2VDKB

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
461
structure length
455
Chain Sequence
b'GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 129
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdkB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdkB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdkB03
1M2VB 3K72B 3ZE1B 5ES4B 1YUKA 4MMZA 3NIFB 3K6SA 1M2OA 1N9ZA 1PD0A 1RD4A 3M6FA 3TCXB 4F1KA 1QC5A 3EGDB 1T0PA 1AOXA 1U0NA 1MF7A 1M1XA 4G1EA 1ATZA 3Q3GE 5KYUA 3AL8B 5E6SB 3PPVA 4Z7NB 3T3MB 4IHKA 1PCXA 4Z7QB 4WK2B 3PPYA 3TVYA 3OL2A 5KYXA 2QTVA 1V7PC 3E2MA 3VI3B 2NUPB 1MJNA 3GXBA 4A0QA 1SQ0A 4C2BA 4MMZB 1DZIA 3K6SB 1LFAA 3RAGA 3BQNB 3EG9B 1JEQA 1QC5B 4NEHB 1AO3A 3K71A 4WJKB 2VC2B 1M1XB 3IJEA 4G1EB 3ZE2B 1XDGA 4PN7A 5KYUB 1ZOPA 4WK4B 3HXOA 1SSLA 2UZYB 3NVQA 4GZ8A 1PD1A 2VDPB 1BHQ1 3OL2B 2ODPA 5KYWB 5KYXB 3EG9A 5E6RA 4HQOA 5BV8A 4K3JB 2VDMB 3EOBI 2VDOB 4FWWA 1RS0A 3PPWA 4WK0B 3V4VB 4UM9D 3BN3A 3ZDZB 2VDRB 1OAKA 1CQPA 1JEQB 1BHO1 3TXAA 3V4PB 5KYWA 4MMXB 3K71B 1SHUX 3IJEB 1JLMA 3F74A 1M10A 4XW2A 1IDOA 4IXDA 2VDLB 4O02A 4BJ3A 1ZOOA 3EFOB 3FCUB 5E6RB 2XGGA 4G1MA 4MMXA 2IUEA 1U0OC 1CK4A 1M1UA 2ICAA 4CN8A 4JX0A 1FE8A 1YVRA 2O7NA 1JEYA 1FNSA 3T3PB 1NA5A 3EFOA 2WW8A 1XDDA 1IJKA 3HXQA 2NUTB 3ZDYB 1RTKA 3BQMB 3IBSA 1N3YA 4UM9B 4IGIA 3EH1A 1SHTX 1IDN1 4O02B 2M32A 4NENA 2P28A 1MQ8B 4HQNA 1AUQA 2XWBF 5E6UA 4G1MB 4FX5A 1Q0PA 2VDQB 2NUTA 1U8CB 1XUOA 2NVOA 3NIDB 3AFCA 1RRKA 1SHYB 1QCYA 1JEYB 2ODQA 4JDUA 3AL9A 1IJBA 3ZDXB 3EGXB 5HJ2A 1DGQA 3VI4B 5HDBB 4CN9A 2B2XA 4Z7OB 3FCSA 5KYNA 2XWJI 3F78A 5HGJA 1U8CA 3ZQKA 4HQKA 2VDNB 4CNBA 4NENB 4HQLA 4C29A 3ZE0B 1UEXC 2VDKB 1MQAA 5E6UB 1MQ9A 4M76B 1JV2A 2I6SA 3EH2A 4WFQA 4DMUB 4O3TB 3EGXA 5KYYA 1L5GB 3EOAI 1YVPA 4MMYA 3HI6A 1M2VA 5LN1A 1TYEB 3K72A 4F1JA 3OKYB 1ZONA 2ADFA 2WINI 3EGDA 3OKWA 4C2AA 4HQFA 3NIGB 4O3UB 3AL8A 5E6SA 3TW0A 3FCSB 2I6QA 1L5GA 1PT6A 1OLZA 3N2NA 1MHPA 1T6BY 2P26A 4UM8B 3PPXA 1JV2B 2NUPA 2I91A 5KYYB 2X5NA 3QA3E 4MMYB
chains in the Genus database with same CATH superfamily
3GYRA 3NM4A 4QYWA 1R3IH 4FCAA 9LDBA 2AJZA 2Y4SA 1DQKA 2D0FA 3QJFA 1X9IA 3THWA 3KJGA 3MEQA 4EUSA 2H2IA 1A6AB 3KB1A 3AR6A 6ADHA 3QI9B 4FULA 3W1EA 1G4HA 2Q3FA 4Q3CA 2YR3A 2ZOKA 5CCKL 1P69B 2VIRA 3T04D 1UXKA 4HWEH 4WUUA 2V6BA 3ZXYA 4KQ3H 3CCBA 2BNRD 5P21A 2O3UA 3HFRA 5I5RA 3GRVA 4HD5A 3C4JA 2XA8L 1FZKB 5K4AA 3G6DH 3OKEA 1NVDA 3W2TA 3ZIAA 3IU4H 5KOMC 2GCEA 2E9JA 4E41B 3I76A 3GJXC 1YO6A 1G42A 4XN5A 3C5ZB 3GEEA 1A82A 4E42B 2O8EB 4JV5B 1F4PA 2B8NA 4UTAA 3IHWA 4D0RA 4M1DH 1T7VA 3U4QB 4TUJA 5H9VA 1UK9A 3L4EA 1MI5A 3GZOA 2VLBA 3PNYA 5HDLA 3ZKAA 1JPTH 4GRMB 4RLDA 2EDJA 1XK6A 4OTXL 4UTPA 4FCWA 4R5XA 5H5JA 4EA9A 2BP7B 5MENA 3URMA 1G5RA 3HACA 5JSZB 2HMVA 3AY3A 4WI1A 1P19A 4L4VD 1R37A 1MV5A 2XZCH 4MP8A 2CL5A 4EGSA 3EDRA 1ADQL 3FUMA 3NIFE 4MJIB 1EO5A 3NZEA 5E5MB 5EC1A 4MRVA 1IBZA 4URYR 2XY2A 2Z83A 5DHTA 2W93A 1MWAH 4R2HA 3P0RA 2VMEA 3EGDB 3NEXA 1V7NH 1M1XA 1A2YB 3QCVH 3UBXI 2NW3A 5I6DA 4JI0B 1EZVY 4QPJC 4BO8A 4B45A 3SHQA 4L8CB 3UMNA 1QCDA 1Z45A 4MKFA 4R3SA 3A1NA 3V5DA 2ZICA 3A9CA 3ULSA 3AW9A 2XYGA 3RHFA 4XNZB 4MDHA 2I54A 1MAWA 1WF5A 4FOPA 5I8CA 2BGGA 3CISA 1WBBA 2OHOA 3VU1A 4B9CA 3TF7C 3SBRA 5I1IL 4RC9A 3BB1A 4Q66C 1OKKD 4BB6A 3ASWA 4ZOEA 2YXLA 5ARCA 4ZQGA 1FG2A 1WISA 2VDOL 1A7PL 1J9GA 2F8MA 2CE2X 2JGEA 2A6KA 3H9QA 1MJ5A 5EOVA 4QHKJ 1SD5A 3SPCA 4L0ZA 3BJEA 4M0UA 3AUFA 3B1WA 1HOCB 3B2XA 3IL2A 4D9MA 4UILL 4I5BB 1XA3A 1EPUA 3OJMB 1LW7A 4L95C 5TVGA 3WIVA 5CLJA 3GCWA 4PW9A 2P65A 1LK2A 2XVZA 1KJYA 2H0RA 4NQUA 3AERB 4HS3A 5J11C 5F7FA 4EI5B 3O1IC 3DYOA 2O7VA 3AHEA 3CZPA 3SDXB 3FLBA 5JZBA 4S0ZA 1DC6A 1ONPA 1MFEL 5C7XL 5IJWA 5FYJE 3CSYB 2GJZB 2BD0A 3AKYA 4OYYA 3BJ91 3QFJB 3M6UA 3I6KB 3H04A 3ARDD 3A8TA 2HT3D 4JZKA 1IHXA 5A2FA 3GT3A 4NLAA 4Y2TA 3Q3GA 5KJEA 2Z9BA 2BSTA 1HH6A 4PG2A 5BUGA 1L9SA 1P75A 1MTZA 1W85A 1DJGA 1BZDA 4N5HX 3QZOA 3VTAA 3IUPA 3C12A 4HWSA 5AQ0A 1N3LA 1UQUA 4KX5A 2HBQA 1ZLSH 4TUOA 3CVYA 4BWYA 4TRPH 2C88A 4TTDC 1K6MA 2RJNA 2HBYA 3EEOA 4GR4A 1GTMA 4HX1B 3V8CA 4ZVRA 5BVGA 4FQJL 3I37X 3NATA 1T22B 1TJYA 4HJ0D 1M0TA 2IFGA 1I7ZB 4M1WA 1T35A 2E4ZA 1BQHG 3C6EA 3BXNB 3K8MA 5K20A 5HMLA 1QX3A 4LU5L 2V7WA 4C9BA 1BD3A 5G0SA 2VZ0A 1HXHA 1XEWX 4X6CE 3VPCA 4P4KD 2XI9A 4XZUA 3C6BA 2XXBA 3F6SA 4N18A 1GV1A 1UXJA 5EFOA 5KSPA 2CIIB 2AGJH 4NJEB 2JBAA 2Q1YA 3S1LA 1SWVA 4DO6A 2JATA 2L7QA 5KTRA 2Q9CA 1I9IL 2ZSJA 4OJCA 3JWPA 1ONBA 4LAJH 5BQ7A 4W8HA 3JYCA 3OKWA 1PZ2A 1JHLH 1HEHC 1PUJA 3RIHA 1HYSD 4OD2A 4DEPC 3MMPA 1C3VA 4Q4DA 4K3GA 1E0SA 4K5PA 4R7DB 1GOTA 1EFRD 1QRAA 2E4YA 1U80A 4HG2A 1FV1A 2O19A 2NTFB 3II6X 3GMRA 3SZGA 1XRNA 3C09B 3VNQA 1EE2A 2PH5A 4PMEA 1NLDL 4WI4A 5IPFA 3UGQA 2IPAB 2GFQA 3LY6A 1LO0H 3QJOA 1OCOB 5IC6A 3CFBA 4Z2AA 2B21A 3COJA 3IQIX 4QXTB 4XP4H 4QODA 3CVHA 3VXUE 4PG9B 3OFNA 2VRCA 2PU5A 4H25A 4JN1L 2VXSH 3NJGA 1N2RB 4JZJC 2MINB 5MN6A 4U1RA 2Y7SA 2ITDB 1U0GA 2HRCA 5JOFB 2R8PA 3NMUF 1G6RA 2K5UA 3AKEA 1R4MB 2AYYA 3RSQA 3NDYE 3BD5A 1UM6H 3AHJA 4JHAL 2PTGA 5A6SB 1CWVA 4J0DA 3P5SA 2BVEA 3H11A 2WO3B 1ZGLB 3K0AB 3VRLF 4PWYA 4RQQA 2G5GX 5KBMA 1NX9A 2FB4H 3PG2A 1VTKA 4YCDA 5M34A 1T89A 4RH1A 5CBAA 4TYPA 2GABA 1IQDB 3ENZA 5CP7B 4LEOB 3AILA 3GJFA 3UBTA 4L0QA 3VUFA 1QVAA 15C8H 2HLEB 4RESB 1KIUB 4EF6A 3B37A 1QHNA 2DSTA 1QAWA 2O48X 1JV2B 3PUKA 3MJ8A 1OEZW 3D8UA 4OMUA 4NRXA 4MYRA 2D4DA 3KJQA 3QJZA 3C6LC 5ERWA 1IM5A 3H42H 5IEHB 5SWZB 3NZUA 1FTQA 1ZM2A 5F77A 2E5EA 2OTWA 4OHBA 2QSJA 1ZSDA 1FJ2A 1JNLH 5G0UA 3F7YA 3A6BL 3KWVA 2Y0DA 2CDGA 2PTUA 3KPRD 2NPLX 4BFKA 4BSVB 1YCGA 2VC2B 4GKAA 3HB3C 4H44C 3SSOA 3SODB 1PJ3A 4W4OC 2P6OA 3LHSA 3OXRB 2VERA 4ASUA 3SDDB 3HJEA 1BQ4A 4Q39A 1ACXA 3REWA 1A7OH 1D2HA 2IEYA 1MCOL 3MGTA 3AU1A 2GJ8A 3UHFA 4JB3A 2QL9A 5TDNA 2AAVA 1GXSA 4CCYB 2QMZA 4PS4H 3FCUB 2YJLA 4UIMA 1A2KC 2WWIA 2J0UB 3HC7A 2ESVB 5KVEE 3NJRA 5L51A 1NAMH 2WPGA 5GRXG 4CMGA 1F11A 4J1SA 2DBLH 5JUEH 1FVCB 2PZAA 1D6EB 1QIKA 4V0OA 1KCUL 3KDMA 3L8MA 2EIZA 3VSDA 3HS0C 1T1SA 4XNQA 3FJOA 3GHEL 1D7BA 3MLYL 2GETA 4YFVA 1O9HA 4B8ZA 3AOEA 4X6DE 3AUYA 3LHAA 1Z5WA 2OLJA 1HIML 3DKHA 2BM3A 1Z15A 2EKBA 3DE2X 3VNRA 3S0JA 1GR0A 1K3UB 2I91A 1JDCA 3B52X 1O9GA 5DEGA 2VTBA 3UB3A 1LGVA 4AT6B 1DAMA 1ZHKA 3MMEA 3P3YA 3KVOA 4Q56A 1VLJA 2DAPA 3FPAA 4G59C 1Z9PA 4MQTB 1E18A 5C4IA 5B8CB 4FXKC 2M1KA 4YDKH 5GGQH 1KEGL 5FYQA 3AREA 5EJ5A 4WXRA 3C87A 2V33A 3OQBA 1W29A 2J9XB 2C95A 3EVTA 3F58L 1F86A 4EY3A 3LEYH 5JATA 2VF2A 3RTCA 3VTFA 5JS6A 5GS3A 3HR7A 4Q4CA 5DRTA 2IWGA 1EAQA 2Z9TA 2IQ5A 2YJ3A 4KXZH 3DUWA 4MIEA 5LBSA 2JQAA 5CLIA 5HDQL 1CG6A 3KQMA 3BZ4B 3P2DA 4ECEA 1BOYA 1KK2A 4YSOA 1QQ7A 2WWGA 1EX7A 3FHCB 3BIAX 4CIVA 2DKUA 1ONNA 2R2AA 1F3JB 2IH1B 1G2PA 3FUHA 1GGUA 2OPHA 1U28C 2PV7A 4Q47A 4WEEA 4KO4S 2PL9A 1RIUL 2XV1A 5D7JD 2OK8A 1JXQA 3PX2A 2UU9B 1UWYA 2HT4D 2N1BA 3GSRA 1JMXA 1TA9A 4ODXB 3EO1A 2IEGA 2WJPA 1E9CA 1Z7WA 2HX9A 2QW0X 4K5MA 1COBA 3C60D 3B9KB 1GC1C 5BZXA 3WNIA 4AY0A 3KD2A 2FSUA 4KQ1A 3MDJA 3D5QA 3IKMB 1MHPA 4PHGA 3NV9A 1URZA 4XQEA 1WVZA 1DVFA 5FLYA 2PA3A 2DPHA 4CDMA 3D69A 4JPKL 1OTTC 2JFWA 3VPFA 3T1YB 3CD4A 1NCJA 4FFPA 3PQEA 4F9LA 3UQYS 3DDFA 3WFBL 3ZJ4A 2GPAA 2FO4A 2O1AA 2D8MA 3IUYA 4CDGA 5EHGA 4QUBA 4XR4A 3WNVA 2YXPX 3O4GA 1WZ2A 4PZZA 3L7LA 5KCMA 3F04A 2NSLA 3K4DA 3EVBA 2IHKA 2YAEA 5FYKL 3FF7A 4D3CL 4UUJB 1NQXA 3G5AA 3F5QA 2XCOA 5IZCA 4PLZA 5HHNB 3UO1L 3X1JA 2W0MA 3CFKB 5LKNA 1P4HA 1M6VA 4Y2OA 1M8PA 3ENNA 3T1TA 2K78A 4ODSH 1JDBC 2EFGA 5LCVL 3P4NA 2WP0A 1AKPA 3IXLA 2IL1A 2Q5JA 4N8CH 1E6WA 4MO9A 2VJDA 2WSDA 1VCMA 2EVWX 4H20H 2AXJA 1XD2A 4GXVH 2HKAA 4FYVA 4JHXA 4ZVOA 3A9UA 1FFHA 1GKOA 2I85A 4HMQA 4KMLB 4NUPA 1DARA 1KELL 5CIPH 4DTIA 1VQ1A 4D46A 4P2BA 3CE9A 3BCDA 5E9AA 1UMBA 5HGHB 2WNKA 3CKYA 5H0IA 3DGDA 3GS7A 4MX7A 2HX7A 2ZJFA 4M76B 1QFMA 2DV6A 1JF5A 3OOYA 3RGVA 5KEZA 3ZH9B 2GK6A 1IC0A 3NEYA 1UZ8B 4G4SP 1AKMA 4AW9A 2FQQA 5CCBA 3WL3A 1V3JA 2ZSKA 3P11L 2NAFA 1XF9A 4JM4H 2B94A 3DXYA 4H8WL 5TS3A 3SMVA 2BELA 4QAWA 1I7QB 1MJ8L 2C9XA 4G8GA 3MIIA 1UJ3C 4RMVA 3MO1A 3D5EA 4MEAA 4UXIA 3EOTH 4RDIA 3WELA 1YZQA 3QX8A 4FG6C 1HI6A 3V6OE 4N9GB 5GZ6A 4E9TA 2IU0A 5EE9A 1GPOH 3ZWVA 2YFKA 2CBOA 1QGED 1R6TA 1O0CA 1HHGB 4A1OA 3WRXC 5ADOH 2X6AA 4F60A 3TLKA 5GZND 1YEJH 2FE4A 1DBBL 3C24A 1TGVA 3HUFA 4OT1L 5KOIA 1ZKAA 1WCXA 2JK5A 1Q1JL 2A74A 3W1WA 3CZQA 3FRPG 3TDMA 3PUHA 3WEXA 3LHDA 2NZ9D 1ACLA 4B6GA 1U2DA 1THZA 3BYYA 1FVHA 4E2ZA 4U7KA 1QFWH 4OCRL 3OEHD 1Y8QA 2IOQA 3SKNB 2IGFH 1R3LB 1J9CT 2I67A 1EXVA 2X4GA 3HUJB 4BBJA 1UXMA 4AK9A 1ZJ4A 3VU9B 3B2NA 3EYQD 3WLMA 2P9YA 1KYYA 4Z8YA 5K69A 4H13C 3WIBA 1ZSNA 4TKLA 1MXDA 4EKDA 4NFDA 2LV8A 1LLAA 1RMYA 2WJAA 3OY2A 2ZWPA 4L5FL 5D3MB 1OF2B 5JXAH 3G2QA 5FUCC 1U0EA 4W99A 1TQVA 5ES4B 1IN8A 4MDEA 2PBFA 4XQCA 5DZLA 1RKUA 4Z0TA 5CAYB 1TPXC 3W6UA 5DNEA 1HEZB 4FQHA 2AUTA 1Y07A 3HCOA 1XSIA 2OA9A 2V3VA 5A7FA 4FEMA 2VSFA 1QLRA 1EG2A 4HWGA 1DG9A 1AACA 5AHOA 4L5IA 2JI4A 1QP1A 1SR8A 2DWCA 1X0VA 3B3IB 1JXDA 4JJHA 2ZRIA 1Q1PA 3S88L 4MRRA 4HHAA 5F21A 4RKRA 4EGAA 4TVPE 1FVXA 1GNLA 3P27A 3PG5A 1FL3B 2CKBA 4D9RE 2GQHA 2ZQYA 1A1OB 4CWAA 3INUL 4HGWA 3HBNA 1ENOA 2R2GA 1EZVX 2X4QA 1MFZA 4ZPXA 1SZNA 3KE8A 3WL8A 3KCPB 3GUFA 1E8NA 4KAQL 2D7PA 3QEOA 2Z93A 3OM8A 1M6OA 2HHHB 3AQYA 4ERXA 1P1CA 1LQBC 2GJSA 4EFNA 4OKIA 1YHZA 4F3FA 4JK3A 1T2XA 4JHVA 2IO5A 1XV8A 3VM7A 1IH8A 3L8CA 4RMHA 4I77L 4F12A 3CVOA 2NLOA 4HKBA 1K3TA 4U1SB 4IOIA 1QASA 2JFHA 3G7NA 4FSHA 2DECA 1AMYA 2X89D 3X1NA 4KFSA 4AZSA 3WTUA 3EGEA 4C2AA 2VLKD 3G8YA 4E11A 3KCWA 2A9DA 4AJJA 3ICWA 1NIEA 3FZGA 2YRFA 2MT9A 2IQIA 5DLEA 4FQPA 2PZEA 1JB1A 1G9SA 4IIJB 2BNUB 1DDHA 3NSDA 4IUYA 4L1BA 4L8FA 4TRRA 3F7QA 2P6NA 4Y8DC 4APQA 2FLRT 4RTLA 1SHZA 4NDMB 3CBRA 2JLRA 4NV1A 1XX9C 1OV8A 3QW4B 3UF0A 5CEZH 1HEJC 1AXIB 1E20A 5FPIA 1JEDA 5EMLA 1PL6A 3NP9A 1H8SA 4EPXA 4R8WH 1QKIA 2WK2A 2VZEA 2IC2A 5DC0A 2D73A 4O2FA 1AGFA 1O5OA 3HY3A 3CPUA 2Y36L 1A3RL 1TQSA 1UACL 2FH6A 1ZUWA 3PXLA 3FNIA 2HKHL 3EXIB 2DIEA 5TDPB 1SVOA 1M2KA 4Y4FC 4HIXH 1PFVA 4OU5A 4QRPD 1OQAA 5KOHA 3HXTA 1MQ8A 3CHSA 3DOFA 2C3YA 4HCRL 3UAVA 1H0KA 3CRW1 3BT2L 2XUDA 4J16C 1F1JA 1ID1A 2G4EA 1PZGA 5FDFA 4PHCA 3BOVA 1NJ5A 3T71A 4QJ5A 2QPUA 4IBVA 4LKRA 2YYSA 5FHQA 2IZ6A 1JIKA 5LHDA 4D9HA 4WO4D 4PJHE 2JJTC 4HATA 4L0YA 4N3CA 2FJHB 3P2MA 3WDIA 4O3UB 4Y9RA 3DHYA 4KKCC 4LXIA 2XVMA 4Y4HC 3V4OA 1J33A 3OKYA 4BU1A 3O0DA 3FXIC 3ZDCA 4HN4B 5I7UA 1Y3CE 4UT6L 1OGJA 2WD9A 2M2DA 2CXXA 4GG6E 2H6OA 2AF2A 1CDHA 3MOSA 3CZGA 4MS8D 4Y2RA 3WJJA 3IBCA 3DAOA 3F65A 2VHZA 3E58A 3ED5A 4NKMB 4IGAA 4R98A 4XX0A 1RAGA 1I9EA 4MSWB 5AW7B 3OOHA 4ZUTB 2Q1UA 3IAQA 3SPHA 2AJDA 3GIVB 3O6FA 1N6IA 3RAJA 1AYRA 2R1ZA 1CXZA 2CHFA 1USUA 3PREA 1J7JA 3JSXA 2WFMA 2Q3AA 3HHSB 1H0SA 1NR1A 5LKAA 1ZLWH 1MIHA 1DEEA 2X4RB 5GY7A 2CLZA 1D8TA 4MQ6A 1GGFA 4K7JA 3OJDB 5J6GA 1T5XA 1Q2UA 2W9DH 2G6TA 2XKKA 2FFQA 1VBNA 4B3GA 4KI5C 1SKBA 1URLA 1TQ6A 3U6XS 2ONZA 4L4VE 4XPGH 2BCMA 4IHOA 3EVDA 1P0QA 1QORA 5I1DB 3N5CA 1WFNA 2GHRA 5AWNL 4L2IA 1K9SA 1WZ1H 1Y4SA 2OFOA 2P6PA 2WCGA 4XMTA 1UDAA 5L2KD 3STZB 2AJXH 1G87A 1CC1S 3JD0A 3CSFA 4P4KA 5IBQA 1I4LD 1YJAA 3VISA 4MAUH 4G83A 1HYQA 2AMLA 1TVBB 4QBFA 2XUZA 2O4EA 1EWRA 4R01A 1V7MH 3FNHA 4JZOA 2QTVB 2FNWA 3BHBA 4C7BA 4DGVH 3A24A 2H41A 4IRUB 2IOYA 4K7PY 1ND5A 2B61A 4P4RA 3KPPA 1PWXA 5HVFB 1JZGA 1AGXA 1NNSA 2XMSA 3WIUA 1A9PA 2FPPA 4OQ4A 3E9RA 1B4JL 1KB5B 1FS5A 1C5DB 1BBDL 5I7VA 4RX4D 4YAIA 5IESL 5FCUL 1SLVA 1NICA 1Y6KR 1Y6QA 3RURA 5AW2B 5COBA 3FI9A 1SQSA 1MJJB 1JR4A 4YSPA 3UJNA 4Y9UA 5T64A 5CP3H 3H5NA 2PS9A 4FQCH 1B6GA 3CZFA 5ICZA 1O54A 3D6HA 3L48A 3R4RA 1JJUA 1TZGH 4UMEA 1ZM3A 3S81A 4IS6A 1HKHA 4NFSA 1U7WA 2PXYA 5LDHA 9MHTA 3R5FA 3VU3A 1PMYA 4O4LF 5JYDA 3GH3A 3A2NA 2Y1VA 3P71T 2EWWA 4WZBB 1CURA 1EJFA 4KO7A 4G0PA 3TZHA 3PD0A 4QF1B 1I1YB 3HZMA 3BZEA 1AI1H 3U7FB 2ZAIA 2GN1A 2MWMA 3N86A 4J6EA 3H1AA 1NBHA 5M7EA 3OZBA 4EPYA 1BJRE 1GPDG 4WZ9A 2CJTA 4QDTA 2GCYA 4PV8B 4QXVA 3HJRA 4PXSA 2VR4A 2ZIUB 4NPYB 3VA2C 1XQWA 3LRMA 2BP5M 5D1XD 2HWZL 2N56A 2JIXA 5GRZA 2AX3A 3N2ZB 3CB2A 4H4CA 4MNHA 3IYLW 2OAQ1 3ZGYA 2APTA 1O7JA 4L2LA 2R4TA 5ABPA 3WXWL 2JNWA 2C8LA 5HGAA 1REIA 4G86A 1JU3A 4I9HA 3QWQB 2JGNA 3TBSB 1ED3B 2GSGB 1YY9D 4XWGA 3T0IA 5DMGC 2CRYA 3OE4A 4DV1B 2HK7A 2QDXA 3HJNA 4L37B 5EBWA 4X6EB 4K87A 4PY8J 4ND1A 1CZLA 2Z35A 3KXLA 2UZIL 1Q6ZA 4BHUI 2VSQA 1SRDA 5CK5A 2R0LH 1FVDB 1JQ3A 2WSBA 4R81A 3LXXA 7MDHA 1X9GA 1NDTA 1FFPA 4M02A 5KJ1A 2BMKB 1QNZL 4I3SL 4ROSA 3TX2A 4CW1B 3KPRA 1GZVA 1LJLA 4C76A 1HYEA 5DYOA 1UENA 2AW3A 2C78A 3C2AL 3F6IA 5F71A 4OLEA 4PBXA 3HE6B 3DZGA 3PC4A 3P1VA 1WPQA 1D07A 3KJNA 2QUBA 3CGGA 1V25A 4HA1A 3K35A 3CSTA 3BIJA 3HU3A 1OB0A 4OZ4B 3PWJB 1CVRA 1NE7A 4ZUVB 2HC9A 3HM2A 1DSYA 4YMPA 2PX8A 5CFQA 2ZI5A 4KFTA 2YPVH 1U0JA 5I7HA 4UF7C 4MHTA 3VNYA 2F6RA 1VHTA 2ZJ2A 4RAUA 4XBEL 1GO2A 3N2GA 4UUPA 6YASA 2XTJE 1W2GA 1MJ7H 3HPLB 3MFFB 3I3DA 2Q7YA 2IF2A 2GK0A 5F64A 3DFIA 1NDUA 2VPTA 3CLFH 3KJZA 1X3DA 3TNDA 3E27A 4EI0A 5IANA 3N04A 2VCEA 2I33A 3DX4A 5CX1A 1FP5A 3OE7D 2NXZC 4NQCA 3I62A 2VNKA 4IXMA 3D3EA 3OUZA 4JE0A 5JU6A 4RY0A 5TQ2B 2EBFX 2P80A 2XPGA 3DWTA 4BECA 4Q9QH 4K7FB 3K5PA 1Q74A 1LP9B 4FNOA 5EU5A 3MOBH 5ADVA 2ID4A 3QE5A 2P5ED 1UCBH 2QLLA 4DLZA 2QHRL 5ABAA 5FECA 3U7GA 4EDXB 3WGVA 2ICWB 3VWJB 1TM1E 3TQFA 1WZNA 2AOVA 2FUG6 3KGUA 4HF5L 1ZIYA 3NFNB 1GU7A 3GUZA 3IR6A 4GFXA 1A66A 4FX5A 2EXSA 5FOXA 3PAUA 1H2BA 2ENQA 4J0GA 1KEVA 1A9TA 3VR4D 1DBWA 3JUYA 3KAJA 5BSHA 2AITA 4XP6L 1XDWA 1IKFH 3UXYA 3BWBA 3UADA 2XQBL 2PGJA 4KCGA 3L6RA 3ICEA 4ZA2A 1MAML 1UMDA 4RSYA 2XNHA 3QZUA 2XA9A 4PSKA 1OSPL 1JFTA 3IMWA 5KJ4A 1VPLA 4RV9A 5JNYA 3WNMA 2BEKA 5ID0A 4P57B 2BM1A 2XUGA 5HZMA 1GZQA 4XD2A 2XOEA 1TJ3A 1MH5B 1G7QA 1J70A 4F7PA 1DQLL 5FF6A 2R7KA 4A2MA 1A7KA 1CUFA 5AFSA 3R5HA 4IM8A 4JDVA 2H8PB 4E08A 4PJDA 5GJCA 4LKXA 2GPBA 1V0JA 3H1PA 5FPHA 1ZS9A 1ADYA 2JBWA 4NNPA 3K0YA 2ZKIA 1C1EL 2CKMA 2BW5A 2BEVB 5IB5B 1OLXA 2DMRA 2V6HA 2Y8EA 2OAEA 2RKBA 4H2AA 5CLFA 2JB5L 3ZU2A 4QDKA 4EIZC 1Y9JA 2B1IA 1Z74A 3FRPA 4UM9D 1B0GA 1Y5LA 3DZHA 4AXBA 3UGXA 3MRJB 2YEZB 3O94A 5TGTA 3KWUA 1QQ5A 2PXHA 2HQSA 1XSEA 1KBWA 1TT5A 3OQHA 3O2VH 5EUCA 1PS0A 1XFPA 1PUIA 5B2EA 3EXLA 5E7QA 1JF1B 1BM3L 4I55F 2X4SA 1GCIA 3K9FC 5A2CA 4XXWC 5MGNA 3KAQA 5DJZA 4BZWA 5F5LA 1CICD 2QTWB 4C0AC 3LFTA 4QBGB 2RIPA 2H26B 2RGSA 5IBCA 4V1CA 1MY5A 4HC4A 4RISH 4XTRC 2XZOA 3VYTB 3U9LA 1HQ4A 1E2NA 2FHPA 5AVOA 5GS1B 3KLMX 5ALIA 4EYQA 2HUHA 3LZFL 5L4SA 5IVXE 3AR5A 2PZFA 1NFIA 1NV9A 1K6IA 4G9DA 3RLSA 4B97A 2Y5TB 4J8RA 4UM8B 2H31A 2E4UA 1F6BA 4KEAA 4F91B 1IMJA 3TAXA 3ZVNA 2C9VA 4UAVA 3RPKA 5ISZA 2G2NA 2C5SA 3KNBB 3LVTA 2FYTA 1AS6A 3D1VA 1FTGA 2ZQ5A 1YEFH 2XODA 1OVZA 2K7ZA 1DYZA 3GBPA 3R09A 3OMAB 4N3TA 2AJZB 3BQUA 4IYJA 3RJOA 3CE1A 3O47A 2CUAA 4G5ZH 2PCPA 3QJFB 4KVCL 3THWB 1IBYA 1UCFA 2UYHA 2VUSA 5BMFL 5F72S 1Q9OB 1EWYA 3HJCA 1VRSA 4GP6A 1OB1A 4QTUB 2ZOKB 3DIVA 3UAEA 4BIKA 3KPMA 1LDPH 4TWBA 2ZANA 2VIRB 2VSXA 4WUUB 1YI8A 1M2JA 1CK4A 4N2MA 3PHHA 4OUUA 5AO9A 5BN1A 1MR3F 2JHCA 1ISPA 4JU8A 3OKEB 2FMFA 4HWBL 2VZOA 3W8NA 5EP3A 1ID5I 5CIQA 4BX9A 2EE0A 1ZJ5A 4TLLB 2ZATA 1E30A 2CHWA 4NUGL 4P3PA 5B21A 1LO3L 1GPBA 4D4IA 5AH0A 5GZNA 3R9XA 1N8KA 1R0LA 1P7ZA 4B76A 4TUJB 3TT3L 5TJ9A 1XEDA 3MOAH 1MI5B 3FAXA 1E7UA 3T8VA 2WG1A 1A02N 2I7DA 3JZIA 1QLFA 5LXTF 1J49A 4K0KB 3I4CA 4CMIB 4FADA 1IO4C 2NSHA 4HMPA 4X83A 1DKOA 4XPHH 3Q9SA 4XGNA 5MENB 1JH9A 4DN4H 1NVVQ 2JLWA 4X7BA 4CADA 4BX3A 1MOQA 3UTQA 1GJRA 2J1WA 1ZDMA 1NJ9A 1FSFA 4COKA 5IEJA 3QK0A 3SZMA 3KJIA 2I1WA 1WT5A 1WETA 3EJYD 3QAQA 4IG4A 5TQJA 5EC1B 4YT8A 3E2MA 3D85A 2PK3A 5K5EA 3ISVA 1M1XB 3RC7A 1VGEH 4G07A 2NW3B 2SICE 4MA4A 5IVNA 3QJSB 3IDZA 1PPIA 3CVIL 2D2FA 4M93B 1QRTA 3V5DB 4AM8A 2YFQA 4EG0A 2WINA 3ULSB 3A9WA 4XAKE 4KY2A 2QTZA 4R90L 2BERA 5AJZA 5I8CB 4AZTA 3WIIH 4PXAA 5LQNA 1Q0HA 3I2JA 4OF3A 1PK9A 1QG6A 1FG2B 3MNDA 4K8RL 3PCXA 1ZT4A 3AUXA 5AJWA 2JI6A 1Y63A 2A6KB 1XR3A 3EYUH 1ZJYA 2HFFA 1QXSA 1YZLA 2RCSL 5DW0A 2DLTA 2EVIA 1OFUA 3G8AA 1J6UA 5EZSA 5KZCB 1PEAA 1X9RA 4O1HA 1E5UI 3BFKA 1MBZA 1NATA 3CPSA 1LK2B 1RIFA 5JW3H 2YPKA 1R88A 2Z8YM 3OHPA 4D94A 4FI3F 4HS3B 3HRPA 4C3UA 4GB9A 5CYPA 3I73A 3CWGA 4PQGA 2PW2A 1SUHA 4L29A 3DMGA 1J11A 2XXCB 5D2NE 5GGXA 4OCXH 4R9UC 5EQDA 1MF7A 3ADBA 4M62H 2DQHH 3U25A 1BYPA 2RB4A 5L4NA 4RXTA 2CGRL 5DDHA 5LLDA 1NBVL 3Q3GB 3ZWBA 3HVKA 1HH6B 4WU7B 1RUPH 3BCRA 4WKOA 4GSKA 2LU5A 2IPTL 1BPVA 4QLAA 4N6RA 1W85B 2QV4A 1P9WA 5DRZA 1OWNA 5FTWA 4OCYH 1P1KA 2V58A 4WNJA 5DVOA 4TUOB 3PGFH 3ZHTA 3LPGA 4EG3A 3ZHOA 4XB7A 5HZGA 2NZJA 3WLWC 1XBRA 2B78A 5BVGB 4N1EA 3IJ5A 2DLEA 2OR9L 1PTKA 1ZTMA 3JU3A 1KJ2B 4IV8A 1W19A 3EXHA 3ZJYA 3IHLA 4HFMA 4JFOA 5JJCA 2QV7A 3CNHA 3VI4A 5HUQA 4G5QA 4PLGA 2H5UA 2MTAA 4CL3A 4WASA 1QWOA 3VR0A 4DN3H 1G5FA 4XAWL 1QSEA 1H3TA 1JOIA 4KYUA 4XZUB 2PH7A 4MW1A 5HUJA 13PKA 1I1NA 2XECA 1HX7A 1W72A 1RAIA 3GI8L 3IXAA 3DO3A 1BGXH 2JBAB 3K2UL 4DVBB 1DDGA 4EB3A 1XVUA 2O2XA 1NQ5A 2WTRA 1MO6A 2GCOA 3H16A 3O82A 4C5CA 1F2QA 3KQQA 4AAYA 3CUVA 3CLEH 2FZCA 1AZRA 2ZJSH 1M7HA 4R5TA 3Q48A 1MRFL 5BQ7B 3SBQA 1XYYA 1TQTA 4KN6A 3I9GL 3ZTNH 5C09A 5KCZA 2VR5A 5DJ6A 1BOOA 5ICMA 4OD2B 3S34L 3CIFA 2WJ4A 3OPMA 3MJDA 1AGPA 3MUJA 3HCFA 1XZIA 4L4ZA 1Q7TA 4KREA 1W2KT 2XZDA 4HFWA 3GMRB 2MOGA 3U6RA 2Q1XA 5LOVF 3BA6A 4AC4A 2HDWA 1KC5L 4OUOA 1YFJA 3PU7A 3CFBB 4HHGA 4K7PX 1OUMA 4ED9A 1J39A 3BMVA 1Q3HA 4HG4J 1NVXQ 4WBSA 5FFGA 1HQDA 4WK6A 2SKDA 1N5AB 2JLCA 4KV9A 1UZMA 1SQ5A 3DFZA 3TLXA 1GH7A 1F4YL 4WF7A 4A23A 4PJEA 3HI5H 3GL9A 2FQGA 3VD3A 1WIUA 2DY1A 5IAOA 4RLHA 4XIGS 4I4IA 2AB0A 1G6RB 4YDNA 1Z16A 5FYJD 2DWPA 3EZXA 1L4MA 1Z4OA 3B6JA 1KBQA 1KMQA 3VGAB 1L7IH 4OFKA 2C96A 4XO5A 3VRLE 1D9XA 1NJFA 3H11B 2UWEE 4RQQB 1RK1A 5L45A 4ICWA 3DKVA 1Q95A 4BNDA 4H1WA 1F12A 4BFYA 1CDYA 5CBAB 2CNDA 2C3GA 1S6NA 1U31A 1P1ZA 4XWWA 3GJFB 2J8UA 4GKSA 3V52L 2E4TA 1ZI9A 4X99A 4L3OA 4Q7LA 1LBHA 5AI8A 1Z4QA 5ELXA 1EP9A 2WBWB 2PLWA 1KT2B 4N5EC 3ZE2E 3QZPA 3MJ8B 1D2NA 3ZHCA 4NXSA 3DV9A 2VTDA 1XNRB 1QOZA 4MRNA 3E4CA 3EBLA 2RGAA 5ERWB 3KB8A 4Z8FH 4FYXA 5JW4M 3GBSA 4OZHE 1W73A 5ESVA 2OTWB 2R1YB 3ETCA 4KTYA 2L0XA 5DTIA 5FT9A 2GESA 1F8TL 4X5OA 2EP5A 3F7YB 1NIBA 3EHDA 2CDGB 3C5WP 5ULLA 1Z6XA 3B1JA 4AVYA 1A6PA 2A5LA 3WB1A 4G8JA 1YYMH 3V1TC 1SZDA 4MGHA 1KXJA 5AG9A 4J8QA 1IAIL 3MA9H 3DX9A 4QJ3A 5F6HI 2IIPA 2KWIA 5GGUB 3IETA 1KBBA 3MGAA 2GBTA 3REWB 4TUYF 4PB0L 3OZ7A 4IHQA 2QSCH 4EI6A 1Z0IA 3MGTB 3AU1B 2AYXA 2L82A 2DWOA 3PL1A 1ZM4A 5TDNB 1GXSB 4ODTH 2AQSA 2QZQA 2GCIA 1C9SA 4OFZA 4UIMB 3UCRA 3WY3A 4EJ2A 3OGCB 3A47A 3C6KA 4TLUA 4X9FA 1AB5A 4NWUH 4HFRA 5TF1L 3PCTA 2Z64C 1Q90A 2Q4EA 4G1CA 4EM6A 2NNRA 4E5SA 3KDMB 1B4TA 2C4NA 2EIZB 3KS0J 4D8WA 2VZ3A 2F7QA 5LN4A 2C4TA 1F8GA 4XNQB 5GZOC 3DT9A 2RG7A 3VI3F 3G5ZA 1DV2A 5BVHA 2D4FA 3OOEA 4LSDA 2J48A 5JWHA 4YR7A 5JAQA 1V8FA 4GYWA 1SD2A 2WYVA 5IUKC 1FTWA 2ATVA 1E1CA 5AHKA 1X2EA 3PGMA 1XG5A 1OWPA 2YC2C 3E53A 4OLZH 5DEGB 5IJAA 5C0ND 4GT1A 3HCAA 1GTVA 3GFBA 5LDGA 4YIHA 4GDMA 1ZHKB 3VAYA 3VXUD 3CZ4A 3LRKA 1Z83A 3AWIA 2F7RA 2OZ4H 1DEXA 2DQ4A 1TEGA 4HQOA 3C6MA 4Y9CA 4J0FA 4FQLH 1XRPA 5EF3A 2F1BA 4MQ5A 1AK1A 5I7FA 1R3KA 4PJ6A 3AREB 3T0EA 3DHMA 1WUTA 3N6RA 4N4AA 4OL0A 4GQBA 3O9WA 3SDAA 2XTSA 3KLHC 3NP3A 1T4KA 1NIJA 5T7BA 4K3DH 3DMDA 1G8FA 3WY4A 2J71A 4KYVA 3VXMB 1NCCH 2QGBA 3NNSA 4YLBA 4UBKA 1WWCA 4B7CA 4XC1L 2DLNA 4FXGA 5L2KE 2IDSA 2C5LA 2I76A 3LE8A 2C8KA 3BE5A 4HIJA 4LBEB 3S36X 3UTSA 1U8CA 2R7EA 4CZ2A 2HVJA 2YUIA 5CLWA 3TH4T 3JD1A 4R2GB 3RS0A 3CHRA 1EIWA 4RFSA 1DO8A 3BT0A 2FY8A 3P0JA 4U6TA 3KLDA 3PDDA 4F9PC 3PDJA 1ZDQA 2EJCA 4WWPA 3CRMA 4BOYA 3REVA 3ARBC 3GSRB 3EO1B 4HTAA 5HHXH 4ITRC 2F55A 3R6DA 5C37A 1SXGA 2CDBA 2PGLA 1BXXA 2FCBA 1U9ZA 2I7VA 4UZFA 2V03A 4OZGA 2AZUA 2J21A 3DQPA 1X94A 1DVFB 1NW7A 4KK8D 4M8SA 1H3NA 3D69B 3UZEA 3BJZA 4H4DA 4UDYX 2J4FA 2WFLA 1QRSA 3H9SE 1QLJA 3MSPA 3INYA 2YBRA 2A9MH 3I3OA 4HLCA 1QH0A 5A4FS 2GY7B 5DV9A 4XMUA 5SV3A 4OSOA 3D0KA 2YAFA 2A9FA 4XVTL 3HKFA 4W9HC 1W8OA 5D87A 3X12A 1IC6A 3RHSA 5IKEA 3WJLC 1ORDA 4FI8A 3T4AB 1J5CA 5FOTA 2HHLA 5CW1A 1PFCA 2X05A 4TN1A 1I4TD 3ED1A 1ZVSA 4G0MA 5M3BA 2FGKA 5EP1A 1M6VB 4Y2OB 1ZCZA 1R3IL 3U1SH 1MCIA 4FJ2A 1GTJ1 4M1TA 1F06A 3P4NB 3MQIA 4JO5A 3VQ2C 4XX1E 1QZTA 1I8KB 1TVHA 1AKYA 1OE0A 3GA7A 1L4YA 3GGPA 3PT9A 2FYYA 3ILXA 3BTUA 4HWEL 3NJ8A 4Z51A 4W9EC 4KQ3L 4PBDA 3VXKA 2NY4B 1NF8A 3O0RH 1V3TA 3LK7A 4XDYA 4Y18A 4LOIA 1DO0A 1J1PL 3G6DL 1UMBB 4NBRA 2ZE0A 1IBDA 1VFBA 4MX7B 2J6EA 3RGVB 3GZNB 3V8EA 1YXMA 4MLIA 5DWPA 1FRFS 5KQRA 4ZYLA 4EY8A 3OIDA 4G9GA 3OZCA 3QDMA 4M1DL 1S7CA 1XMPA 1YYCA 3LNEA 3FU3A 3BXFA 1S78D 4A55A 3V0AC 4P46B 2YAQA 3MO1B 1PW3A 4TNGA 4DV7B 4HX2A 3ULKA 5ECGA 3S44A 4HGRA 5BNZA 4QXRA 1HI6B 5I2IA 3ABIA 3FPEA 4PTTB 2Q4DA 1NNI1 5FS5A 2P5UA 4DV0B 1WBYA 2XZCL 1IOWA 1A97A 3V6ZA 4Y1RA 4O51B 4QHNA 4L9DA 4JM2D 2G1PA 3CDGA 1BJMA 3EWIA 4OAQA 3W1VA 2QLFA 1IY1A 4Q15A 1EXWA 5J5EA 1W48A 1XB3A 3TR0A 3OPNA 3OZXA 5E6IB 1XMWA 1QVOA 4TULH 5L4LA 4DKFH 4P6VF 2WSLA 2A74B 1Q22A 1SCIA 3U48A 1WLHA 5ANMA 2JGRA 2XPZA 3WEXB 2CMRH 1E1RA 3NDPA 421PA 1IXYA 5B6IA 3FT4A 3IEIA 2R8BA 2GJ4A 1GN8A 1X80A 2DBYA 2D1QA 4TS4A 1Y8QB 4BFBD 4R9NA 3QVVA 4QU5A 2OMNA 4RGOH 1ODJA 2V8OA 5FA5A 3H19A 4A39A 2WXMA 3CUEF 5K2MA 4P8QA 1BS2A 3DGFC 1YZ3A 2IPOA 1E0JA 1NCAL 2E59A 4FHGA 5DLYA 3G8CA 3MWDA 2BWJA 4G84A 1G59A 4CVZA 2Q49A 5E4FA 3FT3A 3ZWNA 1JAXA 4OZIA 5IROC 1ITBB 1UTDA 3IAUA 2HU2A 2QZPA 2D2OA 5A62A 5DULA 1U1CA 5CD3A 4N0YH 4B3FX 4HX5A 1EE9A 3JWEA 3QXWA 1HHKB 3T8MA 3QMWA 1ORHA 1QLRB 3CT6A 2PO6C 1YU6A 3O38A 3IHKA 2CBGA 3ITEA 1B0PA 3Q5YA 2A5GA 1TJGH 3VYNA 1WGOA 2CZGA 1QYIA 2VJ0A 4RD3A 5F76A 4HHAB 2DD8H 3GMNB 5F21B 1UK7A 4EG1A 3QORC 3OF2A 3ZCXA 1LPOA 5L6MB 3RZCA 5CVDA 4TQIA 2DZDA 1Z66A 3AR4A 2CKBB 3FTSA 3GGOA 4OLHA 3VXPA 2RFLA 2EXTA 4HGWB 1A7QH 1Q1NA 2X4QB 5FUMA 3RPIA 4M1ZA 4FNRA 4FUQA 3B7PA 1F2UB 2WXRA 4KTGA 1PS9A 2Z93B 1M6OB 4QHMA 1ZLSL 3T3EA 4HVLA 5LZ9A 1UKBA 1GMIA 3VSEA 2WHQA 4F3FB 4G43A 3BEDA 2EEXA 3AKZA 2FDCA 1PJ9A 3RSGA 4M8RA 2HWWA 4N76A 3ZV6A 4M0LA 3EH4B 3AFIA 4IOIB 2PUEA 3LIZH 2WU3A 3QO0B 4AURA 4H7DA 3TVTA 4P58A 4YBQC 1EFAA 2DQEH 1TT7A 2BBTA 4AJHA 3NVKI 4NKIH 3MU3A 4J4PA 4MAYD 3WGTA 2AGJL 4KGVA 1GA1A 2IXDA 3LMKA 1YV9A 3DUFA 4APQB 3DGCR 1X3SA 1UBKS 3EQ6A 2R1XA 4LHEA 2IYSA 1TZ2A 4UHFA 4RZXA 3FSOA 4J12A 3GT7A 3RA7H 1BFDA 4IIEA 3QUKA 4EVNA 2QENA 1BQHB 3BF7A 2P9QA 5FLKA 2OYCA 3SOTA 4ID9A 3NTUA 3NBMA 4HXEB 1AGFB 1UWEL 3FKSD 4FHEA 1U3HC 1UKZA 1KS2A 1V05A 3E9YA 1JIJA 5B3JC 4IDBA 1A65A 2WHYA 2GKGA 3OXSA 5D7SH 1Z2DA 4J28A 4PLCA 1X44A 3RSHA 5KOHB 1MQ8B 3AT9A 2H1RA 4NXKA 2H9IA 4TM9A 2TRSB 4ELKA 3MLVH 2RGDA 4KU1A 4JJFA 3WJ1A 3HNTH 5E8PA 3ZGOA 1BG1A 3VRHA 1P4UA 3E7DA 2JJSC 4KK6D 1OB2A 1LO0L 1TYBE 1JAHA 2Z8YA 4MCMA 4KJQD 5AKTA 1G2IA 3OC0A 4XP4L 1WLYA 3ZJVA 1B2YA 4XVCA 4RQBA 3E6AA 4GXRA 4ARBA 3MTXA 1E3QA 4FZEH 4FDLA 5CJBA 2VXSL 1BS1A 2HWUA 3NCYP 2DMHA 3B56A 3DSNB 4LCCC 2YWEA 3UG6A 1H9CA 3IPXA 4M54A 1G9MH 4P84A 1P6UA 1WU8A 1UM6L 4WH0A 5KJFA 1FNMA 3GLHE 3QU4A 3I5YA 1ZGCA 1XGTA 4JBGA 3WMWA 4WJKB 4PC2A 4TVPD 1TYCA 5C0FA 2XWJA 4D9RD 2QJFA 5AVYA 3NTXA 4ND4A 4JVOA 4DMGA 2FB4L 3GUYA 3NEPX 5E38A 2ZBDA 2I26N 3NTVA 2L3BA 2KI5A 4XX0B 5ID1A 3CN7A 1VADA 5A3RA 1AH1A 4O2CB 2UYOA 3EJQA 2IU3A 2VK2A 4FZJA 3L07A 4PGZA 4B3MB 1CP3A 1NKVA 3HHMA 2OCCB 3FYHA 5CCHE 4MDFA 5AAMC 3O6FB 1OM3H 2IUEA 4YEFA 4A10A 4DPAX 3LKSA 1UK8A 3JVUA 4W63A 4RAVA 1GRCA 1LILA 2VT2A 3I42A 2VQEB 3CRRA 3H42L 1DEAA 1ZG3A 5J57B 5TQ0A 2ZYAA 5DHQA 3TLGB 4OKDA 3MERA 1DEEB 3DAPA 4F7CA 2CLZB 1JNLL 5J6GB 3VGJA 3QF7A 5ILTH 4MUAA 2CLIB 1ZV5A 1R0ZA 4MQBA 1F38A 2G1AA 3CM0A 4IHOB 1WQ1R 2Y1YA 3QBTB 2FDRA 1PR5A 2EO9A 3TVMA 4EMSA 4L2IB 4WOCA 5IGXH 1O6GA 1A7OL 3ZHNA 3K46A 5EEYA 1PGRB 4IVRA 4X4KA 4PS4L 4INJA 5SX4H 4P4KB 1HK6A 4OM0H 1H2ZA 5DF0A 3HW7A 2FUQA 3C39A 1NAML 3B2UC 1GL7A 4JG0H 5ANRB 1C4OA 2DBLL 2P2CA 5JUEL 5BXFB 3HI4A 3BHBB 3TOPA 2IYZA 4OQFA 4UBLA 2HRBA 4HC1H 1TC2A 2VP3A 4P4RB 1S8DA 3KPPB 5GRUH 2PVSA 5TF4A 3ARGD 3N8DA 1ZMXA 2FPPB 4OG2A 4TSBH 2ZBGA 1YQXA 1TZOA 1NRJB 1MB4A 3HVDA 3GBDA 2Q8PA 1KFBB 4PAMA 2GVDC 3G0DA 2GBUA 5TFSH 3M4ZA 3LD8B 4Y4KD 3QFTA 1UBHS 4CMEA 5MN5A 3CSDA 1CFVH 3PABB 4IHJA 4G6KH 1WF3A 1XQ9A 2H4HA 1WJGA 3L1JA 1LRLA 3CZFB 2HWKA 2ALJA 3ND6A 1WZMA 5ICZB 1FNDA 1FJ1A 5A40E 1H85A 1VB9A 4MCZA 3T6QC 1KZGB 2A2ZA 4TM7A 4C0SA 4IS6B 5K3FA 4I14A 3EYVA 4KZCA 2PXYB 4YDKL 5GGQL 3MCWA 2X9XA 2WANA 1KO5A 3KOOA 4WTQA 5BOZG 4R2LA 3MJFA 3DXZA 4O5AA 2R5WA 3LEYL 1KB3A 4LLVA 3IUQA 3HZMB 1OHZA 2P68A 3BZEB 1F2VA 5BCAA 3FZEA 3VG9C 3CIQA 5CJ5A 2VEDA 3FNGA 4QTXA 4MWOA 5B7GA 4X1IA 2ZU0C 5IVPA 3RVUD 3I74A 5HI4C 1CBJA 4I9UA 1ROCA 3RVXD 3A3YA 3L41A 3B48A 1IPEA 5J1TC 2JIXB 5IB4A 1U5CA 4MNHB 4ALKA 4ZFOB 3ZT6A 3JV0A 3NHWA 5HGAB 3IO3A 4MA3A 1A7BA 4CLOA 1EX0A 2ADYA 5JAZA 1KOFA 4H1UA 3CQPA 1JNYA 3QS2A 4ZPTA 3EZJB 2V5YA 5EBWB 2XJ9A 5J6HA 1PUXA 1W5EA 2Z35B 1R0RE 2C3VA 5AHRA 4DCVA 4ENEC 1DQYA 4LYJA 3V3KA 1NFAA 2H1CA 4J3TA 3LCYA 3E70C 2W38A 2YFYA 1XCMA 4BO0A 1ZMRA 1A4JA 4FQXC 4GKJB 2D6FA 1SHLA 4PJCF 5EIBD 3MUHL 3UAGA 2GHZA 5DYOB 3ZDXB 3B60A 4DLLA 1G98A 5BUQA 4JUBA 1P9MA 1QBGA 5AVWA 4X63A 4PZPA 2PWHA 3SOBH 5HXMA 1UIMA 1GZDA 3M1AA 3GBVA 3KS9A 4QG7A 2P49B 4PBVC 4A68A 1TU2A 5JAOA 4JWKA 1A25A 2HLDA 2GLUA 2XVYA 3NG1A 3QUZD 1DAGA 5I0XA 3AY2A 4QOJA 5TEVA 5DK3A 2GPSA 1U94A 4MZDA 3LN4A 4QUIA 2C4MA 5HQJA 2F1JA 3OM0A 1NFKA 1FYVA 3I5UA 4YDRA 2ODWA 4RAUB 3N2GB 2XDQB 2QAGA 4H20L 3BPOC 4MW6A 3MUNA 4L1HA 3GEBA 2XG5A 3KWXA 3DXXA 4YXWD 2GK0B 2FMTA 1WZAA 4HEMA 1NHGA 2DLGA 3ZQ6A 5I71C 4NUJB 2X3BA 3FPBA 3QVSA 1OQOA 5CX1B 4KOEC 4NQCB 5A4AA 1H2HA 4XVJH 4DW8A 3KBFA 3ZUNC 5JCOC 4FXOA 1CYDA 1E0KA 3OG9A 2AG6A 1G9NC 3MODL 2WY2D 3P9MA 4H88L 3GLFA 3FO0H 1PZNA 4JM4L 4DUVA 2WZCA 4JLAA 4MD5A 5EU5B 3FQNB 5FTMA 1JZJA 2AQ3A 2QQFA 4X3PA 4HAFA 5FECB 3LTEA 4M8VA 4OFXA 4KTVE 4KIJA 3IAGC 5EE3A 3T5MA 1GOHA 3CWZA 1ZZGA 5I4KA 4HVBA 3O45A 4KXWA 3EOTL 3KALA 4X7SL 2YOHA 2AQNA 2ZP1A 3UZVA 2EVHA 4TPKA 5HRAA 5IT9A 2YJTD 3B7UX 3MLPA 1PYOA 2BINA 2XN9A 1GPOL 4Z7VA 3PRJA 4BK5A 2ICWI 3IUBA 4KI1A 5SY6A 2FMHA 3ZLTA 3QLVA 5ADOL 3TG8A 1P5UA 3OESA 1BF5A 4KPHH 3O6MH 4XHQA 3CO0S 3A4DA 1HG0A 2GZDA 4TSCH 4MCJA 1PZXA 1I85A 1VIMA 2F1KA 2XUOA 2EKSA 5ID0B 1WXDA 1N5LA 5GJSH 1GZQB 1OXYA 4MCYA 1G7QB 3UY4A 4F7PB 1QFWL 4I36A 3MKKA 1HOEA 1QVVA 4PJDB 4ZJUA 4LKXB 4KI5F 4JUDX 5I6PA 4OU3A 4TWAA 3A4MA 1RI8A 4YMLA 3NTCH 1PZUB 1KGJA 3CAFA 3P5BA 1CYWA 3J80A 3H55A 3ZT5A 1YB4A 5DU2A 2UZXA 1O94A 1Z4IA 3UAFA 4PG4A 2NY2B 1RJ9B 1GIGL 3TZ6A 5DHAA 3SD7A 1O8BA 4MFHA 1FXUA 1T1GA 2K9FB 3O8BA 1NVBA 3ARRA 3FRPB 3TSZA 2BLFA 1B0GB 1N5YL 4KWUA 3OHMB 1AHIA 1YZZA 3K5SA 4X3OA 4U49A 1G21B 3JWOC 1FDTA 1TT5B 2VNJA 3RS2A 3O73A 5B30A 2ZX6A 1X5IA 1G8JA 4FMBB 2X4SB 3ES6A 1M7DB 1IKOP 3D39E 1OP4A 4C29A 5DHEA 2Q21A 3HEMA 4YC2B 2JAPA 1NDMA 5DJZB 3FNKA 4O3TB 1P84K 4FZRA 5FWRA 1GJUA 4R3WA 1X9QA 2XTJD 3K7EA 4RF3A 1Y3FE 2EZ0D 1PEKE 3MHPA 1E3JA 1T0OA 4FYSA 4U1MA 3HGTA 3O6LH 4JDTH 1TFUA 2XWDA 4XGZA 1HQ4B 1U2TA 4LT7A 2PGXA 1VLQA 3T0AA 1LQ2A 2GPYA 5DLPA 1AY1H 1H2FA 3HNPA 4IRZL 3MYJA 4P05A 4KTEH 3FE2A 5JH7A 1E2HA 1P77A 4NQXA 3JW8A 1NQBA 1RXEA 3TNJA 2FP4A 1D7OA 3L6UA 5ISZB 4HDQB 4MAFA 4XO3A 1AZTA 2G9UA 3V0DA 1XQ1A 4I9GA 4OVKA 2P9ZA 3ELDA 4GZ3A 1JSYA 3TBCA 1V8BA 2ZAMA 1CQPA 1L7OA 1M71A 3BQUB 2PKQO 2QUHA 5F1OA 3TGPA 3RWHA 2PCPB 5HS4A 1G7CA 2VDLB 1WXQA 1PAZA 1LEKA 1FNSH 1FJXA 3ZN2A 1R18A 4FD3A 2APJA 4U3SA 4KWEA 1C0EA 2Y67A 3TRDA 4UNQA 1OB1B 3PEFA 4RF4A 2W6JD 1V11A 4Y16C 5L3ZA 6GPBA 3X2QB 2LU3A 4FCHA 4OUUB 5C07E 1AHHA 3SN6N 3S96B 3M7OA 4HQRA 4ZX6A 1CGXA 4G0UA 1ZCJA 3ZPDA 2GM3A 4JM2A 4R8WL 4G82A 4OSPA 1MT0A 4RD0A 2I25N 5A9SA 1OREA 5AESA 2WWTA 3R9XB 3NIGB 2FW1A 3R8XA 1OT1A 2V9QA 1FW8A 4HYQA 4DANA 3H6KA 1SA0B 2HB0A 4HIXL 1QLFB 2PU7A 4Y3UA 3ZE1B 3DWGA 3PWKA 4ON9A 4MQEB 3IGAA 4C57C 1FSPA 1KEPA 2ZJ1A 4U1GC 1URIA 2LOEA 2B4CC 3UTQB 4XAQA 4EA6A 2NV6A 4HDRA 4PYRA 1NJ9B 4X7EC 3ZWPA 4TTRA 2D3VA 2ZUQB 1WP9A 5IW1A 3AW8A 4PLHA 3JQPA 3E6FB 4LYHA 3GLGE 3D85B 3Q7RA 2G1UA 1KGCE 2HDHA 4XB6B 4UOQA 1UADC 3C8KA 3K5RA 1OA1A 4M1CD 2X41A 2ERJB 1XALA 1GIAA 2WINB 3CX7A 2GY5A 1SVMA 3BE1H 4AL4A 4DOHB 3WWYA 4LSUH 3RYCA 2PYZA 5F23A 2J08A 1NBME 4ODIA 1KIAA 3VDQA 4C7VA 4DR2B 5KYNA 5BN3A 1ZT4B 4ALNA 1IB5A 5LQRA 3AW5A 1ZD8A 3S9DB 1J8DA 4R6WA 3ATDA 4RBPK 2N1KA 4MBOA 3KAKA 3ZV4A 3PJDA 4DA0A 3AXHA 1YFZA 5I74B 1Z0JA 4PAGA 2W88A 4ZUWB 2HDOA 4X9HA 2CJXA 2GI7A 2YPKB 2BO0A 4QTIH 2G2PA 1A6UH 5KJRL 4IGKA 4N2KA 1SVCP 1I32A 2LQRA 4KN9S 1PS3A 1OZTG 3NHJA 1F9EA 2P1YA 5AJVB 2PW2B 1NMBH 4YJ3F 3O8XA 4L2YA 4X90A 4L29B 2ZP9A 1CQWA 4P2QD 4WKCA 2W9DL 4LDOB 1KLUA 1GZ5A 4G6MH 2ZKXA 5AK4A 1BCRA 2E2WA 3DIDA 4XPGL 5D3QA 1IXKA 1KPUA 3C15C 1M05B 1DDIA 3FCGA 3GS0A 1VMIA 5DDHB 4CIAA 1WZ1L 3AEXA 2RHLA 5TE9A 5HILA 3QEKA 1MHCA 1XLWA 1YZUA 3WFIA 1L8OA 3V6OA 4YZWA 1EHNA 2OV4A 4YK4B 1GSOA 5K0GA 4YZFE 4P7KA 4N6RB 3IUMA 5DRZB 4LPWA 4JYCA 4DABA 4MAUL 3DRQA 1GKLA 2BKXA 1UKEA 1GAFH 2ZVJA 4QTYA 5BORA 4MHHI 1V7ML 1G5TA 2CXGA 2NV0A 4KRPB 4YDLB 3MXTA 2A9JA 3W9SA 4MMZC 5E95A 4OCWL 3B53X 2IALA 4BFIA 1UL1X 1XTTA 1X5AA 5D5QA 3EXHB 2WHVA 2DG2A 5HJ2A 3VI4B 5CU9A 1I75A 4ZMZA 5FYKE 4LMQI 3ARPA 4NU8X 4HISA 5JIHA 4YGXB 1QSEB 1LV8A 3WAKA 3G5XA 3BDAA 4RAOA 1CYGA 1W0KA 3RBSA 3D50A 4E15A 5JD3A 2AMFA 3NETA 1W72B 2P26A 1P0MA 3OSKA 4FQCL 1CY1A 4DJFC 5FX2A 1TZGL 4MLDA 2YD4A 2ZX9A 1QFPA 5MHSE 2WTRB 2FWIA 1X7GA 2GCOB 3H2IA 5BWBA 3P96A 4H77A 1LI7A 1K4YA 2QFRA 4NRYA 3Q98A 4ZHQA 4XAKD 5C09B 1LK3H 4K8RD 1D9ZA 1UT9A 1N2BA 4LTNA 5DJ6B 3QM1A 4BVBA 3OB0K 3AGPA 2JI7A 3V80A 3NGXA 2FUG1 3N3BC 5H81A 4FJ6A 3K9LA 5A4JA 3UH8A 2GEKA 1U8YA 1J8RA 4PCSA 4HFWB 3U6RB 4Z9BA 3THOA 2I99A 1Z9OA 2WW8A 2HT2C 2V65A 3VMNA 3DMNA 1XHHA 1YB7A 1UBOS 5ICXB 2AKEA 4QNNA 2ID5A 1MV8A 3LXAA 1ND6A 1CS6A 3T7AA 4UJ5A 4ZK8A 3PNWA 4YS4A 1VBMA 3RKSA 2D62A 3QX9A 3OAAD 3A6FA 4N26A 2BNQE 4PJEB 3JZAA 4DMUB 2JW5A 5K6AC 4LDLB 5EMHA 2GF9A 4PNEA 5C7OO 1KL7A 3DPSA 4JBWA 5J4KA 4B5EA 1DAEA 3JR3A 3CNBA 1SHXA 3K8QA 4JGMA 3AUWB 4OV6B 2OMEA 3LBHA 3BMWA 1RK1B 2CLSA 4OJQA 2VZUA 3FCBA 2VSOA 4LNUB 4BNDB 4JP3A 4G1FA 2Z0BA 3ZVVA 4GUQA 3PVZA 2PWAA 1FDOA 1II4E 1P1ZB 4Z9KB 5T3XH 3QCTH 4TYWA 1IM9B 5I19H 4XYGA 1TM2A 4X99B 1EFTA 1AZNA 3S28A 5INDA 1VDMA 1G6VK 3OJ2C 4CTMA 4FFNA 2AJVH 3G1WA 3CH5A 2NX5A 1YNTF 2I4OA 2P43B 1EDQA 2BZDA 2HMSA 2O6EA 1LDSA 4NHEA 5GONA 2AG8A 2NM0A 3DV0A 2YPVL 2AEOA 5ESVB 4L9RA 3IBYA 3HKZA 3R41A 4L5FE 4MRBA 3VFRA 3QEUB 5H94A 1MJ7L 3KOXA 1ULHA 4JHZA 4L0CA 1X6NA 4MCHA 2V3WA 3PJGA 1VFMA 4HSCX 1L6IA 3CLFL 3DX9B 1KSJA 1WU7A 1RPKA 3A32A 3IETB 4YPFA 4N2BA 4I87A 1K7FB 2VLJA 2AHRA 1O7SA 1P6QA 1Q1EA 4U05A 4EI6B 4N0EA 3NTRA 5D7BA 4P2OC 3NHKA 5EHNA 4OHPA 3PQFA 1EV2E 5K0BA 3U60B 1U0FA 3D1LA 2J32A 2QHXA 3S3BB 1Z6GA 4LQDA 2GTHA 1IM2A 3AF5A 1HL7A 2HUNA 1G5GA 5HP4A 4Q9QL 1TECE 5L3RA 2P47B 3CW9A 2QM8A 3G13A 3AFHA 3RD5A 4BB5A 1T2VA 3MOBL 3BAXA 5F7AA 1UCBL 2XWXA 2HU8A 2BH2A 4D98A 2AANA 3HZKA 4HMOA 1OCEA 2JGLA 5E2BA 2ERXA 3VI3E 1YMME 2C7OA 1QK3A 1G94A 3FFCE 2XDWA 3G5ZB 4W6XB 3MFYA 1FEZA 1U90A 2O0MA 1YZTA 1S3FA 2Q8QA 1C8QA 5BVHB 1U8PA 3P0VH 2GN0A 4RJIA 1LQSR 2KUTA 1XGKA 2X3CA 1JEQA 3BWEA 2EACA 2HJLA 3MLEA 2BOVA 4GG6A 1ZGGA 2QRVA 1Q11A 3P9IA 1L7VC 1XV5A 3IULA 4M6NH 1IKFL 2AN4A 3NYQA 2YKLH 2BNRA 2DI9A 4FI6A 1RZRD 2EO7A 1D0VA 1PY4A 1EERB 4Y9EA 2D4HA 2H18A 5AZ2H 3QH3A 5DRNA 2MCG1 4PRHB 3OPXA 3JWHA 4F5WA 2I7TA 1FNLA 3HI1A 3WE1A 5FBKA 1R3KB 3G7UA 1FNCA 3T0EB 1SHJA 4YMIA 2F3PA 1ID2A 5C7YA 5DR5H 4MIKA 1HSAA 3B1XA 3O9WB 3SDAB 1A4UA 1Y37A 3UJ8A 5JJBA 2FOLA 4NU5A 2OEPA 2XUAA 4JFQB 1EIBA 2QLMA 1IE5A 1Q1AA 1NCBH 4XNXH 3TP4A 5EIWA 3D8SA 4LYYA 4IXWA 3TX6A 4ANUA 5IOPA 1M4KA 1JJAA 2B7DT 5CM2Z 3PIDA 4HNSA 1I8LA 2EIMB 3CO5A 3MOGA 2C1EA 2PQ6A 3O3NB 5JO0A 4FXGB 4L4VA 3KNZA 4GS7C 2FPSA 5AKJA 4HIJB 3UTSB 5ALCH 1A9RA 2R7EB 3VZCA 4YJGB 1WB5A 2HVJB 3MZGB 2BE9A 4V02A 3E3QC 2ZR0A 5F35A 1UH3A 1RPAA 3OZWA 5HKBA 3ZRCC 1FBNA 4ALJA 1QE0A 3AB3A 3O2VL 1NVTA 3REVB 4AGQA 3TD2A 2VA8A 3ML1A 3FM9A 3BH6A 3CG0A 2EUXA 1WPCA 1ZXBA 1U7TA 3E9QA 2CLVA 3NVQA 4ABVA 4YC7A 3VYPA 4OZGB 1CD5A 5E9DB 2AABH 4CVWA 4AQ7A 2DEUA 4RISL 1TF2A 4KWIA 3L17A 2WKWA 5IASA 3IV9A 3KZVA 1AYOA 1BH6A 1FSGA 2C7QA 2DTEA 4RGMC 5CFNA 3GCXA 2YBRB 1G6Q1 1OKKA 3H8JA 3HC4H 4IBWA 4R5VA 1VENA 2IDFA 1JRHH 4PCLA 4WI9A 1J09A 1MABB 1WW2A 2GAOA 3ZQUA 3FDFA 5IM7A 5IUSA 3X12B 2RHOA 2P28A 1OROA 2JFGA 1RKVA 5DLMH 3M3HA 2MYTA 1YNKH 2FX5A 2QRGA 2WBJC 5EU3B 1YEFL 4KK3A 2VLME 5TPWH 3P4YA 1ZVSB 2JB6A 3FFXA 1WFIA 1KKMA 4OFVA 5D8DA 3RWGB 3LZDA 1P33A 4G5ZL 1IEWA 4RETB 1FTYA 1C16A 1YASA 2D2XA 3Q87B 3ADKA 3LT4A 2HSIA 4BO7A 5BW7A 5DC4B 4HZGA 3EZ8A 4CQLB 1TVHB 1KYIA 4ND8A 4QULA 3RWMB 3JYLA 2COVD 3ZD7A 4LF4B 2FYYB 3ARDA 1V16A 1LDPL 1KMHB 4RSRA 4LJAA 1KCSH 1T0NA 2CCJA 4PAWA 3ZR5A 4ADSG 4RFNB 2H1OA 4B0MM 2AOTA 3N06B 4YONB 1VFBB 5EEZA 4AZUA 3SZ3A 4C20A 3PS6A 4XTCS 1DKNA 4B0OA 4P5TC 5AR1A 3QDMB 1EWHA 4F9EA 2HLPA 3IP3A 3C7AA 3MOAL 3I5AA 3CYFA 2CH8A 5EKSA 3MJWA 1NOIA 4D45A 3GXTA 1ZWKA 3MNFA 3Q6MA 5HKLA 2I65A 2QLJA 4XPHL 1PLKA 5DD3H 3N0WA 3O3EA 1OMOA 1KAHA 4RNRA 4XE5A 4DN4L 1ESMA 2KYIA 2HRRA 1FYTE 5I2IB 3H05A 2ZETA 3FB8A 4X8HA 4RMWA 5A71A 4W5NA 2ZXDA 3GEFA 2WFAA 1SVBA 1WBYB 1B90A 5B1AB 3V6ZB 1OAXH 4Y1RB 3OKCA 1UAYA 4J9VA 4UNVA 4FEYA 4TLMB 1BVNP 3CDGB 4ZSOA 1YQDA 5F2NA 4J3OC 3WNOA 4MROA 3P20A 1E94E 1QVOB 5I66A 1MAJA 4B3EA 3WYAA 3GLDA 3UH0A 3FTUA 1MMFB 3WYRA 1VGEL 3RW9A 3H9BA 4EY6A 1SOXA 5ESQA 3CEHA 3VPSA 5ANMB 3ATFA 3FT4B 4KK5C 1QWSA 4EN3D 3JD3A 5GXBB 1IG3A 3C3EA 5ICYA 1PR4A 1PO7A 4PZEA 2BEJA 2BVNA 3BPNC 5DMYA 3WIIL 4NH0A 2P45B 4JFSA 1HT6A 3DLQR 2D5BA 4ZXFA 1HZZC 3H9SD 1EFRA 1CLOH 2G9ZA 2DJ4A 5KSBB 1QANA 5A2AA 2MSLA 4LSSH 3TNMA 2YBGA 3EYUL 1W6RA 2B1OA 5IW6A 2GFHA 3GSUA 3MWDB 4MVBD 4CVZB 4EG7A 3KHUA 3FT3B 4R7VA 3DMYA 4G2AA 1Z4KA 1FVFA 5ALTA 3ULAB 4JVMA 3RRYA 5BRNA 5T1JA 2VZTA 1VJTA 1B41A 1JNXX 1TK3A 3DVSX 5A3JA 4YVFA 5FIEA 5CD3B 3I83A 4H6XA 4R9SA 3NUQA 3GNSA 4JI8B 1GGJA 2BPOA 1XGRA 4AE0A 1C1XA 2OAGA 5DWDA 4CMCA 2JD0A 2AEJA 1Y3HA 5AW5A 4OCXL 2DQHL 3CPLA 2BY2A 4GBMA 5IXYA 2GW5A 4JR2A 1GUBA 1G8HA 3RZCB 4F8QA 1F1DA 2HJFA 3GD7A 5I0VA 1ZOLA 3TQIA 2V5AA 1CVSC 4B9YA 1U0LA 1YBFA 1VOTA 4ZCSA 3PF2A 3LKQA 4WUKL 3ZI4A 4RY9A 1JGLL 1IBKB 3RPIB 3N7TA 4LJRA 4UBNA 6REQA 3L7EA 3T4PA 4BWGA 5HJ7A 1JGEB 4OCYL 4F7KA 5C0GB 1X1AA 1YZNA 1T1YA 3D33A 4QHMB 3OBBA 3KGTA 5F96H 1PR2A 2PL1A 3ROLA 3ZW9A 1DBQA 3QWBA 1QVWA 1Z4JA 3W5AA 4G43B 3GLQA 4INAA 4CRWB 1F0PA 3D2LA 1AD9A 2ZONA 4K3HA 3V2IA 3BPCA 4FQ8A 3KJFA 4HS4A 4OXKA 1I4EB 2DBRA 1WUHS 4TL4A 1E96A 1OFUX 1HOTA 4WW1A 4JWTA 1C8VB 5B1JC 3T7EA 3APFA 3PQYB 4EJMA 2I4NA 3B6IA 3FZQA 2V96A 3E9EA 2IZ0A 2I29A 4F1SA 1BXAA 3QELA 4D8UA 1E4EA 4LHWA 1BGXL 4G7VH 3DUFB 1ZIBA 2G72A 1TCUA 2Y4NA 2R1XB 3ARQA 1IBGH 2F58H 2L04A 3TKAA 4GT7A 2ZJSL 5DYYA 2NUTB 3QPAA 3OCUA 4R2XA 3QUKB 4EVNB 2DEYX 3IGLA 5D6NA 4E51A 1U3NA 1G7SA 3JQAD 4GIAA 2V2TA 1D2OA 5I9QC 1U2PA 1A9YA 3OXSB 2NACA 1T2JA 4ELKB 2VDMH 2Z92A 1KYTA 2O1XA 1X1RA 1X15A 2QJOA 2CVQA 4MVJP 4GPIB 3MCTA 3N2NA 1QX4A 1RI1A 1QBMH 3EX7C 4B7AA 5TH2A 5B7QA 1JN0A 2FR8C 4BMNA 1ONSA 4HB0A 3C3YA 1KRHA 5IVXA 1NVEA 4EJ6A 4BH7A 1OIXA 4ZFGL 2K3TA 4GGPA 3JQ9A 4F8NA 5EMKA 4HUQA 1P61B 3P4MA 2WLTA 4FJYA 2VCOA 1E3SA 3EVNA 5B53A 5KOJA 4HWTA 4MRAA 2J8OA 1NR5A 3F5DA 3JWDC 3DBVO 5L3SA 4L9LA 3JQEA 4GEGA 4RZUA 4NMMA 3RGWS 1HA3A 1L7IL 1XGTB 3GVIA 3MHTA 3BPSA 4NH4A 5C0FB 4ANVA 4ZI3A 2CEKA 1YMUA 1S8FA 4GO1A 5I1AB 3ETEA 3N8IA 4WFFE 1VADB 4RJ2A 1AR2A 1OC2A 3FQ2A 1NULA 2G36A 1PT7A 5E2VH 1DLIA 2L69A 3DDZX 2ZUVA 2XRAH 1XN1A 4MS6A 1BZQK 3OKNA 4WHMA 4WZAB 4DYDA 3MJCA 1GPNA 4ONEA 1GDTA 3LKSB 2P9EA 3H9EO 4FQQA 3AU0A 1DPFA 4J3BA 5D7JA 2RBGA 4G6ZA 4Z8FL 2VTVA 5J43A 3WLJA 1N0XH 1D2PA 4TVSA 2XE6A 4Y6QA 1AO0A 1SHSA 4H1LG 3ANXA 3C60A 4FA7B 1ULSA 2B9AA 2UDPA 3F6YA 1YYML 3I1YA 3CE6A 1KIRB 2VF5X 1OILA 4YT5A 5K0TA 5H35A 3OBIA 3TVMB 2HNAA 5DH9A 2JFQA 2P2YA 2SCUA 2QSCL 3BAEH 1CBVH 5BV7A 3GMPA 4XGIA 1L5ZA 2VZSA 4ODTL 3T3DA 3PWSA 1UQRA 2ARJQ 3EZNA 1DJZA 3UBGA 3FY4A 4Q3EA 4PB9L 1U1GA 4NWUL 3H54A 1SXAA 4JHWH 3MGKA 5K0CA 3SM9A 3Q15C 3WNCA 4GKVA 1J8HE 2VH5R 1KY4A 2R62A 1P8JA 2B14A 3VO0A 3W5JA 1S8DB 1SC6A 1GAJA 1KI2A 3NYRA 4Z4FA 5HVGB 1A7AA 3VBEA 4NZUH 1P17A 2WF9A 1GLGA 2B99A 2CLDX 2QPEB 5TE6H 3CLTC 2BC4A 3VCLB 3DMTC 2B1GA 3SHFA 4XQ9A 4HWUA 2X87A 2QSTA 4Z3TA 5A2IH 3PHIA 3R5JA 1N92A 3N8NA 3FUFA 4L72A 1WS7A 2GDZA 4ZCIA 4BXSV 4GH5A 1P5JA 1MFMA 2WD0A 1EMTL 2QMKA 4WQMA 3VR2D 2YFNA 3WSQL 4NU6A 2H17A 2JAOA 3ZCUA 4Z1MD 5FW7A 1GGKA 1FJ1B 5BUZA 3E9ZA 2OZ4L 2RI6A 3PP4L 2ZF8A 4J4HA 1Z88A 2DVMA 1RUKL 3QG5A 4FQLL 1WULS 3EYVB 3GMOA 1LF5A 2Z3FA 3EEBA 4LVNC 2ATCA 2JJWA 1NI4A 3CZAA 3WJAA 4Q4JA 1JU9A 1LH0A 2I6FA 2WGXA 5ENZA 4LLVB 4P2QE 3D30A 2MCPH 4GE0A 2BX5A 1HWWA 4K3DL 3PPVA 2D03H 1PJ8A 4XDGA 3BORA 25C8H 1BMDA 4IRJC 4X1IB 1FMLA 3QQ3A 2BYTA 3HNVH 4I18C 3KB6A 3HM9A 3U7AA 1PFYA 1BQEA 3EXEA 4J0EA 5CBPA 4M6MH 3A3YB 2L17A 3A3PA 5IB4B 4KIGA 4EYSA 3F7NA 3FKQA 4MUEA 4OAPA 2NY0C 5T5FH 3ZDZB 3MROA 5HTOA 3HKBA 4KITB 3V0VA 2P4EA 4L1KA 3VXOA 5F1YA 1MNAA 1YN6A 4MA3B 2ZBFA 4QRBA 4NOFA 1ZMBA 3ROKA 3O4JA 1NA5A 4JG1H 5HHXL 4I3RH 3RUIA 1VHQA 3KW8A 3QULA 2YOCA 5BQPA 4ZPTB 3L3OC 5J6HB 3OLEA 2A6DA 3TA3D 3NCFB 3MJ9H 2C3VB 3OEHA 2AT1A 1SXZA 2PR9A 3VNUA 4Z7OB 1J10A 3NQIA 1JQKA 4MUYA 1NGSA 2FSFA 1A4JB 4PJCE 3CKLA 2P24A 3U26A 1IGTA 2A9ML 1WQ4A 4WEOA 3VDXA 3ZXUB 4YR6A 5I9NA 4P35A 1AS8A 4K86A 3TEFA 5C8YA 2EF0A 1AZLA 2HLHA 3ESUF 1NCNA 1FQWA 1JQJC 3HXLA 3WEAA 3P4XA 4PPNA 5AVWB 5KUTA 2QYHA 1Q5PA 3N2IA 3PXUA 2VAWA 4NJ9H 3GELA 3CU7A 3BLKA 1GEEA 1DJLA 1EBAA 1A04A 2EZ9A 4JSTA 1CJSA 3VXSE 1TU2B 2H59A 4R3SB 2VT3A 3A7DA 1KTJA 2XXJA 3CMGA 4LOAA 5ILQA 4KRGA 1Y82A 4Q97A 4WNAA 3U1SL 5B3JF 1J21A 1HFEL 3LN4B 4FN4A 2CHEA 3UEQA 4DL9A 1A5SB 2P9JA 2RAVA 1CFZA 4BFRA 2H9GA 5IHHA 4R4FH 3KZNA 2ZSUA 2QAGB 1URPA 4KVPA 1OAAA 5IMMA 1W1IA 3L3HA 2XG5B 1YE5A 2Y6UA 3O93A 3RQIA 4UM7A 1QPXA 4HPOH 4BJ3A 1P91A 2VJAA 3O0RL 3EUEA 1LC3A 4RGQA 2BPBA 2JI1A 3CLSC 2VPXA 2B4CH 3E9NA 1JDNA 3V9EA 1TFHA 4UHHA 1PFWA 5I7OA 2G08A 5KW9H 5KHOC 4YUAA 4M8UA 3N1MC 2GZ3A 5LXGH 3GR6A 3P9MB 1N10A 5H80A 3GLFB 4AUMA 5AALA 4CG2A 1Z0MA 4U8GA 2VQUA 2JARA 4U7MA 4ADIA 5JIIA 3G08A 3ZQKA 4JQXA 5IB1A 2YJ4A 3G7SA 1D5CA 4JKWA 3Q2OA 5HKAA 3O45B 2JG3A 2ZEJA 4M8QA 4XVSL 3BP4A 4XVRA 3UZVB 2X89A 2BSTB 1PT9A 4XBGA 2VLKA 2PD3A 2D0HA 4QTZA 2XN9B 5JG7A 4Z7VB 1AHWC 3U7EB 4XIIA 3C6YA 1FFXA 2G5RA 1QZXA 2GZ1A 1M1ZA 1JZDC 3A2MA 1A3LH 5EF2A 1P6AB 5JV5A 2YKKA 1P5UB 3OQ1A 5G55A 2JHPA 4HCJA 3RKUA 4S12A 4DKFL 3N75A 4RPCA 5FO2A 5HGBA 3LRTA 1UEJA 2OORA 3LZNA 3VTZA 4IJTA 3ZV5A 4MRMA 3TE7A 2EKSB 1KI4A 2CMRL 2XOXA 2IS2A 3MNMA 4MCYB 4JHBA 3GAZA 4MW0A 3DAFA 1YU9A 3Q2IA 3Q8XB 4PTLA 3SB3A 4W5RA 4GR5A 3P45A 3B1TA 2NSQA 3K9QO 4XR8C 3AS0A 1JZSA 4J2HA 4OZHA 4RGOL 4UANA 4OJEH 2DTSA 3NFYA 4QRPA 4FNUA 4JB0A 3SYNA 4IUDS 2UZXB 3INGA 2MHAA 1DO2A 2E7BA 5FYDA 4DDWA 5EMMA 3U17A 2ZXFA 4RADA 5F7EH 2RARA 3RVTC 1EVKA 1OI2A 1JZ8A 5HJDA 5EJEA 4XXDA 3D54D 2J57A 4LF7B 4UCFA 5F7BA 5TDOA 4MDYA 2H3HA 4WO4A 4N0YL 4F56A 3WLLA 5FR2A 2GRAA 3B9RA 4FOSA 5FA6A 3KU1A 3T1VA 2XBTA 4ZCRA 3ES6B 2BKEA 3KDAA 1VJGA 1GC1H 1NDMB 1TJGL 2E5FA 1FV1B 2PR4H 1OTXA 4K9QA 3BUYA 2DD8L 4Y5XC 3GI9H 2EGGA 4MUHA 3FU0A 1H6FA 3JR7A 2WKRA 4XGZB 4I50F 4QBIA 3X1ZA 3ZDWA 4W70A 1BMZA 2FF5A 1LTXA 1JL3A 3S8YA 2VDQH 1A7QL 1XR9A 3W9DA 4PR5A 3EYWA 4V1CI 2HYDA 3MYJB 1JHKH 3U62A 3CVHB 3GIZH 5JH7B 5DUJA 4NQXB 4H25B 2RH8A 2ATAA 2YWGA 2FP4B 1F97A 2VPWA 2P8LA 4G8DA 3UGUA 4I0PC 3LSTA 2K6WA 2YV4A 1S3GA 4QGAA 4RMRA 2RB5A 4XVUD 4GR9A 1I7DA 3WTTA 1Y7TA 3SD2A 3IPCA 4LHXA 2QX8A 3ESYA 2BFEA 3EA0A 4TN9A 4Z78A 1M71B 3LIZL 5F1OB 5IFJA 2NY5C 2YD2A 3RWHB 1HWYA 2DWTA 4NZMA 3QT2A 1UMCA 3SSNA 1HSBA 1C3XA 2DQEL 1CBUA 1HTWA 2RR3A 1LEKB 3FF1A 1R1DA 1TADA 4U3SB 4EVIA 4PYHA 1YZVA 4U6VH 4N4YB 4PIMA 4YLEA 4M1EA 3PD7A 1V11B 4XN8A 3TG2A 1B0RA 1N2CA 4MA0A 1KDJA 3KPNA 1W5AA 3JQFA 1BVOA 3D43A 1RULH 2P77A 2G80A 1I1RA 2H1VA 4ZMOA 1E3FA 5L2KA 4RXMA 4NHCH 4RVOA 4NRXB 2Q9OA 3RA7L 4BVKA 2CV2A 5CN3A 2G28A 2F8XC 4KAFA 4DSYA 3LEVH 3UCEA 4ISBA 5A9SB 5LMUB 1DELA 2ZWMA 2ADIA 1HNNA 1SJVA 1QSGA 2AOWA 1ZSDB 2CM5A 4MXQC 1NBAA 2ROQA 4UATA 1PJTA 2GBGA 3WS3A 3T7JA 3MLAA 5KS2A 5D7SL 1OYVA 3MLVL 4EN3A 2HFTA 3IGAB 1WOYA 4RX4A 1IEHA 3IKLA 5GRVK 1HGXA 4NO5A 3K0FA 1LK0A 5E6RA 2A9OA 4AY2A 1E65A 1OTUC 3I64A 1X1SA 3HUDA 2J8HA 1U8TA 3FOAA 5K99A 2ETVA 4F2HA 1CD0A 3TECE 4OATA 4LF5B 1ZOOA 1C30A 1WTGT 4UFOA 3IFLH 4ZPVA 1F11B 3D9AL 4LV5B 3WKNA 1S2NA 3EFDH 4S2UA 2LNDA 2VCYA 4FZEL 4JX8A 3MBWA 1TKRA 3B2EA 1TLKA 4DQAA 4DLAA 1M2HA 1YS1X 3C8KB 1V55B 4D3ZA 1FDRA 2VJMA 3D39D 4NAMA 1QFHA 1G9ML 2I3DA 1SZJG 1OD6A 1KJVA 3BZUA 2HO5A 1LRJA 2ZP0T 1RR6A 2W2KA 1NRWA 2BVUA 1XWIA 1KJJA 1SBYA 3RYCB 1EWQA 3WNQA 3AVWA 2WINI 2J3EA 2JVUA 1NONA 1FU4A 2O14A 3QZNA 2VTBB 4PJ9D 5BN3B 5H37H 3V4UH 4BWTA 4PO1A 3E3AA 3MMEB 3K3QA 3H4MA 3RVVD 2B6NA 2H1WA 5D1XA 4POZD 4AO8A 1OM3L 2I2CA 1EGAA 4ZUUA 2XX0A 4NZFA 2XB6A 1KBKA 4YQFA 2ZPUA 1P9RA