2VDKB

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
461
structure length
455
Chain Sequence
b'GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
molecule tags Cell adhesion/immune system
source organism Homo sapiens
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
total genus 129
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdkB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdkB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdkB03
3ZDZB 1PCXA 2M32A 5E6SB 1RRKA 3K72A 3QA3E 3TCXB 4UM9B 3NIFB 1M2VA 1PT6A 2XWBF 3TXAA 3M6FA 3TVYA 1SQ0A 4C2BA 4WK4B 4CN9A 3IJEA 3AL8B 4FWWA 1V7PC 2UZYB 3PPWA 4G1EB 3ZE0B 1SSLA 1MJNA 3FCSA 4MMZA 3V4PB 1T0PA 2NVOA 4WJKB 1IJBA 3PPYA 4JDUA 3EGDB 3ZE2B 2VDQB 3K71A 1XUOA 2XWJI 1BHQ1 4F1JA 2VDRB 1MHPA 1XDDA 3EOBI 4WFQA 4MMXA 1QCYA 5HDBB 1MQ8B 4BJ3A 3PPXA 5E6RA 2VDOB 4O3UB 2ODQA 3OL2B 3K6SB 2QTVA 2I91A 5HJ2A 1SHTX 4HQNA 1CK4A 4CN8A 3EH2A 5KYNA 4O02B 4HQOA 3EG9A 1M1XB 3OKWA 4WK0B 1IJKA 4XW2A 1JEYA 3N2NA 4G1MA 1L5GB 1N3YA 2VC2B 3EFOB 2O7NA 3NIDB 3FCSB 4MMZB 1M1UA 2VDNB 1SHYB 1ATZA 3F74A 1LFAA 2NUTA 1OLZA 4PN7A 3ZDXB 4UM8B 4A0QA 1FE8A 3NVQA 1BHO1 1FNSA 1L5GA 3FCUB 4G1MB 1M2OA 4HQKA 5E6UB 2NUPA 1PD0A 1DZIA 2IUEA 1M1XA 2ICAA 1NA5A 3K71B 5ES4B 3ZQKA 4CNBA 1JEYB 1YVPA 4MMYA 1JEQA 2VDKB 1ZONA 2VDLB 1RTKA 3T3MB 4DMUB 5E6RB 2VDPB 3AFCA 1XDGA 2WW8A 3EH1A 3T3PB 4HQFA 4C29A 1M2VB 1IDN1 4UM9D 3VI3B 1PD1A 1Q0PA 1ZOOA 3GXBA 1AO3A 1DGQA 4Z7NB 1YUKA 4F1KA 5KYWA 3BQNB 4K3JB 1M10A 1MF7A 1ZOPA 3EGDA 1QC5B 5KYYA 4WK2B 3RAGA 3EOAI 4O02A 3Q3GE 1QC5A 1MQAA 3PPVA 4GZ8A 3BQMB 1JV2B 3ZDYB 2I6SA 4NENB 3HXQA 4Z7OB 1UEXC 3OL2A 3V4VB 1YVRA 5KYWB 5KYXA 5HGJA 1U8CA 3TW0A 3IBSA 1CQPA 3EG9B 1OAKA 3F78A 1IDOA 1U8CB 3K72B 5E6UA 3EFOA 3EGXB 4FX5A 5LN1A 2P26A 1JV2A 1TYEB 3NIGB 4O3TB 3HXOA 4Z7QB 3BN3A 3EGXA 5BV8A 4G1EA 2B2XA 1SHUX 2NUTB 4IGIA 3IJEB 3AL8A 1MQ9A 4IXDA 5KYXB 3VI4B 2X5NA 3K6SA 5E6SA 4M76B 2WINI 3AL9A 4NEHB 1N9ZA 4MMYB 1JEQB 2P28A 2VDMB 1AUQA 4NENA 3E2MA 1AOXA 4JX0A 5KYUB 1RD4A 1RS0A 3HI6A 1JLMA 1U0OC 2ADFA 2NUPB 4IHKA 2ODPA 4MMXB 3ZE1B 1U0NA 2I6QA 5KYUA 1T6BY 2XGGA 3OKYB 5KYYB 4C2AA 4HQLA
chains in the Genus database with same CATH superfamily
1A1MA 1CZHA 3EHBD 4GUOA 5K0SA 1NDQA 1PV4A 5BXFA 3Q11A 4HH8A 5IT4A 3HKDA 4G6JH 4KNSA 2VMCA 1QQBA 3ULSA 3D2AA 2FATH 3AI1A 3E7FA 1NQTA 4KX7A 3N2KB 1SLWA 3P27A 2OVFA 2I6TA 4MKTA 3OMWA 5C8XA 1DTWB 4WXRA 1H9VA 2P5EE 2IT1A 5G3ZA 4YRLA 1PFUA 1IB0A 2IV7A 1T13A 3ECUA 1NQXA 3OZLA 1FLRH 3DNFA 1VMKA 4RGOL 5LNGA 2V6HA 2EQAA 4L4TA 1DBJH 3FTYA 3GUYA 4XPGH 2IIVA 1CJYA 1QP7A 2F1BA 1VHLA 1LO2L 2YHGA 5E8OB 2SHKA 1FFOB 1HHIB 3A3PA 3OPQA 3WENA 1A6VL 4KP7A 4XGKA 1LYQA 3T1NA 3TEWA 3T7TA 3BUYB 1QI4A 1BM3L 3U30C 1EHIA 4F4CA 3DB2A 4FQ1H 5IOPB 3RTGA 1T5LA 3R8FA 3BIAX 4H4NA 4YFEA 4YMVA 5DJ2B 2GAZA 3LUDA 4EPVA 4ZRGA 4JRXD 4B60A 3SHTA 2XUQA 4Z4EA 1UB5B 2N1TE 4X85A 1ZS2A 2ZKWA 2O06A 3OO1A 2LR0A 4U7KA 5AWNH 4CPDA 5EF2A 1UR5A 4PRIB 4YP0A 1BQUA 3MUGA 2DW5A 3QRGL 3C16C 3GIVA 4ZW5A 1YDMA 1OASA 1VA4A 3G9AB 1QS0B 1N9GA 4CU2A 4CMEC 4MJ4A 2SKEA 2IHZA 5CPBA 5CLJA 2QLMA 4XC1H 3LN4B 5F7AA 5E4JA 1TLTA 2EG5A 2F7RA 1EU1A 1MJGM 4K5MA 2BR5A 2F7PA 1GS6X 3T9CA 5H9VA 5C0AE 5IVXB 1XA3A 4I08A 3L1IA 3EXJA 1BECA 1GIAA 1KLUB 1ZUWA 1XD2A 3TBFA 2WZBA 2IWGA 4Z3FA 3GLAA 3JWOH 2E4VA 3FZUC 1QQDB 3BJLA 3IUEA 5ILQA 4BGEA 2A2QT 1AQMA 1DO6A 4HUVB 1AGFA 3SI7A 3ZJAA 4RV4A 1RPNA 2FI1A 4Y1GA 1E5TA 1AHPA 3DVIA 2GFQA 2V8BA 4NCNA 4KFSA 3QKTA 3WOHA 3I76A 1CDJA 3GMLB 3CRRA 3OLEA 1NGPH 5K3FB 2EE6A 4L6AA 3FDJA 2PSSA 1MJ5A 6PCYA 4ZZFA 2BFDB 3K4QA 2FK8A 3U7RA 1JYWA 3QZWG 2B5VA 2WQWA 2H1FA 3LOWA 1NBQA 3TZLA 2FGJA 2JDIA 2ERJB 3MLTB 3W0WB 1ZQ1A 2JVIA 3V0WL 3WWZA 4O5AA 2D2IA 1O9ZA 2Q1WA 1GTG1 3KQHA 5E4YA 3FNIA 2JEZA 3CGWA 1CCWA 1Y6ZA 4ARVA 3O45A 1XRSB 4JFHD 4BU0A 2NDGA 3KZNA 3VI4F 4RK5A 1RVFH 2WXHA 4RDQG 2PBRA 4ZMSA 2PFSA 1OTXA 1WW2A 3D2LA 2EE9A 4ZKDA 2O3RA 4BGIA 3U1VA 3DCYA 4HJGB 1Y7PA 4UUBA 5DHUA 1I8LC 4F93B 1WD7A 3V7AG 4H1LG 4DAEA 4FKEA 5D1XB 3NZEA 1QP0A 4L18A 1RKQA 1DSFH 4KQHA 4HUKB 4M0UA 4PPFA 1SFHA 2EE2A 4PY2A 4M61B 1DXQA 4ORGA 4L9LA 4H8VA 5TMEA 3S8GB 2RONA 3ETCA 3VFNA 4FS0A 3AVEA 2QZJA 1UPAA 2NADA 4E9WA 5J4KA 3DFMA 3AY4A 2E4UA 1FYEA 2NO5A 1SZDA 3BORA 5ITBH 2V65A 3LB6C 1ABFA 4HV8A 3CB4A 5FI3A 4CN1A 2X2JA 1CHDA 1D1QA 1T9GR 4DTGL 1XZJA 4HKTA 3W77A 3D34A 5BQOA 3LCUA 2XEXA 4JN6B 4KR2A 3IPCA 2ZWNA 2VXTH 4GOLD 1G3IA 3RFFA 5LU8A 4NO0B 3EIUA 1AQHA 5JNLA 4C05A 1TIBA 3SBWC 2OBYA 1SMOA 3LSOA 5DM2A 3ARXA 4WXYB 3B3IA 4BQEA 4S1RH 4HPYH 3IT1A 2Z1MA 4GX0A 2YZKA 4JY4A 3K0AB 3QLTA 3IVKA 5IZCA 5CBAA 2Z4QB 2A30A 1N9GB 4FMBB 3DV6A 1F6DA 1M2OB 3M6UA 1QHPA 1IZ7A 3HA7A 1G8FA 4ZCIA 4RMHA 2A58A 2H18A 3QAZB 1KI6B 4GICA 2AI1A 3EUDA 2OL3A 2GYVA 4D0NA 3VD4A 2ZWLT 4HLQB 2ZRAA 4IS6B 3LY7A 2CH8A 2BFOA 4O9HH 4YGXB 5KHOC 5E9WA 5IT2L 5BOPA 2YUIA 2IAAC 1A69A 3N41B 4BRVA 2CA3A 3LX4A 4N2LA 1EXHA 4YAJA 3GPEA 4YT4A 3CSDA 1FVOA 3FYIB 1KE2A 1A82A 2MFNA 1Z2KA 3C60A 5IBRA 2VWEC 3BZBA 4QYXA 3MXWH 1FF9A 1OK0A 1Q1QA 2FETA 3NP3A 4OYRA 1P7ZA 2BV3A 4K2HA 3KZVA 1SEBB 2HLHA 3QG1A 4GRLA 4P4KB 5GS0C 4JROA 3M6LA 1EGQA 2E4ZA 1H6TA 4AJIA 4F8JA 1XMWA 1OYYA 1C1XA 1HL8A 3JWDH 3GH1A 2AV7A 2DQIH 4PJ5E 3MSXA 3LQKA 1FRVA 1P4LA 1TSHA 4NAUA 4D4MA 2O5ZL 4Y2OB 4BBWA 2DCMA 2F0CA 4FFDA 4N2CA 5F3WB 1C5DA 5K3DA 1XO8A 3JV5A 3RYFB 3EPKA 3MJ6A 4MASA 3HKEA 4F7TB 1SDDB 5EUCA 1C16A 1XZBA 3F65A 4GRDA 4XB8A 2I32A 2WLLB 3THRA 5L0QB 4OSUH 4LCIH 4KXXA 2UUBB 1WY5A 1MCFA 2YLKA 5AKKA 3EYOB 1ZEAL 2ZOKA 5H94B 1LX6A 5GGRB 3BMVA 3KE8A 4A7PA 1IM3A 3A14A 2REXB 4IZ6A 4H88H 1BLNA 1GZ5A 3DEKA 3I84A 1FHGA 1OZTG 2NR6D 4JLOA 3VR2D 2V7HB 1SOSA 4F9FA 1OCCB 3MVSA 5KSPA 3ZY3A 2H0EA 2EEXA 2EIBA 5KSUB 1X38A 4BQPA 4IIBA 3RUGE 5LXTA 2GBVA 3OXRB 1CS0B 5DZLA 4DJEC 1KK2A 2CL0X 4G0NA 3HI1B 1X3LA 5J58A 1GPKA 2I71A 5KDOA 2Z7WA 4MVJP 3FN4A 4KSCA 4MYPA 1L4NA 1SH7A 5D7LB 2DWPA 1IB6A 4V0QA 3QJQB 4ENTA 4R2IA 4B75A 1DKRA 2IXFA 1LTQA 2JJTA 5IDVA 2FZ4A 2WEKA 3WS3A 3IPAA 2VWHA 2O1SA 1GQSA 3PI7A 3TT3H 3EF7A 1ZCZA 3ROLA 4IEFA 2V7GA 3FKQA 4RFEB 4B3HA 3VMNA 2UXFA 1MPAH 3H6KA 4LZKA 2WV3A 3K6KA 4IICA 4LLDB 3TIDB 3IBFA 4OK6A 3G1UA 4W68A 1BS9A 2PP8A 2PX6A 2CJXA 3CLVA 3ZYIA 1PZBA 3R3WA 3S4YA 2Q9UA 3AP2A 4RF3A 3VKVA 1QQTA 3CVUA 3AUSA 5MEND 4A0RA 1IIIA 4DZRA 1PF7E 2DUUA 3EY9A 3U9PL 5EUQB 2ZXCA 2IDZA 4Q93A 1M3IA 1E62A 4JLSA 4II3A 2VDQB 4J3OF 2BLNA 5KPJA 3NFPB 2W37A 2IKSA 4NG4A 3B5EA 2H52A 4AYFB 4V24A 5JZBA 4XW2A 3LV3A 1UBNA 2OJEB 2EZTA 1MJUL 1SXNA 4KN9S 3NUQA 3SPVB 1I1AB 3ABIA 2BKLA 1MFDL 3TYFA 3HWRA 4G1BA 2R5WA 2FJFB 2G3YA 2Y06H 4NCXA 1DZIA 5F1OB 4DUPA 2CO6B 3C60B 2NXYC 2B8EA 2VCEA 1E7YA 5JPIA 3H3XA 3QUCA 1JJ7A 3FH5A 4TTIA 4TF4A 1O5IA 1M10A 3TO4A 4X6FA 4Y2LA 4IY1A 1GG2A 5TQ2H 1NYQA 1E4WL 2YASA 5BRNA 1OSNA 4QRPD 4HWZA 4WLVA 4X3PA 4BBPA 2XB8A 1JR3E 3X44A 1ZVHA 1F3JB 2F3RA 1NFAA 4PYJA 2A2ZA 3WGNA 3T0EB 3T9EA 1ECBA 4NHEA 4LCUA 1QTRA 3GS7A 2O30A 3VH8G 5BR7A 3W5HA 1VJRA 1A5FH 2WNHA 1OI2A 1E0SA 1J2TA 3QBDA 1RJYB 3ZOAA 4XCFH 3K32A 2PS3A 3QUML 1ECLA 3M70A 3CX8A 2AJ3B 4WWID 4C0BA 4ZGWA 1AGBB 3D9AH 4AZTA 1X3DA 3DHYA 1TT5A 1YZUA 1IYZA 1Z38A 4AQ7A 5DEFB 3IMRA 3HJRA 3G8CA 2FJHA 3OZKA 1NCGA 5E2AA 3MD9A 4TYWA 2CO7A 1UT9A 4BH7A 3OLQA 1N68A 4PGHA 1VBKA 1KHTA 5C7LO 1XC7A 1Z68A 3RUGF 2AMVA 4YRQA 2Q20A 2XF8A 4BDVA 3GSRB 2WXPA 4L02A 4JM4H 4LPXA 5CLWA 4CVUA 2FO8A 2C5SA 4EDFA 1TM2A 5E70A 2ZCLH 1N3BA 1MMFB 1JDPA 4XAKE 4U0JA 5B4VA 1V4VA 4RZIA 1PEWA 4B09A 4EWLA 4PSRA 1XMSA 1RYEA 1TGYA 3MTXA 3UXHA 4C0SA 4M5YH 2XXAA 3TNDA 3O31A 1HQ4B 1MHHB 4OFXA 4OHRA 2NSXA 1K85A 1O7VA 3WZLA 4D9EA 3RI3A 3NAQA 1DFBL 1PR3A 4NBKA 3RFTA 2CO3A 1WM1A 2EIZB 1YASA 4JBNA 3W2DL 2ZCZA 2QYOA 4LPWA 4ELMF 4DZ8B 4A7SA 4BK4A 3RC9A 4C3VA 1JT9A 1G6KA 3CH1A 4CSZA 1DHTA 4UUQA 2ZOLB 1QYVA 5FBLB 2A9BA 4NN7B 4IBTA 3IPBA 4PWJA 1OKEA 2J8HA 4DHWA 1YJDC 5J2TB 4IJMA 3TBSA 1B4JL 3EFFA 4L1BA 4X6CA 4EUPH 1ZNXA 1SBSL 2FUEA 2F2HA 3QR1A 2I5YH 4J3OC 2ZP1A 3FUXA 4JDTL 2JB5L 4P7BA 4GP4B 2Z9DA 4U4BA 3T4XA 3S3PA 2WKWA 2XZCH 5F72S 5K1ZA 2E7MA 3WIIL 1WY7A 1KCLA 1BBJA 2ZRJA 1JJVA 1FZJB 1HDZA 5I9QC 4NO3B 1JNNL 5DMJB 3ZOZA 4HFNA 4R7VA 1EXUB 4D41A 3O93A 2WTEA 5FD8A 3QITA 3AF4A 4BVGA 1NV8A 2C2HA 1KB5H 2P77A 1KI2A 3J2PA 3ZKQD 2OAQ1 3EG5A 2NR6A 4D9HA 4PV7A 1OFHA 3HE6B 3LRSB 3FDFA 1AHWC 5BPPA 4QRIA 3V48A 3ISYA 3UJHA 4OU3A 3BEWA 4XJSA 2ID9A 4GEKA 1SCIA 1INDH 3ZV3A 2IGLA 3MREA 1FRGH 2CGYA 4TRPH 2VDOL 1ZK9A 2JIZA 4TWAA 4MUBA 2DIJA 1C30B 3SBXA 3QEBZ 3LEXA 4L4XA 3LCCA 3I32A 4HBQA 3X11B 2J57A 1BE8A 1GZ6A 1A2OA 4PU0A 1RPUA 2CK0L 1GRRA 3RPIB 1J9EA 4PWEA 4FTVB 2O7QA 3KQMA 5BVHB 4FNQA 1B73A 1W2WB 4H2DA 1J0YA 4LEXL 1C50A 3CFKA 3W1VA 4BNDA 1FFPA 4JJIA 4LBWA 3EYQD 5CB4B 1E1LA 4PWZA 3AM8A 4LRWA 4WTQA 2V55B 2C84A 4AMKL 2CJPA 5MEPB 5CU9A 4W9RA 3WLHA 4MWEA 1XKLA 4X4KA 4OMCA 1K9SA 3QOYA 4EEZA 3K8QA 5D72L 1COWA 1J90A 2R97A 3INYA 1ZANL 3JQ6A 3ML1A 5F1PA 2AJUL 3SE9L 3D4NA 3VTMA 3QQXA 3VJMA 1OSPH 2H16A 1J1UA 3QZMA 3EJUA 3WHXB 5EG6C 1Z6AA 3FCBA 4G4SO 1D9KA 1SF3A 3MRMB 3P9ZA 3SPVA 1JHQA 1P6QA 1XTIA 5FXCH 4LMQI 1L5RA 4MJXA 3P4XA 1QEWA 2QM7A 2J5LC 2PFGA 2H6OA 4RULA 2CSUA 3NEXA 4BDSA 2OYPA 4JW3A 1P7KA 3PWTA 1M05B 3GXMA 1GCFA 4Y2TA 3OOEA 4RISL 2H7XA 4BFUA 2ZVPX 3J80A 4OLYH 3ZN6A 3FPGA 4YROA 4WRRA 4ODVH 4GKAA 3ROFA 2CR6A 3VG9C 2J1ZA 4B3RB 4G9FA 3GFFA 2WBJD 1C4WA 4WDQA 3DZ8A 2RG1A 2BOBB 3G5ZB 2XYVA 5DD3H 2EC9T 4WKXA 4NEHB 3FOLB 4LY6A 2AF3C 1RZFH 2IH8A 3ZE1E 3PLAE 1DBVO 3GNTA 4OFKA 4BVAA 2RH4A 3IV6A 4U7SA 5CMAB 2EXTA 2PBFA 2C92A 4OZFG 4XP4L 1NVTA 2XCIA 3L4SO 3A58B 1JPTH 3IELA 3OZEA 2IAMA 4KQ3L 3MRBB 4QOIA 2L7EA 2YJGA 3B7SA 5DEOA 4A91A 4L9WA 3G9UA 3KB1A 5KREA 3GCWA 4O3UB 1V10A 1GHTA 1Y8AA 2QADB 2XD4A 1N2CB 1AZLA 1MW9X 1MFAH 2BM9A 1O2DA 4XPTL 5TDOA 5AW1B 1XMOB 2ARWA 1I8KA 4P57B 2GLTA 2HCBA 3MMEA 3CX4A 3KPSB 5CMAA 2CLRA 4MKRA 2NY5C 1R24A 1E9BA 3KNZA 3SM9A 3X3FL 5HQTA 1ORVA 4MPTA 4P92A 4MFHA 3MTAA 4DIKA 4Y2VA 3A4FA 5F9JB 2PUWA 3LKNA 2Z8XA 3CC8A 3TQHA 1ISPA 1MDFA 1F9AA 1V8FA 4DQOH 4XXWC 1E8DA 4YMWA 4IDJH 5J56B 2HWZH 2RGNA 1F4WH 1E9VA 4FYVA 1Y18B 2EE3A 3FTCA 2BSQA 1WUNT 4NOBA 1AGYA 2DBVO 1A96A 5FULA 3W9EA 1WOMA 2WQRA 3UZQA 5I1IL 2DBZA 3VXUD 4OL9A 4B3CA 3TT1H 1SD2A 4CKCA 3M5CA 3UHPA 4UTNA 2YICA 4PLHA 1AMYA 2B0SL 3CT6A 3KS0H 1VE5A 3NOQA 3MLVH 1J70A 3I62A 1Q9LB 1KTCA 1AQIA 1RLUA 1X7QB 3H7BA 5B4UA 1XI2A 1QSED 1QH1A 5FRDA 3FUHA 4MUHA 5I4BA 2FX3A 5JZSA 3R7WA 1O87A 3WGZA 1N7IA 1YBMA 1SD1A 2PXYC 2WQXA 3ZGHA 2PZJA 4MHSA 3WP1B 2X05A 4WUTA 1OQOA 3AXLA 3SCMD 4J16C 5JDIA 2AS5M 4JFDA 2EKJA 1UZ6F 3QXAB 3P52A 3GHEL 4HLUC 3LEVL 4QD2E 1CR2A 1PKXA 2Y6SD 4KSYA 5HW0A 3TWCH 1OZFA 3LHFA 5CP7A 1RMYA 4UIMA 1KMHB 3JUYA 1RI3A 4K46A 1JGVL 3V6LA 3GRUA 3H75A 5DJ6B 1JHYA 4N2KA 5A7BA 1OWPA 3C6LB 3MV7D 4KJXA 3PKZA 1H3XA 4ZCTA 2WWNA 5HHVH 4IMKA 1ILSA 4NN6B 2WMNB 4I81A 3D64A 4IOFC 2YSSB 1T6WA 4M7ZB 1I5RA 3FTDA 3UJJH 4GXTA 4AF8A 1FNLA 3LKOA 1M7UA 2V7WA 3R7BA 1KGJA 5GRJL 1B3RA 2ZM6B 3CRVA 5FWRA 2VRQA 4DK5A 1MFCH 4GS7C 3C5JA 3D4ZA 1MX1A 2ZDGA 2OMWA 5EG5A 2C97A 1H8NA 1BX1A 5I66A 2YJ6A 3KR2A 2F6AA 3FHJA 4FNSA 3QF4B 4O58H 2RK3A 2NP6A 3WHPA 1GJUA 1HE1C 4PLVA 1FV1A 1FO0A 3Q41A 2ITFA 3S37X 5C2BH 2J7PA 1HDGO 1QM5A 1XLWA 4KUCD 4L4YA 2TRYA 4PJEA 1QATA 1QOPB 3JQFA 5L40A 2HJKB 1NU8A 4R3WA 4DCOA 3RUFA 2I65A 4KVZA 2IYWA 1EJ0A 3LRLA 3QVXA 1DJGA 2VQ1B 2WSSD 2EGHA 2QUHA 4NKMA 1ZIDA 2GTIA 3K0EA 4UARA 3A9CA 1AFVL 4C47A 2FQEA 3L1OL 2ID4A 3KZ1E 1KOLA 2NVWA 1Y0LA 3T9DA 3LDBB 2GCNA 5CP8A 4CVXB 2A9PA 4QE3A 3WRVA 4WI7A 3HG7A 4F6CA 2N0MA 2BSSA 1PWEA 4YLBA 4XIGS 2PV0A 5AVZA 4YUVA 2Z92B 3FO1A 1OWRM 3CHRA 2HU2A 1XTRA 2DC1A 4XNDA 1XFPA 1HJCA 1H22A 3MPCA 1JXFA 3T7JA 3B9DA 4FXKB 3O4OB 4MEAA 1QP1A 1RP1A 2JJVA 4Q97A 2VLRD 4PGGA 5KANI 2HEGA 1B2RA 3QYPA 2VJBA 1ZMOA 1RSYA 2VJMA 1IBHA 3L3DB 2FTKE 3A28A 3OOWA 1J6UA 4NBWA 5HIJA 1IL1A 2X0JA 1QWOA 4LC0A 4AMUA 3BCHA 4L07A 2OZ4A 5J13B 3M86A 2A5YB 2ZI3A 3LVFO 5JE8A 4ETQA 4HB2A 1Z12A 2IG2H 1ULUA 3MLYH 2NXWA 4GMFA 3NJJA 1EFUA 4XNAA 3LJKA 2ZE6A 5AVWB 4NMXB 1K72A 1K4YA 2X3BA 2GI0A 3EWAA 3WB1A 4L2LA 2P2ZA 3OETA 4PNZA 3TN7A 4BKMA 4UTPA 2PJRA 3WNOA 2QTEA 4NO0D 2ZXDA 4HMQA 3AAZA 3STLB 3ASVA 2AMGA 5LQJA 4QWMA 1EJFA 1YZZA 2P3OA 1E2NA 4PY7B 1M1YB 3K4ZA 2OZLB 3WKBA 4F9PA 1IPHA 5H7XA 4J4PC 1W0JD 2HMWA 4M7RA 1SJ9A 1WV7T 2OR9L 4XMLL 5J4MA 1YCHA 2W2KB 3TNMA 2PNFA 4CEJB 3DROA 1QFPA 3BERA 2IEGA 2WJ3A 3VQTA 2MR5A 2YWDA 3HE7D 1OHHD 2X6QA 3KVQA 5ALBH 3U3DA 1NE7A 4B3IA 1RZ3A 1FG2A 3SJCA 2OCCB 2VDJA 4N8PA 1F1JA 4AJVA 5KBLA 3IERA 3GFGA 2UWEF 1MCPL 1ID2A 4OIIH 4IJ3C 3Q7QA 2CDFB 4KTEL 1J1XL 1PQUA 1S3GA 4P2GA 5EFIA 2MNWA 4EB3A 3R44A 2MWMA 4GKVA 3A1EA 3OY2A 4XGRA 1P2UA 2CALA 5DN9A 3GKWL 2P9ZA 3UAEA 2I6GA 3IJPA 4PYKA 2M2DA 1VGKA 2LE9A 4XPHL 3KD4A 1NEZG 3GBNH 2QSYA 2XA8H 1RZ8A 2HN7B 2W6CX 5DJCB 3MBXL 1QV6A 2P6UA 4EEKA 2IADB 4YDNA 2W6MA 3AY0A 2NSLA 3FQYA 2VG8A 3FVTA 3RREA 2C0CA 5EIAA 3T4UA 1QMUA 1FNMA 2CXGA 1E4KA 1D03A 4LA4A 5EE5B 3ROKA 2AEIT 5GM2A 4GQ9L 2HK9A 4DARA 1ASPA 2ZBGA 1QSFB 1J0CA 3Q8FA 1AT1A 1QUEA 3WKPA 2FSSA 5D7NA 3Q85A 2I1VB 1JBQA 5L2JA 3LQRA 1YS1X 1OX4A 3NFPA 3LX9A 4QGFA 2QX7A 1PS0A 2NPFA 1NURA 4PQGA 1WTCA 2WQUA 4X9IA 2BXYA 4C78A 5EZYB 3CBKB 5LWQA 1JPUA 2XUHA 3MTGA 3FCEA 3UAFA 4CCWA 1P2BA 3F6EX 3ZZ0A 5T5NF 2EARA 4BLUA 4BUZA 2WM0A 1ZCFA 3QXUA 3CTMA 3TKYA 2C9BA 3FYEB 1Z25A 1MB0A 1HC1A 5E7MA 3WLOA 1FFSA 1LWRA 1TR7A 5JROA 2PUCA 1UOWA 2AF2A 2DH6A 4JUSA 1AHIA 3OT4A 4AWBA 3OQRA 2G08A 4MNGB 4WCYL 2J5BA 4ODTH 2XHEA 3UJIH 3FW6A 1OA0A 2X19A 2WXNA 4WFFE 5DHYB 2PD4A 3ABQB 1Q74A 2X40A 4J8RA 1WNFA 5F7DA 2WDPA 3QUXD 3MRXA 2CHNA 5FHBL 5AAWA 1W581 2X8JB 3S4SG 3C3AA 2XNCA 3M1CA 3DAOA 1N4DA 4DUWA 5BSEA 2ZS9A 3Q1SH 4XXHA 4P5TA 4LLWB 1SJEA 3LXUX 2H1RA 3LRGA 5BOJA 3VFRA 4X9GA 4ISVA 3TYGL 3OEHA 1IHXA 2BFEB 2G70A 4KO7A 2H2WA 1NBVH 3ZVNA 4DTGH 3NHFA 4NN6C 3P0IA 4J94A 5NLLA 5KEIA 1EINA 3V8RA 4ISBA 5FQOA 4OCMC 3C6LC 3ESYA 3O3BB 1U2YA 4HWNA 2XWQA 4NC0B 3PEEA 1ACLA 1AD0A 3PZBA 1ZPUA 1QG3A 3US9A 2P7HA 2X8LA 1NIDA 3P9SA 2LWIA 4QJ4A 4E5MA 5ED0A 4P0TA 1A4IA 3T38A 3JVUA 1YA8A 1RIUH 2ATAA 5TE9A 1KYIA 4FZEH 3GUTB 4GYBA 5C09E 3W5UA 2GUGA 4JGMA 4G4IA 4FWTA 3MUUA 2X2IA 2Q6TA 2VNKA 1V5IA 4P4LA 1VYUA 5D96C 3QORA 3U7YL 1TDQA 3PQ5A 4RCVA 5F3DA 3HR8A 3UCEA 2MPVA 4KO6A 3QEQB 3S3JA 3ZE2E 2EU8A 4G0VA 1XL1A 4I36A 4CV2A 1HI6A 1UMBB 3L07A 1JHUA 1M7BA 3IV7A 5BV7H 4FJ6A 4K3EL 4KRNA 4KK6C 4GNRA 2EATA 1AA9A 2H65A 1PSDA 3GEPA 3T4YB 3GN2A 3I6KB 5HYJE 2RBKA 5HY9B 1FBNA 4OM8A 4LARL 1DQDL 2CUNA 3FN0L 5IEHA 2AW2A 3IAQA 1K86A 3B3IB 4QAJA 5BUSA 4BFXA 1IGML 2OOKA 3P2DA 1ET5A 1Z6JT 5DE3A 4X94A 4KV5E 4YH6A 1N34B 3L3KB 4TZKA 3KVYA 1I51A 1HHKB 4NJMB 1LQBC 2JWGA 2RCNA 2PUFA 1AN0A 1XZCA 4XBGB 2KBFA 4AEEA 3F84A 3Q3CA 2HY7A 4IV5A 1JPSL 1TRKA 2BFFA 3FGNA 3EYUH 5K1NA 2WTBA 2B36A 2E1PA 1UKZA 4J7RA 4PTUA 4PC1A 1YB6A 2CKNA 4G8EA 2VWGA 2Y36L 3CPLB 1OW0C 4FTVD 3TR6A 3MN8A 1CJMA 4PV9B 4ZIRB 2HG0A 1OU0A 4YLQT 5F7DB 2G9NA 3P97A 2Z83A 3UJ6A 4NBUA 5A5DA 1CGWA 1RUAL 3RC1A 5G0VA 2F00A 2B08A 4C56D 3TJZA 4BNJA 5HHXH 1ZR2A 4FFYH 1OR8A 4QO8A 4CMGA 2QPDB 3LKRB 5BN3B 2XN1A 1KUMA 1VQ1A 3MGGA 2FG6C 2C98A 5G0SA 2R8BA 4K9SA 4PIMA 4ZARA 2HCRA 2ODAA 4MW2A 3VO0A 1OXUA 4YZWA 3GW8A 2P9BA 4YHYB 1Q0HA 2VZUA 2DERA 3TIEB 5DEGA 5K59F 4CKEA 4WO4D 2WGXA 4HAVA 3UYOD 3RWEA 4EKYA 5B2ZA 1HEZA 5DK0B 2IP1A 2TSAA 1A50B 3I02B 4PM1A 2BMEA 4D8XA 2O5RA 1NP7A 2CBTA 2HR1A 3C8UA 4APQA 1USUA 2ATKA 4MCHA 1OWNA 3NJXA 3TVDA 3SDBA 2PCXA 3E0GA 5KYTA 4KX5A 4JFPA 3S55A 2H5EA 1W85A 2IS1A 3ZTDC 5LJYH 1OLSB 3M49A 1JAXA 2C9YA 4R9HA 4MW6A 3DVAA 4NHOA 3WJJC 4URZR 2WTRA 4O0LA 1H0DA 5I71C 2A99A 4RENA 2INGX 3GG2A 4A2HA 3VWJC 1RLTA 3I2JA 1RPAA 3O8RA 5FR1A 4R3NA 3EXAA 8ATCA 4PYLA 4DHEA 4Q7MB 4XP9L 1ACXA 5CT9A 2MNUA 3SVZA 1NUGA 4XI5D 3U17A 8CGTA 5FPYA 3RSOA 1C5KA 2I85A 3FT1A 1RRMA 3VXKA 2LTQC 4PW0A 1D5XA 4X7EC 2GVYA 1YBFA 4R8SA 5T3ZD 4ZV9A 1F6AA 4FZ3A 2ROYA 4EB0A 3OEHD 4PAOA 5GS2H 1X4XA 3FB7B 1SXBA 4FFZL 3KGTA 3NHKA 2CM6A 1MVNA 4NQZA 4EA7A 3OJMB 2PP7A 4TM7A 5ESWA 4G6JL 3CPJB 3QIUC 2CHZA 2G9QA 4KFCA 1ZEMA 4UM9B 2WXOA 4CM6A 4MWFA 4N6RB 2AF4C 1JBKA 4AUKA 2CDFA 4L05A 5FLXA 4IBZA 3UQYS 5LLTA 5JLZA 1MHPA 1C0IA 5ALZA 4MLCA 5JLZB 3MFFA 3VG0L 3MJ7B 2JE8A 3T7CA 3OZUA 4Q4LA 3QWNA 1KN2H 1B2LA 1UZ6E 4K28A 4H8WL 1U11A 1KBVA 2BHNA 3AUJB 3WDKA 5EQDA 3FCTB 5JY6A 4LMPA 4TUOA 2IUTA 2YYAA 5DZOA 1VFNA 4IRJB 1T8RA 1H8HA 4XJXA 1YQVL 4W5RA 3RAEC 2QX4A 1UYWH 5IP4A 4LGYA 3HWSA 3V8QA 4YE0A 2I29A 5K3AA 2YWGA 4B6OA 2N7AA 1MQKH 2JL1A 1G6RH 4BO4A 3RYTC 3KPQA 1ACYH 4GW4B 2CYAA 5EMLA 5JPNC 3C48A 2RGSA 3UPRB 4OG2A 3STLA 2WD0A 2ASVA 4CDGA 1SA0A 2W6ID 1HSZA 3F00A 1UPXA 3WV4A 2I7TA 2R5NA 4Q0XH 5JSKA 5BNIA 1ZSYA 4GSUA 4Z51A 3IFPA 2QVCA 5GQBA 3LCYA 1MF2H 5AQ0A 3MBIA 4F3CA 1KEMH 4UB0L 1ETZA 4WU5B 3E8UL 2Y0SA 1FDUA 4RAVA 5FKJA 2QEQA 2VMEA 2IVFA 1OYVA 2F8LA 1CG9B 4RFNC 1HILA 5AB0A 5C0CB 4HETA 5DJ8A 3NJNA 1PR5A 4EITA 5K6AA 3D7NA 3KPRB 4YEDA 4XNUH 5JW4N 3GAZA 3BZFA 1ADGA 1DRJA 4G86A 1F2UB 2X42A 2CG9X 1SQ0A 2XA3A 1OIOA 1U3NA 4KFMA 3FJ1A 4JDUA 1TAHA 5JHDD 2WJWA 5CLXA 4FQJL 2H1LM 1UC8A 4UE2A 4JPKL 4ZUUB 4XB6B 1T5KA 2WM3A 5IGXH 1UPUA 3GJZA 2I7VA 4HGYA 3VHRA 4NYJR 4XNMB 5CVTA 3WHE1 5E1AB 4OAWB 5MEQA 5AKYA 4XRCA 4D57A 1T9DA 4XO9A 4WU7B 1LRLA 1QUPA 3ISVA 4GM0A 1JVKA 1U2DC 2NY6B 1EEYB 2AJSH 1I8UA 1DG3A 3QUKB 1CLEA 2QD2A 3ARFC 4M62H 2HPVA 1BIFA 5EO0A 3UHJA 1W76A 3FFCD 2GN8A 4TRPL 1Y07A 1JR4A 5BZZA 1L5FA 2H00A 3EDYA 3NU1A 1TZKA 1R12A 3GCDA 4X7CC 3IDXH 5H35A 3ZYOA 4DIMA 5FUCC 1WFIA 5JDCA 4ZI8A 3BIOA 4DRYA 4UHFA 5ICSA 1COWD 1HKLL 4C6TA 3QI9D 4B97A 3FPFA 2HU7A 4Y2DD 4O2RA 1T7YA 4P86A 3KL0A 2XXGA 2E9JA 3VBEA 3U36B 2HTFA 1VCBC 3KB6A 3IEUA 2O8FB 1C12B 1Y6GA 4PJ7A 4YR6A 1YEKL 2HJVA 2M6KA 3B8HA 4UFNA 1A4CA 1FSSA 4OJYA 1KIMA 5K0BA 3LRMA 3QI7A 2Y69B 1E3WA 1O95D 2BVPB 4DSZA 2XUGA 1PR4A 4DDMA 1N4XH 2PGAA 5KTPA 3HNVH 5ETUB 2D73A 1OD9A 2RGXA 1Y4SA 4FXGC 3ANMA 3TTTA 2YAFA 4QGTA 3PU6A 4JFFB 1OBOA 3H9CA 2C04A 1A6VH 3B3AA 5CJOL 4X20A 2VKWA 3N0RA 1SZPA 5DNUA 2QN1A 1U30A 1YEGL 3FOMB 5LKAA 5EVCA 2J31A 4FCWA 4QQKA 5T3ZH 1WCIA 1QHSA 3ZU5A 1DJHA 3BGFC 1SR8A 1TG8A 1RL1A 2QV0A 4JBLA 4QWWA 2WP8J 2R6GA 1G7MB 5EBWA 5DW0A 3MACL 1YVEI 3KLAA 3L6FA 1I9JL 1JP5A 5CH3A 2XB6A 5JS6A 4K7JA 3F96A 1ECJA 3HUUA 1ORTA 3JV6B 4MEJA 1FVDB 3FRUB 2OJEA 4XR4A 3OCJA 3ALPA 1IOVA 2OK7A 3KKPA 4YX2L 4DJJA 3DETC 3DTYA 3JPYA 3LP8A 3I30X 1GT6A 2C7UA 3UGEA 4ZW8A 4X7TB 4ZMAT 1UFUA 4B17A 5TE7H 2XQIA 4QHLB 5JYLA 3QWAA 2QGFA 5BO5A 4Z49A 2GY7B 3LKNB 4FGLA 1DDGA 4FDAA 4TTGA 2WLJA 1L7DA 3HU5A 2GSMB 2VDRB 2YIHA 3BFKA 1KIQB 3FB8A 3OGCB 5AO9A 1C9NA 5IX8A 1W47A 1NG1A 3VDCA 3HO8A 4R9UC 5TE4L 2G77B 4ZUWA 3HDQA 1T04A 4K86A 2C9SA 4D3CH 4AQYB 1RK0A 4JJOA 3PU7A 2IQAB 2X1VA 3ONVA 1UK8A 7REQB 3ELDA 4PJHF 5D7LA 2O14A 3TSOA 4FYSA 5FFNA 4LP5A 2JFBA 5GJVC 1WGOA 2EFDB 2WZQA 2DQUH 2B78A 1LI4A 3QISA 4UBDD 1M0WA 2P7IA 1TFUA 1KTLB 4XZ4A 1LC3A 4CQMA 4NQVA 4OJKA 1SU8A 4O4LA 2DIEA 1MCJA 5B36A 3EJ6A 2O6HA 3A6PC 2IOOA 5ESXA 1UEXC 2GC7C 3UEZA 2JI7A 5FBHA 1WQVT 2EFEB 2NY2B 4JY5L 3FOLA 3UO1L 3ETHA 2QL5A 1WUTA 1B0ZA 4DGVH 2EKZA 2WU1A 4EHDA 4OHUA 3U7YH 3IE0A 1RUMH 1I4WA 5TQ0H 1LQ2A 3NX4A 3MCZA 4WFGD 5FYKD 5H4GA 5IQNA 4K3HA 2IALA 3ULUD 4JQXC 3ROMA 4BNNA 2D2FA 4XR9A 3CFBA 3D31A 2EDTA 1ZLWK 1RCYA 1YYML 4R7NB 2EYTA 5TF1L 2W2QA 3KW7A 1GR7A 2W8BB 3D2CA 2RAFA 3C5EA 4RH4A 3S5LB 1JDBC 1JYXA 4DQKA 3B1XA 3ESUF 2ADJA 2H0RA 1RJ9B 3O8BA 3ZY5A 2ICEA 4W8HA 1FH5H 2V7XA 3BRDA 1X9UA 3IKKA 2FRGP 5FUOL 1UH5A 1S7QA 3WHXA 1N3YA 4L2IB 1W0CA 4IRSD 2YZGA 1I2DA 1UT6A 5KTNA 2VJ8A 1MHTA 3OJWA 5EXPA 2NSYA 1IWPB 4HRVA 3KOXA 2CDEA 5L4JA 4L0CA 1NBMD 3AW8A 3A4AA 1E7QA 5JNWA 1WHTB 3NBMA 1AC0A 4OBBA 4UUJB 1CN4A 4N7MA 3FU6A 3DI2B 5I26A 5I0ZA 4NRZA 1K89A 2FIRT 4A66A 3BKJL 1EQWA 4C0KA 3D87B 2EWVA 4B2IA 1IAMA 2GPAA 3T0XA 2V3CC 3N59A 4J2OA 2VJQA 5FYDA 3R7SA 3QV1A 3KU4A 2OMYB 3VOBA 1YRLA 2IPKB 1MCWM 3O3AA 3O3EB 3JBG7 1R3JB 2Q3HA 1PQZA 5JNUA 4JJZA 3G2HA 1KFKB 4H20H 4IWNA 3R3HA 4R7LA 5ALFA 4F4HA 1WMSA 3QQPA 3LZNA 3FLBA 5A16B 1IQRA 4RV9A 2XAUA 3GI8H 4HRXA 1AIFB 1XCLA 5J6GB 1B2WH 1OM3L 5CEYA 4TKVA 4AQEB 4EMUA 1CE6B 3CLEL 5D93C 4H8PA 3SE3A 1DAIA 4TLEA 1OFUA 1A6ZA 3M5DA 2ZEJA 1NZFA 1KGUA 1NIAA 4B50A 3EB9A 4MRMA 5FLEX 4BKLA 1CPUA 1PBTA 1TCBA 5DYIA 1O08A 4HS6A 4RS4A 3N76A 3BWAB 2ITDB 2R0KH 3BUIA 1JA9A 1TAGA 3MUFA 4LHWA 1J5HA 3QZWA 3UJTL 3AONB 1A9XB 3ZCXA 2OYKA 3ENNA 3F7QA 2IZ7A 3Q6IA 4GW5A 2O50A 5HMMA 2IBSA 1JTEA 3G5YA 2I62A 2IY8A 3FNEA 1WMBA 1KY6A 4BAUA 4J2HA 2CIIB 4TSBL 2YFNA 3PL6B 1IZ9A 1CEQA 1UZLA 3TC9A 3IIEA 4RBNA 1YMMB 4GXUM 1JW9B 4JI8B 4B2LA 1WO8A 4ELMB 1PW3A 4Z8FL 2EVIA 2FX7H 5J3JA 3P19A 1J11A 4NJ9H 4CMEA 2K45A 5ID1B 5B1HA 4MV4A 4BMXA 4C6RA 1SKAA 3HUEA 1VL2A 1O7DC 5EHXA 3D6NB 1KC5H 3B9KC 1WHPA 1NXSA 1JXGA 5LUBA 3CX2A 4FMFA 1VMAA 1IC5H 4S0SD 3IOYA 4NHCL 2XXAB 1TU2B 5SWSB 1KQGA 4MS8D 1ML4A 3IAS1 2OV0A 2NY3D 1DYZA 5DA0B 1N59B 4JLBA 4LO9A 3VC2A 1DQDH 2N0SA 1Q14A 3BUPA 3HG4A 3S88H 3VJLA 5IJ0A 1HXKA 3VXOA 1WIOA 1L6IA 3BWEA 5TE7L 3NZHL 1DJQA 1KDVA 3TD2A 2JKXA 4MITA 1N7JA 1VXOA 2R6HA 4Q37A 1XDSA 4JNKA 2WR8A 3PUHA 4JFYB 5EC2A 4QUDA 3M4NA 2ISQA 5CZKA 4A7TA 4B85A 2PV7A 1RUQH 4GG6F 1JQBA 1FE8A 1EV2E 1R8SA 2CCJA 3L3IA 4QRQA 3D39E 4A10A 2FFRA 3FPHA 1Y6FA 1U3GA 4RL6A 2CHEA 2XT1B 1AR1B 4P4RA 3VO8A 4IDFA 2XNAA 4DP6X 4UMDA 3CHOA 2BSDA 3ZKMC 2WFAA 3CSBA 1QWSA 4BWGA 4JBYA 1QANA 4R9RA 1LDEA 3GRWL 2CLKB 3GRPA 3QXJA 1V3JA 2WMOB 3WDHA 2VF5X 2GS9A 4R1UA 3MT0A 4MSWA 4NXSA 1E6KA 4NCHA 1J0EA 3WDSA 3JWIA 1GGCH 3MRIA 2MYTA 2GSDA 4DG5A 4P0QB 1OPGL 4OOFA 3DRTA 2HRDA 4MCZA 3ID6C 3NHRA 1DUIA 1TOXA 3R9WA 1AURA 2CJTA 4HVBA 5C8ZA 5CSGA 1Z8HA 3IT0A 1K98A 4GLOA 5KAMA 1ZO8A 1XGKA 4U3JA 2P52A 1JZ4A 4H4EA 4BEIA 3TSAA 2BNQE 3PXGA 3D43A 4EJ1C 1N0WA 1IPEA 1UPTA 3DOCA 1FZOA 1GGYA 1EXVA 3ZVVA 4Q03A 2R8ZA 3X1NA 2VHWA 4ZXBD 4IIUA 4Y19D 5C0CD 1RZGB 3EXLA 5BQFA 1BV8A 4UOZA 3OF2A 3P11H 1OXYA 4YJHB 2O3SA 1GCOA 5FYJL 1MG2C 2C9VA 2D4AA 3MBOA 2I34A 4LRUA 5IAAA 3GGWB 3RVTD 5B22A 1RFLA 3TZQA 3G82C 4D98A 3FMFA 4TVPH 2L0DA 4KXCA 1RKXA 4BL5A 3FOEC 3C2AL 3T08A 4JKLA 4ED9A 1BQLL 3KDPB 2OZPA 2A73A 2AN9A 4L5AA 1ZOIA 3VACA 4PWFA 1L1RA 4FD0A 1AZCA 2WBJA 4HUUA 3SP1A 5GGVY 3O8LA 4PRYA 4HWSA 2VXVH 1E2ZA 2HWKA 2C8JA 3Q9UA 4M1GH 1P1VA 2QT0A 4AIZB 3T1OA 1EVYA 2GF0A 1XNRB 4HIHA 4Z3JA 2SCUB 5CINH 1QBML 4KI5D 1VFOA 5MHSD 4YV1A 5BN1A 3G6AB 4RAHA 3SPJA 1GIGH 6TAAA 5ITWA 4KGLA 1TO6A 1WFOA 2XN9A 3OJDB 2IH9A 1WTAA 3EZGA 4KWCA 3RA7H 4G1FA 3FJOA 1GTSA 4RMUA 4Y8DC 1SRDA 4I1OA 3WGUB 4K6KA 5AJTA 4PJHA 2YO3A 3HE6C 3I6MA 3HPQA 2JIRA 4YRZA 2YBDA 3AH8A 4NKDA 1M2EA 3AVUA 4OD3H 5E8DL 4PSVA 3LQ2A 1KEZA 2COVD 3NTQA 3UROR 5EE1A 3E1GA 3EXIB 1UP6A 3IP1A 2R96A 1J9QA 1CT9A 3STWA 1JGEA 1UKVY 4G5GA 3A1TA 3NCJH 3FPSA 4G67A 4J0DA 3DV4B 2ZQ5A 5DHVB 5FO8A 3A22A 3BJMA 3SIWA 3D8HA 4KKCC 4GSDL 1OC4A 3QDAA 1N2RA 1HKHA 3D3NA 1M6UA 1M7XA 5CMLA 2GBTA 4ZVUA 3IDIB 2W70A 3HVIA 1EK5A 3DTTA 1RY7B 4B40A 4KKBD 2PGJA 3QUYA 2H3NB 5D5MB 1G4MA 4DYHA 3QO0B 5B8CB 1YR2A 4ANXA 2QFPA 5EHFA 3ZXUB 3TAHA 2NO4A 4BLWA 4FQCH 3DVSX 3MK31 1NCBH 4X99B 1KIRB 3GLIA 1PYOA 1GSOA 5L2JB 4H6VA 4QU0A 1HXMB 4OIIL 2VJDA 3UANA 4UBJA 2QVLA 3VPBA 1RM0A 5GS1A 4K6FA 5D1XE 1KBZA 2YWZA 1LMKA 4H6WA 4CTOA 1HYBA 2NU8B 1NVVR 1TZBA 4OCXH 2PRKA 1A9QA 1BROA 1J1PH 3VU9A 2YPLD 4AY6A 4OHCA 1Z9BA 2WSDA 5K8IA 5DHMC 4E7OA 3T8XB 3H4VA 3GHEH 2DJMA 4G8GB 4FXLA 5JOPD 1OH6A 1KK3A 1VLLA 3O26A 2PLNA 5LJIA 4MH0R 4J4HA 1FGNH 2Y2WA 5LZ2A 1BA2A 3T4AA 5AOJA 3SJVB 3FPAA 5AUPB 5E8NA 3M5WA 3KKMA 5ALWA 1GQOA 1OI7A 2GTPA 1XZIA 4ND2A 3FU8A 5DCLA 4B41A 4NICA 2PPAA 5D7KE 5B38A 3HCCA 4YWGH 3GLHE 4JBHA 5BQXA 3G68A 2RGBA 4NBNA 4YREA 3TBWA 4DABA 4D0SA 1MELA 4KITB 5ALPA 3BK2A 1CE8A 1EM8A 3FYTA 3EYVB 4C56B 2Z2ZA 5AKXA 2Q4EA 3Q9PA 4AP9A 2VF4X 2NT1A 1NI5A 3AK4A 3A6LA 1M2OA 2QKYA 4DKFH 1DLFL 3OB8A 4QUIA 1NDHA 1A7RH 2JELL 2HMAA 4I9GA 4PLGA 3UJIL 5CBAB 1WG3A 4S1SL 1C7SA 2FB4H 3HMXL 5BSHA 3LT2A 1KTJA 5JASA 4LVUA 3SYNA 1TZ8A 2Q49A 1WFUA 5ALMA 2YQ5A 3NJ8A 4G5RA 3U0WH 4JX9A 3C5HA 1RYYA 2J87A 4KR9A 5G4OA 4LYYA 3ZPDA 1NEZA 1OBHA 3KUDA 3NEOA 3Q2CA 2JIOA 4DFDA 5K1JA 3K91A 4KAFA 3VXQB 1OFGA 3MBWB 1TGVA 1YCDA 2AI0H 4KDWA 1CZKA 3HFRA 1ITCA 3VNUA 4ZXBA 1MAVA 2DLFL 4JK3A 5AW9B 3H3KA 2X3UA 4G4SP 3L6CA 4Y2GA 2B8OT 5F2EA 1UAGA 4D94A 1M2KA 5F0PB 4OTXH 1QR1B 1TW2A 2BGJA 2ZKMX 4D9QE 4OH1A 3QKRB 2NY5L 3DJRA 3T54A 5L95A 5TH2B 1IK6A 4BE7B 1JKXA 2AOWA 1MWAL 1LK2A 4PCYA 1C8KA 1NM5C 4O51A 1OB0A 3BZDA 3HFSA 3REOA 4XX1E 2YVUA 3LOQA 3Q88A 1NW8A 2UZ1B 4E1VA 1WZNA 2B16A 2O5NA 4N90D 4G07A 3DL7A 3G9VA 1N2JA 4HJGA 4B44A 2I2WA 2J4CA 4HAFA 1O5TA 5FUWA 4NQSB 3PFHA 4EYSA 5J6GA 3OCVA 3L2OB 3ZE7A 4QRSB 2AQKA 4C8XA 1CDUA 1X9GA 2QUJA 2B77A 2VM9A 5TVGA 5HGHB 3Q2NA 3FF1A 2HV9A 2EGUA 5ICZB 4LSRH 1HI9A 3C6XA 4ZCQA 1P9RA 2G3ZA 4WF7A 2VYND 4BNGA 4OF8A 1NF3A 1N4AA 2ILTA 3JY6A 1CF8L 5FNVA 1AC5A 1O6ZA 1XP8A 4C29A 3LXBA 4Y2RA 1F8FA 3EISA 4IIFA 2WLZA 4KK5D 5JVDF 2R2GA 5CHNB 3EUUA 1TQCC 4Y98A 5FA4A 1GZ3A 2RG7A 3A6GA 5J6HB 3WJMA 4HF5H 1Y89A 2WC7A 5EPMA 3FQTB 4JIGA 3I6QA 1KTDB 5JAQA 4LLMA 4AJHA 5J2UB 2OFWA 4FTVE 1F58L 1B8OA 1EUTA 3MHZA 2Q5FA 1U3CA 1RYBA 2O8CA 2Z9CA 3GEHA 1RU9L 3IDGB 3NTCL 2YWHA 4L73A 2WUFA 2HLNA 5PNTA 1FV1B 1WKCA 5IY5B 4JHAL 2H4HA 2Y67A 4IDNA 3RWDB 2ERYA 4WNAA 1K8YB 3SJVA 2JLXA 1J20A 5HVHB 1TMGE 1M3JA 1YYLH 2VDVE 2G5CA 5KQLA 2YY5A 1Y8CA 3M6FA 4ARCA 3DEYX 1J5IA 3T8XA 2V45A 4MR8A 4JNXA 3CXFA 3NP4A 1EAYA 1QBKC 2SKCA 1CQXA 4A8PA 5HDQA 4KG7A 3FCGA 1SQ2N 1WCBB 3NC1C 5AB2A 2JBAB 3WHKA 3ZDYE 4UMFA 3OIVA 2FSVA 4FIZA 1L5ZA 1MHCA 1EVTC 1UFQA 1Z82A 3V9FA 5KUTA 1EWVA 4LEXH 1IGYB 2XVLA 1JZ7A 3E58A 3RS5A 4DSOA 4TS6A 2AV1B 1CC3A 3QIUB 5CNMA 1NDUA 1JI1A 4F5ZA 2FWPA 2D2XA 3L9WA 5E6UB 4U1KA 3H8VA 2QVZX 1IZKA 2X10A 4TNFA 5FOWA 4U0RC 4C04A 4Q47A 1PKQA 4S1QL 3GMQB 4JG1L 1P5UC 12E8L 4QTIH 1AJ7H 4UQ3B 2P91A 1Z5LA 4R98A 1CUBA 1DPFA 5F1KA 4HJJL 5U9CA 1AGNA 3IMBA 3WL8A 3I2CH 2Y7NA 3TPKA 3IDSA 4YEEA 3LNHA 1THZA 2XZZA 2ERCA 3TD9A 1DVTA 3CEJA 1T3TA 5ITSA 1Z18A 4NKOB 5FAKA 1PZHA 4BQ9A 1YO4A 1L0YA 4YO8A 3MOBL 3KPSD 5F1SA 1GCIA 1K9VF 1JFFA 3FZEA 3GMTA 1LA2A 1QKZL 4AZ3A 2C57A 1EZUA 1E3DA 3H11B 1U58B 4LI3X 3JATA 4H0IA 2G0LA 2PSDA 1I4TD 5EHQA 3PAYA 4F4DA 1LE9A 4HXAH 1X4YA 4FHCA 1U95B 1E5QA 3MOSA 1RBZA 1Z4QA 2GCPA 2QUZA 5CKAA 4Y8AA 1D04A 4WOKA 4NIYE 1X1AA 3BGMB 4HDKB 5D4JA 1GL7A 5E5LA 4FG6C 1X70A 1OOWA 1NQBA 5DZJA 4ZDKA 2G82A 4XVCA 4Y8VA 2SCUA 2DQHH 2RH0A 4L57A 2DQYA 1BP3B 1X7TA 3ZR4B 5D1QE 1H5UA 1R10A 4LHJB 2W0FA 3IKLA 2A7QA 2WBJB 4HUUB 4M8QA 1B3BA 3IE1A 4BD4A 1GO2A 1HTYA 3II2A 4TNWK 4HLNA 4XN7A 3ADKA 3ZDZE 2WYWA 3VU8A 1KJZA 4PPNA 3MJ8B 5FLKA 1WXEA 3UTSD 4BXOA 1K0UA 2V3EA 1ORRA 4L4ZA 4LVNA 4P2OB 5CNHA 5EP1A 5BXFB 4JI0B 4HBCL 2XB4A 5A4AA 1RRGA 2Q6VA 2FEDC 1FYHB 5IC6A 2C3OA 1TVDA 4Y4HA 3PWJA 3ZWMA 5KYXA 3NVMB 3B2UC 3W9DB 2YYSA 3IQZA 1F6BA 3KPUA 1MABB 5EOQH 4D8VA 2PR7A 4PFJA 1MEEA 4BMVA 4GI5A 3MRFA 4ODUA 1ZSHA 5C32A 1D9KC 5ICCA 1WCIB 1A98A 3HB0A 2DDQL 1UJ6A 1SU7A 2ENSA 3UTTA 4RK4A 3ESRA 3Q6FB 1BJ1J 5I23A 1EXGA 3FNRA 3BREA 3D3WA 1EANA 1X1TA 1D5CA 2YXFA 3RKDD 1UA6H 2QRVB 5D7EA 3VFMA 2J46A 3W1EA 1ESDA 8LDHA 1R3UA 2O5CA 1XL6A 2ZWKA 4X83A 3ECCA 1EPUA 4LXGA 5LGJB 3QQ4A 4TRJA 1OVZA 1R0AH 4Q1CA 2IXGA 1HEUA 3P2KA 3L05A 1Q94A 1BAFH 2OUKA 2Q50A 1LW6E 2WNWA 1WDWB 5DHAA 2FSEB 2YCLA 1A6UH 1HOCA 2VZVA 4ZI3A 2J73A 2AJVH 2NQDA 2QYHA 4QAWA 2EXXA 3BP6A 1DFHA 4BO5A 2HFGH 1F4WL 3DOJA 3RFVA 1EZVY 1R3IL 5CGYC 4MR8B 2JKTM 3VVWA 3DE2X 4YNYA 1FTGA 1SEBA 1IHUA 1NBYA 4MXVF 4WERA 1J8HB 5AW2A 3P0VH 4LJRA 2IFFL 1FUKA 2PW1A 3RDTA 4N3BA 2VQEB 3BRGC 4GRWF 3NVAA 4M55A 1URIA 2R29A 3UTTE 3E3OA 4EARA 5C92A 5I76B 1EWTA 2H8GA 5T5FA 4XDGA 3IEKA 2J0UB 2ORYA 1BD4A 5LB1A 2QF7A 3HUDA 3VPXA 4ZFOB 3IH5A 3AHFA 1YEFH 4E51A 1UEYA 2BUAA 3LBYA 3WSWA 4GYWA 3UBXG 1U7PA 1Z74A 1TO5A 1DZ3A 4HWBH 2OL4A 3T4PA 5L2KA 1MJ7L 2XGGA 2XYQA 3L0YA 4YJZL 4X95A 4AZVA 5EAIA 3EOTL 3EQ6A 4RPCA 1SY7A 1K8ZB 4QM6A 4ZMLA 5ALVA 3PV7A 3RYCA 3VA6A 4R16A 4F1JA 4KKNA 2VZ1A 4Z54A 5FA6A 2CR3A 5CTJA 4I4NA 4HIJB 3VGAB 4QT4A 1QFUH 1EA7A 2TSBA 4JBSA 4KAXA 3NCFB 3EIXA 4DNOA 3PNYA 4RY2A 5BVJB 1IUPA 1BD2B 1Q17A 1YMVA 1EUUA 4ATWA 1GCGA 2HH0H 3GHBL 3OAAA 2XGOA 5E5MA 1T0BA 3P9LB 3BSZH 3VD0A 5B2FA 1AKRA 4B6EA 1YN6B 4UDXX 3C6EA 1LO3L 4MA7H 3VI3F 3DAGA 4LV6A 3AESB 3ABZA 4LCBA 1JK8A 3APFA 4C9BA 1TJ4A 3TU6A 1KS9A 4BQSA 1NCOA 1H2YA 3ATAA 5F8QC 1LK2B 2FPIB 1KAQA 2OC4A 5BR1A 4E2XA 1LPNA 3WN5A 1NAML 5CLHA 1WDAA 3F8SA 3FRJA 3MO1B 4HLEA 4BP8A 2L7JA 4DZBA 5GZ1A 3A6EA 4P3CH 5LAXA 3M17A 3AI2A 4KJQC 5K51A 3P20A 3LPAA 1A1SA 5DB4A 1CYWA 1A02N 2F43A 4JP3A 1L7BA 3UXMA 1CT8B 5JSZB 4Y1AD 3TIVA 3UT0A 1C8PA 2IZ0A 4HKZB 9GPBA 4X9BA 3T7RA 3VVCA 1N1MA 3GLSA 3ZTWA 4MJ3A 1HEJC 1BD2A 4NTZA 4YSOA 3CZ4A 4JMNA 4NNXB 3PI6A 1ZISA 1UXGA 4H7FA 3ML9A 3N39C 4DT2A 5IB2A 4QBHA 4BO1A 3OKDA 2ZWVA 4EG8A 3T41A 4QRHA 3HEMA 5CD1A 1UVQB 2WSSA 1QLRB 1DZBA 3FU7A 5D7LE 2IQ9L 4RISH 1P6FA 4PCVA 1TZIA 2WZPD 4X54A 1VA9A 1JL8A 2LTAA 5FBZA 1WXGA 3QBTA 4W8GA 3BZEB 4WNCA 4F2WA 2IXBA 5E4EC 4M0EA 2DKMA 3FB7A 1QFMA 3ZBQA 4UDTB 2XRYA 3RABA 3IAAA 1I3RB 2DHCA 4B27A 5KSAB 3HS3A 2YJNA 4KNVA 2BVYA 2QW1A 1ZIAA 3WKDA 1E5LA 1OI3A 2R29H 2V5VA 1F48A 1YUMA 4M4SA 4UQBA 1JGUL 3IE2A 2W58A 3H86A 4YZFE 2YOCA 5KBMA 4EI6B 2C7VA 3HS8A 2Z1NA 4ZNEA 3NYQA 3MCKB 5BQDA 3LD8B 1QHYA 1RFGE 4CODB 2JQZA 5KW9H 4KQ4L 1M7DA 4BNTA 3EDKA 3H2JA 4OHMA 2DI8A 2OXEA 3TOZA 4J3TA 3V3TA 2YGPA 1AGBA 3QI2A 3L04A 4RZXA 3MUOA 3ZXXA 3HVDA 2HHAA 1OGAB 3KXIA 2B99A 2A8YA 2IIQA 2HA7A 4C4ZA 4L8WB 4HZIA 4PJIA 2BF4A 1H6AA 4FYMA 4E6PA 1R3DA 3QQ4B 3NJ4A 3AL8B 2FR8C 2IANA 4FFYA 15C8H 4KL8S 4RADA 1Z6XA 2HX7A 1F86A 2H3NA 2OKGA 3PQYA 1A8SA 3U2QA 4P3OA 3LQQA 3V4LA 3HVKA 3CRZA 2BNRE 3P0RA 3K8OE 3GJFA 1N2RB 1I6WA 3KPPA 1F2QA 3HJEA 4NQEB 1HQCA 3FSZA 3AY2A 4NFDA 1UH3A 3ARZA 1GPDG 3OAUL 3FVWA 5SYNA 1TIUA 3L1UA 3OPYB 1G84A 4X0KA 1H5BC 2P9QA 3LUFA 4XNYL 1XZEA 1Z16A 2WQSA 3ASZA 1XMJA 4G56A 2A9NH 2GZ1A 2GTHA 1G8JA 2B4YA 4XWYA 3ZDXF 3HUTA 2IQAA 7REQA 1U0EA 2V9UA 1P4SA 2GRUA 2D5LA 1XL4A 3C09B 5IB5A 2Y1OA 4GSYA 4XXCA 5K0FA 2V0NA 5T3YA 4XP1L 1GZPA 2FFQA 1Q9OB 1V96A 1JF1B 1W5AA 4H1WA 1WVZA 4RF4A 1EDYA 3AU0A 4PRBB 4HXFB 1XNQB 1G66A 4B9CA 4HH4A 2WIKA 1Z9NA 1H6FA 2OLEA 3EH5B 1PWHA 2MQ3A 4N24A 4YXKH 2P4UA 5C4GB 2YMXH 3CHYA 3FX2A 1UMKA 1UPCA 1PN3A 3C5ZC 5C3LD 2JNZA 5KB3A 5AK6A 1C1EL 1UGNA 4LLDA 3TIDA 1WXHA 1X5YA 1UWFA 4FLRA 3V52L 1QE3A 2HKFH 2PU5A 3L45A 4R8WH 2WT8A 4QRPA 5AB9A 4UXIA 5CP3H 1MUJB 4LJ6A 1QHHB 1U93B 5E5UB 3D1VA 3DO6A 3OJLA 4L76A 2ODQA 3CO0S 3GLFB 4ZYLA 2JGJA 5T1JA 4QI3A 2PWEA 3WKYA 2GJZA 4YBLC 2K8QA 3FT3B 4MAUH 3SDCC 1NMQA 4BOYA 1VKOA 3ZKAA 2VR9A 4MI9A 4WECA 3BZ5A 3QRGH 4LPSA 4BLOA 5AVUA 2NGRA 3L6FB 4MXQD 4BYMA 1AD9B 1HI6B 2QHRL 1OAOC 1FZOB 4D9CA 1PP4A 1A6AB 2H3KA 1PUIA 1T2QL 3LKQB 2Q86A 1OFIA 2EXYD 3MZGB 4CV3A 2EO1A 3IVRA 2B4RO 2X5JO 1RXYA 1VE1A 1S46A 1Z1WA 5HDQL 3HE6D 3N55A 1EWYA 3ARYA 3IUYA 2ISCA 2DBQA 2GT1A 1MX3A 3BQMB 2OQJB 2DQIL 1RMTA 2F54D 4NJAH 4ATTA 3KL3A 2X1PA 4TVSA 4M1TA 4QUAA 4ESVA 3RVSA 5E6UA 2HCZX 4A1RA 4PJXB 1OT5A 4TUYF 1S0UA 2YN0A 1ES0B 2ZWYA 4AV5A 2XF2A 4MSWB 3GBPA 1GKOA 4OO3A 2CXXA 4JZNA 3GJFK 4QPDA 4NI5A 2ZM5A 1H0HA 4JO8A 5EKSA 3USZA 2C8KA 4UE6A 4MNHB 1FK8A 4EN3D 1XCXA 4PVLA 1KZ6A 2BT4A 3H97A 3PR2B 3DXAB 1TYZA 1DKMA 1DL7H 3QPVA 4HJ0C 3RU9A 4IBLT 4ZA2A 1TMYA 4O4IF 1E8MA 1XSJA 7FABH 2R4SH 2I80A 1ZU5A 3JVGC 5FECB 4ZQEA 1QGYA 3GFTA 2IOHA 4IRSB 1VIWA 2B1JA 4WUKH 1W73A 2WHYA 5I73C 3PHSA 1IZZA 1W8OA 1XWIA 2WKPA 2P3YA 4R2KA 1L9PA 5T4EA 3PSHA 3OQJA 1O3YA 3QBTB 4UANA 4BUHA 2CLZB 5EPEA 5IBUG 4RPHA 4ETWA 3W05A 3GLIE 3EGDA 2DMKA 3PIQB 4DOMA 3DLCA 4MNGA 2WJ6A 3I92A 3TQIA 3S8FB 4QHUA 3H2BA 4GVPA 3PP3H 3GNQA 4GM4A 3MRJA 3TEUA 5AL8A 3D39D 2WFZA 4KAJA 3NOVA 3KXPA 3CK0L 4NVRA 3HUJF 2GSGB 5A3IC 3AW9A 2XQ0A 4JKIA 2B1RA 3D2UA 2UUAB 4DC0A 4JI5B 4TULH 3FYCA 1IC6A 1VSBA 2Q7AA 1OC2A 4KDRA 4KO8A 2GNPA 2Z0MA 5AYQA 2Q7DA 3RPEA 1QFJA 2FLVA 3EHBC 1T5WB 3KKNA 3BVPA 1BCRB 4TWZA 1TVEA 4ODIA 5DJ8B 2Q8BL 3EBAA 1JPGA 3URKA 2WO2B 1CY8A 1S7WA 3DRQA 4LCWA 3ZVLA 1VGEH 3H4FA 3W0WD 1F4VA 4Q4JB 5TS3A 5CDUA 3CFNA 5D7JD 1HYSC 1GJRA 4Q4EA 2XT0A 3P7MA 3HCEA 3I9MA 3CU7A 2Z5VA 2VAAA 4WU5A 4AQOA 5B7EA 4M7LH 4JI3B 4UTVA 1YF3A 2GZRA 2JAHA 1FF5A 1W0WB 1AUOA 3GI1A 2AEQH 3ATDA 5HHME 4FFZA 3F6YA 2CHWA 2QMOA 1MV5A 2GDZA 4L1KA 2GJPA 3A5VA 5AKGA 2KBEA 4NCC1 5BNTA 3OU2A 2WJ7A 1MNQA 1QFOA 2GTZA 3A23A 5EJIA 5E8DH 4JM4L 1HE8B 4RNRA 4PSCA 3GLUA 5ES3A 1UZNA 3L8GA 3ULUH 1JRHL 2HFGL 5FDWA 5EUOF 5D8DA 1MF7A 3U0TA 2AFRA 1V48A 1FS4A 3AS2A 4M1SA 4RTQA 1KH1A 1UZAA 1PQZB 4M93B 4QULA 5A06A 2AYZA 4R7ZA 4DR3B 4W6YB 4EK9A 4Z2AA 4JHWL 3ZNQA 2PMBA 5H2BB 4ZO9A 1Z2NX 4Q9LA 5TQ0B 4TSFD 3RJ5A 1C2TA 1NATA 3NABH 3MW8A 3A0OA 3D9AL 4WNJA 1RHMA 4B9JA 2VZLA 1KMCA 5BNZA 2NPOA 3FDZB 3E3MA 1Y6MR 5EQFA 1EB9A 4PYHA 4X7DC 1R8YA 4XIFA 4ABQA 4PRAB 4A67A 4PG4A 2R0ZL 3X1YA 1NYRA 2EIEA 2AHIA 4OQNA 2EZ4A 3MRDA 3L8QA 4K9OA 1A7KA 3OKLB 4PP2B 1YUBA 3HJBA 4GZMA 1NFDF 1ZMYA 3MV11 1ORSB 4BSWA 3KQNA 4W5HA 3SSOA 4N9QA 4X9XA 2GD2A 2WSBA 3OVMA 1NBMA 4X80H 3CUYA 1MCNA 2F8SA 3NNDA 3KWUA 3UH0A 2HC9A 4PIPA 2JPDA 2P49B 2KMWA 1E2GA 3P11L 3TSZA 5AHOA 1QG6A 3C5CA 1I6KA 2FPRA 2P45B 4TS3A 1LVGA 5A9SB 5D2LF 4HAGA 2EZ0D 5E4OA 3E27A 5IB1B 3TA3C 3ASOB 1LNUB 1YZFA 4P2QD 4PBTA 1FORL 3EVZA 3NT2A 4Q0MA 5LNDA 2NY3B 1PVOA 5FYKE 1QCCA 4L5FL 1CI5A 4MR7A 2LD4A 4LC1A 4P2QB 3NCXA 4C4UA 4Z3TA 5AXCA 4YXWA 1DBKH 5C7XH 2FWOA 4KQEA 5KYGA 4TMXA 3BSYA 2C2XA 3VGDA 4HNUA 4UZSA 4OXIA 1AZVA 1T0MA 2ICWA 4E9RA 3QVAA 2ZJ6A 1QIFA 4ONFL 3PAUA 4Y2DB 3A1UA 3TVMA 3BILA 4GXUN 3N70A 4Z3DA 3RWEB 3WEAA 3BMXA 2E87A 3I6GB 1NBVL 3BVNA 1ADFA 5IT9A 1FFDA 3UTTB 3OECA 5CEXB 4K81B 3URMA 3K92A 4N2NA 4M6OH 3SGJC 3SE8L 3G5XB 1N2OA 3KXFA 1NXVA 1VPOH 2X4GA 4M8UA 1ZDQA 4K1XA 1IJBA 2E8YA 3TQTA 4KXBA 1F3OA 3WY2A 2F58L 3RIYA 3ES6A 3OXSA 4MI3A 4ENVA 4HCRA 5JVDA 5DQDH 4EP1A 3J07A 2XDQA 1VBNA 3DC7A 4AVKA 2X7XA 2XWRA 1N36B 1SOUA 3DZIA 4KJZA 2OQRA 1EE9A 4H17A 2QPTA 3L1EA 3LVTA 3Q6GL 1X80B 2COEA 4CDHA 4RH0A 3FGOA 4LVOB 4Z7OF 4X91A 3BT7A 3CFDB 4CKBA 4GO8A 5AI9A 3LQ4A 5F7FA 4P1ZA 2XG5A 1XAUA 1KCSL 1VJDA 5ALBL 2OP4H 4F12A 3VB9A 2R7NA 4LFCB 4P5KA 1IQPA 2R2BB 1H2XA 4B81A 2C4WA 5A4MS 3C98A 4H8WH 4EHJA 5JHHB 4LCWE 4OI4A 3NXKA 1MAJA 3CZNA 1N8OE 3I4LA 2FDXA 1UJBA 2BC4A 4HYEA 1EX9A 2WUGA 1YY8A 4H8WC 4ZPXA 3LDBC 3FH8A 1X1QA 5BQ3A 3KGRA 5F9WB 2OBLA 3I61A 1OY1A 2GR9A 1YONA 5KSBE 3H9YA 1KCVL 1U9ZA 4DQ0A 2GA9A 4EG7A 2J2ZB 1NGXB 1XT5A 2BDUA 4M0DA 2Q87A 3CMCO 4ALKA 3H53A 2BE7A 2IPUG 9ATCA 4I18A 5LU9A 2BFVL 4FTWA 4X1IB 1EZZA 5AWNL 2VQFB 4N4YB 4HFUL 1UD5A 3IMTA 4F7DA 1G7MA 3M46A 4CDGC 4E2FA 3IOCA 3PDUA 4YMGA 3OEEA 5AR1A 3QEQA 1IM3D 1HZHL 2WXJA 4MK4A 4U3JB 5KTRA 1G16A 5DUBA 2H2GA 4HK0A 3BZ4B 4NZZA 2HH0L 3GHBH 3IDAA 5AM2A 3F6RA 2W6ZA 3O8XA 2ZI7A 2AOTA 3GUTA 4DQXA 1XTZA 4CVWA 5IQMA 3D39B 4AMYA 5JBIA 1X8XA 4KQMA 1YI8A 3QEKA 1ACYL 2WAQA 3AADB 4B3BA 4KZPA 3IVMA 5D84A 3KK0A 2AK1L 1ZJ6A 3U6RA 1QNIA 1MEOA 1O6SB 1H5NA 2UUPA 4X8HA 4QYOB 4OXYA 1LF0A 1TK9A 4HXBL 5K39A 3SLRA 1ENZA 1LO0L 2W42A 1R9NA 1QG2A 4J3BA 2KQNA 1EO8H 3IFSA 4CN6A 5CR9A 1KQNA 2MR6A 4MX8A 1QO3B 4FYPA 3HO1A 1E5CA 1MCLA 1G4RA 1HFEL 2NXZD 2QGDA 2AVGA 3O95A 1R4NB 1ZGGA 5HFAA 3OQNA 4C7BA 3H1GA 1JIIA 3LS4H 1OP3H 1VKNA 4KMTL 5DD1L 2DR0A 1Z62A 1H2FA 1KZ9A 2Y1WA 4XYGA 4EUPB 1W91A 2H63A 3RWGA 2IJ0C 4P4GA 1SC4A 3ENVA 1SDYA 2HJRA 1BGXT 4PJ9B 4OHZA 5A5GA 3GJFH 2A1WL 4O4YH 4RD1A 1JUFA 4UV4L 4V1CA 1I80A 3VD5A 2Z1KA 1XEFA 2ZIWB 4MMXA 3PUZA 2VKXA 2IDSA 4L8BB 3SKJH 1OLUA 3TR0A 1I2ZA 3X2FA 5JDCC 4EGQA 4YRKA 4JYPA 3S2UA 3UT5A 5A2LH 3NSYA 3EULA 5IVZB 4IOJA 2OKCA 2JIXB 2HKFL 3I52A 3W39B 5MHTA 1AZWA 1G9NL 1GKEA 2IHVA 1DCLA 5CINL 4AEIH 3FJYA 4YX9A 1BH6A 4YUEH 4K0RA 5FA3A 5ALRA 2TRHA 5HBRA 4ZRDA 4WO4B 3MIZA 3LTVA 1V7ML 1ZI8A 4DQOL 2VLMD 4P05A 5JCJD 1EQUA 1FS5A 1WPRA 5HYIA 3HP1A 3MQFA 3LQ1A 2Q7NA 4Y6OA 2V3WA 2BP3A 3JXEA 3J7HA 2IPMA 4OQMA 1SB9A 3K3PA 4CLOB 2Z98A 4YC7A 5JXHA 1RAFA 5IKOA 3MHTA 1QNZH 1GSAA 4K6HA 1UWKA 1JMZA 1EA5A 1YJ8A 4OQTL 4CEIB 3G7NA 4EVRA 2O52A 4Y9EA 4EZKA 3CSGA 3W9BA 4E5NA 2H2PC 1NW3A 1HWWA 1SXGA 2C77A 4TL5A 4DK6A 1AOXA 1SA0B 5D7HA 2PLRA 3UJAA 2FMKA 1T8UA 2PXYA 3BGVA 3ETTA 3WYRA 5D00A 4EOWH 4AYWA 2BOCB 1X7SA 3ZZNA 1ZS8B 3CU1A 3L81A 4EVNA 5F8RC 4JRXB 1ZIYA 2FBOJ 1G8YA 5DC4B 2V98A 4X4XB 1LWHA 3VFOA 2DFLA 3SPHA 3F12B 5BQ7A 2BI7A 5GRYA 2G71A 4XE5B 1Y5MA 4KRXA 4M6WB 1DFIA 5C5DA 1A4KA 3EFOB 4KKAD 3D5EA 4Q01A 5E9QA 2JFWA 3LNDA 5D1QD 4NGHL 1GILA 1MW1A 4RQQB 3LFTA 4N3TA 2H32H 5KBYA 2CJ3A 4LNAA 1A8UA 3Q10A 1Q9KA 3MLXL 2NYVA 4IGBD 1BYUA 4U49A 3RS0A 1U3YA 4CHGA 5HPYB 5T5NG 4KXMA 4IXTA 2WHVA 1KZ7B 3ULAB 1QQ7A 2OAEA 1R9GA 3WJ2A 4X5PA 4GDMA 3RZCB 4PM4A 4BAZA 1I75A 2WT9A 5ARDA 1I4OA 4MXWH 3AFHA 2XUDA 5D2NA 3TTWA 3DHJA 1WZCA 3PLNA 4WWKC 2IYQA 4OLEA 4IV0A 5BOSA 4JB3A 3MLZH 2E82A 4NQED 2D2EA 4TV8A 2CLMB 4Q12A 2H4XA 2KHAA 4YDZA 5IPFA 1RJZA 1AYOA 2RGDA 4Q4AA 4R1NA 3TI9A 2CD9A 5CXSA 1E0JA 4B4VA 2JLPA 3FFCB 3HMWH 1MB9A 1E7SA 3I28A 1FIEA 3RFUA 4BZ2L 5AW7A 3LBIA 4QARA 5KZCB 2I87A 2ODIA 2EADA 1RWPA 1L1FA 1U8HA 5DR5L 5A6IA 3KLLA 3U79A 1ONQA 1MY5A 2IEIA 4ACPA 1WZUA 2DQTL 1SOWA 4N6OA 1I1NA 5C80A 1PYWB 3NRCA 3EF1A 2H6PB 4XE0A 3NM6B 4TUKH 2G6BA 4F3FB 2J6IA 4PJAE 2J08A 2Y05A 4CLDA 1GZUA 3RBVA 4C7OA 5ERWB 5IFAH 3L6OO 4V3CA 3DBHB 2CYBA 1KYXA 2AEPL 4GBGA 3TIEA 3HK2A 1QA9B 4WO4A 4L9SA 3S8YA 4BVBA 1U1IA 4H2CA 3SQBA 2BMKB 5EU4A 1ODIA 2CRIA 3ZE2F 3D6VA 5FHAL 1DXOA 3ZWNA 1YY9D 2V7NA 2FUKA 4U6HB 3FOAA 1SCQA 3W2EA 1R7RA 2YMMA 2X0FA 4JANB 4ER6A 1LP9A 4NKMB 4URWR 3R8XA 5IHXA 1SULA 4OLVL 4MS3A 1H23A 1E42A 1VLZA 1H2HA 3QULB 3MCAA 4PV9A 4RHYA 4NPHA 1E2QA 2H26A 3QYCA 1XQXA 2NT4A 4JX0A 3WNCA 4FFWD 4Q9HA 4WJLA 1AQJA 2ZJSH 1O8CA 4ZS7H 3X43A 2WHEA 4KOEC 3IMFA 4UNUA 1E4EA 4NPKA 3IP5A 4US0R 2YMXL 2R44A 2D03H 3CZJA 5E2BA 1L6XA 2FX5A 2H1IA 4PTYA 2OZNA 1DAPA 2GQ0A 2H2HA 4AITA 1SXIA 3FWHA 4HJIA 3B2EA 1SLUA 4GHWA 4FD2A 2NY0C 1OAYH 3AIKA 4AL8H 1HOTA 2QVBA 4LS3A 2XWBA 5JW4M 5A05A 4WKPA 2EFJA 4AS3A 2FK9A 3MUEA 3BUBA 5DRNA 3M8OL 5SWZD 1B8NA 2QUAA 4CKVX 2QRZA 3L1JA 2DWEB 3KMDA 1JDAA 1R3IH 3CNKA 2QR3A 2VIRB 3L79A 2ZSDA 3AKZA 5EBWB 1HCYA 4F57H 3LU1A 4KQ9A 2XMQA 4NYIR 1BA3A 3ETDA 4DY6A 1WXWA 5DNEA 2VNIA 4IIDA 5EHNA 3WQBA 5A3JA 3P9NA 3R7WB 2CLEB 3TRIA 1ILUA 1DDHA 4BNUA 3U16A 4OZIF 1JN6B 1ACZA 3M88A 3QV2A 1AZBA 2MKWA 2PKEA 2P40A 4YECA 2JSFA 1N5YL 4XEUA 1NBWB 4X7MA 4I87A 5HTKA 5AYUH 4YP1A 4X6LA 1G9MC 4CKCB 3TGWA 3VSEA 1LXCA 4AKIA 2GZAA 3AKYA 4I4WA 5HGGS 1SVOA 5EIIG 2CCLA 3IDUA 1B90A 3Q3VA 2D5CA 3ZHCA 3THML 2OK0L 4EA9A 1YQXA 1P7HL 4FNLL 1SUJA 1UJCA 2NYAA 4U2FA 3TDKA 1BOFA 4CF3A 1V16B 1Q1BA 3QMWA 5I8EA 2RK6A 5BR8B 4G1MA 3N7TA 4OFZA 521PA 3HCVB 4AJ9A 2VJPA 4HUMB 5E1IA 4Y2JA 2A6DA 1AAJA 2XECA 1TJIH 1IMJA 2I4TA 4DIEA 4FG6D 2P80A 3OICA 3FAWA 1PDKA 4NFLA 3NGBB 3BQUB 3NRJA 1JZHA 4BVJA 3CZFB 3V6OE 3E8VA 5BT8A 1A9YA 5F5NA 1T1SA 4F5EA 4L4RA 3SDYH 4RDBA 2EGGA 1MNUL 3G13A 1C5BL 2NTJA 1BQ4A 2V5AA 2CNBA 1F4XL 1M2WA 5E0FA 1R33A 5ITVA 1IEVA 2P5WE 3ETSA 2JEOA 3LNGA 5EN2B 2ZAIA 5DHPA 3KLOA 4WAFA 3QULA 5IJ0B 3QFSA 5IB5B 1FTQA 3LHPL 1GGTA 4XRGA 3EVFA 4QUJA 4PIRF 1DCTA 1I0LA 1U8UA 3MJ4A 4YDKH 4A16A 1MQ9A 4P2QE 1G9NC 2O8NA 3HKZA 4UTRA 3AUVA 2KX7A 1L7IL 5KYUB 1R4AA 3UPDA 2FW8A 3DH0A 2XOKD 2WOOA 4FQHB 2RB8A 2XW6A 1C1EH 1GZHB 3K6FA 4CG1A 4YIKA 2DAVA 4C2BA 4YLEA 1W4RA 4FG0A 4ZBJA 5FYQA 4EPXA 2WKOF 4U6VL 3E5NA 2OJZL 5K1VA 3NH7L 5IDXA 4L5YA 4Z4HA 4HPWA 1XGUA 3RUHA 3ARGB 1L1EA 4V1DD 5IHLB 4AXXA 4TSRA 1C3OA 3X13A 4QELA 3BDIA 5BRPA 1PW5A 1NIEA 3HJFA 3U44B 1L4KA 1ODCA 3NHMA 3K8YA 1T2DA 3E18A 4MQ7B 3HCBA 3QORC 4Q9RH 2FJ0A 1Q1PA 2IV8A 4W1PA 1RWVA 4WHYH 4HS6B 1AKJA 2OSWA 1SBCA 4IMLB 3OE7A 1NLMA 1Q77A 4D7BA 1MFEL 3HRPA 3Q2VA 2HFJA 4E1BA 4I55B 2EEZA 2E75C 3IDOA 4IK7A 3LWDA 4PRHA 1JA1A 3OPYI 2C4XA 4E4TA 2I54A 3F4KA 4M9QA 2GYYA 3A4EA 1QK3A 3AEUB 4CFZA 4PINA 3QEQD 4LIPD 2QW8A 3FU9A 5FORA 4EY6A 1KI9A 1DR9A 1OARL 3OKEA 3D0KA 1FL5A 2O2EA 4TKVB 3BLKA 1EO8L 4IU3A 1X5LA 4H3VA 3JQBA 4NV0A 3CZ9A 2VDMH 2Q2VA 1WL8A 1ZV2A 4HAOA 1CMOA 1QACA 5GM1A 2QI9C 1A6UL 1W5BA 2V17L 1OAXL 1UBKS 4G59C 2Z93B 3UUEA 2WNIA 5BVHA 4JB9L 5T8IA 3T0AA 1FSZA 2DLNA 4XBEH 4FGKA 4Z77B 1ZA3B 4CV0A 3I75A 1PR9A 1WZAA 3N58A 5AVTA 2K7FA 1ORQA 1YLBB 2PWDA 2XTJB 2AJTA 3UBXA 2ZTSA 2OYRA 3OQBA 2F7SA 2WVHA 4UVEA 4KKZA 4KHPB 5JPMB 3GLFE 2JJ2D 1WLSA 5HHNB 3RY4A 4DGSA 3TLMA 2R6ZA 2XJ4A 4M8IA 2O2XA 3RB8A 3HNSL 4K73A 4LF7B 3OKMA 3SOBL 2B69A 3VCLA 5FHQA 3GMPA 2AVNA 5DHDA 1KY7A 2OD9A 4EYOA 1UKEA 3TNMB 4JM2D 5FM8A 2BFNA 1ELOA 3FXAA 4L6CA 3CKLA 3WK4A 1D5XB 1PV2A 4K3DH 3WE7A 4BNIA 1ZT7A 1NVWQ 5IH7A 4FB4A 3H9ZA 3RE1A 1H3TA 1T1ZA 1YRWA 2W48A 4APXB 5CK5A 4PSUA 3BE4A 4MKHA 1Q72L 3CFEA 2NVBA 4OAOA 5F7WC 5E23A 3P9YA 4L4TE 43CAA 1GNRA 3TOCA 1IE5A 3FDWA 2N4IA 5EIFA 2VEOA 1I31A 4PJGB 3QC6X 3QJGA 4MVJH 1TU0A 3WXWL 2F54E 2XICA 1FUIA 1T0UA 5I0VA 2P9TA 2BVNA 3H0EA 2PO6D 4KR0A 2Y0PA 1DADA 3W4JA 4HT3B 2CHUA 1LSUA 4TT3A 1MFEH 1WKBA 4YHIB 2JKVA 2DGDA 1A14H 3CUPB 2G04A 2OO3A 3UCXA 1HHGA 4WRLA 4OI0A 2IP2A 3I4CA 3AP3A 2X6CA 1MAWA