3ZE2B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
469
structure length
469
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 469
sequence length 469
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze2B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze2B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze2B03
1U0OC 2ICAA 2XGGA 3HI6A 4XW2A 1U8CA 1YUKA 1JEYA 5E6SB 2UZYB 1XDDA 2VC2B 2ADFA 4C29A 1U0NA 4NEHB 1LFAA 3ZE1B 1CQPA 1PD0A 1DZIA 1YVPA 2NUTA 1U8CB 2VDMB 2I6SA 4K3JB 1M2OA 3PPVA 4FX5A 1IDOA 4IHKA 1SQ0A 5LN1A 4HQLA 1ATZA 5KYYA 3RAGA 1M10A 4IGIA 2NUTB 4O02A 3K6SA 4F1JA 3ZE2B 1ZOPA 4IXDA 5HGJA 3T3MB 3AFCA 4WFQA 1JLMA 5KYYB 4MMYB 3N2NA 1XDGA 4O3TB 4O02B 3K6SB 2IUEA 3TW0A 1OAKA 2O7NA 3ZE0B 1JEQB 2NVOA 3E2MA 1UEXC 1CK4A 2ODQA 3AL9A 3EGXA 4O3UB 1QCYA 4Z7NB 1DGQA 2I91A 4NENB 1RS0A 3EGXB 3EH2A 3PPYA 3PPXA 4HQKA 1N3YA 2VDQB 1PT6A 1IJKA 3F78A 4PN7A 3VI3B 1FE8A 4BJ3A 1JEYB 3OKWA 3M6FA 2VDRB 4A0QA 1RRKA 3QA3E 2P26A 1TYEB 3ZDYB 1OLZA 2B2XA 3EG9A 4HQFA 2M32A 5HJ2A 4UM8B 4HQNA 1NA5A 3EG9B 3EOBI 1QC5A 1BHQ1 1AOXA 3K72A 3V4PB 3OL2A 5KYUA 4Z7QB 2WINI 4F1KA 3IJEA 1ZONA 1AO3A 1PD1A 5BV8A 3K72B 5KYUB 3OL2B 3IBSA 4M76B 3NIFB 5HDBB 1M1XA 3IJEB 1SHTX 2VDOB 3VI4B 5ES4B 1MQ8B 1Q0PA 3EGDA 3EH1A 3V4VB 1V7PC 3HXQA 1M1XB 3ZDXB 4G1EA 4JDUA 3NIGB 1IDN1 3EGDB 1ZOOA 3PPWA 3BQMB 3BQNB 1BHO1 2VDNB 4G1EB 1RTKA 1FNSA 3BN3A 4WK0B 3F74A 4CN9A 1MQ9A 1T6BY 2VDPB 3NIDB 4G1MA 4UM9D 4WK2B 5KYXA 2ODPA 4CN8A 4MMXA 3TXAA 3FCSA 1SSLA 3ZQKA 4G1MB 2X5NA 1SHYB 5E6RA 5KYXB 5E6UA 4UM9B 4MMXB 1QC5B 1JV2A 3FCUB 2NUPA 3FCSB 4HQOA 5KYWA 3OKYB 3HXOA 1T0PA 1SHUX 1XUOA 5E6RB 2XWJI 5E6UB 1L5GA 3ZDZB 5KYNA 4FWWA 4JX0A 1JV2B 1MF7A 2NUPB 5KYWB 1M2VA 3TCXB 4MMYA 1MHPA 3GXBA 3EOAI 2XWBF 1MQAA 3TVYA 1L5GB 3Q3GE 4GZ8A 1PCXA 1AUQA 3AL8A 3NVQA 4WK4B 2QTVA 1JEQA 1M2VB 2WW8A 3EFOA 3T3PB 4WJKB 4MMZA 2I6QA 3K71A 1IJBA 2P28A 3AL8B 1N9ZA 2VDLB 3EFOB 4C2AA 4C2BA 1M1UA 4DMUB 4MMZB 4Z7OB 1RD4A 5E6SA 1YVRA 4NENA 4CNBA 3K71B 1MJNA 2VDKB
chains in the Genus database with same CATH superfamily
4WEMB 2VXVH 1LLDA 5A4JA 4G8BA 1A98A 4BUJA 4C7BA 2HJSA 2WHEA 4JAVC 2ZAYA 1DBMH 2K9UA 4AEIH 1EMTL 4J2HA 1RJEA 4YHZH 3ZHYA 3BC9A 4YDLB 3EO0A 2G7ZA 4IGAA 2O2CA 2F8XC 3GHYA 1OTUD 4EPYA 3ZWOA 3NCTA 1EVIA 2NT1A 4QEGA 3FZEA 4WTXA 1C29B 1UDXA 1ECJA 1NDGA 3LK6A 4WZBB 4H8HA 2JELH 3D8TA 1NSTA 4Q58C 1RZFL 4WW2B 5IB3A 1BHSA 5LBSL 5BRZD 2BI4A 2H2HA 3SQOA 3LZQA 1T3FB 3GGPA 4O25A 1MAAA 3W9BA 3DBHA 3IBTA 3FPXA 2XPYA 1ZCRA 5TE4H 3WTWA 3NOIA 5ICXB 1EIZA 2QTHA 4IJ3B 1X5XA 3VFOB 2YC4C 5INCB 4MW0A 4ICWA 4KE8A 13PKA 4RXMA 1L8QA 3WEXA 1V8HA 5HHMD 5FCSH 4QXPA 5JS8A 4EFKA 1T83C 3ZX4A 4UINH 4H6PA 2BVPB 1N0WA 1G6RH 3ARFA 4RH1A 3KBPA 4BCXA 1SCNE 2CCGA 1DJXA 3HM9A 4KYVA 4IHQA 4OLEA 3BXHA 1M2KA 1OZUA 3GJXC 2OFXA 3HJGA 1I6KA 3HKFA 3EZGA 4GFXA 3MCG1 4LVNC 1N8TA 1MHEA 1B0ZA 1TPZA 1OH5A 3C5VA 4KE9A 1N2CE 1GGYA 4IS3A 1HNWB 5T5QA 4O3FA 4IZHA 2VDJA 2Q2VA 4W9KC 3ZHRA 1BWSA 2QVCA 3QDAA 5EVCA 5I1JH 1OLSB 2CIKB 5E1AB 4EARA 2G1PA 2DBJA 1OBFO 3KO8A 3WS3B 3BUIA 2EJTA 5FQOA 1JDBC 2YD0A 3LVQE 3HDGA 3G5XA 4TTRA 3ZX5A 1UPAA 1SXCA 3I6KB 5DURB 1THTA 2DQGH 2J20A 5ECWA 3W1WA 4P08A 2JW5A 5AAPA 3UOWA 1R6TA 4KWIA 2ZE6A 5GSVB 1GGHA 5BOVA 4FLEA 3FD8A 2BLFA 1G1YA 3GSNL 1MH1A 1G4RA 4POZD 3WYAA 2QVFB 1T4DA 3CPLB 3OTHA 1SHMA 3FTYA 3X3FL 4RETA 5U1PA 4XYBA 5B8CA 1WCIA 4IMLB 2NO4A 1U8HB 4L9WA 3NJRA 3WIVA 5BN4A 1BBDH 3MLYH 1MJ8L 2NY6C 5JMOA 1P4GA 3PGA1 3VR6A 3C74A 1WMBA 1D5ZA 3K8YA 4AS3A 5FFLA 4X6FB 3F3KA 2ITCB 4LDZA 2BM3A 4UBKA 3G9ZA 4NYJQ 1BV8A 2G6TA 3SCMC 5DZOA 1HI6A 1DVXA 1T2UA 5KWVA 3WK5A 1GYPA 1HMYA 4G0VA 4Z77B 1OI3A 4QU5A 1Q21A 2LCFA 1KEUA 1M2OA 2XTLA 3PPVA 5GJBA 4OGYH 2PGIA 2OR9H 1TTGA 1YB4A 4XMUA 3PFCA 4JSYA 3VMFA 4ZMXA 2WIKA 1TU3A 1SUWA 2VJPA 3TN0C 3PNKA 1BGWA 2SODB 3WUWG 4JFDA 3DIVA 1IL1B 4D3XA 3WRVA 1EJFA 2L0DA 4LEXH 2QJOA 5EHIA 5HXMA 5AVRA 2BHTA 1L9RA 4WNJA 4TMPA 2Q3MA 4J1QA 3BCRA 1OBOA 1I1AC 4ZQKA 1BVHA 2Z8SA 4QFBA 2P44B 5D70H 2OG1A 3RBVA 4JDPA 1XU9A 3C6MA 1EHKB 1U3DA 3UKJA 2X4OA 2VZ9A 4AEEA 5GJSH 3QH3B 1T5XB 4ICIA 5SX5H 4NECA 1GTVA 2DI8A 3EJUA 5ELXA 1NC4A 5I1IL 1ZV5A 4JB0A 1GNVA 4ZV9A 2N0SA 4TYPA 5IBCA 2XQBH 3VVMA 4HU8A 2H32B 4JNCA 5CXQA 1Y1PA 1OGAD 3BN3A 4ZO7A 4PS1A 1GAEO 1IBBA 1TNNA 5AKSA 3UCRA 4F80A 3LTEA 2PP7A 3DSFL 3SQBB 4FFNA 1CUIA 2YMLA 5A06A 3BILA 3I85A 2C5AA 4N82A 4BSJA 1U65A 1HYEA 4J7AA 4RV5A 3DHYA 3K05A 1BA2A 4Z5XA 4FUTA 1WISA 5IMMA 3DXZA 2P8JA 3BWSA 4H6XA 3JYHA 3H16A 4CUCA 2B6NA 1NCHA 4MKGA 1YIAA 3DVGA 5A4FS 2WTRA 4XMLL 3NV7A 4NMLA 1NEUA 3QXCA 3O74A 3QFHA 5HMLA 3A4LA 3PQYD 3ZWVA 3PWJA 1DAGA 1NJGA 5GM1A 3TJRA 3NTUA 2BP5M 4GKZB 3TBYB 1P0SE 2YOGA 3NOOA 1EV2E 4U0QB 5LA6F 2ADIB 5JJBA 3LRSA 1H3PL 4K8RL 2R1TB 3MOBH 2J8UF 1YMMB 2NYVA 1RWPA 4MJ2A 4UWQB 4ISVA 4CU6A 1RC1A 3QXDA 5D2NC 1SXJD 5HHME 5DM70 2FK7A 5IJKA 5F3DA 1ZBDA 2WUEA 4KX3A 2JATA 3WQHA 3HL4A 3SDXF 3GCWA 4IH1A 1K2DB 1GNTA 2VLMD 1XLTA 4X64B 4BKLA 3U82B 4KB5A 1P69B 1QHEA 3X1WA 4FG0A 4Z0TA 1MQ8B 5E9DE 4GSXA 3C75A 1C9JA 1SELA 1FMTA 2ZJ6A 3ZE7A 1EXHA 1LO4L 2DQIL 3BYTA 4DCQB 2XI9A 4KFRA 1YF3A 4EOGA 3FNFA 1KTBA 4X6CA 3WLWC 5TR9A 4XMPL 3QUYD 5CIYA 4YP5A 2Y7LA 4HBCL 4FHGA 5IASA 1VRCA 4NIMA 2ZE0A 1C50A 5GGVY 3KFXA 2P1YA 4RTRA 3JTMA 5HCNA 5JIBA 1ZD9A 1F4WH 5LA6B 4DSZA 3THWB 4LLUA 2CFRA 2J8UB 4G8EA 3CF4A 1BQLH 4JM2F 3HI6A 2VNKA 4PJIB 4LAQH 4XCVA 5D7KD 1WIUA 5KJ7E 4MR9A 4ANKA 4QD2E 1RJDA 1RZPA 1Z18A 2GFIA 3SDXB 2WXIA 3L7FA 4PRIB 3QLJA 1YA4A 5J9PA 1YR9A 2ATPA 4U1LB 2YV1A 2TSYB 4YO0A 2WM2A 1V16A 1VJTA 3NCJH 1G5FA 3ZWBA 1ZD4A 1UWGL 2YN4A 5EOQL 4L4VB 5IT0A 5JVDA 5IAEA 1KQGA 4EB8A 1EO8L 5F7DB 4A6YL 2I60H 2UYLB 3VSBA 2Q1EA 4X0KA 3PUIA 1P4LA 4LDOB 5TXGA 1EEXB 1FLNA 3OKYA 3UBTA 3K9HA 5EZIH 1NQAO 3D7PA 2EINB 1YS7A 3QAQA 3UT5A 1ML0A 4B9KC 1ZOIA 1G55A 4XZ3A 5GRYA 1MW8X 1XGKA 3SE3C 3MUJA 1ETA1 3MW8A 4Q56A 4JM2B 2VQTA 1ABFA 5DZNA 2I0FA 1GRWA 3WI9A 4UXHA 2LQRA 1KWKA 4MRAA 3FPGA 1ZCFA 3VXPA 3UTCA 4HWRA 4UQ2B 3BRFA 4JFWA 3X2QB 1WXFA 4MV5A 3EZ8A 5HKBA 4H16A 4QBKA 5IZ4A 2L7QA 4JN1H 3J81A 2XUZA 3LYRA 2P42B 1V05A 3H75A 3P4LA 4EJSC 4UCXA 1KBKA 3KJIA 1Y8ZA 4H0FA 1KELL 4OY3A 4KE7A 5CNHA 4GBXC 1K6IA 3U3JA 1DLFL 2VF8A 3UAWA 2A0XA 3DZGA 4IK6A 2AEFA 1MHHB 2CXOA 1JWBB 2QHXA 3RH0A 1TZBA 1KO8A 4QHNA 3FVQA 2WZ6A 3UG3A 2ZUXA 1JTEA 4TWRA 1IRIA 3PCXA 3UCQA 1GARA 3ZK9A 4F8PA 1BRTA 4TV9F 1ADYA 1DTWA 4PINA 5CDSA 4IOFD 1OGAE 4HIQA 3VAEA 4FA6A 1NF8A 3V9FA 5AKGA 4BBPA 2HEIA 3ELWA 4AIEA 4HUVB 2WTBA 4OLVH 1ZJAA 1IAIH 4QGSA 2M1XA 3ZKSD 1E99A 2YWZA 2OHVA 2X0EA 3KDPB 1S9VA 3G0CA 5GS2H 4J7CA 2E0IA 4WLUA 3L7BA 3CSUA 1KFCB 4IIBA 3T1VA 4RCAA 1SD1A 4HV4A 5C7OO 3DJTA 4IDJL 2AEPL 1KE2A 4JP3A 2DBRA 5EIOA 5EWIH 1BS2A 2HNAA 2PS9A 1ERNA 1KGCE 2FDBP 1G7IB 3BQUB 3N50A 4RWEA 2RGSA 2ZWYA 4RQBA 4KZ0A 3TA3B 5HGHB 3VXKA 5GZNC 1DQTA 3PP4L 4OD3H 3RWJB 3HO6A 1B8NA 2HQSA 1VADA 4YECA 2JVUA 3GJ0A 4XQ9A 1EM8B 3PQYE 1BPVA 5CB6A 2R7NA 1F7VA 3ROEA 1C8KA 1NBVH 4OD0A 2ZIVB 4B4OA 4A67A 1ML3A 3TG8A 4LXQA 3W2HA 2FOLA 5I30H 4L8SB 1DEDA 4PS7A 2HVBA 5FECB 1Z2NX 5EZOL 4XB3A 4PBVC 4DUZB 1IC4L 1ONPA 2B2NA 3VU2A 3EY9A 5CKAA 4RCYA 2EQDA 1J10A 3IAFA 5H70A 3FPAA 1D2OA 4WHMA 2VLME 5AJVB 1EGAA 1BLNB 2WXMA 5KVVA 1N59A 4XBPA 3F4KA 2HJKB 2OD2A 3LSYA 4FSDA 3UG6A 1F1AA 3ZCQA 2WWKO 4AYBA 1R8YA 1EDYA 1LYQA 4LLMA 5BZXA 1NXXA 2PD6A 3EVTA 4DFIA 4ZQGA 5DGXA 2AI0H 3BAIA 3FU3A 4KY1H 3L1EA 2MKLC 3WGUB 1E4JA 2ONKA 5LYYA 3U3KA 3D51A 3HG2A 5F1OA 1OAYH 3JTSB 3FCYA 4RKRA 4BFBD 3BD7A 4WENB 3ZJAA 4MHSA 2R5NA 1OI2A 2V7VA 2HO5A 4L08A 1BZ9B 4URUR 4UQEA 5C0GA 4G5AA 4KR3A 3TOPA 5REQA 2JXMA 3G5VA 1L6PA 5I6MA 1A4KA 1VZGA 2VTDA 3FDZB 1XZDA 2ZKYA 2CHGA 3DB1A 5K01A 5L3SB 3EYSL 4MAYB 4I66A 1MCOH 1W16A 4M5YH 2N7SA 1GADO 1MCHA 2DHRA 1P3JA 4AYID 3FB7A 2UY6A 1I9EA 2V5AA 2WWHA 1E9OA 5EJ6A 3FVTA 2WYTA 1A7NH 2GEKA 4NN5C 2AMUA 1FCCA 4H20H 3BPSA 1FFAA 5BS0A 4U39A 3EQ2A 4P23D 3E7WA 4HNAA 4D2IA 2Y0DA 1Z82A 1TFPA 4EY8A 1U6AH 3G08A 1H3FA 1ZGAA 4P4KD 1ZBQA 5GXBB 2NDFA 3NMEA 2QLBA 5K3FA 4NC1E 2ZQKA 4O2EA 1LDBA 5KAMA 2HRLA 2FJFA 2P2LA 3GC3A 1IFHL 3VTTA 1O6SB 4PRDA 4EY7A 1E3IA 1Z5VA 3TZQA 4CVNA 1MHCB 2ODHA 4C0XA 1YZTA 4ONGH 3ZZUA 4S04A 3HNSL 1OCWH 1T22B 2RGCA 3V6BR 3AAZB 1Q1QA 2O0LA 1EJOL 5E08L 2G2RA 1PD1A 1YEKH 1M8JA 2QB5A 1I85A 4OBRA 1W85B 4CCAA 3HBGA 5K05A 3PHHA 4IIVA 1SVBA 1O7JA 4REQB 4HIHA 1Y3BE 3L4UA 5FNVB 4U5QA 2XKNA 4HYEA 3GVPA 3RKRA 2Y1EA 4D6PA 4ENEC 2H2IA 5TQ2B 3R7AA 2ZRLA 3BAFA 1KYQA 3W7BA 3F7VA 4UOW1 2Z4QA 3CR7A 1GLNA 4EI0A 4M99A 1FLRH 3TK1A 1HHGB 1H8EA 1RW4A 2XLBA 2ZCZA 3T71A 1L7XA 1TDJA 5IQLA 1I8UA 4AUEA 1FXSA 3G2HA 3A4VA 5J3HC 2HLAA 3JQOB 1ZDSA 4BFLA 1BMTA 5ALEA 1I7ZA 2CAKA 2XCSB 1NUSA 3QYFA 2POQX 2PZLA 1PIWA 1LK2B 2RCSL 3L7KA 3KPWA 2PR4L 4OKNA 4K9EL 1U0SY 2XUPA 5BSUA 4ZCLA 4BRUA 4C5AA 1FHNA 4Y5XA 3JAWB 2GBPA 1U8KA 1XH0A 3LNIA 4XCYB 2MPAL 4YI5A 4JI2B 3UWDA 3PHGA 4ZK8A 4H26B 5K99A 4ZDHA 1TQBC 3C6ZA 1M71B 1N6PA 1KZ1A 3L1JA 1GUYA 5AW1B 3ARDD 3TI7A 3EZ6A 5IJ9B 5SZJA 4I5GA 4JE0A 4NQVB 3DJYA 2NTYC 3QPQC 5BV7L 5E0KB 3BC1A 4R8WL 1FDIA 2O3QA 2F58L 3MWKA 4TRPH 3I6QA 4NNOA 4PPQA 4AKQA 3L4WA 1PLJA 2I6XA 3K96A 2FUG6 1QP1A 2WHYA 4XXHA 2JQAA 2ZBFA 4WDRA 2WMNB 3I4LA 1DT3A 4QHUA 1D2NA 1WKVA 5B55A 3VO1A 4YVFA 2HKFL 5KOVC 5K39A 4HZAA 5CRIA 2ZJ1A 1XHHA 4PB0L 5DB4A 4OZGA 4OCLC 3RWHB 4FG6C 4PJGB 3QCTL 2YPLD 1YRKA 3W8RA 4HXFB 2BVEA 4Z7QE 1OXTA 4C6RA 1WZ1L 1ZA3A 3MLXH 3JV0A 2DQCL 1A02N 1XXDC 3PI6A 1EB9A 2BRUC 3H87A 1AGBA 3C60C 2XHZA 3SY6A 5EF1A 1D0IA 3V2GA 2P7IA 2FFJA 4EA7A 5LYJA 2WWRA 3F2LA 5BZDB 4ALJA 4FZ8L 1T5WA 3WIFB 2H0RA 4OLFA 3W77A 4OP2A 1A2OA 1U8JA 2Q7YA 3I75B 5ITBH 2HCBA 4W5TA 3KTFA 1JNNH 1ZOXA 4JKLA 4YHMH 1SRQA 4BQBA 5B39G 3GH3A 1BP3B 2H1PH 3GCXA 4NOFA 1U11A 4AV0A 3UC0L 1LDEA 2X4IA 3Q5DA 1FBTA 4U3SB 1KJNA 2QYTA 4TQIA 2KPOA 2G1AA 2J41A 2CM6A 4KQ0A 1JKJA 4O4LF 5CUSH 3DNKA 3ULUF 2E3JA 1CX9B 2YFNA 4ZRNA 2XWTB 5C0EB 4LHJB 4H60A 4JBIA 3ZE1E 5EI5A 3DDUA 5I3CA 1UA3A 5AVQB 3MLZL 4M62H 1C1XB 1GKKA 1DN0B 4OFPA 4EI5D 4M8VA 1MNUL 2H6EA 4R7XA 4NV1A 4FFZA 2HMVA 3DA8A 4XVUC 3FXAA 3U4KA 1LTQA 2VF4X 2QZZA 4P86A 3RFCA 3F67A 2HHAA 3L6UA 3GTVA 2TSBA 1GG5A 4YRRA 3SD7A 2XUFA 1BQ3A 3QKSA 2A5UA 2Q6WA 3T6XA 3IWVA 3NZSA 2OCGA 3KYDA 3C2QA 5D7EA 1M7UA 3V7NA 2DMRA 4N3GA 4YONB 5I6XB 4I8DA 2ZGVA 2N01B 2Y24A 3X1YA 1W6RA 3C5ZB 4OU5A 1PU2A 5BR1A 5JHDE 2AE2A 4TLCA 2P1DA 4ACAA 1FZOB 4WTWA 3X11A 4M37A 3OPYI 2VZUA 1HAUA 2ODIA 1UWCA 1IEVA 2Y66A 4DIEA 4CV3A 1J0ZA 4O4LB 4YDVA 4XB6B 3QX3A 2OXRA 2O1WA 3ARSA 3RS3A 4HP8A 2VJQA 4BCBA 4FF9A 5LXTF 1EDQA 1EDBA 3MKKA 3ZGYA 5AZ2H 3GMNB 3GZTB 3WFCL 5K3BA 1LA2A 5IK2D 1RWXA 1US8A 4NZUH 3QQPA 1MBZA 4FRWA 1IKOP 2VZOA 4I48B 4IOSA 2WE7A 4CM8B 2RE8A 1BXRA 4CEJB 4EN2A 3I64A 1X5KA 1DEEB 2A6KA 1BQHG 3L7JA 3MREB 1IJKA 3V52L 4N2EA 4R9HA 3DE5X 4Z51A 1TM2A 3I3OA 3SDDA 3AMKA 3L5WA 3SQRA 1J21A 1LK5A 4ZODA 4W4OC 4A36A 3ZHZA 4EVNB 1NATA 2VXVL 2QQGA 4GT1A 1PV2A 3H99A 4FULA 3ABLB 2N47A 4NQQA 3OPMA 1KOLA 5JSQA 2HT2D 1DBML 4PG2A 1N6QH 5LLTA 4AEIL 2XRFA 3ILSA 4F57H 2XY4A 3ZIAA 4IKLA 4YHZL 2YNMD 1SQ2N 4YAKA 3MRDA 4R5HA 3AHDA 1VKNA 4WJLA 1MLBA 2ZUFA 3VYSB 1I8LA 5LOVA 4A39A 5IROD 2P5WA 1CK0H 1FFRA 3ILQC 4YRPA 3EQ7A 3RO7A 3VGGA 2JELL 4DCVA 3LRMA 1NHWA 4TL9A 3JUZA 3EDRA 4WCFB 2QJWA 3WIBA 3WJ2A 1A5TA 2CF6A 3O03A 1GNSA 3T8VA 1Z6PA 4G42B 5TE4L 2QTGA 3G8BA 1TC2A 3I6GA 4B87A 5DURD 2R65A 2CJUH 4CQMB 2JFWA 3TSAA 1TD9A 2FT7A 1OH6A 1T0OA 4PTTB 5LXVA 5A2FA 3S8WA 2HTKC 2BFAA 1CG9A 2X9NA 4H8PA 4UINL 3RPEA 1J2TA 4LKCB 4QNPF 3NTVA 1G6RL 5ENZA 3OKNA 1VFBA 4KK9C 1KJVB 2GT1A 1PK9A 5DK3A 1QRKA 1FG2A 5EZ6B 5MEOB 3WLKX 1NCOA 4GRWB 4GL4A 1CFVH 3MMNA 5C0OE 5HJ2A 1GGIH 3CVVA 3GSQB 2YPLE 4C89A 1M53A 3KXKA 1N5IA 5SWSB 2BKEA 3RWBA 3UFXB 4HMCA 5AOZA 1UDWA 1EAQA 4XCNB 3A70A 4FKMA 1MOEA 4ZAGA 1Q9LA 1LSOA 4MKXA 3TQHA 1NN3A 2MPVA 5IHZB 4DMRA 4EUEA 3F7MA 3PR3A 4LPUA 2PO6B 5I1JL 5ALGA 3KPMA 2V74B 5BUPA 4B7UA 2HT6A 4DY4A 3MTEA 1JQEA 3FUIA 1RTTA 1WAMA 5J58A 4MV0A 2DQGL 5D1QB 4NO3B 4D9KA 1PAUA 4KWEA 3GEPA 4KMOA 2AZUA 4NJMB 1TEXA 1U2DC 3VZBA 1FQ9C 1NBYA 4C9BA 3BWUF 2E7CA 3BCDA 4DM4A 4FGJA 4KDEA 1JWMB 4MROA 4KFZC 3KLQA 4PRHE 1EUTA 2NCEA 2X8LA 4EKEA 3PWPE 1GCUA 2BL4A 2APFA 1FAKT 2NY0C 1FV1A 1SXZA 1QAQA 2DWUA 3QVAA 3T2LA 1NW4A 2QN8A 4LTNA 1CIJA 3MV7B 4O2CA 5LCVH 1BBDL 1IBDA 3MLYL 4JLRA 2XGMA 2APTA 1R2QA 1SG6A 4WXHA 3NCWA 4P2OA 3QI7A 5DTMA 5H2BA 5EDXA 1L5QA 3U39A 1I1YA 4JW3A 4KAAA 4J03A 1T0JB 5ALJA 4WHDA 2QNIA 3SMQA 1QC5A 5BPHA 5BNIA 1CD5A 2IP4A 4CXMA 3IHLA 1F2TB 1JPSH 4NRXA 1Z9OA 2QE7A 3HWRA 4OGYL 2OR9L 4F6CA 1A3RH 2AEIT 4XX0A 1L9TA 4U3JA 1XGTA 2R4QA 2IGLA 4RPCA 1AR1B 3FWNA 3QA9A 2O3RA 3VFDA 2EOAA 4WZBE 4EHJA 1XNQB 1OYYA 3K0WA 1HH6A 4LEXL 1Z07A 4FQ2H 3UMJA 1YGPA 3NEYA 4Q4CA 5GZOD 4PGEB 2ODEA 3KVYA 4U3CA 3FOLA 1A6ZA 2WCSA 3RU8H 4R3SB 3BE5A 2VUKA 5D70L 3MOAL 4GE3A 1VKJA 3X3GH 1E4OA 2ZW9A 5GJSL 5I2IA 2FPPA 4Y2JA 3Q15C 4MKZA 4P1ZA 4XZUB 1ORQB 3CN4A 3JTTA 1J99A 1EK5A 1O0CA 4RV9A 2ZT8A 2XQBL 3NZUA 2AXFB 1SOAA 1GQ2A 1QIKA 4DBLC 4KYIB 3NH6A 3FBGA 2FEEL 1TENA 3G6AA 2X4NA 3NA9H 2DKSA 1C3JA 3S28A 2CT8A 1G64A 4KQGA 4O29A 5KSAA 2AAAA 1U0FA 4LYAA 7ADHA 4R1LA 3JALA 5HRAA 1T8SA 4B3CA 4WWHA 3GG2A 1XZJA 3ARBB 2WTAA 4J3JA 4HDAA 1FFEA 2ZCKH 1DIAA 1LQUA 4JQZA 4E09A 4MVJM 5CFMA 2EKJA 4CFSA 1M2HA 2G5BB 3KWMA 4G07A 4DXAA 2VNIA 3R77A 1YWGO 1C8PA 1HEZA 4IBTA 3ANLA 4ML3A 3V34A 2BFNA 2FHPA 1BZDA 1EP1B 4NBYB 3Q2IA 3SDYH 3ZHBA 5ECJE 1YJDH 5ILOA 1OKKA 3V7FA 5AVWA 3BH9A 1SSLA 2CK3D 4ZYKB 4HH4A 2C97A 2QP4A 3MOBL 2FVNA 5JROA 3SKXA 2DKOA 3ZKXB 3ZI0A 3ZDZB 4PRID 5DD6A 1X1TA 2O8DB 3QEMB 4DS3A 2GIXA 3RDTC 4RGND 3D0VB 4EJ1C 4RVUA 2YXLA 3LMKA 1JIKA 5J11B 4BN4A 2VQ1B 4BS9A 4YQFA 1FLAA 4HX1B 1HJBC 3V0VB 1R0RE 4L4VD 3WDJA 2C7VA 2AOUB 2AR9A 1G5IA 3MTRA 4PYOA 1OGSA 3SDAC 3P3SA 2C00A 3V4RA 1TKWA 2WKOA 4GO6B 1JDAA 5KNBH 1SG0A 3DECA 4B96A 3GLTA 1E5XA 4FX2A 4F3TA 2BZ0A 1NM5A 3QTLA 3VXUD 1NY5A 2JK1A 5WRFA 5L3ZA 5CCGE 2FEWB 4MUBA 3AU1B 3AUFA 3T52A 2X1XR 3E3LA 4XJTA 4FJ2A 2IH4A 1RL1A 3VTMA 1LO0H 1ZMYA 1GYAA 3IMUA 4EKDA 3T61A 4JM2D 2A30A 1A2YB 3LV3A 1XAHA 2AF4C 1R6BX 2WLSA 4RIIA 1F4WL 1YO6A 1STOA 1PK8A 5IFJB 1JR2A 3PLYA 3RRMA 3UUFA 3EOBI 3F85A 3EZ9A 2JLCA 1EDHA 2GPBA 1CV2A 2P9CA 4LAQL 5AJTA 2IXTA 1NFRA 3N7AA 5CGMA 1DO6A 3DSRA 3SGDI 1YAZA 5LLSA 2FSEB 1KZQA 3EGDB 4MQEB 4IU2B 3RIYA 5IR1B 3VSQA 4N41A 5C7LO 5KWSA 3RVUD 5BUAA 2PNFA 4L1HA 4HEQA 1GPUA 3NCJL 3LAWA 3AXLB 3D7MA 4LRWA 3U0TB 2IQ5A 4J2QA 2Q62A 4RTSA 3DZBA 4MDHA 3GY0A 3CH4B 1TFHA 4R2GC 1TJMA 3DE4X 2I60L 3QEHA 1IGYA 3RB7A 1JDPA 3FMOB 2EVWX 2OBBA 2GILA 3UYOD 1GEEA 2V37A 1F60A 2AK3A 3X14A 5IOPB 1NUHA 1R3HA 1KERA 3G7TA 3I76A 3HVDA 5EZIL 4YXKH 1DGQA 2Z3FA 2I9TB 3R9WA 1NV9A 1L4IA 5EBMA 3HKDB 1C3LA 4PJ8B 3HYSA 2WD0A 2X7LB 3F6BX 5DULA 1UBUS 4N2AA 4BGDA 4BGEA 1KIRA 3B1YA 3DYOA 1SUCA 1J9GA 3MJ9H 3WY4A 1MCIA 3O6FB 1XRMA 3L8ZA 5EMYA 3GMQB 2GKGA 1X3LA 1M7DA 2EZUA 1BMQA 1RHHA 1WWBX 1HNZB 1KYXA 2N42A 4HEA1 3KKEA 5EYPA 4JN1L 1NR5A 4IRJB 2XF2A 2Q5CA 4MBOA 5B36A 4EIZC 3TA3D 1HEHC 5I7UA 1W0CA 4DLAA 1UZLA 3NDJA 3OJ2C 2I1LA 3V7WA 5E3IA 1EUCB 2A5LA 3W5HA 3D4NA 2NZ8A 4G5SA 1YTLA 3DO7A 3SIKA 3FYCA 1KLGB 4NC2B 4DRXB 2IXQA 4N2GA 3T9BA 5AJHA 1V8FA 2J0UB 4FMDB 4NV0A 1WMAA 3W0WB 2H11A 4A0HA 4PNPA 3Q2CA 1XHEA 1YMME 1OPOA 2XMDA 3ESOA 4UM9A 2NNWB 5I16A 4HKZA 2C1PB 2PLNA 2HYMA 4OTXH 4DGYH 2VYRE 1BWQA 1FB5A 3L08A 5GPRA 4JY6A 2WBLC 2OP0A 1QG6A 5BUCA 4D81A 3VNYA 5I9IA 4OLVL 2CPCA 2JCBA 1IAIL 1WFUA 4GMHA 4AZWA 4DKDC 1VPLA 3ODPA 2HLFC 3DX3A 5KQLA 3H56A 5EB9A 3X1BA 3TL2A 3C3XA 3QO1A 4KK8D 4G7YH 3E0QA 2YN3A 5KPJA 3GWJA 4ODWB 4X8OA 5EWIL 1OE2A 2HU2A 1PL3A 4JAMA 1RIFA 1QZXA 3WKQA 1CO1A 1NIEA 4R7TA 1TJXA 3CAFA 3PAYA 4HFUH 4CBPA 5COBA 4OD3L 1BMWA 1M3IA 1H2RS 1ZA6B 2G0NA 3VFVB 3B56A 2SEBA 3MFQA 2IX3A 1I36A 4NG4A 3RK4A 1EGJH 3CVCA 4GYBA 1NBVL 5TK4A 2J8UE 3TS1A 1FE8A 3CN1A 1ORHA 5FM4A 4TOYH 2J9GA 1BVZA 3ECQA 4ADIA 4E13A 3TTYA 3B60A 4LSDA 4GZ5A 4JQIH 3C3AA 5I30L 1S9KC 1O6GA 1WH0A 4XCEA 4QUJA 5GOZA 1Y0LA 3SDXE 2GCPA 4RANA 1A71A 3FQXB 4F33B 2X1OA 1ZONA 4TKWA 5D4QA 4PRIE 3K6IA 1I4TD 1R12A 4OMCA 3KPSA 4Y9TA 3PGCB 1NUDA 4OJFH 3VPAA 1S2EA 1LFDB 2HGZA 4ARAA 2VDOB 4AP6A 4Q7DA 4ENUA 1AB5A 3FRJA 4YHYC 2WZDA 3SP1A 1ZVMA 2LW3A 1T36B 1FUUA 3U4AA 3VVWA 4G9FD 4QRIA 1OAUL 4L4VE 4ENVA 4B6OA 4MRRA 3TOCA 1VL5A 1FFOA 5LSAA 3QJYA 1Y8RB 4DG9A 3GZNA 1YVDA 2AI0L 2NUPB 4Y1EA 1SJMA 4KY1L 1FXWF 2PYZA 2X3AA 4V33A 4FEAA 2IHJA 1KG0B 4GM1A 1GGKA 1UA6H 821PA 1OAYL 4TQHA 3EXG2 2CMGA 3K74B 4XMVA 2QYHA 4HB2A 1EEYB 3E23A 4RL4A 4AC9A 3K2MC 5T8KC 3NZHH 3ENWA 2XG4B 4DSTA 3TLYA 4G86A 4MAAA 3EDCA 1UH3A 1Z28A 4UNUA 1HYHA 3WFHB 3OVMA 1LO3H 4NN6B 4OU4A 1MCOL 1RSYA 1C4KA 4M5YL 3W11D 3OKLB 1MI5B 3D3NA 5AKLA 3WIEA 1JF5A 2Z8VC 1WABA 2HQBA 3DZFA 2ZXFA 4GKVA 1ED3A 1KMMA 1A7NL 1RURL 2DWEA 5HDLA 3OEED 4H20L 5JC8A 3FDWA 1ISIA 3CGGA 4DWOA 4YT5A 1RULL 4PJ9A 2EE9A 4PJ7F 3H83A 3ZH2A 3V4UH 2IYAA 4WO4B 4X5RA 4D41A 4DDKA 3I5XA 1PKEA 2J3EA 4G0XA 5IAOA 1U6AL 2ZATA 3WE6A 5BRZB 1C1DA 1W0KA 4KSYA 4GIPD 4ZPJA 3NSFA 2PR2A 2EXWD 5H3LA 1RWMA 3HU3A 3N07A 1AHWB 4I1NB 1IMOA 4RH4A 1LDNA 2O0KA 3OC5A 3O2SB 3RHFA 4EKYA 5D1ZI 5DT2A 3KYKH 2XF8A 3PPWA 5E6YA 4OB6A 3R5XA 3IFOB 2EKPA 5E2TH 4BU0A 1I4FB 2ODPA 1REQB 4PZAA 4L2LA 1EGVB 3FCSB 1QJCA 2IBTA 3FTPA 4FAAB 3I02A 3FQRB 2HXAA 5K8VA 4ONGL 4YMTA 3GBVA 2HFEA 2E3VA 1GPMA 2GCEA 2VJKA 4U7DA 1OCWL 4QHMB 4M8QA 5DSCB 5IJXA 1LWNA 1X7GA 4YJFA 1DKUA 1YEKL 4HI0E 3TRIA 1FFQA 4ZT3A 1H2BA 2PTTB 1OTSD 3CLFL 3ARRA 4PJ7B 4ZT6A 3ZY2A 2R2BB 3PR2B 4PQYA 1JU9A 2IDMA 1E4XI 4AY3A 1P6AB 2C3PA 3WIHA 3DGGA 4BEVA 2VJYA 2XD4A 4EF6A 4INZA 2FV8A 5CFZA 3WLNA 3KSDO 4I0KA 1S5PA 1P9MC 3V2UA 1CC3A 4IZOA 1WT5C 1FLRL 3I1IA 2AA3A 3GLIA 3NWPA 3BE6A 2XQYG 1XYYA 3K6KA 3KEFA 4KMTH 1YHPA 2A0LD 2D3LA 3GRWH 3QBDA 2Z8WC 5U9CA 4MWGA 4EQ6B 3DPIA 4J1TC 4RVGA 1RMFH 1PJRA 5BP7A 5KUTA 3T41A 4RZCA 3U17A 3JYPA 2EATA 1NPDA 4QT0A 3O90A 1G1OA 2GETA 3HNPA 1QTQA 2AFIA 3DOHA 4ZX3A 1JEAA 2PJRA 1ODLA 5CA1F 1FA9A 5DQ9B 1DXOA 5FGRA 4C56A 4G5YA 4TL4A 4G81A 4MWFB 2DPYA 4CMEA 1MY5A 1BD4A 4JYZA 4QGGA 5KX5A 3WBJA 1RH8A 2V6IA 1RUAH 2PSEA 1GAWA 4XHQA 5AAWC 3VH8B 2UUDH 1NMZA 4GRIA 3V5HB 5KVEE 3DTDA 4LYDA 3MRMB 4MJ5A 4OHOA 3TT1H 1MW3A 4E70A 4YCCA 3U80A 3CBGA 3SYKA 2FZ3A 4XWKA 4AXXA 2KC0A 4ZHQB 5DVMA 1P5VA 1EUYA 3QDGD 4QUDA 4BELD 1YCDA 4FXOA 5CAYB 2B20A 3R3JA 2XRMA 3WLSA 4QXTA 4JS0A 3S88H 3ULVH 4YBRA 2FW1A 4ZCQA 4MJHA 1B3IA 4U7HA 1G9TA 1I8IB 3KHSA 2AJXH 2PFGA 1FZKB 4FINA 4UM5A 3FWKA 4PJEA 1JFRA 5BSKA 4ITUA 1ZI8A 1XDGA 3CFKA 4LHVA 1OPXA 2WI8A 4FKBA 2A74A 4B5ZA 2FFHA 4FNGA 3T6ZA 4CIBA 4B9JA 2H1OA 1ODTC 4AP9A 2JIBA 3RK1A 4QRSA 5LB2A 2YN5A 3MLXL 1DC5A 2HW8A 1DX4A 3K1YA 4YN3A 3HUUA 1DVFD 4Y1FA 1XEXA 2IPMA 1WRFA 2CUKA 1CTMA 3GNSA 1SQSA 2YC2C 2XUHA 3K32A 2CUTA 3C5ZD 3OL2A 4HVTA 3WV4A 2C4NA 3O6VA 2Z83A 1KFJB 4FI7A 1X42A 3GCGA 4BB5A 4K8OA 2JGEA 4HNHA 5MENB 2ZRQA 2JZCA 5ITBL 3N2EA 2YUZA 4MKRA 1JNNL 2X44D 1KMCA 4YHML 1A4UA 1ECCA 2WZPA 3WGYA 5LJLA 2YJZA 2F4NA 3TX4A 2H1PL 3L8MA 1T4MA 5KSYA 1JZQA 4P5KB 5L4IA 1FNHA 4R2HA 4HVCA 4A04A 3G9XA 5DEOA 2EKZA 4UCQA 3UXMA 1YL6A 5B2FA 2WN3A 3SYMA 3ND9A 4QTHA 2XNAB 3IGKA 3DDNA 2X4RA 2XWSA 2F74B 4MA0A 1Q38A 3US9A 3L84A 2A5DA 4P5MB 2YXEA 2JVJA 3QXJA 1NX9A 4M62L 5EZYF 2J30A 3TNDA 1DDIA 5I66B 4P58A 1U36A 4Z4FA 2WQZA 1UR5A 3DEKA 2CZQA 5DJDB 4GUAA 1RABA 4UARA 4U2DA 4CFZA 2Q0HA 4FCWA 4OIFA 5TT1A 4NCC1 1VMAA 3UPRB 2P2CA 3CT6A 1FFXA 3MYRA 3SE0A 1M6OB 3QIUC 1I3RB 4MPPA 2C2ZA 4HZUB 2P2SA 5DLLA 5DJZA 1IQDA 1GGUA 1UBHS 3E7PA 3GMTA 3AC0A 2G5CA 4I5BB 2PW2B 4Q02A 4RACA 2GEJA 3QU2A 1EEUA 2G9RA 3HADA 1K8ZB 3APMA 1N57A 4BK5A 4NE9A 3PV7A 4LCBA 2UVPB 4QYWA 1SXJB 3PDOB 5LQBH 4WWKA 2XDQB 3M46A 3O2NA 5T3XE 2EICA 1ZN2A 2PFKA 5AZ2L 1GA6A 3HUTA 5PNTA 3BMWA 1BFOA 3K3QA 1U6JA 3FAZA 5EZYB 4NZUL 2ZP8A 3EJZC 4NM4H 5E7FA 3COVA 2JBAB 2MYNA 1Z83A 1E94E 3VISA 3KPUA 4L1LA 4L4SA 3QDJA 2OJEB 1Y18B 4ZMRA 3FO0H 3WLEA 3IAGC 3KL4A 2AJVH 1LE9A 1HDIA 4K05A 4CQMD 3FU6A 4YT2A 4ORZC 4ZMBA 4B43A 4O8ZA 3SBRA 3EO1B 2K3TA 5FO0A 5CLFA 4NMXB 4E41B 1ZEAH 3QIBA 5F9JA 1ZIBA 1TEZA 1MIMH 3IMWA 2NZ9C 3WJLC 4AK2A 1N6QL 4EDXA 1GGNA 5BJTA 3D8NA 4AM0A 1DZIA 3R5SA 1NFAA 1GL4B 4ZQFA 1TO4A 4DMHA 5A5VA 4PJGE 4YIQB 1R9GA 5AI8A 5SWSD 4BYGA 1XAGA 5AW5B 2AMLA 4PYJA 5KYYB 2R1UA 1G5TA 3A05A 3C97A 5FBRB 1CK0L 4MYDA 2OCKA 4GLFA 3QBEA 1J8KA 1I7UB 1E9EA 4EYSA 2KUTA 1T5TA 3L48A 2JFYA 5F8RC 1WDWB 4F2GA 2WY3B 4OQDA 2Q6LA 4P5DA 5HHOB 4XGQA 3EVAA 2ADOA 4CIWA 2XN9B 1S2GA 1UQSB 1FU4A 3Q6NA 3D7KA 4N5HX 4N90D 1AUPA 4DNQA 1PEDA 4WZ9A 3F3YA 2TMYA 1C7QA 1J5PA 1JNXX 1D07A 1NAMA 5IQ9B 2CJUL 4X6DB 2R8RA 2BHSA 2EZ0C 1SQ5A 4OZFH 1P4BH 4I5DA 3OA2A 2NNRA 4QYSA 4EABA 1TT7A 1WITA 2PD3A 1FQKA 2ZT6A 5FO8A 3A1VA 3WGVB 2FBJH 2J32A 1BYUA 3TXXA 3E22B 3EXLA 1E9DA 2IBMA 1MDTA 4GI8A 3MTDA 2R9VA 3H0TA 1CFVL 1S8DB 4LYFA 4N1AA 3FCOA 3T08A 2ZUDA 1GGIL 3I04M 2CJSA 3BWCA 2FMUA 4MB5A 3EYUH 5DR5H 4AGPA 4H0IA 5A6LA 1JAYA 2NU7A 2VH5H 3N5KA 2YGQA 3DR3A 1GGTA 5HIAA 2ZBPA 4BHUI 3KJGA 5DMGD 1YR7A 2V2WB 3M5PA 3RTAA 1WBYB 1JH8A 1I5EA 1LW7A 1DQVA 1YEGH 2IDQA 2CKDA 3VD3A 1U8NB 3IETA 2ISQA 1D2GA 4ZO4A 2FP4A 2RR3A 5B30A 1HKFA 2UXTA 1VJSA 2I71A 3TG2A 3ECCA 1FX0B 3A2LA 3S5LB 1ACLA 5ES3A 3EC7A 5A2JH 3BZFB 1FVOA 4E08A 1ZZGA 3BEVB 2CE2X 5D7BA 2UUOA 4RS4A 2CFIA 3F7OA 2A6PA 4D0DB 4FFYA 3U3XA 5HKKD 1B9KA 1T15A 4JLUA 3QUQA 4N8VG 1G38A 5JW5B 3GJ6A 5H7XA 1G7JA 5DCCA 4PG9B 3O0DA 1DDOA 5CDFE 4XPFH 1Z4IA 4WIQA 5DUMH 1U7DA 2RBKA 2R1WA 4OY9A 4YGAB 4REOA 2BNRA 4HETA 5AH0A 5AUQA 2Z0BA 1NVMB 4YXWA 4LV6A 5LCVL 4ZEWA 2QMUA 2SKEA 6CHYA 5E8NA 3RJTA 1FUKA 1T9KA 3JWHA 4Q4DA 3OKKB 4WTOA 4F8EA 3E1F1 3CVBA 1VCHA 4WZAA 2B4RO 3ILPA 5TMPA 4AQ1C 1FNGA 1PCXA 2J1WA 3U3ZA 4Z7IA 4UEWA 2NTFA 1JPSL 1WGVA 1RM0A 4Q1EA 4NENA 1A3RL 1Q1AA 3D6UA 2IPXA 4XM0A 1IBKB 5AW4A 4IXWA 4DV1B 4YACA 5BUZA 4GLJA 4XOAA 2I2BA 5DEGB 3W5BA 3K1KC 5EIBD 2QLNA 2E7BA 1HEUA 3HR6A 3KCPA 2Z8RA 3GPEA 3AF0A 1YZQA 5EU6D 4FQ2L 4XOBA 4JFXA 5DHYA 2V9QA 3DYVA 1XKQA 2J9FB 1EX1A 5AVTA 1CLYH 4Y19A 3RU8L 2HFJA 1KARA 4GW4B 1AQDA 3LT2A 1I31A 2PXYD 1MFUA 4AVJA 3X3GL 2XUDA 1Z56C 5G4KB 3UBXA 3NALA 1T3SA 3RZWA 1L0BA 4BV2A 2EYUA 3K0FA 4AQ8A 2DY0A 2QRJA 1YZUA 1HPLA 1J05B 4RMRA 5HPMA 1Z7JA 2E9IA 3FB1A 3KVQA 3NA9L 2HX1A 4JQXA 4PJXF 3A9WA 3QI9D 1OWNA 3AV0B 3P0HA 2X9QA 2NR6D 1TUGA 3E6FA 3HAEA 4GI6A 4H1LB 1A7JA 4GRWE 1LJLA 2AKRB 5HG0A 5E8RA 1ROCA 5JD6A 2J5WA 2Z31C 5SWSE 2ZCKL 3QEOA 1QHSA 1OX5A 2XWBF 3V8BA 2BTEA 2YD8A 1UT9A 2GB4A 1OF2A 1I14A 1W9XA 1U2EA 2YC1B 2F2TA 5ELMA 3PIQB 5I74B 4L3AA 4D98A 2REXB 2E47A 3SDYL 4N90E 1ND6A 1YJDL 1IVNA 4TF4A 3S3BB 4IIJB 5HJ5A 3IBYA 5JNSA 3BP6A 1P5JA 4I14A 1GKOA 4CRPA 4LBZA 5D1QE 3C6LD 3JQGB 2QDXA 1U42A 1GUDA 2H08A 2WXOA 4PJXB 3CGTA 4RBPH 5KUKA 3IAM6 4QPJC 1M33A 4HALA 4NNPA 4D3DA 1YECL 2KPWA 5AG9A 1ULUA 2EUWA 3QWNA 3Q06A 2OBXA 3ACDA 3LIIA 1JLLA 1I6LA 2C4KA 4LQDA 1HQ4B 3LKRA 2PZEA 5FNZA 4O00A 1NCWH 3WY3A 2V5RA 1VE1A 4KQKA 2XWBB 1U04A 4BNFA 3P97A 3KLOA 2F67A 3MV7E 3QUGA 4M3KB 5EKDA 1IM2A 3FC8A 1BEYH 4I4TF 4EM6A 3WGQA 3VNVA 4PJ8D 3V4OA 2ZTHA 1N2CA 3LL4A 4MMZC 1LO0L 4HN4B 2EDJA 2OKCA 5TPWH 3AQIA 4MKIA 3AHHA 4M9PA 2PETA 5KYNA 3O6FD 2K8QA 4M2LA 2CDFB 4UT9A 3CNLA 3AVXA 1KVTA 3TFWA 4G85A 1F2XK 4DMUB 4AW7A 2OHJA 4MUHA 4LIQE 5BY2A 3OE7A 3LKQB 4JL8A 3V4FA 1TMKA 2YD4A 3CPJB 2NSHA 3PD7A 1J5DA 3KKLA 1TETH 1J1IA 2YAMA 3MTIA 1EO5A 4WI2A 2X1PA 3DRTB 3AI7A 2Q2OA 5KTYA 3Q9UA 5FPYA 1QZTA 2W2VA 4AJYV 4QTXA 3IEPA 4A2DA 3NEPX 3VZCA 3ZY3A 3LRPA 4KVGA 1UVQB 4IUYA 5F97E 2PKEA 3BHBA 3KB1A 1IUKA 4QMEA 2QT1A 3ANSA 3OR6A 4YXKL 1ULZA 2H52A 2NO5A 3OBIA 4KIWA 3ESYA 2JKYA 4KI5C 1JZ4A 1M0SA 3EPRA 1K5NA 1EEQA 3J81k 4R0LB 4AC2A 4HXGA 5JORA 4CM3A 4CMHC 2W6QA 1V9LA 5AW8A 2OFQA 3T0EC 1WRBA 3MVEA 2QKIB 5D7JA 3IDZA 4GKJB 3MJ9L 1XRSB 2H4JA 3VDRA 4IW4C 4KH9A 1LK3H 2RKWA 4CG1A 3JVFC 2DJIA 2C2HA 3PRHA 4AK1A 3KYNA 1RZGA 3DJRA 2N75A 4Q97A 2CUNA 4M4SA 1SHYB 1NN5A 1MFAH 2EBHX 4ZCIA 1QZNA 3CNKA 3G49A 3E3QE 4N2DA 3I37X 1KOAA 1W80A 4JX0A 4XAKE 2XUKA 3PENA 1BPLB 2VO1A 1GDHA 1IBCA 5A2QA 3OKMA 2QAGA 3VV2A 1EZ1A 1ULHA 1AFVH 1OP3H 3WP0A 3Q2WA 2ZOSA 3HLKA 4KK4A 1H15B 4J0FA 4KPGA 3KH4A 2CB9A 2XX1A 2VA9A 4AZTA 3LH8A 5C3TA 3EHBC 4NJOA 2MCFA 2J3HA 2Q27A 4G8AC 5T3ZH 3CNHA 2WP3T 3SR4A 4KUGA 3ZDZE 2AV1B 3TR0A 4TVPH 5F5LA 4OTXL 3RP1A 4ZFFB 4DGYL 4KVAA 2X19A 4I55A 4O5LH 4K40A 5A3VA 4LXXA 3EVFA 1MA3A 4XCQA 1GH7A 4HKBA 4ZVVA 3WQSB 4RESB 2DSTA 4QYTA 1DI0A 1FU8A 4RPLA 2JI9A 4DC0A 2QRUA 2O2JA 3BAKA 1I1FA 1C8VB 3FMGA 3CDGA 4G7YL 4PWKA 1HE2A 3GJ5A 3BZ4A 5K9KB 6PFKA 3GJ4A 2A0UA 8OHMA 5AQ1A 4YWGH 5EMKA 1WV7T 4MX8A 1PNVA 4HFUL 3QQNA 4K2UH 5B4MD 1MOSA 3BTSA 3P96A 3CZEA 2IODA 1OPGH 4GOLD 4PS0A 3MWFA 4RAOA 3SYPA 3U26A 3HLTA 1N5AA 4W9IC 4LK2A 1YFKA 3L1HA 1URPA 3BFPA 2Q87A 4TOYL 2VHJA 2J4WH 2WKLA 1ZNXA 4DKTA 2IOYA 2P0YA 4JQIL 4KGVA 1MI5D 5GGVH 2P9RA 2XZAH 2YD7A 1KNQA 3X12B 5E8JA 2QN2A 2PW1B 2O8FB 2BHFA 4OJFL 3Q1LA 4BO9A 1WAEA 2MHAB 2PCLA 3BZDA 1U0NA 2YHGA 1BKDR 4WO4D 2F1JA 3UC5A 2Z2KA 5F3WB 4OLBA 5F12A 4F2HA 5E9DA 2RHGB 1Y7HA 3B2UC 4DCUA 3NFRA 4DQOH 4TRNA 3KKZA 2GQHA 2QGBA 1QK5A 4TYMA 4WJ5B 4IHBA 3E5MA 3B83A 1Z25A 1UA6L 4AH2A 4N8PA 3F6SA 2XWXA 1Z3IX 2NLJB 4NZ8A 4MJ7A 3NZHL 5KNDA 1NW8A 1SDDB 4G8FB 1LBSA 3MERA 3M6MD 5GSRB 3ZGLA 1Q0EA 1G8JA 2IHYA 1CNMA 1LO3L 3STBA 3DETD 4MA8H 2XJ4A 1YI0A 1DMSA 3OG4B 3MVSA 2ACEA 4DIDA 2HRDA 1S6NA 2CEAA 5T1LD 3VWKC 3IVKB 3KTOA 3EFFB 2P2YA 4GT0A 4OGXH 5C32A 5CYFA 4AK9A 2O57A 3V0EA 4MDJB 3WL7A 1RP9A 2BS9A 3QIVA 3V4UL 2FUNB 3QMWA 4G5OA 2ZXCA 2W2NA 1UBFA 2OAQ1 5H94A 3RZCB 1NVTA 2FFBA 2G75A 1E8MA 5E6SA 4RO0A 2JFNA 5AM0A 3RC8A 4ANFA 2VIRB 2DCMA 3W0WE 2K87A 3FVVA 1ZUIA 4B4KA 2VI5A 2X6AA 2WP0A 4WY5A 5C5DA 4RFEB 4D80A 2C9CA 3RYIA 2B9VA 4KO7A 4GC9A 5E2TL 5DHFA 2QF7A 5F7AA 3V4PA 4R4BB 3QWRD 2IYTA 1N70A 2BZ1A 4PR3A 3LC0A 1X80B 4XIGS 4HDSB 3VGAC 2YWFA 3CE9A 2RMKA 5FFGA 4OZHF 4ZMNA 3CF2A 3DKVA 5FDWB 5C9JB 3HV2A 4LXYA 5HF9A 3PKJA 1V5GA 3V7AG 3JARA 2OO5C 1WZAA 1JH9A 1TCRB 5HVWA 1DBRA 1SHXA 5HE8A 3E35A 1AAJA 5TE7H 3UFIA 3WK8A 1IGIH 1OAZH 1CQJB 1S9YA 3THSA 3H4IA 3Q3CA 2QADB 4XR4A 3SC6A 4OAQA 2WV9A 2EDTA 4KDTC 1E27A 3ZTEA 2ATEA 1C30B 1IIKA 1JGTA 2AQKA 3AU0A 1DBVO 5DBHX 3IQIX 3MUY1 1XR3A 1NUTA 32C2A 4KSBA 4D4GA 3T9AA 4UHKA 3SC2A 3K6DA 3GMSA 4QF1B 4V3BA 1QYCA 3I34X 1PNTA 5DIZA 1ZLYA 4R1UA 4R2MA 3VOBA 5GGUB 1CDBA 2VYNA 4RGMB 4LDPA 1ZQ9A 1YNTF 4GXTA 1WSST 4KMTL 1A4RA 1ZHNB 3GRWL 2HG5B 1HCFX 1YAIA 4JVMA 1AYOA 1RMFL 3C5CA 4L0PB 4PLGA 3WB2A 4HUXB 3A24A 1EG7A 4ENRA 1OGAA 1RUQH 3O0RH 4OZHB 5JEEA 1AQLA 1OCRB 2J7LA 4A82A 2Z8XA 1IEAB 4HA1A 2CKBB 1P5RA 2NY4C 1SHSA 3GB7A 4CDGA 4X65B 3RROA 1O6VA 4ZOQI 5F0JB 2IY8A 1GZQA 1WBZB 2X2JA 1KZHA 1RUAL 4KAQH 2NZIA 3CPEA 4A5SA 2WQXA 2N0MA 3MLWH 3W5CA 1CQXA 2QV2A 5MEND 4L9AA 1G9SA 3LH2H 1ZS9A 4MI6A 1Z5PA 5CYOA 3W7VA 3EDJA 1V10A 1I30A 1UDCA 1OFIA 1X9RA 3DAHA 4INJA 2X4DA 3PQYA 1YNTB 1JP5A 2YHIA 1MVUB 3HCVA 2FR4A 3ULVL 3BL6A 3LC1O 2PNJA 3FUUA 4G43A 1SM3H 2QTZA 4I9WD 1CE6B 2P9ZA 4HDIB 5JBQA 5JJLA 4O4IA 1MI5E 4PD4K 2FQWA 2AJXL 4O4HB 1LGYA 2ITDB 1NDHA 5B4UA 4HQQH 2YJLA 3E27A 2C1XA 4FMVA 3WTUA 1YI1A 2IHTA 2Z98A 2R7EA 3ZDYF 4NC9A 2QMJA 2HXGA 25C8L 4P06A 4LI3X 2E5EA 1JEEA 5DHSA 1CKEA 1NVUQ 2YVUA 4AN4A 5AK3A 4DGWC 3RVXD 4KI1A 1VDGA 4QBTA 3PUYA 5BRZE 1AKEA 1VA5A 2X0JA 1MW2A 3R4VA 2J1ZA 5LNK6 3MA0A 3SEPA 2BW5A 1OZFA 3TCKA 1XGRB 1QIGA 5ICZA 2H8KA 1NMEA 1J8VA 3HB5X 4X1OA 4JVSB 3ZCXA 2ILVA 3REFA 4FGZA 4YLGA 3K71B 3WO4C 2JVIA 1H2HA 2H29A 2JWGA 4P4UA 1SY7A 2VYVD 2JA2A 3CR8A 1CQPA 3ET4A 1T6WA 3WWDA 3BWAA 3IDAA 2HZBA 4PJIF 2XVAA 3IHKA 5JXED 4QGBA 4ZXPA 1KBGH 1UC6A 4HGRA 4U6SA 3FYUC 5IB5B 2QVIA 4PB9H 1C2TA 4EEZA 4YCBA 3D6HA 2YCLA 4ONHB 5D1ZB 3RWGA 1MRZA 4OKDA 3R1GH 4X7TB 3T9WA 1TZIB 2YVLA 5HHPA 1NIDA 2ETXA 4BQRA 5CLJA 4X8MA 4BC1A 4TUUA 5IVXF 3TLAA 1Y42X 3E9TA 1MV8A 5IF9A 3HG4A 4WWNA 1KE1A 2M1KA 3ZDYB 5DI9A 2SNIE 4YYZA 4RD1A 5EWMB 2IPUG 4PJ7E 4LLDA 2GUGA 4ZVNA 3OQPA 4UU9B 5FRDA 2YBDA 4DLLA 1N3NB 2FQGA 1EK1A 3CC5A 1M83A 4Y9RA 3CVXA 2E6PA 1A9YA 2QLYA 4N20A 1RJWA 3QNYB 5AW7A 5AL0A 4E41D 2XH8A 2VT3A 1KP9A 5JO5A 4OI8A 3UH1A 4FTVD 3GYRA 4ZRGA 1OZAA 1Z8DA 1EE9A 2FEDD 2FQDA 3QS2A 1F48A 3EKCA 1ISFA 1JGIA 2A0FA 2F43A 1SUDA 1T9HA 4ZI3A 1YEHH 3AQDA 5B4TA 4B9IA 3TBWA 3V2AR 1SMOA 3FFXA 3F00A 3AESB 1UCBL 5JIPA 2QN1A 2JFVA 4QNRA 1QA9B 5D96B 1XX6A 1Y3DE 1D7CA 5IVXB 5LQBL 1PHRA 2P80D 4RGNB 3R09A 4ZYUA 2YMTA 3PDUA 1VLQA 2DH5A 1T20A 5HHOD 4Z99A 4IDDA 2XN9D 3OEWA 421PA 2AEJA 5B1SA 4E4RA 4NM4L 4WKCA 1KYAA 1MIOA 1U4SA 3JY6A 5IQMA 5FBWB 1GY2A 3I09A 3ACCA 4L6IA 1CTQA 2ZIZA 5IRCD 3FO0L 4QVIA 4M54A 2AJVL 1MFVA 4Y5YC 3VXUB 5GZ3A 3WOVA 1BXGB 5KTPA 4OL0A 1EWYA 3O3CA 4HWPA 2FGWH 2KMWA 3S40A 3P19A 3LRKA 3H05A 1ZEAL 2VH2A 3FUKA 2F1BA 4MD4A 2P4EA 1MIML 3T9EA 3T8XB 1KXTA 5IZ7A 1FFHA 1BYNA 3KM0A 4A23A 1F4PA 4IX9A 2KHAA 2ORYA 4Z7NF 2CY0A 3QWOA 3IF1A 4F9LA 1GDDA 1GWNA 1JXDA 4CEIB 4OF7A 2NNLD 1M1ZA 4GKKB 1UURA 3CRMA 3OQNA 4X7FC 4AEFA 3V1YA 3OEHD 4UVDA 1C4WA 5JO9A 4XPIB 2IDTA 4S0SD 3C6BA 4Y2DC 3IIEA 3IDMB 2OTPA 2EDFA 5EO0B 2DHQA 5MENE 2XOXA 4TUYA 4XNZB 2C4VA 4P2GA 2XJ9A 4MSWA 5HYQB 1NMSA 1P4BL 3MNVA 2FMTA 4DEYA 4B9YA 3AR2A 4JB2A 1KZGB 3H8WA 2BW0A 1P53A 5FV4A 4JXZA 4DOHB 1QX3A 1JPFA 1D4OA 3HFJA 4QKTA 3W6PA 3L7DA 4MD0B 5CGYD 3S36X 1D09A 2BZ7A 1W76A 4I9WE 2FBJL 1T5SA 7REQA 3N8NA 1YR8A 2WYHA 1JG3A 3IRPX 5HHQA 4AKGA 3C6XA 4Z7NB 4XVQA 1U0BB 3CCFA 3CO0S 4HAVA 1Q7TA 1RZKH 1NVDA 3M83A 4C8XA 5DQJB 1FIGH 3AG1B 5DR5L 3T99A 2VH5L 1QLJA 1FS4A 3TVMA 1UKZA 4TLSA 3FSOA 3WV5A 1QFYA 3ZGIA 4JA2A 1DFXA 3VNQA 1MFZA 1YEGL 3E4DA 3R7SA 5GJTH 5HHNB 4KXLA 1KB5A 4EY4A 4Y2SA 5J5AA 3HS0A 4D43A 1U92A 4HKTA 4R40A 1WL8A 2CXTA 2PLAA 4I9FA 3SQNA 1GIAA 4Q21A 2PVSA 3M6XA 1Z6JT 2JWHA 3VKWA 4D7PA 5IESH 4D0RA 5LD2B 1U8IA 1VJ0A 3T0DA 1SXJE 3S81A 4LCWB 1UFKA 5HPYB 2FEMA 3KCWA 2J57A 1NDTA 4XPBH 4WI0B 3ZW8A 2C31A 4Q4HA 4A2FA 3L95A 2IKQA 1ZUNA 3IKVA 1W8EA 5KVQA 2O4UX 4FI3F 1P1HA 4TMFA 3F12A 4EUKA 4XPFL 2BR3A 3W8NA 2ZDQA 2C4TA 5DUML 4Z4GA 2C3YA 3EGOA 3SIXA 3HS9A 2P6NA 2FJUB 4GLRI 5JYBA 1SCKA 1GRNA 4QOIA 3CLRC 9LDBA 1PLAA 4ZT5A 4QT5B 4JR2A 3VDXA 1F90H 4P23A 2WBKA 1NOKA 2ZJSH 3LBNA 2PMEA 1AZUA 4OCMC 5C0BB 4P4KA 1EVUA 2UZ1A 1F42A 1UWXH 1P8JA 4WW1A 3WXMA 5CGZA 5JHDA 1YRBA 3F7TA 3AB7A 4QDOA 4D3FA 4DKFH 2PQ6A 5D7KE 2XWZA 2JJSA 1S5HA 5JHGB 4GMFA 3KLBA 4CKBA 1LNUA 1JRHI 1IN8A 3TFOA 2G2NA 3P77B 1HTBA 5EZLA 1FVCA 1H0HA 4ZFOA 4LV5B 3PCRB 2HA2A 3ICWA 2FX3A 4F6LA 1YMHB 4NICA 3QHAA 3BWBA 2I6UA 4WK0B 3O3DB 2CVOA 3FZQA 1SXHA 5HHOE 2KDYA 3PYLA 1PYDA 3OZBA 1CLYL 2FWJA 1ELOA 2QL7A 5IJWA 1EBPA 3B2MA 5FNVF 4XX1E 4G9FB 4HGWB 1DKOA 3X2EA 2Y6UA 5E6UB 5ID0A 2OSLA 4OA8A 1G1AA 3BZ5A 4UOZA 3QBJA 4X6DE 5AESA 4K9MA 1WVZA 1B0RA 2VM4A 3FFDB 4GO8A 1A9OA 1M1UA 1Q74A 3KJ4B 3ORQA 5IWCA 2O5EA 4GR4A 2KBFA 4R51A 1YS9A 1NOAA 2AHIA 2ZUUA 2QLLA 5ECDA 3S7TA 3TLCA 2MOVA 5G5DB 3G8YA 5C4MA 4NCJA 1G2OA 3II6X 3DJFA 2TRYA 4YASA 3VFSB 4QBIA 5CEYB 3LPLA 1IK4A 1KEEA 1HYSC 2IHBA 4ACPA 3P2TA 2IXBA 4B5LA 4TULL 2GSWA 2PS3A 2Y5TA 1XU7A 3FRHA 1CDEA 4UBMA 3H86A 4HJIA 1ZKDA 3RL1A 2HKAA 4HFWA 1ORDA 1R47A 3DX7A 4HC1A 2VJMB 4XTRD 1O97C 3MLRH 1PPIA 1BF5A 3SZ3A 3NH7H 1JFLA 1UXLA 2WVSA 1MORA 1E90A 5EEUA 1U8YA 4KPUB 1UZ8B 1QPGA 2GH1A 3WK6A 2I85A 1XA0A 3EYOB 3OEYA 1B76A 2J46A 2VWQA 4B75A 1YH3A 4FYMA 1X87A 2PMFA 4I18A 2OYCA 4PQRA 1L4GA 3FCTA 1HLPA 1CLCA 4W6XB 5KYXB 1ST2A 1DVUA 3UX9B 1YULA 2VZLA 3VVCA 4LOFA 2AQIA 5DD1H 4PJGF 2C9UA 3WXWL 1FRFS 3MLEA 4NCIA 1M7IA 4Z2AA 1WA5A 2ODWA 4LE0A 4LRIA 3TGPA 2R29H 1NCWL 1GQRA 2ZRPA 3N42B 1OSZB 4AN1A 1HZJA 3BXXA 2NVUA 1FVDA 3G0HA 3QHFL 4ELMA 2YPLA 1FRZA 5HJ3B 3GFUA 2LLLA 4WU7A 1BEYL 2HF7A 1SQ0A 3P27A 3LAFA 4RQQA 2O8CB 2Y5QA 5DMYA 2DWOA 2WU8A 1HL5A 1X1BA 4YAGA 5FDFA 1U3TA 5EU5A 1I6MA 5J6SA 5TPWL 3UUGA 1ETZA 4CTKA 4GWLA 4ED9A 4P33A 3WLLA 4OI9A 3WEAA 1IZKA 4MRBA 1IY1A 3SIWA 4GQ9H 2ZJFA 3A04A 2IADB 1KYOJ 3FCGA 3V8RA 3D69A 1WXWA 2R2HA 1V8DA 3QEQA 1RCUA 2EACA 4U1NB 1TETL 4J3FA 4X90A 3QP9A 5D7HA 4JLKA 1OW0A 1XCLA 2BCGY 3ES6B 4JVWA 2ABWA 4G25A 1JPJA 1SBTA 2GK7A 4ES6A 4PRHA 4Z23A 5T33H 1UWEH 3PWPA 3PNLA 4QRUA 2OYLA 4H13C 5LZ5A 1JV2A 1NYRA 1QM5A 3T3GA 4EI5A 3TZVB 1G17A 1HEJC 2LTAA 3UKOA 2QM8A 1MN6A 3EYVA 4JM0A 2W0SA 2BWJA 3OOSA 4TT3D 5C8DA 1YEFH 3SB3A 3ST7A 4UT6A 3GUCA 5GGXA 1SYSB 3GMDA 3QDGB 2GPWA 2BCEA 4DCMA 2X86A 1NJ8A 2IZZA 5EU7C 3T5GA 1CU4L 4YMUA 5F0PB 3CKLA 1LK3L 1U2QA 1ZNQO 4HT1H 4LHZA 3I6ZA 4AIZB 2CEKA 3EEIA 1ZIAA 2NDGA 3AI1A 1B8OA 1E2BA 1AKMA 1MFAL 3T4AB 2VJDA 5ANRB 4RY0A 3ZKQD 3JSXA 4JZJB 4WZBA 1KEPA 1TZKA 2CHQA 3CO5A 4OG2A 3AJEA 3OWHA 3I73A 2XTSA 1UZGA 4HUKB 4WW2A 5C92A 1Q92A 4A0QA 5HIIA 1DVFB 1GGCH 1X44A 4PVDA 4WBXC 5F2KA 3U40A 1AFVL 1T3FA 3BH6A 4TTIA 4RHCA 4OB5H 2PO5A 4PLHA 1OXYA 1BA9A 4MA7H 1KJ3H 5ICXA 1SHTX 3X2SA 4YEEA 3VFOA 5INCA 5T3ZL 1O03A 5HJDA 1PEKE 3DMMA 1A9TA 3VA6A 4TVPL 4PJXE 1AF4A 4O5LL 2OMKA 1XSJA 2WWVD 1DJQA 1AY1H 2BVPA 3L79A 3FH0A 4GSLA 5E3JA 4DT2A 4YRAA 5DC4B 2YPKA 4BKPA 3W9YA 4DEWA 2YNMA 2FK8A 4NAMA 1G2PA 3BXEA 3IPAA 4A68A 3M6VA 1R9NA 1QVZA 1W0JD 3D3EA 4YWGL 1DBWA 3C8KB 2APSA 4F86A 4HJEA 1Y9ZA 4UMVA 4K2UL 2AC0A 1AGDB 2UXVA 3FTXA 4FXTA 5MF6A 3AUSA 5B12A 1I7NA 5CLXA 4P5RA 4DM3A 1W72H 1OLSA 5E95B 2CIKA 5E1AA 2WAYA 1BQ5A 2QQFA 3A0RB 3Q41A 4I4LA 4IIGA 2MYUA 1KQPA 1X70A 3QH4A 2J4WL 4ZCTA 2W7TA 5E0FA 5GGVL 2XZAL 4KXYA 5AD0B 2VDRB 1DJYA 3MBEB 4FQLH 4F9PA 1VA4A 3QLUA 4PICA 4B5EA 1GNRA 2VUUA 4MNGB 1ZPUA 4NCAA 4GRWF 2VSYA 4YCDA 4F7MB 5GSVA 5LUBA 4WQOA 1W36C 1IQRA 4U2YA 2VHWA 1BZ8A 5EZQA 3RZCD 2IY9A 3CPLA 2J3LA 1UFQA 2QX4A 2F5BH 4BIKA 2FFRA 3B9QA 1W0WA 1HH9A 1JERA 1T04B 2KI6A 4DQOL 2HMSA 2NXYD 1H2AS 1U8HA 2F8TA 4ENSA 1ZT7B 1YY9D 2WG1A 4QLRA 1BX2B 5IBUG 1J5HA 2PS0A 4CBVA 5CNKA 5IM5A 2VFAA 4H1UA 4X6FA 2ITCA 1CFBA 2XT6A 2LT9A 1NY6A 4FR5A 2O5YH 2YOAA 5DJ0B 1UOLA 4WW0A 4Z77A 3IJ7A 2XN2A 4LHXA 2XC8A 2AB0A 5JPMB 3MELA 2HAZA 1R15A 2FRGP 5JMWA 3PDHA 4OF5A 4FD2A 2F7OA 2RAPA 1T2NA 1SKQA 2QADD 5HSGA 1BXXA 3G5TA 4WKNA 3U2QA 5JH7B 3RVKA 4BWYA 3U1QA 1FFYA 1IL1A 1QNZH 4OGXL 4S24A 3IJ9A 1JVKA 5HYVA 4EQ2A 5E8EB 1OD7A 1VE5A 2CJXA 2G71A 4I5EA 4JG1H 2OPBA 5ESAB 6FABH 4MW5A 5CZRA 3GQBA 4Y4HB 1U2GC 1M67A 1X1AA 1WWKA 3UMVA 4XCFH 4A7GF 4N1CA 1J18A 3QH3A 1TQ2A 2B4KA 2P4SA 3U9PH 3DFFA 2C5HA 3N0AA 2J9ZB 4XWGH 5DYTA 3IT1A 4EPRA 1VIYA 2BTQB 5BO1H 5CUQA 1S3FA 2H32A 5AVSB 4C14A 5CG1A 3GFVA 3V4SA 3EA4A 4H3SA 5AUPB 4PTZA 3SQBA 2XETA 4OCZA 4U9IS 4FKEA 3GJFK 3FBQA 2VN8A 1R0WA 2X0NA 3AMVA 5TE7L 3UG5A 1IGIL 1OAZL 1L8AA 3BP5B 1MEOA 2PUFA 2AWNA 2IH8A 2PL9A 4D82A 1PYGA 2OORC 5DZ9A 4MQBA 4XGRA 4C2BA 1JDZA 1EO7A 1CXIA 2YJGA 4FFVC 3FPKA 1FXUA 1X5IA 4L3OA 4HK3J 1ZOLA 3HTXA 5C3UA 1JEYA 1ZDQA 2Y1KA 3ZWQA 3BDIA 2XCTB 5E4JA 3JQ8B 3E3NA 1G3QA 2BVTA 3O1IC 4Y2NA 5A5DA 4GKZA 4ZCSA 1KGDA 3TBYA 3SHSA 4FQJH 1I51A 2O54A 1ICEA 3KNBB 1P7KB 3OHPA 2O30A 2R1TA 1YMMA 4BD4A 2EUXA 1R24B 2PSFA 4MW2A 3ENEA 2BWQA 3DXAB 2ENJA 3RARA 4HWOA 3OZIA 1QO3A 2BP7A 3O0RL 1RUQL 3UHPA 4LJYA 3QHQA 3U6XA 3H42B 1JZ7A 1K2DA 3QU4A 4JDEA 5B38B 4H1VA 4LECA 4GAJH 2Q0SA 4RAVB 1JG2A 1MQ8A 4GUDA 2ZITA 3O0LA 1GL6A 3LRXA 1FFCA 1A7KA 3EH5B 4KAQL 4QSHA 3QNMA 2IDCA 1GFWA 3CFMA 2W6JA 2WK2A 2B21A 1P1IA 3NP9A 1T4KB 4LE2A 1Q7GA 3PLNA 4HLNA 3Q1KA 2EH8H 2PX8A 1T2FA 3AT9A 4YT4A 1I9GA 3UJ9A 5K5YA 1NUQA 1PX4A 1H94A 4GOOD 5D1ZD 2XADA 5LA6A 2C8KA 1ECZA 3ZDZF 1XZPA 3THWA 1C9NA 2WW8A 2J8UA 2BY4A 1SM3L 4MQTB 4NWUH 3VXTA 3W90A 5FYDA 3AG5A 1EUDB 5ESXA 1K9SA 2RK3A 4HIEB 1YQTA 2CK3A 4JCWA 3L6RA 4EI2A 2CXGA 4HQQL 3SDXA 3L4ZA 3TT3H 4OD2B 2D7PA 3FSZA 4TTDC 1ZD8A 4JMPA 4U1LA 4MVJI 2EFJA 4LAFA 3OE4A 3S1LA 1WCWA 2P9TA 4PO9A 3VHQA 3WX0A 3WSVA 3CQ9A 5EU6B 3S70A 1NGQH 3CLTD 3BJRA 5E2WH 3EBAA 2NXZD 5F7DA 2SCUA 2E9JA 3VOSA 3OB8A 2L42A 2YASA 5L7WA 2C7QA 4HEHA 3S8GB 1OB0A 2PXYB 1KTRL 2P91A 4UTPA 5AG8A 4AZ8B 1ZJ6A 4GEKA 1IGJB 5IK3B 2I7DA 4BRSA 4J0EA 4D0NA 3AU9A 3OC0A 2QUZA 1BVNP 1KBGL 1I8TA 1NHGA 1E79D 4Y3UA 2MMXA 4JM2A 4G2AA 4WV3A 4PB9L 2DUJA 5F7JA 4BU1A 3ZKND 4NH4A 3V79C 3ZWCA 3R1GL 3PTZA 2Z3WA 4ZI5A 1SOSA 1CGWA 3QI9B 3OM3B 2WNXA 5B3NA 1IG0A 2JGAA 4GSQA 4L0ZA 1L4HA 4EG4A 3P2OA 3VSCA 1OUMA 3FIUA 2ICEA 2JTYA 1JVBA 4E9QA 3IXLA 4A27A 1MVYA 1NXWA 3UK1A 3N6XA 4QU0A 1UWKA 2J1YA 5MEQB 1R9FA 3ARWA 1MHHA 3TLZA 1Y1UA 4G7SB 4J6IA 2FOXA 1CS0B 4J0HA 3OO0A 4B80A 3CLEH 4FX5A 2Z7YA 2HMUA 4CU5A 3ZE2B 3DA0A 3NTXA 1B2WH 4UHJA 1PZ5B 2C07A 1BQLL 4PO3X 4XSHA 4POAA 4NZNA 5HA5A 1YEHL 4RENA 4OZHE 2GSDA 3MJ6A 1RP1A 4ABWA 4LN1A 2LVEA 3C6LB 1XDWA 2FLMA 3KUXA 3ON5A 2OUKA 2BWDA 4RX4A 1KY3A 3SD5A 1INDH 5JAZA 2JIOA 3G0BA 5CURA 2BGMA 3A9UA 3NI2A 2YKKA 3KDPA 5AYVA 3AM8C 2PX2A 1KSRA 3CZFB 3B5JA 1EZVY 3OZWA 5D2LB 1TUIA 4XO9A 2VLBA 4MCJA 2FW7A 2ED6A 5GGYA 3RSGA 1CXHA 3FCAA 1MENA 4GYKA 1R64A 3WP1B 1NVBA 1G7IA 3BQUA 4HXBH 4OQPA 3DAGA 2I07B 5HGHA 1MQSA 3S99A 4AB1A 4LYEA 4FMDF 2VPIA 3RWJA 1J0HA 5JOEA 1IK6A 1R3KB 1RWWA 1NVKA 4Z1PA 3MRQB 4IVQA 1QAMA 2FGWL 2WU3A 1FYTB 2A3RA 2DBLH 3L16A 2W9EH 4MWDA 4H7DA 4NNJA 3G8CA 2GAIA 2RK4A 3MIIA 2Z1PA 1QKJA 4TV9A 2BY0A 4L8SA 3CNBA 4DVJA 1FSKC 4S1DC 2VOEA 3C8HA 4JYAB 1XMSA 4BXOA 2ZUWA 3S34H 3F49S 3TKAA 2EX4A 1BDBA 4ND2A 3K5RA 3R0IA 5I73C 1VIVA 2X2YA 1JG4A 1H93A 4N2NA 5CFQA 1BLNA 2NYYD 2HF8A 5FHBH 4PHTA 3GHBH 2HJKA 2R60A 3ESZA 3EZYA 3CLSD 3HJFA 3DEHA 4P22A 4BVFA 3CHPA 4QEDA 5SV4A 3HDVA 1JZ2A 1SFRA 1X5GA 2A58A 2CBZA 1T4CB 4HJ1A 2VBFA 5DISB 3WGUA 1VHTA 1CUOA 3JTSA 1NBQA 1OFTA 2NWQA 4B0MM 3LUHA 3H13A 4JYMA 1FL9A 4LCWD 3U49A 1IKNC 1L7PA 3W2GA 1QFSA 1BZ9A 1E9QB 1AZTA 5FJIA 4BHTA 5F33A 2X76A 5JXIA 2ZICA 2JKTM 1IE3A 1LBQA 2H1LA 4F5YA 3VKFA 3BW9B 3FDZA 3NJVA 3RAJH 4JH0A 1IE5A 5L3SA 2CDGB 1BECA 3QFSA 3TNMB 4MAYA 4FDLA 2XGJA 1D9XA 3V8EA 3Q7PA 2GPTA 2COEA 2LVBA 5FK9B 3AQZA 5DVNA 2NU6B 4GYJA 1UT8A 3ZDYE 5FFMA 5EBLB 4KO4S 1W0YT 1W15A 3S0PA 1D6MA 1RZKL 2F9LA 4D9GA 4Z7WF 3HXOA 2Y6SD 1ACCA 4XPHH 1ZIXA 3ISTA 3QXHA 1FIGL 1CDOA 1KC5H 2DEYX 3QKIA 1KT2B 5CDYA 3RWIB 4F2DA 1ECPA 4WSOA 3IJSB 4HUWB 3S96B 5C0BD 2B2CA 5BXFB 3MZ0A 1U3HB 4XB1A 4BO6A 1T8YA 5GJTL 2CR3A 4PYLA 1XMQB 2NNFA 2ZWPA 2CR0A 1E9CA 1I10A 4PJIE 1TT5B 3HE6D 3IJ5A 5J4VA 1H2YA 1QHGA 3S2CA 1OAXH 3FKUS 1C5KA 1CGVA 3TQQA 1ZJZA 1O6SA 3CEHA 4EUPB 1QVOB 3UMFA 3BH4A 4PW3A 1MHCA 3GF8A 4UOW0 5IVXE 4RGNE 2FH5B 2W65B 4N85A 3DI2B 5JSKA 2P3QA 4EIUA 4FNRA 4XPBL 1L5OA 2XDYA 3GNTA 3UABA 1KKUA 1T22A 3MJWA 3AAZA 4L8FA 2ORWA 5ADVA 3MJ7B 5JDSB 4Z7WB 3AB0C 4CF4A 2XYHA 1ONQB 3P0YH 1Z5GA 4ZO6A 4WEEA 1W85A 1C3VA 3ML1A 4H4NA 5FGBC 2YD1A 1TQ6A 2BR4A 1BD3A 2WJZB 5DVZA 3VXUE 1G84A 1OFVA 1YA8A 1V6AA 1FH5H 3K7UA 1F90L 4QHYA 3QG6B 2WT8A 4EZBA 5TQ2A 1WA0X 3J27A 3W1VA 2ZI3A 3CUTA 4EJ0A 1VACB 5B7MA 3NFPB 4OQ4A 2FJGB 4DQDA 5C8VA 4V2UA 4AUKA 4N0EA 4NC0B 1DL5A 4NT6B 2VP0A 4GIBA 1T66C 1GW6A 4DKFL 4W9LC 4EGQA 1ZH2A 3WO1A 5M5BA 1YKSA 2I7TA 3WJ1A 2IYYA 3APCA 2YINC 4KYTA 2PIDA 4YMPA 3VGHA 2Q76B 3KX2A 3FO2B 3BVPA 3V48A 2HBZA 1YAHA 4XCYA 4H26A 2J3KA 3CZMA 3BUYB 4XSGA 2HX8A 2AYXA 1EWKA 1M71A 1R33A 3ONEA 1AXTH 1BF2A 2ZOLB 3JR7A 5AW1A 4OR1A 2AG5A 2JRCA 3X44A 1Q20A 5IJ9A 1DQRA 4WI3A 1GM5A 2WZAA 3ICOA 3CLWA 1HCZA 5TF1H 1PZMA 4G67A 2ZG2A 3BAXA 2V3WA 3IQWA 1LC0A 4LRUA 1D9KC 4WEUD 3QW2A 3L3GB 3Q8BA 1UOVA 4DOHE 1SKYB 5E2VH 2HKHH 1G8AA 1QGDA 3NSDA 3L1IA 1P72A 2EJBA 4J4BA 3MBKA 1MFDH 2DQ6A 3N3BC 1YVLA 1GTFA 4JU8A 5H9WA 4Z7NE 2ZSJA 4BSVA 2VMDA 4TMZA 2FDCA 1X9IA 3QWHA 1B0GB 2E56A 5JR1H 4YAEA 4LOUD 1BX3A 3DL2A 2BHRA 3I9LA 3GA0A 1PBNA 5AK6A 2A86A 1HQKA 1RVV1 2D5AA 4JJ7A 4JQSA 5T1LB 5DNCA 2F1RA 2K6WA 1JTTA 1ILSA 2FQQA 1QWSA 1I2AA 4RHYA 2PL1A 2X0KA 1JJFA 3PXHA 2AX4A 4HWEH 3MLRL 4OCXH 3EOZA 3NH7L 2GD2A 4KQ2A 2Y2YA 4KR6A 4Y6OA 4IJVA 5BZDA 5EHGA 4C3UA 1PLLA 4ZHQF 1JZGA 4UVHA 4JRWA 1BJRE 3P2MA 2FNBA 3MSXA 5DJAB 3WIFA 1F5NA 2CD0A 3N3EA 2HB6A 3QK0A 2DMBA 4YLBA 5ELIA 3I75A 4ODUB 3BSHA 4UQAA 1T2EA 3BXFA 1Z0AA 5KVDH 3UWKA 4LLVB 4H8WC 4LCWE 4MXWH 4DUVA 4G0QA 1VENA 4U3SA 1ZUHA 4JKWA 1QXSA 2R6AA 3QORA 4FOTA 4H5SB 2H5JA 1X8KA 2WYOA 4L76A 2XIIA 2IJGX 3PF8A 5E6ZA 4COOA 3FQ4A 1XSIA 2XWTA 4RK6A 2DP4E 2EWVA 1UOOA 3FQYA 1O0SA 5A2BA 2R29L 3GRZA 5D01A 1QYGH 2FMXA 1C1XA 1Q9OB 1S8NA 1DN0A 4H8UA 3TZVD 5KJCA 1ZK0A 4RNCA 3VXMA 1QGZA 3R20A 4I4IA 1QNIA 1EERB 3O2DA 1WCQA 2X5PA 5JWOA 2WB7A 1IIBA 5C0BE 4BFTA 4TRPL 3TR5A 2Y71A 1A7OH 1GSIA 2E55A 3A6LA 1SEQH 2EDEA 1H1LB 1DAIA 2O2EA 2X22A 1DQJB 1FZOA 1QTIA 3O41A 3WYCA 3DZDA 4LT7A 3ONFA 5EEGA 1BDYA 4MV4A 3W9DA 4O4LA 5JYDA 3TONA 3N2LA 4GRAA 5CF3A 3NBQA 3OZRA 4JEGB 5TE9A 4BN0A 4WXEA 2BHYA 1IU1A 4A73A 4BAGA 5EAIA 2NZJA 5DE3A 3DWEX 3RAFC 5DFTA 4L6AA 1U2SA 5EOVA 5ESQA 1K0UA 4MVBD 3GMNA 4WDIB 2O1AA 2EWWA 4UB0H 4G9FE 4EOWH 1OGIA 5T33L 1UWEL 5A2CA 4I48A 5CDFA 4PV8B 4ZMZA 2QPLA 1J9RA 4CM8A 2XTMA 2EKSB 4CEJA 4QO7A 2AS0A 3CZPA 1DEEA 3MREA 1XNJA 5BMVF 1EAOA 2O5ZH 2IDFA 1UPXA 1OWWA 3K8OE 1UJ4A 4LF3B 5DHPA 4HAZA 4LFHD 1YEFL 4RDBA 4O1MA 3TBKA 4EVNA 1OB1B 1WQ3A 2JRLA 2YWEA 5I75B 1OGTB 1LCIA 4QD3A 5CUSL 1NQOA 4H1HA 2N1TE 4DJFC 1EHXA