 3VBEA 2OZKA 4JI3B 1CL7I 5ADVA 3ZN6A 5FTJA 2IUTA 3G6JB 2OL3L 3LNDA 4WKNA 4HGQA 3RYFB 4AZVA 1EWTA 3QB7C 1SOVA 2HFFB 3AVUA 1NHGA 3GMSA 4W82A 1LNQA 3ZCRA 4K8RC 5FHAL 4OCNC 1E4KA 2DWPA 3LN5B 1ZLWK 2A1UA 3I6MA 2ZWVA 4YDLB 1PGPA 2VN6A 1B76A 3H2BA 1GS8A 2YJGA 2FP4A 3QTTA 4PLKC 2X2YA 3O2QB 3VU9A 1GGCH 2XWDA 4YLGA 3O03A 1L7NA 1M2JA 1OXTA 4FQIH 4GW1A 4YSDA 1JALA 1R5WA 2HJFA 2W70A 3RI5K 1EESA 4L51A 3ETNA 3OQPA 2F1RA 3PTAA 2VDOL 1NYTA 1U8NB 3DAPA 2ZIZA 4C4RA 3IAAA 1Y1KE 1EGVB 1KJ2L 3BGSA 3RY5A 4I2XB 1EXGA 4DPRA 1HSAA 1RU3A 3TVYA 4WRRA 3GH1A 2XZDA 4ZUTB 2YAPA 3BE1H 5CLTA 4YCSA 4MEJA 2EL9A 3U1BA 2G09A 1EHNA 1V39A 4F86A 5DFAA 5C3TA 3KKMA 1M2EA 5DRXB 3S8GB 4XWWA 5TH2B 3AVQA 1OCWH 3PFUA 3EJRA 1U6AH 5D7JB 1SUAA 3ZYJA 1X7HA 3OEHA 1DO0A 2XVXA 2B1HH 3SQXA 3WK7A 2AFHE 3WZMA 1P5JA 5AVUB 2WNIA 4DKEH 1AO7E 1M2NA 4HZUB 1NMBH 2VSCA 2VDKH 3ZQ9A 3U3ZA 1CUUA 3AEXA 2BGNA 2J3IA 3SVTA 4NPCA 2JFPA 1K5NB 1TAHA 1NM5A 1DMRA 2F74A 4PU2A 2MPAL 3QUZA 5DVZA 3ZHSA 4KQWA 4LLVA 4AEHL 3V5DA 2ZJ2A 5AAMC 5JNYB 4PLZA 1BD2B 3ROPA 4BKUA 1G9MH 4DUGA 2EDWA 4PJFF 4RIFA 3MQFA 1WJGA 3RFZB 1KFEB 1R3IH 3G5WA 1BVHA 2V7EA 3QVMA 2IYFA 5LLDA 3OCYA 1GYQA 5ACMA 4HSQA 1B0RB 2ZX8A 3CFKA 3O6FA 4F72A 3FT9A 4DEPB 2O2YA 2WLIA 3MLPA 4UUOA 2UVPA 4HJGB 1GC1H 3OP4A 2A5UA 4IX9A 3UH0A 1VZHA 1DJNA 2XZAH 1DOZA 1XR8B 4N8CL 4A5SA 1SLVA 3TH4T 2XXFA 43CAB 5IROD 1VAHA 1NQWA 3AXTA 3O2SB 5FUBA 5AXDA 1N10A 4K2UH 1Z15A 1MA3A 5I17A 1WO2A 3NM5A 2R51A 4WLNA 4TVPE 2EVGA 1XVIA 3WMSA 3R9WA 1G5TA 1VBNA 1U3JA 5CM8B 3VD2A 1JGVL 2IEPA 5CCEA 1UWYA 3VFOA 2OSXA 3MQ2A 2BFVL 1ZD1A 7MDHA 3O8OB 3G2MA 2R1XA 1OHZA 2SEBA 4WK0B 1N5AA 1G9XA 1WF3A 3IU4L 2ZSUA 1JH9A 5C0NC 4RIGA 1JIUA 5TDPA 1TJGH 2XQVA 3S28A 2ZZKA 2RCSL 4I9HA 4B41A 4RLDA 5DJ8B 3HO8A 4FDLA 4P06A 5JORB 5INTA 4H1UA 1V2HE 4X0KB 2X12A 2AJYL 4KTGA 2QR3A 5C0CB 3SC2A 2C3PA 4RUKA 2P3SA 3RF6A 3MBEC 5HHMB 3WFDL 5SWSE 1TLLA 1MVUB 4G9DB 2XIQA 1HQRA 3EWNA 4JM2F 4P9NA 1PS8A 1H05A 2CHDA 3MUOA 1UXSA 3L8FA 3QHAA 4XP5H 5IJWA 4QHKI 5HHNA 2IG2H 1M6HA 2Y24A 1E3LA 4HAFA 1UMDA 3C8UA 3GHEH 2GESA 1FX1A 4UTCA 5A2QA 1TC1A 3C6XA 5LVEA 2QN7A 1V8DA 1UB5A 5JFOA 2OP4L 4FZEL 2BW0A 4DCOA 4GSQA 3E9QA 1ZLVK 1MNNA 1I7UA 4PGCB 2EXYC 4MRMA 4PZYA 4UW9A 1L8LA 1FO0H 4Y9FA 1MG2C 3EF0A 2VZEA 4B7IA 3KLKA 3DV4B 4X71A 2WVVA 3A6DA 3OXRB 1QBML 2WN3A 4YJFA 2J57A 1MAWA 1DKPA 4I14A 1V05A 1KTIA 3O8QB 1G20A 1JUFA 5EKSA 1K86A 4F7DA 5AHRA 4F6RB 5CCKL 3AM4A 1CFSA 3SDXF 3RPEA 1RH8A 1V3VA 5AYUL 3CFBA 1MJ8H 2CT8A 3ULVL 3QH3A 4C21A 1FPTH 2FDXA 5FM8A 3C3DA 3L5WB 1UMKA 3C09C 1YC7A 3ZXYA 3U5TA 3P9WB 4NC9A 1E5VA 3MMEA 2X23A 2GR9A 2OBBA 3K1YA 3RU2A 3K6JA 3FQ1A 2A86A 2A5FA 4TVBA 3AR3A 2ECOA 3D69A 2OMTB 1I53A 5B58C 4CF4A 1XN1A 2O19A 3B9KC 4C0SA 3EARA 3A3YB 2QTZA 2PKDA 1MQKL 1E9PA 3C60A 4BKOA 5KJEA 1XGTA 4CDRA 2D8KA 3VZSA 3PQYE 3UTTE 3HJUA 3PGA1 4TMVA 1SXJC 1Y1UA 2IEAA 3OUUA 5C0CD 1TF4A 3L1FA 4QEGA 2HIGA 4P9MH 2PRKA 3P2MA 4DADA 5GADl 1IHPA 4DQVA 3C6LA 2PV7A 4TMXA 3UYRH 4PFJA 1NMYA 4Q01A 1QQAA 5J23A 5FYKD 1J4AA 4Q47A 3JXEA 4R4NC 3A9TA 1BLNB 3VNZA 9MHTA 5IVZB 4G1BA 2BGRA 5JIKA 1AB5A 5THQA 1RPZA 3HC0A 4D0NA 2JFQA 4PC2A 4CMBA 2L0DA 3L79A 3GSWA 2AKEA 1SN7A 4NHCL 5ITFA 5E7IA 1BQEA 1RZFL 1RKBA 5L9DL 3C14C 1NNSA 2HWXA 1J56A 3KPMA 4RZKA 4LEIA 5KC8A 5HFJA 4HH8A 3HB3D 4GR9A 1BVNT 4A7SA 5EO0B 1QHHA 4YO8A 2RH8A 1ASOA 3IUMA 1EMDA 4GP9A 1T4CA 1FDUA 3OF6A 4XO9A 1BFTA 3GU3A 1EXMA 5EU5B 2X6RA 3WDKA 2XN9A 4CSSA 4W8GA 4F9FA 5BY2A 5FO7B 4QYOB 3FROA 5TFSL 1DXYA 1AHPA 1QRDA 1VZ2A 2BFMA 2O5ZH 1PZAA 5FYLD 4MWGA 1I5OA 1K72A 3MRBB 4QUDA 4WI4A 1ZTXH 5H16A 4ZYKA 1YY9C 4AJYV 5E6ZA 4KK9D 4RFOL 2XECA 3AETA 2OBMA 4HJJL 1BMGA 4OHBA 4LJLA 3P9MB 4OUUA 5KZCD 5F97E 1FVEB 3NA9H 4IBOA 3KEMA 2XJKA 4WESB 4ZOEA 1KYQA 1DCFA 3AL3A 2PABA 1QIDA 2AJTA 2HSGA 2A9RA 1X39A 4EG7A 2PWZA 1USVA 2OA9A 1RPJA 2FD6H 1QRRA 4B3XA 3DTVD 3Q7PA 2EP6A 4AJOA 4O2RA 1OF2A 4JB3A 1KPVB 2X9XA 3S27A 1QLEL 4KZEL 4I9WE 5AVRB 4JO2L 5B7FA 2G0AA 1OE1A 4Z3GA 5DO9A 2P80A 2PA0A 3CPLA 1R5IB 3LAWA 2B4YA 1ISMA 3ARGB 1QACA 1ZT7B 2ZEJA 2YXNA 1A5ZA 4ZYYA 1E2KA 2FEDD 3OX2A 5GRVL 3O1HB 2Z5FA 2FR0A 3JQGA 3QUTA 1E3MA 2MCG1 2PPEA 3TWOA 3PEWA 5CA0F 2QSQA 3FO0H 3UZEC 3KXLA 2IXDA 4LHZA 2CVZA 2P3YA 1CUGA 3P4NA 4PRNB 2AQSA 2W37A 2WQRA 4EIBA 3ROMA 1MUJA 1A9OA 4KXWA 5DV9A 2KPNA 1SIOA 4WCFA 2QAGB 2PO6D 1OAXH 3H6AA 5CDFA 3LXUX 3TZ6A 1K9VF 3S2CA 1CLYH 2ID7A 5JISA 1DT5A 1AV6A 3VPGA 3H75A 5EJ9A 3VACA 3E8UL 3RX5A 3ZKQD 1LDEA 4W9KC 5F1NB 2FF5A 2VXOA 2GJRA 4BKPA 4P3DB 5DVLA 3EUFA 2AJLI 4Z3HA 3VSAA 2APXA 3NCYS 4P81A 3HL0A 4J4BA 2IZ7A 3RG2A 3JT0A 4CMAA 3GHHA 4US2R 2H9GB 1ULAA 3GHPA 2C9DA 5ALVA 3JRNA 3P94A 5FO8A 2XCQA 3MJDA 2ITDB 3MLZH 3TPUA 4LE2A 4MWFB 3PKZA 3RTLA 4IOKA 3LCMA 4OCLC 4I3FA 5HZMA 4ODBD 1BG9A 2QS9A 1O6BA 2ZWSA 1BDHA 3BWUC 3L8GA 3O6LH 1RFGE 2RCYA 2LLGA 3L3GB 3INGA 5D2NE 3WDMA 2KI6A 4ZT4A 1Z6YA 4XN8A 1H9DA 5KDLA 4YUWA 5G0VA 2GERA 4XIIA 3QJFA 1R9NA 2BI7A 2HHCA 3LCVB 2A0LD 2K6WA 2VPIA 3DARA 4LEXH 1UBMS 4M8QB 4LA4A 4HN9A 4K9DA 3TXYA 2LTQB 4KQ3L 2J88H 1SWWA 4X8MA 1HSBA 3EOTL 4BHUA 1P4LB 5LD2B 1TECE 3UEQA 1QIFA 4KKLC 1NH6A 4HXYA 2A35A 3UAFA 4AC4A 2CJUH 4OLUL 5HHQA 3X12A 2UZ1B 4KI0A 2HT2C 4AUKA 4DKXA 4KV7A 4DV5B 4JI1B 1G2PA 4X5PA 4A2PA 4JY5L 2BEWB 5JS7A 4HDNB 3MUHL 4RSGA 3MXWH 3BHMA 2IZ6A 3MV8A 1U8LB 3M7OA 3R1GL 4Q6IC 4DUPA 3HKDA 1UXWB 2I33A 3FU0A 3AKZA 1JKIA 3M70A 3CWQA 2PTGA 4OOFA 3NBYC 1P9LA 1OTUD 2WLIB 2FQDA 1WITA 2VQ1A 1UADA 3FU7B 1NCDL 2BHTA 4RGNB 1BHGA 5AVOA 1NBIA 5KOMC 3Q2KA 2RFLA 3TZLA 4ERSL 4S0TD 3SBWA 4MVJH 4HXBH 4ZYWA 3VRIB 3IIMA 1I6LA 4MWBA 5AJZA 3DAFA 1B0WA 4FGKA 5DJDA 4RMHA 4L0YA 1YA4A 4E5NA 2OXHB 1LE9B 2AX3A 2ZB3A 5I15H 1MKYA 3DOJA 5LB4A 3BXFA 3GO1H 4TV3A 4DZ8A 1KTVA 2HHAA 1DI0A 1NCTA 2MQ0A 1MFZA 5HCIA 1Y1DA 1A25A 1Z0NA 2BHFA 3COOA 3R0JA 3HBAA 3OOSA 4E4TA 3MRLA 4CCYB 4WBNA 3KZCA 4IFBA 2WUCL 4GSUA 4LSQL 2FFRA 5CU7A 4XXDA 5I7RA 3CZPA 3S0JA 1H3PH 3QUXC 2DQ4A 4XH9B 4UULA 3OEHD 2RI0A 3NIGF 3FM9A 4MRBA 5D5MA 4TNVF 1BMDA 3CCBA 1RURH 4RQTA 3AHJA 1PL3A 1FNLA 2Z65C 1YQWA 4HPHA 3D2UA 4PP1D 3CFCH 2H1PL 3UL4A 1H8SA 1VE7A 1YUNA 1C8LA 4KGVA 3KUXA 2ZM5A 1U1CA 2PWHA 3HNRA 3EFFB 4XIYA 2LCQA 3QUZD 1YNTF 1JKFA 5DK0A 1UKCA 1YZNA 1ZBDA 4DUGD 2Z34A 1WEJH 1N2CA 1OVMA 4O4LA 3RJZA 3DBXA 4GXUN 4Z7NE 4LJKA 4AVYA 2CAKA 2C9RA 3ZYZA 1B3JA 4AG3A 5LG6A 2OMEA 4QIHA 4MB4A 4S2EA 3O6FD 4D4MA 2OQJB 3KHQA 3I62A 2I6XA 3OI7A 1B0IA 2HX8A 3KJ6L 2WO3B 2PKWA 4L16A 4OCSL 2L0XA 3GI9H 1A96A 3LZDA 4X6UA 3OLVA 3UWDA 3BDAA 4KNYA 1MAVA 3UAAA 4PR5A 1CZRA 2NAPA 3OB8A 4Z1MA 3L6RA 3KZXA 4MJHA 1P84K 1BXGB 2R4UA 4DC9A 2KSQA 4DC0A 1T9HA 3VFUA 3B9QA 5DOZA 3ZQWA 1Z5LA 4LSUL 3NSCA 1SNYA 2BFEB 4R84A 2YICA 2PX2A 4M7OA 3QH3B 2ZPKL 1N5DA 3CZ9A 2D0IA 4P22A 2A74B 3GJ6A 4OBEA 5BW7C 4Q4JA 3MMEB 3STHA 4PSKA 2VLLB 5LCVL 2Z6FA 1OGYA 2QSZA 1EEZA 2ICEC 1G55A 3K9WA 1FYXA 2DIAA 3SNKA 1G6RA 3PG2A 3BSFA 4R97B 3PGXA 1BOOA 4Q39A 4NP4H 4HBZA 2OV1A 5DHRA 4QWWA 3AERB 3GELA 3O41A 3GI8H 4ZODA 5MERA 1T03L 3GEHA 1HG1A 4Q3EA 4N0FA 4RFNC 3QEUB 4EB6B 4DIBA 4U0JA 1P4GA 3H9QA 5GJCA 3S3JA 4ENVA 4JPSA 1HSOA 2YJ5A 4S1RL 2P2YA 1P5VB 1T3SA 3SR0A 1W59A 4MV6A 3BCDA 5H4GA 2ORWA 4NRDA 3L8EA 1U0OC 4PZ0A 2UU9B 4I5FA 4BN5A 3LHPL 2PVCA 3PE6A 3RVTD 5K2MA 1MCJA 3Q98A 4UF7C 1TFPA 4CU8A 4XMPH 4HZ1A 5H4YA 4Y2DC 1HNXB 2C8JA 2WSLA 2GAIA 1QHEA 3K1JA 4RH4A 4DIDA 4KO2S 3U6RB 3P1JA 1IM9A 3SKXA 4FJ1A 4ZAZA 2W91A 5BSTA 1NX6A 4Q21A 1AA6A 4NAHA 2Q9BA 3LA6A 4BFYA 1LI5A 2FPRA 3OJ2C 4MW0A 4OK3A 1QVWA 3AXLB 3DD1A 2HRGA 1OLLA 3O3DA 2PEZA 3TH2T 1V7CA 1FZTA 5D1ZA 1RVV1 3KOXA 4B85A 2E37A 1DBKL 4XPBL 1FJ2A 3ZE2B 4L5YA 3TN7A 1ECCA 2HWZH 1UINA 3UXFA 1PFGA 5IVOA 1DC5A 2XN9B 3DEAA 1PGNA 2WF7A 2BVNA 4MP8A 2VDUE 1ZQ9A 2GETA 3ZDRA 3NFRA 3S3CB 3CZKA 4HZAA 1YKGA 3OM8A 5IHBA 3NJRA 4RWYL 3RX9A 4BH8B 1YH3A 1YN6A 3TLEA 1GZHB 1M1YE 1TMYA 2WWVD 2R2CA 1PS0A 4ZYKB 3N2YA 4FQXB 3VKFA 2F6AA 1ISRA 3AETB 4KTEL 4WKXA 4YMWA 2CSPA 3MFFA 1N67A 3C60D 2XZCL 3FOLA 2ZJ6A 3O1JC 5J5VA 1MCLA 1RAIA 1F4YL 1XTJA 4QXUL 1RTKA 4D0GA 4AZWA 4WH0A 3DMYA 4QPCA 2G80A 3F0TA 3NJMA 1RIHH 4HVTA 5HXAA 4NERA 5DU2A 3U7WL 4INZA 2PW2A 1NZRA 4WADA 3IP5A 4ERNA 1XBRA 3DHEA 4BSVB 2K70A 1G7QB 3C6LD 5AMXA 1QZ3A 2I3ZA 4U1SA 1UD6A 2R1UA 3E3MA 1BOGA 1XX9C 4I9GA 3IKTA 1DPGA 2W2PA 1DJZA 5CJXA 2OCAA 3HBFA 2Q8AH 4F12A 4RPHA 1M6UA 3HA0A 5TPWL 1XXDC 4GI1A 4DLSA 4EKNB 3WLAA 4LOVA 1W1WA 4EI6B 1NAIA 1WL8A 2HLEB 1KTDB 2ZNXA 4RGOH 3N9GH 4UNUA 1BVKA 1KBVA 4C55A 1KI7A 2X28A 4FQLL 1S8OA 4W63A 3WDHA 5SZJA 4Y1AE 5AVYA 5C52B 1PWZA 3D2AA 4WBSA 3K91A 1KT2A 3KHUA 4QATA 1MHPH 4EZMA 4MIYA 1FFBA 1SXIA 2D2CC 3OF6D 1CPYA 3CSUA 2YWBA 5BRNA 3TX4A 1RULL 2E9WA 2H06A 1WZ1L 4J7UA 2XN9D 1ZGLP 2H1HA 4K86A 2AFVA 2Q8NA 4FQHA 2DOCA 3CUVA 2VT7A 3GUUA 3QFJE 3TJEH 1NXSA 4M86A 1PKQB 3TLBA 2W8ZA 1WVIA 3NBZC 5JAOA 5L7XL 2D9CA 3LK6A 4MDYA 5A9SB 3KYAA 2F8SA 1H2XA 4XP1L 3MMNA 1HYEA 1IUNA 5REQB 2HLNA 5JHMA 3A5VA 5IQ9B 2GQHA 3O8XB 3E9EA 1T2QL 2XGMA 2WLLB 3RZWA 4JPWL 4CSZA 5ESAA 1KEML 3Q87B 2FZVA 4IOMA 2IANB 5GJVC 1YHYA 3WIHA 1M6OB 3GJFH 3CHPA 4GUPB 2XBZA 2B34A 2HRRA 4H7IA 1HYGA 821PA 4I1NB 2M1XA 1AP2A 5J11C 2O0MA 4XNZB 5AUOB 4LRYA 5DLEA 3ZGVA 1ADFA 2ZYDA 4CM9A 5CG2A 4KPEC 1SCJA 2O8DA 3A67L 3K0SA 1D09A 2ATPB 3OCJA 2VDWA 2P80D 1FSPA 1C8QA 1HH6A 4WW0A 4U7MA 1UWGL 3AWFA 5HVFB 2R60A 3R9XB 3WP0A 4NZTL 1P7KB 3PXJA 2CZQA 4L9LC 4WDIA 2O2IA 5WRFA 1WA0X 1AD9A 4O02L 2DM6A 1BX3A 2CRMA 5HHQB 1ZQ1A 3GBEA 1DAOA 1I8TA 1CUZA 1KJ9A 2BFBA 4G80B 2OZNA 1VE6A 1A8HA 4H25A 3ZEAA 5CEEA 3JYLA 2A30A 1TMGE 1Z5ZA 4DRYA 2FWOB 3ZQ4A 2YPLE 4POAA 2QZQA 4G5AA 3ABRB 3E1SA 3WLPA 2GQ0A 3UA3A 3IBEA 1LC3A 1GG2A 1QRNE 4N9QA 2AFIA 1HDEA 4LP4A 3SDSA 5I1AB 4NHUB 2G0LA 3VR5H 1DG1G 4V0ME 2IPTH 4JXXA 1ZKDA 4AEIH 3MBXH 3TU6A 3D31A 3QVLA 1Z26A 2VQ1B 4JEHA 2DJIA 4I55A 7TAAA 1YJDC 3KE0A 4PIRF 5CBAA 2VJYA 2IZZA 4HB3A 1MDFA 2WBWB 2RGEA 1TTPB 1HFKA 3RSFA 4CIVA 4O9HH 1AY0A 4WDRA 3TFKC 1CIDA 4CL2A 2R1VB 2CIIB 2H1FA 1ZT4A 2P2NA 3KUUA 4N41A 3FYUB 1BLIA 4JM4H 4MRRA 4IJ3C 1RZJL 3TAXA 3FCCA 1XAUA 1GA4A 1ULTA 2WB1A 2O8CA 3Q1SH 1F7UA 4N2DA 4BK5C 3PEUA 3D64A 4GBXA 4PJ8A 1Z0IA 1P6AB 6REQB 1T4WA 3MRLB 5ICSA 3TW0A 3DDCA 4BFNA 3IKJA 2V8BA 4OJKA 2X3UA 3JD2A 4BFOA 2VKXA 4XR4A 3J8F7 1HETA 2VA9A 1RIUH 4YJ3B 4N6OA 1V8PA 5I1CL 1D07A 4LKCA 4P49A 3NRCA 4BO9A 5DVNA 2GM4A 4L3AA 4PS1A 1NFDB 2JVIA 3CLUD 4XARA 2D5CA 4RWZA 1LWJA 4E2YA 4G6AC 4C29A 1UM8A 3B2NA 3PL6C 1BD4A 3T04D 4YR6A 4YT5A 4X85A 3LUAA 4PD4K 1W9MA 2BFFA 1CGUA 1NBZA 2AE1A 1LLFA 4E51A 5DPMA 3MV8D 5KVFL 1J39A 4WECA 2OMKA 4Z0XB 2PGNA 5J8OA 3V33A 3U7HB 5PCYA 4K0OA 3SLRA 4BVHA 3VAEA 4ZPTA 3F6LA 1A3ZA 5CEJA 2VR6A 1E2FA 4M5YH 2X0VA 1NVBA 4G89A 1DHRA 1BWQA 4J3NA 1EINA 3AABA 4X9IA 1K75A 4NKQB 1WMBA 4UTZA 3V55A 3GDOA 3MLYH 4EUSA 5JARA 4FLFA 3KT0A 3M1OA 3SKMB 1C1DA 2FRGP 1W46A 4JN2B 3SM3A 5BN4A 5LOVF 4QXAA 4GP5B 4JL6A 5KYYB 3VZPA 1Z5LB 3MRHB 1LBIA 3NTOA 1U0JA 4W8HA 1ECFA 5DHVA 3B3BA 2B5OA 3CW9A 5GZ3A 1EHKB 2JIPA 4QHMA 2ZKWA 4I1OA 4KL8S 3EY9A 1XVLA 4JFVA 3TW8A 1J1XH 3W81A 4DGWC 4S0XA 3NG1A 1HY3A 2HMWA 3KJQA 5E1IA 3FSZA 5T4FA 2OSBA 3ANNA 3DRTB 2X2HA 2DUWA 2Q7NA 2DLEA 4DL9A 3B7YA 5EPEA 2YRXA 3S2FA 1GJIA 4NCHA 4YDSA 2WC7A 2HEGA 4M9XA 2B94A 2MR6A 2BVYA 2PAAA 4GYJA 2Y0PA 5F6IB 1BV8A 3IVCA 3Q1LA 5KTTA 1RZIB 1FRGH 4MQUA 3MJ9L 3Q8KA 2ZXBA 4WV1C 3D2UD 1E2MA 4L4TE 4AL4A 2XWZA 4GKBA 4KI5E 1Z9BA 4NFSA 2J4WH 1AXTH 1YPZE 2YMQA 3LYLA 1DBVO 3JXAA 5DJ0B 4C6TA 5KOJA 5CK4A 3NHLA 1V95A 3CH6A 3BQ9A 4ISBA 3ZU3A 3K5IA 3OOHA 1NL0L 4ZTOL 1WDTA 4KQCA 2NIPA 1KPRB 4B9GA 2YMLA 1OB1B 1G4RA 1ORHA 4OF0A 3V0JA 4IKPA 4AYXA 2AFRA 2J44A 4WW2A 2O72A 1AGCB 4UQPA 1NGWB 1S8AA 4QO8A 4R1OA 5BNTA 4MV3A 4C83A 2VAMA 3PXCX 3IHLA 1WGOA 5EEWA 4IQ0A 1N77A 2HT3D 1EVYA 1F02I 1GZ4A 1UZ8A 3CVHB 3C8KA 4HCRH 1RYBA 3Q3CA 4IDBA 4EABA 3H16A 4O8ZA 3KAKA 4Z1MD 1P7YA 3D3QA 1JRHI 4A5OA 1PT7A 3NT4A 1UQTA 1AGBB 4D4KA 5CJOL 1UT2A 1FL3B 3C7DB 3GMMB 3LMKA 4QXTB 2JIZA 3IT1A 4PO9A 5B57C 1GZPA 1YZ3A 3HN8A 4P92A 4AN4A 1BWWA 5IR1B 2ZWPA 4HQLA 2G75B 2FJGA 4AGNA 4D0SA 4F4DA 1QGZA 1AXRA 1MLDA 4RMTA 1L9TA 4R8WL 4KXZH 2ATIA 1QF6A 1ZP6A 3BMOA 3ENWA 3WFBH 1LQBC 4LZZA 2CK0H 1TC2A 3TBTA 2X1WL 3PU6A 2RC5A 3ZUPA 5B1YA 2BYTA 4X66B 3G6JF 3LHFA 3OZ7A 5GGSY 4DP9X 3MFFB 4RZCB 1AS0A 4U7TB 4IKEA 1ZM4A 4QWWD 2A0KA 3FPKA 2EYQA 1Z66A 3JQFA 4NQSB 1GITA 2AEWA 1XF1A 5E94A 3BDYL 2COUA 4IRSC 3C3BA 2J12B 1GPDG 2PE5A 2HQBA 2WUVA 2R39A 1TPXB 2G72A 1D1PA 4Q0XL 2K4MA 4W5RA 2V6FA 3ZQ6A 1Y8QA 5H80A 1UMCB 4FCTA 5A62A 4REQB 1FXSA 4R98A 4FFYA 4JGIA 4NZUH 2Q1YA 4I0PC 3HB0A 2HXYA 2AGJL 4EM6A 1F97A 4MD0A 5ALHA 4U1HA 1VYTA 3EXLA 1AH1A 3TL5A 1U8MA 1IM9D 5E4FA 2P9RA 2EH8H 4BKLB 3VG0L 1JP5A 3BMNA 4NM4H 4TOIA 4Q1BA 1Z5VA 2R8SL 2BJHA 3U2SA 1A7BA 4IZIA 1F45A 3GA5A 1W0WB 2BOBB 3CEMA 4BDSA 1WETA 3GY0A 2EVIA 3DKVA 4WINA 3BKYH 1YEEL 3T4AC 1UD2A 3STYA 1BXRA 2J6CA 1TE2A 4Z7WA 1T0BA 3BK1A 2GIXA 4I50A 1RQ5A 4A36A 2X42A 4BCBA 5D1ZD 3T3NA 3HE7A 4DEVA 1YEIL 2YV1A 1FNSH 4CILA 1GPBA 2VRAA 5C07B 4WE3A 4ZGWA 5DLMH 4AQEA 5J4KA 3ILPA 3HGMA 4A66A 4M0LA 4ZMXA 2WUDA 1ETA1 3OEWA 1UURA 3SDCB 2DPLA 5AXBA 4B97A 4OI8A 3ZKXB 1E30A 1I2CA 4KB5A 1G60A 1WCXA 1Y1QA 1X1DA 1NCBL 1VPVA 8LDHA 5CDGA 4JKPL 3TOCA 2HMSA 1JFFA 1Z5NA 3KKKA 1VKNA 2JS7A 5ECDA 2ADGB 3PFWO 1UZ6F 2HA7A 3ULUF 1JAZA 4BB9A 3I76A 2UUAB 4XNDA 4B40A 2REXB 4OZ4B 1B0AA 2YV5A 5FOWA 1LDPL 4U3JA 2CXNA 2BP8B 1PK9A 1K1EA 3JATB 2XV6B 4FERA 4ESEA 3IKCA 3L04A 2ADMA 3SVZA 2DLCX 4A6DA 4PJXF 1KMIY 1U6KA 4R4BA 1JTVA 3MREB 2E4UA 3L4YA 3SFVA 1XKQA 5D7NA 1WP6A 2NUTA 3EJUA 2H8PA 3SD5A 1FU4A 4CVZA 4X2UA 3OEYA 1KGXA 1GUBA 1XZBA 4B6OA 1A4AA 5AKZA 2I85A 1KJMB 1QNZH 2WXRA 5IN5A 4X0NA 4WDIB 3ZHNA 4RAUB 4IG9A 3CX5J 5E00B 2B9AA 3DA0A 1QTSA 4WAUA 1JRHL 4IVPA 3FZUD 5TD4A 5K1ZA 4JJ5B 2Q2LA 5JQ6L 3NIBA 1KJNA 2XUJA 1KXQE 1E4EA 5IASA 1PF7E 2H5UA 2HK9A 1T3FB 3K35A 1EJBA 3DECA 4FADA 1TQUA 3CMOH 1DQJA 1TO4A 1WUZA 3FUMA 3WHXB 2HKHL 3ZL2A 1UIMA 2NXYB 4NO0B 2HG5B 2BX5A 1CDIA 3PP8A 2WYWA 2D03L 4H20L 4BSJA 3SF8A 4WWHA 3AQYA 1IDN1 5DJCA 3D3KA 3QDGA 2IGFL 1DTWA 3QCVL 3EFOB 5AW6A 4YCAA 1OPGH 2NZWA 1UYWL 2QG4A 1GHFL 4GAAA 4J03A 1P53A 2K87A 4IHJF 1KENL 4YGXB 4EI5C 1HWGB 4HNUA 5FL7A 2OCIA 5E8OA 4IIGA 4GGOA 5DI9A 4P4TA 4O3UB 1K7YA 4Y8DC 2OMZB 3TMAA 1ZT4B 2RMNA 1CT9A 2DTEA 3P77A 3VPBA 1N92A 2Z57A 3EXIB 1RYZA 2HFJA 2A73B 4Z9BA 1GGFA 4CM9D 5L88H 4FHDA 3B7PA 1P39A 2KQMA 2A0UA 4FWIB 2X2EA 1FDIA 5FLUA 1ZSDB 1MN4A 4NZMA 4U2ZA 3TMKA 1IY8A 4LQ4A 3CY6A 1VA4A 3ZTEA 4F8OA 5C0GB 2ZRFA 5GS0D 3OE5A 3CS3A 2YIHA 2V0AA 4P7GA 3ECUA 1OUMA 2KMWA 4Z18A 1ONPA 1I4FB 5IBCA 5KVFE 3UAJC 1SCQA 2DQGH 3P8ZA 4DKFH 4GSYA 3ROKA 3VMOA 3RVXC 2WN2A 4X8OA 3HABA 5B7QA 5TQ0B 2P3QA 2TMKA 5A6VA 3FNQA 4R2XA 3G1UA 1JZ8A 2MSPA 4ODSL 1FP6A 3ZGYA 2Z7YA 3DOHA 4KK5C 1KDRA 2DG2A 2ZCKL 3QWOA 5EUOF 2X3BA 1HKUA 1MN6A 1ZI9A 4D0LB 2ZONA 1DQRA 2YOHA 3AVTA 3F1LA 2A9NL 4K94L 2JEOA 4C4KO 2FBRA 1MX1A 3LHSA 1LB1B 4WU7A 1T9KA 4GG6B 2JI1A 4QZVA 1RSFA 4O29A 4LFHD 2VBGA 3US9A 5J12B 2H9YA 1S2NA 1SVBA 2Q99A 2AJBA 1HE7A 2BIIA 1THMA 2HVJB 3L17A 2B1QA 2NW6A 4NS4A 3EOAA 1DQMH 5BN4B 3NDIA 1LWNA 3A4IA 2ZIAA 3D3EA 2BNRB 2IYWA 3J7HA 5I23A 1OFUA 3LNHA 1BCSA 2YTZA 4RLHA 1VGVA 1H4QA 1IG3A 3GV0A 5JPDA 3R4CA 3LQQA 1MSPA 5DHVB 1SN0A 3GSQB 3G5VB 3EFDL 2DB3A 3CTTA 2R7MA 4GBXD 4PJ8D 4NE7A 4N5MA 1GRCA 1UENA 4PRAA 4XN7A 2V5SA 2JK1A 1OU4A 2OX5B 2ISSD 3VVLA 3BQNB 4ZFFA 1VGEL 2F53E 4J0JA 3GP8A 1L7TL 4DA6A 2K4AA 9CGTA 2MT9A 4G0XA 2HRLA 2NY5C 1FAIH 1XF9A 1LPSA 2C3UA 2VPTA 4G82A 1U5BB 1K0UA 3BN9C 3HR5A 1LVUA 2P52A 2XQYK 4NDAA 5L3SA 2PLNA 1H6BA 3L0ZA 5M2QA 4O4JB 1CR9L 5GS1B 2OXTA 1SC6A 3WY4A 3CHOA 4IS6A 2OV4A 5C0IB 3IDYC 4DSOA 1NLFA 4XNUL 4QFDA 4MPDA 4BLRA 4PJHA 4XFDA 2JFYA 2F8LA 5JTTA 2WHVA 2P3OA 2Y6TE 2FP3A 4QRSB 3PXEA 3PHIA 4JI0B 1E0KA 2ZCLL 3UYLA 3DEFA 3FQYA 2QMUA 3UIZA 2HXSA 4HFUH 3GEFA 2O1SA 4XCFL 1QFXA 3NO4A 5GVRA 1JZGA 1XGRA 2JIBA 3ECAA 5KQRA 4G42B 3U6BA 4F2PA 4Q3KA 3EGIA 1RIIA 1QI5A 1V7ZA 1FNGB 3RVVD 1A9XB 5DURD 12E8L 2HX7A 2WKWA 4JLKA 4F24A 1XRQA 1F3DH 4ZFOL 1LQUA 1UZ8B 1GWNA 4NFCA 2AEMA 4LPVA 5GGVL 4XBGA 5AVVB 3JAKA 2B59B 4KKAD 2C98A 4RHYA 2WWMC 3GXPA 2YEZB 5FDYA 5EKXA 4EO9A 2D4DA 3WNPA 5LYJA 3RBVA 3NABL 2IHNA 4L50A 3S1AA 3C2SA 4F5YA 4OFDA 4DNLA 4WWKC 5IH7A 4PJGE 3M9WA 3V6OE 1P4IL 1UAYA 3VW3L 4F60A 5DDHA 3PTZA 1ZBQA 3QWFA 4EW6A 1PJLA 1G7JB 5IW1B 5CM9C 2APSA 2AD1A 2YPVA 1J5DA 2QRKA 2IYUA 5CB6A 5GRWA 5GM1A 2R86A 4R9SA 2PIAA 3B5TA 4EKGA 3RWDA 3IDGB 5EEHA 2ZM6B 4PFKA 2ZWZA 1W5SA 3UXYA 3I02A 3CFJA 3LX5A 3UHAA 3AFMA 2WJZB 1F8FA 1Y33E 3W9DB 5KUMA 3HXMA 1N6HA 4RHTA 3BH9A 5H35B 4EPWA 5EGSA 4K7FA 1CNFA 2D31A 1AHMA 1T0OA 1KBBA 4WEBL 4DYDA 1VM6A 1HKHA 2BUCA 2Z9TA 2HTLD 1E28A 1K3FA 2QL7A 4MHOA 5G0SA 2VP9A 5IIEB 1JCVA 4YHZL 1X5GA 2DI9A 1UBGA 5KKCA 2IIVA 3STBA 2EWWA 4OO3A 2WKRA 3ZI4A 2VXVL 3FQ4A 4HQKA 4D3XA 1Y6ZA 4MRSA 3O4OC 1W5TA 2GNPA 4LC9A 2VT6A 1FCJA 2CJXA 4J6RL 1MWAB 4WUUA 3SSAA 1EG7A 4QOGA 4ODIA 4BV2A 4ZI5A 3N8NA 3NK4A 1TVKB 2X4QB 1QBKC 3LRTA 4Z99A 2GHIA 1FRVA 5ALWA 3FGPA 4APXB 2JGDA 1TTBA 3H5AA 3H5RA 4QF1B 4X98B 4J1QA 2O2SA 2VZVA 1H9CA 1ACMA 2JIZD 2AJ8A 1EK3A 4MI9A 3ALXA 3C43A 4BHTA 1KXHA 1WZUA 1KY2A 2R6ZA 4OHWA 1C12A 3HWX1 4OD1H 3QWRA 5DSCA 1KYWA 1I8LA 1MX5A 5FHAH 1WY7A 4Y2PA 4WCVA 3Q11A 2BFDB 3Q7EA 4MUAA 2CJPA 4C7OB 1T9AA 4C5CA 1WUNT 3QI7A 2CCLA 1MRFL 3UJ7A 4OHOA 3L01A 1OI3A 5T3UA 4B5EA 2C31A 3S5ZA 2LVBA 1FVCB 4HOMA 5IEKB 3QJHB 3AVPA 3HC4H 2OHOA 5ICXA 1OB5A 4NOJA 3KPSE 1RQGA 1X2BA 3MSXA 3I92A 1J8DA 3RR2A 4UHKA 5ALBH 4GW3A 3R40A 4KHZA 1RM0A 2WNXA 3TLJA 2VP3A 4JJGA 4FCCA 1DVTA 5AW5A 2D1SA 1UBRS 2ODIA 3QZWG 4ZYVA 1E69A 4QNPE 2JFGA 4HWEH 1WP9A 3S55A 2UXVA 5M34A 1OHHA 3BB3A 4EN3C 1RZGB 2YD0A 3PDOB 4YR9A 1GVIA 4JI8B 1C4XA 1T36B 3MMSA 1N25A 3E48A 3GSNA 3CZAA 3MWJA 1Z12A 1MXDA 5E5MB 4YPFA 1E27B 4ZVLA 3MLTA 1KJJA 3ABOB 1BE8A 5F73A 5EQTA 1BQSA 1TZIA 2I5YL 1R46A 2YKGA 3VM5A 2W81C 2HSIA 3ZRSA 3PUCA 4LXTA 4OFWA 3HE7D 4Z7UB 4MR8A 3N04A 1RQ2A 1QW9A 4GI6A 2WDPA 1Q1QA 2GX6A 2IBZY 1UOQA 2A1WL 1ZM9A 2EEDA 3TEFA 2BRUC 2XTJE 4AEHH 2VDNL 4A3SA 4HEPG 4ZFZB 4JNKA 3KZKA 1DN0A 3GM0A 3IPYA 1P72A 2ZGVA 4EI2A 5B7GA 1N0XH 3VFTB 1C2YA 1QU2A 3IOBA 4KV5F 4U31A 2B4CL 2Q9OA 1IJBA 2Y6SD 1XTVA 3ESZA 4LSVH 1Q0YH 5EU7E 1I24A 2I27N 4NZJA 5CURA 2EKQA 2D4FA 1YR9A 3W1ZA 3GFOA 4ZGGA 2VNKA 1MC1A 6FABL 3L16A 4HULB 1FZQA 5HYSG 2VP2A 3HHPA 1U5CA 4MA1B 1KV7A 1H0KA 2QVXX 1WAAA 1ZM2A 4KR6A 3V4FA 2AJVL 5HW0A 2EEZA 1WX1A 1TOAA 1FLVA 3EQ6A 5D00A 3EH1A 1PIFA 4BFZA 1VACA 1JAEA 1BFVL 4HZIA 3GBLA 1VP3A 3BO8B 3V1NA 4FGUA 1XROA 4MGXA 3THRA 1ZWLA 5T1MA 3LRXA 1DG3A 4MYUA 4FOMA 2WIIB 3ARBA 4YMHA 2OBLA 2O61A 4PZZA 3EHBC 3SYCA 1JHDA 3OMXA 3B20A 4NOBA 1C30A 2AOWA 5IMLB 1KIUB 4HFNA 3RT1A 4KWUA 4LEEA 4G6JH 3OICA 1RK7A 1BGVA 1B14A 2PH5A 4GR4A 1KQFA 1PR9A 3ZE8A 2KS0A 1NCHA 1JEJA 3K8OE 4DCQA 3GM8A 2WBJC 1R9MA 3NIDF 1G21A 1M7DA 5JHAA 4M0UA 2II6A 3TTXA 1D5IH 3G1WA 4DDHA 3IIJA 3W5JA 3ROQA 3U36A 3D0VB 2FN7A 4INPA 1ND0B 2XG4A 1XOIA 1PVOA 5I18H 3B2XA 1DSSG 4PRHA 3IDJB 3IMBA 2AJYH 4F21A 4YREA 1FYHB 3IH5A 3N5CA 1ZK0A 2OHIA 4KWIA 3WFDH 2FFJA 4M4SA 1M9NA 3RC9A 4RMQA 4IUDS 5KS2A 1Z5WA 1F38A 4V1DE 5GTDA 3SYNA 4LY6A 1CL7H 4MS1B 5EIIB 2D0DA 4UUPA 3OMAB 3R0QA 3IMFA 5EUQB 5L8KB 4RBPK 5CMAB 3FRHA 4DJDC 3QWOB 2WMPB 3ENEA 4RVOA 4ZICA 3HI1B 2GJSA 1ECPA 1A6UH 3TO5A 4LSTL 1OXSC 1RFDL 5DWPA 3MO1A 3T3PF 3WGHA 5F2FA 3GSOB 3A1VA 3GZPA 3QDGD 3JVUA 3ARFB 3SPGA 2BVOA 2BGKA 4OD0A 4GLFA 1G8GA 4WFJA 3I6IA 5HF5A 1OLXB 1QV9A 5E2BA 5JJKA 1TFHA 4Q1DA 4L7VA 5FL7D 1NYRA 4FE4A 3KB2A 4RJKA 1AAJA 1WLSA 3RYHB 1BYPA 1HVXA 4YJHB 3MV7B 4MA0A 3LQ1A 2A5LA 2UWEA 2N46A 3PRHA 3A1WA 5AYUH 2YFKA 5E9AA 4Y0VA 3X13B 3ULVH 3FUWA 1R7RA 1WCBB 3F97A 3MZ0A 1AK9A 3IXTB 5I30H 4P3CL 3T5GA 4COKA 2B2XH 2BRQA 4NMHA 3RK0A 4JG1H 3L43A 5I8OL 1XU7A 3B6EA 5HF9A 4AIZB 2QKSA 2BSAA 1CYGA 1SQ6A 5KS9A 1FVOA 4MW9A 1H0DA 3QI9C 4UCFA 4US0R 2HCRA 3DP9A 4TVSA 4I1YA 2OL4A 1MQKH 4HQQH 3GVXA 3K0EA 4OT1H 3N85H 4S04A 4AULA 4HISA 4YHKH 1T9BA 1XAIA 2DJ4A 2HV8A 4JVSB 2J4CA 4KMQA 4BSWB 2BDNH 4IGFA 1SHXA 4PZEA 4XFJA 1WOMA 4CRPA 4B9FA 1LPOA 5D3MB 4FFWC 5CGYD 1L9NA 2OQIA 4PQGA 2ENPA 7ABPA 1MI5B 5C0EB 2REQA 4BUHA 4LF9B 5JIHA 2B15A 3CXFA 3H2QA 3H5OA 2ZI9A 3F4KA 4LL9A 1XGRB 2DR0A 2I26N 1TKBA 3F65A 1K06A 4ZIRA 3WYCA 5K0NA 3WL4A 4YRSA 2CHEA 4H7VA 4FHFA 3NIFE 2C2KA 5EMLA 1JSCA 4PYQA 1N1DA 3X1JA 3TRDA 4PJEB 3IDMA 3ZE0E 4F11A 4UT6A 2RB5A 3LXMA 3KSRA 1N7GA 4Q9RH 2Q3EA 4IUCS 3AESA 3ZKWA 4KPYA 5D7BA 3TA3C 1QONA 3T61A 1G3IA 1NYQA 4K9SA 5GPBA 4PLNC 4HH9A 4XO5A 1APBA 1PPIA 1W72B 2ZJ4A 4AF7A 4LISA 1V3QE 4I36A 5DDHB 3V0DA 2PMZA 3R5XA 5I75C 4QRPE 2CVQA 2J41A 3KQQA 3ASYA 1G7MA 4D4JA 4K3EH 4Q9KA 5KSYA 2PKEA 4FLOA 5E23A 3QNFA 4ZAGA 5EZJA 2RHTA 4U00A 5TGTA 5FKPA 4LCUB 3IJ5A 2W94A 5C18A 2NXNA 3IESA 3KLAA 1A0OA 1PZSA 2IEGA 1KMHB 1VL1A 3I9FA 1DKLA 3M86A 3O90A 2KZKA 2X5XA 3U9UA 1US8A 3GLIE 2BI4A 2JGIA 1E5CA 3RTQA 1QEXA 5B3JF 1XGPA 2AN9A 3UMNA 2E6KA 1RFLA 4OLVH 3RY6C 3V6ZB 2BM1A 4J9UE 1IQWL 5CZXD 4ZUWA 4XRRA 1MHCB 3WIVA 1OTTD 1ECJA 2SICE 4MV7A 3P73B 2CB0A 4QOKA 1U0NA 2DEUA 1VLXA 2WIFA 4CU5A 2NXCA 5D2LE 2X4PA 3DMTA 4H8WC 5K5EA 1E18A 4FQ7A 1HFJA 3SU8A 1KK3A 1HNYA 4O6VA 4EZLA 5KB3A 4GMHA 5D7KD 4H4NA 1U93B 4R0NA 1QLEH 3CKKA 4ZI3A 5L7TA 4BIIA 3U7YL 1JUDA 3H9ZA 1T2CA 1IZ8A 3MCLH 1MCQA 1MAAA 1UWEL 3U82B 4OSEA 3SMQA 1K2DA 3AHGA 4OP3A 3VRJA 2UXBB 4NHEA 5IF9A 3HZVA 1F90L 4TQEL 3WYNA 4AIIA 5CAEB 5A4MS 3D4YA 2ZF8A 4DDKA 3P9XA 1SUIA 4HP8A 5E6YA 2CKMA 1P69B 1EX1A 4KQ0A 4G65A 3U3KA 4MPPA 1IVLA 5BQDA 1HI6B 3V32A 4OI7A 4L5FH 1V6AA 5EBLA 2CUHA 4OIMA 3FWHA 1KXTB 5KX5A 4LXUA 2NQ8A 5DHFA 4PREB 3W0WA 3M8OL 1CK0H 1Y9JA 3E8UH 1PFVA 3EIHA 1X1AA 4LF3A 3GDHA 4GUQA 1E89A 4RY0A 3SOBH 4M7RA 1ZNWA 5JPMA 3DX6B 2CLSA 3OU2A 2ZTUA 1M56B 4XUDA 2OVBA 1YC8A 1ZHNA 1RMFL 2WU8A 3GEDA 1VKHA 4XJXA 4UAHA 3FC8A 1PFOA 2P2SA 3RB8A 2G7MC 4JZJC 1ZHLB 3IUJA 1XIWC 1U7UA 3NFNA 5DCUA 3COVA 1W581 1IBRA 3DE3X 621PA 4TLTA 1XT6A 4RTJA 2E5FA 3HKEA 4EEZA 4V03A 5MF6A 4MLIA 1ZV9A 3W9YA 2XB2A 1BIIB 3ZLVA 2GEBA 4ODXB 2I25N 4PCLA 3IYLW 4PJAE 3A6GA 3I5XA 4XD2A 2L19A 2P5WE 3AUFA 1SJVA 1N4DA 4NJMB 2EYSA 3T1HB 3MEQA 5IG2A 1YZQA 2JJUA 2ZXFA 3UK2A 4IOLA 3UG5A 3FX2A 3K6KA 2BTQA 2I60H 1JV2A 3UAEA 1RZKC 4MNQE 5B7EA 2YS6A 1GAFL 4TZKA 1XD2B 2VP0A 3Q7JA 1GGHA 1H2FA 4WUUD 3F6CA 4F15B 4ZOQI 5GSVB 1XTLA 1NF3A 1A8UA 4XO3A 1ZLSH 1W87A 1IBDA 4HIJB 4KQKA 3RUHA 4YR7A 3K1ZA 4FLQA 2YN5A 4ZUUB 3WRXC 1NGZA 4JRXA 1IBLB 5ETUB 2CDCA 2Q5JA 1HMPA 1Q7EA 3Q48A 4IQ4A 3KYIB 4FNTA 4HUNB 4YJ3F 4MA8H 4EPYA 3I6ZA 1ET8A 1E5QA 3LYHA 2X7LA 2W6ZA 4Y2OB 3WV0A 5KWIA 3QWRD 3R1GH 1YGPA 1XVVA 2CRZA 3GWJA 2POQX 2QX9A 4X4ZA 1ACLA 1EO5A 4P5MB 4E5DA 2X1QA 4HB0A 4UEWA 2ZTMA 2ZP1A 1EZ4A 5D6DC 3B52X 1UC4B 4YBZA 1CDUA 3MILA 1FFQA 4Y7MA 5LJLA 3ROLB 2RALA 5E7BA 4UHCA 4Z7VA 1J86A 1NCDH 1S7XB 3USES 5IUJC 5ESQA 2C77A 1Y1RA 4FX5A 3CLSD 5BUQA 4ERSH 1FPMA 1XP5A 1W0VA 2NY1D 1B4RA 2ZUQB 3SYAA 3O2DL 1QS0A 1AGEA 4QHYA 3ZDXF 1WB6A 3TR5A 3UB4A 5G2OA 1AQ8A 3LL7A 1OJ7A 3OR6A 5FPIA 4YI3A 2XWXA 2AK4A 4HQNA 4H3HB 5TS2A 3NDZE 4HEA1 3HN6A 1JGUL 5JH7A 1PZUB 4H88L 4CM3A 2N7AA 3MIZA 1VSUA 4Q9LA 2WYUA 4R2GD 1S6NA 2H47C 4QGTA 1ID5I 4BY9E 4Y9UA 2R9HD 1QP7A 5DEGB 3VXSE 1OHHD 4N7BA 1YVRA 3O9WA 4MWEA 3KVQA 4FJ6A 4GH7B 1QFWL 1GGTA 4ZMWA 1U2TA 3ILDA 4KQ4L 1D4AA 3VSUA 4V2BA 4M9ZA 4RK5A 5H82A 4X5WB 4RX4A 4IHAA 4UZFA 4DLUA 4KR7A 2JJQA 5DT1L 4NBSA 5JNTA 4GM1A 3SSOA 3GJRA 4HXEB 3U7EB 4EX7A 2I91A 3VHXB 2R2AA 3VWJC 4Z8FL 2C2WA 3C6ZA 5BQ3A 3TSCA 3DZ8A 5C0JB 3FBKA 1BA9A 2XMBA 4EIUA 1J5CA 4P7BA 1YC2A 1XWFA 3HEBA 5CVJA 3Q8LA 1ZOXA 2WD9A 3F5WB 5J7CC 4AN1A 1QLRB 1EVLA 4DB2A 3FDIA 2P6UA 3IC5A 5GY7A 1JDSA 3H5TA 5GJSL 3GNMH 1XJ0A 1N34B 3RFXA 2DPYA 2H31A 5T4BA 5T41A 1K85A 4X44A 3OV6A 2F3TA 5ITZA 3P2JA 1XTBA 4UYPA 3KJ6H 2H2GA 3VRLE 2H1SA 2PR9A 1S5PA 1VMKA 3K71B 5TS3A 3DPDA 5HGGS 1AXEA 4PGZA 2X5OA 5ARCA 4JB8A 3WN5B 1T5TA 2NSQA 3HB3B 3LQZB 1H2HA 3INRA 3JQ9C 5DYOB 1MO5A 4E41A 1IAIL 3BKXA 2V7NA 3U48A 4BFSA 4RTOA 4OU3A 5C09E 2DBQA 2I76A 1A4KA 5DUJA 1RLMA 3WTTA 1OGTB 4MCAA 1CXKA 4WNSA 1AE1A 4XEHA 3ARBD 3W5HA 4UOW0 2QMYA 4K6MA 2ERCA 3VSEA 5DTQA 4KK6D 4HAZA 3TIXB 2GKGA 2CHUA 2P2DA 3N41F 4B2LA 2HD4A 1DBBL 1BJTA 1TRHA 3QXXA 1LKZA 1QWSA 4LK2A 5KNDH 2UUDH 1TJYA 2I2FA 1G0DA 3COPA 2WT9A 1Z4PX 1EE1A 4IMIB 1FIUA 1M1XB 3DOIA 1INEL 4JDEB 1SMOA 4R8RA 1CYXA 5KZCB 2PYEE 4FCAA 2PWDA 4ZAYA 3VMFA 3QYJA 4LKOA 3LC1O 2V2XA 2DEXX 2NYRA 4PRHD 5FXMA 4HJRA 1HHHA 3BX7C 1O96A 2OK7A 4B48A 2ZT7A 3M7FB 3WOHA 1QFWM 7CGTA 5JSZB 5KAMA 1SOMA 2ED8A 4L5IA 3T9WA 1UGNA 3DTVB 1Q9WA 4YFEA 2CCKA 1V11B 3WJJA 2QDKA 5ALKA 2VQ6A 3UV3A 3U4EB 4K3DL 4H0LC 1OK0A 2E7BA 1U02A 5CS7A 2ENYA 2A9OA 1L4IA 3IUSA 4L2IB 4TYNA 2VUOA 1KI6A 1WPRA 4FR0A 1CJBA 1N8TA 1EO8L 3TL6A 2NQCA 2IQ9L 1A8ZA 3MAWA 4UQ2B 4HKBA 1LDYA 3G0IA 1H6FA 1KKUA 3ITKA 3PRYA 2P28A 2B1OA 2M1ZA 4EFLA 3ADCA 4BEBA 3OQIB 2VMCA 2JCGA 1Y0LA 2FGZA 4DA9A 1ZISA 2Z91B 3BDBA 3W56A 2YQBA 4TKVA 5FI1B 2PO6B 3OTHA 2XFGB 3THMH 3E9ZA 2VOEA 3TJZA 4KREA 3DDZX 2FAXA 5E38A 4G9FE 2CDFB 2F18A 3L45A 3KQTA 4HAXA 2WQAA 2H1XA 3T38A 5FYDA 3IVAA 1K5DA 5FI5A 1R5NA 1IAIM 3KLAB 2I8CA 2OVFA 1U7ZA 3D3WB 4Y5YB 3C5JA 2HSZA 1YYML 4IU2A 5LP6A 4BZXA 2O4UX 4ZFGH 1NC2A 1SUJA 3T2NL 1WFNA 2XZQL 1JSRA 3MCVA 2Y1VA 1CDZA 4LZAA 4HGMA 3TYGL 5F3FA 1V3KA 1ESCA 2W48A 2XQIA 3P02A 3GRAA 3AXIA 3BGWA 3UHJA 3OKEB 3WTXA 1V5IA 2RJMA 2Z8YM 1JTPA 4C4OA 1IEBA 1E1NA 4HDIA 4QOKB 1FP7A 3DA8A 4UTXA 4ZI8A 3LH5A 4MMZC 1RUAL 5I76B 5KTYA 4DBVO 3LZRA 2Z1KA 1ZCFA 4OJYA 1KSJA 3U4KA 2E0PA 4E6PA 3VNYA 1IJFA 1OI4A 2FMHA 3KQLA 4L3CB 5EHFA 3JX9A 4LJYA 4GC9A 2UYGA 2GAAA 2RKBA 3UH8A 3LB6D 3MTDA 1GYCA 3N43B 1O6SB 5E8NB 1GGNA 2A9PA 1KLUA 1D5XB 2OKGA 4K4KA 1Y4UA 4HDKB 1YUKB 4C6HA 3ESYA 4IU3A 4MASA 3MJFA 4HS6A 4BNXA 3JWEA 2HB6A 4HGRA 5AZUA 3EXHA 4DT1A 4D9JA 3WNQA 1MAUA 1W5EA 4MQTB 3TVTA 1V4VA 2VDLL 1ZXLA 1TO1E 4XI9A 4I9XA 2CKBH 5KJ6A 3MGTA 3BMCA 1RULH 2Y1ZA 3LT0A 3VZDA 4FM9A 4LXFA 1EIWA 5JO0A 3BPLB 4K40A 2H2PD 5KEZA 4DIOA 4F7EA 1DQNA 3KFXA 1IY9A 1B8UA 2O2GA 4UOQA 3RGBA 2PCPA 1AGXA 4M93B 1CBJA 1DIOB 3H6KA 3V34A 3APMA 2A1UB 4R2LA 1RTTA 1V1MA 1LEIA 3F8TA 1Y6NR 3DD5A 1U3FA 3CG0A 3RTQD 1A4RA 1OI2A 4JKWA 1DEDA 2FP4B 1QA9A 4M4PA 1ZK2A 3T8YA 4UBLA 3F6RA 2Q1TA 3FYHA 3VU9B 2G07A 3FQNA 4NO5A 2I9TA 2RI1A 2YKLH 3FOBA 2PLWA 4GW1B 1N0HA 1R5WB 2HJFB 3HKEB 4OJTA 2VRQA 5JJBA 3CNKA 3LOQA 5AHKA 5I82A 4QOKD 4XVUC 1OIVA 4LCEA 4DP8X 3VD9A 5HZKA 2L7UA 2Y6UA 2G5BA 1DC3A 5JPCA 5G1OA 1IOZA 5E6UA 3KDPA 5A2JH 4ZXBC 2WNHA 4B96A 5DUBA 1M0SA 4CUJA 1HSAB 2CYAA 1U0BB 4UNNA 4B8ZA 1G42A 2IKSA 2PUCA 3PUIA 1URZA 4R4FL 2Q2EB 1KZ1A 1BDYA 2W58A 4DR5B 1E5ZA 1GW6A 3DDFA 4PSVA 1GTZA 3NFSL 1S9WA 1C9EA 2XUOA 3SYMA 2VDMH 5FW8A 2PYDA 2C20A 3D59A 3SYTA 4HBGA 4KG7A 3R76A 3M4XA 1L0BA 3VR6H 2ID4A 4DG8A 4XGKA 3MTXA 4PG2C 3SPHA 4QKXB 3BH7A 1QQTA 1D6VL 1PJRA 1N75A 2O05A 3MRFA 4FE9A 3I3BA 3KFVA 3IOMA 1G6Q1 3O4JA 2AQHA 4A7GA 3CIQA 4G4JA 2F74B 3QUZB