2VDKB

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 129
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdkB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdkB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdkB03
2WINI 4G1MA 4C29A 4CNBA 2ADFA 3K72B 3ZDXB 3EG9B 1YVPA 1FE8A 1OAKA 1RS0A 1RTKA 3IJEA 2I6QA 3PPVA 1IJKA 4HQOA 3RAGA 3K6SB 3FCSB 4UM9D 2B2XA 4JX0A 3EH2A 4IGIA 5E6RB 4C2AA 3ZQKA 4WK0B 3FCSA 1T0PA 1PT6A 4F1JA 1MQ8B 2I6SA 4UM8B 2O7NA 3ZDZB 1Q0PA 1RD4A 1AO3A 3EGDA 2M32A 2NUPB 4WK2B 1FNSA 2VDMB 1U8CB 1IDOA 4Z7NB 5KYYA 1DZIA 4MMYA 3K71B 3AFCA 3TW0A 5KYUA 1XUOA 4Z7QB 5LN1A 1PD0A 1TYEB 1BHO1 5HJ2A 3ZE2B 3EFOA 5BV8A 5E6RA 3ZE0B 2WW8A 1T6BY 5ES4B 1L5GA 3NVQA 1M2OA 2X5NA 1M1XB 3BQMB 1MF7A 1QC5B 1RRKA 3K72A 3EG9A 3N2NA 1PCXA 2VDOB 4MMZA 3EGXB 3TXAA 5KYXA 4DMUB 3AL8A 3EOAI 2QTVA 3NIFB 2NUTB 2P28A 3K71A 2VDKB 3VI4B 4WK4B 1SHTX 1JV2B 1YVRA 4MMXB 2IUEA 4GZ8A 4O3TB 5E6SA 3BN3A 3OKWA 3EFOB 1LFAA 3QA3E 1M1UA 3OL2B 1CK4A 4M76B 5HDBB 4K3JB 4G1EA 3HXQA 1UEXC 3T3PB 1AUQA 4JDUA 1MQ9A 1U8CA 4HQNA 5KYNA 5KYYB 2ICAA 3OL2A 5E6UA 4MMYB 1N9ZA 2XWBF 1SHUX 4HQKA 3OKYB 1SSLA 3PPWA 1JEYA 4MMZB 5KYXB 2VDRB 1BHQ1 1M2VA 3V4PB 3ZDYB 3NIDB 4Z7OB 3NIGB 4XW2A 4A0QA 1JEYB 1ZONA 3IJEB 4C2BA 1L5GB 1SHYB 3FCUB 2XGGA 3BQNB 3VI3B 1OLZA 3K6SA 1YUKA 2VC2B 1QC5A 2XWJI 3EH1A 1M1XA 2VDQB 2VDLB 4G1MB 1XDDA 4HQFA 2P26A 4O02A 4G1EB 3F78A 4F1KA 4NENA 1SQ0A 1ZOOA 3EOBI 4WFQA 3TVYA 2ODPA 4O02B 1ATZA 1JLMA 1U0OC 5E6SB 2NUTA 3T3MB 3HI6A 1JV2A 4IHKA 4MMXA 1IDN1 1NA5A 3E2MA 1ZOPA 1M2VB 4WJKB 1M10A 1MHPA 1MJNA 3EGXA 5HGJA 1JEQB 4UM9B 3IBSA 3TCXB 2NUPA 3EGDB 1DGQA 5E6UB 1IJBA 4BJ3A 4NEHB 1JEQA 1U0NA 4FX5A 3F74A 4HQLA 4O3UB 3PPXA 3V4VB 3AL9A 2ODQA 3GXBA 5KYUB 5KYWB 3ZE1B 2UZYB 1MQAA 2VDNB 1XDGA 3M6FA 3Q3GE 4FWWA 4CN8A 1N3YA 5KYWA 2VDPB 1CQPA 1V7PC 3AL8B 4CN9A 2NVOA 4NENB 1AOXA 1QCYA 4PN7A 3HXOA 2I91A 4IXDA 1PD1A 3PPYA
chains in the Genus database with same CATH superfamily
3QI9C 5BZDA 2DKOA 3B3GA 3C2SA 4BD4A 3DSFL 4Q3EA 4QRPE 1ETUA 3FN0H 4K94C 1Y5RA 4YQEA 1FEZA 3TJRA 1TU3A 4JR2A 4NP4L 4YFYA 1Z0UA 4TMWA 1ZK2A 4NUJB 2X3CA 2FCRA 3GNTA 2BC4B 3FHCB 4IH4A 1NOFA 3MLPA 4HPOH 1FVDA 5EU3A 1R4MA 1M0TA 4DEYA 2P30A 2XX3A 5C8XA 3QEUB 3FPFA 4S2SA 2OR9H 3VFVB 4N3CA 1ZD2P 2FUG1 1DZ3A 5JR1H 3K92A 5C1OA 3Q3EA 4G0PA 4F6CA 3NASA 5DN9A 3H2ZA 3GBSA 2IXDA 3OKYB 3R06A 2UY6B 4MVBC 4A1RA 2HX8A 4R7GA 4JB3A 5IKCB 5TF1L 4EDWH 5LYJA 1U8HA 3EFDH 5G40A 4RK6A 3G6DH 1NI5A 1ES0A 5I1LB 1ZKMA 5DMGD 5BSUA 1KAGA 1JKIA 1VGEL 3JSXA 5C3IA 5IV2B 1H0KA 1ZGJA 3OI7A 1PKQB 1JLHA 3B6IA 1M10A 1JHQA 2O5RA 4KYIB 4LZKA 2JJ1A 1SBZA 3IMCA 2N0MA 4B7LA 5FGCE 3WNKA 3LB6C 5BVJB 1OHHD 1FNSL 3N5KA 2C2HA 3SCMB 3C15C 1FDIA 2YN2A 5L3QA 1KEGH 1ZGLP 1ORHA 3LZ6A 4UUBA 1OI4A 1RXEA 4BUCA 4J28A 4QZVA 1OAKA 2ZWIA 3QV2A 1KDTA 3G2KA 2CFSA 3FJTA 2R68A 3UP6A 2VDLH 1PWEA 4JVNA 1JVNA 2DQ6A 4QNNA 4AIEA 3H4TA 2Z1KA 4MX7B 2JIQA 4D02A 5C37A 1T5XA 1ISJA 2X1WL 5H4ZA 2E1RA 3EXIB 5F89B 5JMOC 1VHWA 3LA6A 3NOQA 4HH3C 1PG0A 5C0AB 3N44F 3VTTA 4O2BF 2PS1A 4Y3UA 3GLGA 1E1MA 2GK4A 3U1SL 4U0JA 4WBXC 4KVCH 4US2R 5DR5H 2SKCA 1G7QB 5EHGA 1FMCA 4AG5A 2OTUB 3OIWA 5IB3A 2JFFA 2ENSA 4YL4A 4Q6KA 3MGGA 4HG4J 1QUPA 1R5BA 3UJIH 4PRPA 3BIAX 4LYHA 1BS2A 4OFZA 2PUEA 3HNVH 1KP9A 2CVZA 4DHEA 4P2QE 4L75A 3U1VA 1OXKB 2VLBA 3LXXA 4R2HA 1VKXB 3VX1A 3AF0A 5KBLA 5T1KD 12E8H 3PQYE 4WEQA 4Q9QH 3FUVA 4K9MA 4EAEA 5JS1A 1OT2A 3R8BB 5I0ZA 1LEIB 3S2GA 3K8QA 2VJOA 5LLTA 1IQRA 3PPXA 4Y0GA 2X7LA 5ESAA 3C74A 4YP9A 5FTLA 3K70D 4JY4B 4PR5A 4LK3A 2WNSA 2NXCA 1GYVA 4PAMA 1GGIH 3X14A 1AXTL 3FTSA 3H9SB 5DIFA 2VUTA 1KORA 3X14B 2ZBGA 5AP9A 3MCLH 3AOGA 3CX2A 1U92A 5EEZA 4EMSA 2EEPA 1FDTA 2HGZA 2R48A 1BFOA 3GWJA 4I18A 1SUIA 2GXUA 5IM7A 5CR9A 1DBPA 3NHBA 3DV6A 1XTTA 3OKKA 2O6CA 4C4BA 1BMDA 1DZ0A 4BZ1A 3FSWA 3U5ZB 3IVKB 1UQSB 1IBLB 1ZM3A 4APXB 2I7XA 3IDMA 5B3LA 2OC4A 3WOHA 1WMDA 5D00A 1LP9B 3N2NA 4NKRA 1NCGA 2BIPA 4JFSA 3GRUA 1TZCA 5E2WH 1TRHA 2PZMA 3NUQA 4BATA 3FH7A 1JV2B 3KXFD 4AJOA 3TN0B 1Z6TA 1BXGB 3AB8A 1R10A 3PDIB 3HWX1 1OE1A 3BZUA 3LT4A 1RC8A 4F20A 3NBXX 5E5MA 4N01A 2J4WL 2L4OA 1I4DD 3OUUA 3ZOKA 4U49A 3L6FB 1JHMA 1BOGB 5IT4A 1UK8A 1YK1A 4PWKA 1QSEA 5JJ5A 1DTWA 4JSYA 1D4OA 2IHKA 5L2KD 1P74A 3R3VA 2CHXA 2V37A 1K5WA 3A2NA 5IYZB 1ICEA 1YY9C 2AJ3B 4UHEA 3P2YA 2NZJA 2AI2A 3WWCA 5FECA 4IK7A 1TJPB 3EGDB 3MHZA 1CB0A 3Q7SA 1A6PA 3OKYA 1EB8A 2O2HA 4J6FA 1KSJA 5DHSA 2IJGX 4LFBB 4J0DA 5BYBA 3ZC3A 4TUYA 1UMDA 3H4IA 4JRYA 4H1LA 2C7GA 1PUXA 3LA8A 4MS3B 2ZROA 4JKPL 3DL7A 3Q7QA 1BVLB 3WFEL 4NLAA 4P4TA 4PBSA 1XKQA 3KPRD 1D5ZB 4TKUB 2PRJA 5TR9A 2JFGA 2O8FB 5D1QD 1PLJA 3WX0A 4DC9A 1BD2D 1DQPA 3FF7A 3RI3A 5ARBA 1PW7A 1N8TA 4APQD 3KZKA 2PNJA 4CIDA 2PYFB 2A94A 3MD9A 4V38A 1YO4A 3WE7A 4R0LB 1GYPA 1QZUA 4TQHA 1OW0A 1HH4A 3QUBA 3OXRA 1F4XL 1B93A 2CK0L 3JRNA 1V25A 1W5AA 4XNZC 4XNYL 2DFTA 4Y2QA 4M5YH 1K4DB 4HS3B 3BAYA 3DFKA 4B6RA 1T0OA 3FUFA 3OBIA 5JZMA 2WHRA 3KLPX 1G4HA 1QRAA 3O3AA 2JDIA 4ICXA 1P72A 1X80B 3HFFA 1BWMA 3ISJA 1T24A 2QTNA 1WA5A 5E4EB 4YWGL 1S2EA 2ZSFA 1FFPB 3SKVA 4EHDA 3L0BA 4TVPH 2MYUA 3SE4A 3TYXA 3EZNA 4OA8A 3TOSA 3MWJA 2VP0A 1ZK0A 1X77A 3D0AA 2CHWA 3DHJA 2VJDA 5AUPB 3I3BA 3AUYA 1IG0A 2QP9X 2Y1OA 5ESXA 2C61A 3I52A 2B2NA 4NKMA 1MG3C 1QD0A 1BXRB 3OGCB 2CO7A 2XF2A 3WQBA 2AC4A 4UTCA 1Z3RA 3HJFA 5G5DA 1U3YA 1OAKH 8LDHA 4HXGA 4DRXB 4JDTH 4X7BA 4ZMRA 1BREA 1YEKH 5FOJA 3A3YA 3MPUA 3U44A 2J07A 3S88H 1KDJA 3GSNL 4O2RA 3T0WA 2X4PB 3B83A 2YIVX 2A2ZA 3PUXA 2EFYA 3LTEA 2F58H 1UIMA 1DJWA 1IXRC 3SC6A 5A71A 1RHUA 4GG8B 4AKGA 5AYVA 2QGCA 4K9KA 2NW3B 5BV0A 1KBVA 4KVPA 3MRXA 3G5YB 1RI1A 5J6HA 4GP6A 1Y7LA 4QTXA 2UUBB 1IBBA 1DT3A 3K96A 3Q13A 1Y81A 2BP0B 1MHPL 5FWXA 3FKUS 4QDXA 1QQ5A 1HE2A 1WVIA 3O3OB 4PHXA 1G6RB 1JTOA 1X7SA 2ADJA 4H0GA 2DBLL 4M6OL 5CXSA 2N7BA 5GONF 3OB0K 1QYRA 4B3SB 1KGCD 3V10A 2OD2A 1YS9A 2B5VA 1OGAA 4NMWA 4F1KA 1I3UA 3H11B 3VNVA 5KJEA 4RZQA 5FTMA 4JSRA 1P9RA 5DJAB 2A4EA 3TCLA 2Z04A 3O3CA 1NDTA 3GNSA 4X9FA 1HKLH 2YARA 3KSMA 5LOVB 2XOEA 2JDID 3LUPA 5DK2B 1M5RA 4LEBA 5CA1F 1KCSH 5CCXA 3U46B 2PGIA 3U49A 4JFVA 5TEWA 4UPDA 2EVHA 4Q7EA 4KH0A 2XN1A 4Z8XA 3QPKA 1GZVA 3VPFA 1FNNA 1QWSA 4LNRA 3LMKA 4WW1B 3JARA 1U8LB 2ZF8A 1P4RA 1J2TA 1P5UB 4WGGA 4J8RB 2N7SA 4RSHA 2OCJA 1DEDA 2QFPA 3WGOA 3E5NA 1WBXB 3G5XA 1FAKT 3EIFA 1C5DA 4M00A 1XMSA 2I2AA 3DE1X 1P7HL 1X4XA 2CR6A 2WWHA 4GBGA 3MLZL 3ET9F 4DV0B 4ODIA 3INUH 1MFZA 1XCTB 1KWKA 4ONOA 3DA0A 2QOEA 4O2AF 5JMRA 1OTUD 4M03A 4GWGA 3E03A 3J7TA 4FFVA 4G67A 1PCXA 1AGNA 2Q5EA 1A1OA 3IUPA 2VDKB 1KEEA 1M9SA 1QV7A 5FO9B 2C97A 1QQDB 2MOQA 1P17A 3VG0H 4K8RD 1Q15A 2HCBA 5REQA 2WZ0A 4RLFA 4MEBA 4R31A 5G0WA 3RJ5A 4OHOA 5IQOA 2C9XA 3WJMA 2Q21A 3BFKA 3TBVB 3RHZA 1NCWL 3MC0A 1N6PA 4OJKA 1XZNA 5T8IA 4H77A 3GRFA 4M3KB 2P9BA 3AHCA 3NESA 2ZXCA 4ABTA 4G9FD 3QJOA 1L5OA 1E4YA 3VHQA 4U6HB 2W6JD 2QAJA 2OMVB 1T0HB 2I7OA 1U0NA 4OH2A 2XRZA 4BM7A 4PC2A 3CLFH 1ZHKA 4Z9YA 1NL3A 3RUAA 4NNYA 1ZH4A 3SSOA 4OXKA 2Z92A 1HAUA 5DC0A 5DXWA 4XTCS 1K9VF 4MCZA 3GLKA 1FDLH 1EGMB 1FL3B 1HESA 1U4NA 2H51A 4U1IB 4AEHL 3WNZA 1AJ7L 3PREA 5LQDA 4GHWA 2AQ2A 4AQEB 2VM3A 1J8YF 2ZAHA 2VDRH 3DIFB 3Q8KA 4OCSH 3JV6A 1XF4B 2X6CA 2P9YA 3OQ1A 5GGUA 4GMKA 4XPHL 4C7KA 4OZFH 3MX0B 1J9ZA 2IH1A 4I48A 1QGDA 1U95A 1T4CA 4Q1FA 1EGJA 3K1AB 2ONKA 5ID0A 5EUOF 1ZIYA 2ZB4A 1FZKA 4IQHA 3ZI4A 1FXWA 1EAYA 1H69A 1WU8A 2CA4A 5DUBA 1BCRA 2WQ7A 5CVUA 1XMEB 4DDKA 3JWJA 3ZKWA 4X7SL 4J49A 3ARDC 4ZT3A 3LN4A 1S02A 1CJSA 1IJNA 4ETNA 1ENZA 1I2BA 2OLJA 5HDWA 1XF2A 2NR6C 4K9DA 1KGJA 1JDPA 3OA0A 4TV8F 5BMFL 3IPEA 3US0A 3B1VA 5CRIA 3GMPB 4OD3H 5DM1A 1UPFA 4JQVC 4CJ1A 4U6YA 1U2CA 2W07A 3L3KA 2C5BA 4Q82A 1XR8B 3GSVA 4KIFA 1I9IL 1EDYA 3IFSA 3QXHA 4TLEA 3HB7A 3D3EA 3ZKQD 1NT2A 1VERA 2NU6A 3TLMA 1UODA 3GRWL 4U7TB 4YQXH 1DPFA 1XU4A 4AZTA 4HLCA 2ZJ1A 3LWDA 3T9CA 2I2FA 5FAXA 5CEZE 1H5BC 4LL4A 3S97C 3QPUA 2WNXA 4NO5A 1MCIA 2B14A 3IK2A 4B0PA 4BNNA 1BVUA 3H17A 1AOZA 5K4HA 4GO9A 3SMQA 3H9UA 3GI8L 3ZE9A 2E89A 3WJLA 4C4OA 5BQ3A 4LRIC 1KP3A 4AG4L 4X85A 1RWPA 3TKYA 5F78A 3B89A 6REQB 2XJKA 2JIMA 1GL7A 4ESKA 1QP4A 5GJSH 4JB8A 5ERWB 3AUSA 4XBEL 1FB5A 1FLDA 3DX8B 3KKQA 3JAWA 1WZ1H 4A5SA 3MROB 2GXAA 3L7MA 3WYGA 3M6LA 3A1UA 5IXJA 3K9GA 4D0NA 1UBGA 1QFJA 1P4IL 4F7DA 2XMGA 3D2CA 3KWLA 1JAEA 2F18A 2V1XA 4Q9LA 4Y2VA 1A8PA 4ACTA 4FGUA 4P8QA 3SZOA 1FG2B 3V8MA 1XJQA 3VQ1C 3QVGA 3WTBA 3AG4B 4MYCA 5JIDA 4KVFA 1EUUA 1AQKL 2DERA 3PNSA 2MNJB 1YI8A 1OT5A 4YL9A 1KF0A 3O81A 1F11A 1YY9D 4W5QA 1HOXA 3BF7A 4HMDA 3BXHA 4LZOA 2IK8A 3BEVA 3SIXA 5AVYA 1JHRA 4KBFA 4Q4AA 1LDYA 5EN3A 3ARXA 3F73A 5JDIA 3F7LA 3CCHB 1U7PA 3LQ2A 1JWSB 2OYMA 3NVQA 2FX9H 5CD3B 2H8GA 3L0PA 4IIBA 4NYMQ 1P2BA 4JFEE 3JTTA 1A5TA 3V6ZA 1AGBB 5IC6A 2BMEA 4C6HA 1JQLB 2JVKA 1NMQA 4TUJA 3DKHA 1IAQA 3LC7O 4JODA 4GRMA 1K3FA 3E6HA 3FFCB 3ET4A 3HOGA 2PRIA 4FI7A 1WY5A 4MKRA 4IRZA 1SN5A 2WABA 1E0DA 5LNK6 1U3NA 4RLHA 4RTNA 1P5VB 3NX4A 4KWIA 4RDHA 3SGEI 2BH0A 4GOND 3EZ8A 1KAEA 4QULA 4QM7A 2VYVD 1D9KD 3ZXYA 1JNLH 3CV3A 2AOUA 3T1NA 2R6JA 2VATA 4KJXA 5E0QA 4RJIA 3SN6N 2HL6A 4QPEA 4K9RA 3T2QA 2CNYA 5DTRA 1U28C 2SHKA 3ZG6A 2N1BA 4KXWA 4Z7WF 2X0DA 4DVBA 4F85A 1WDAA 4ZK8A 1QONA 1QEWA 5FUOL 2PO5A 1Y7PA 3U7HB 1B0GA 4GSUA 3PGXA 5F2NA 4YAQA 1U0FA 1RKUA 2CKDA 5GONB 1UMBB 4J7UA 2FEEI 3QPDA 1WWKA 4D9GA 2XMPA 1IQDB 1RM4A 5E9DB 2NDGA 4PPQA 3Q8WA 3K70B 4GLJA 4FNOA 5JIMA 1AANA 4TTTS 3RUEA 2QTAA 4G5GA 3MJVA 2ZT6A 4PJEE 3HBGA 1IDOA 3GGCA 2ILTA 4CM4A 4YJGA 2BZ1A 1HL9A 5C86A 4L8SB 5CFRA 5DVPA 1JE6A 1K4MA 4C47A 4G70B 1PY4A 2YVQA 3DXYA 1GFIA 2HDOA 4YV7A 2VXQA 3IJHB 5IB5B 2BFVL 1JJVA 3QTLA 1ZE3C 4S0XA 4UNVA 2PSSA 2ZKLA 1NI3A 2J88H 1URZA 5JJLA 4L3EE 4LNHA 4O58H 3BZEB 2OL3B 3A27A 1Z5OA 3R20A 2B8JA 2KMLA 1KXQA 4EF6A 5F23A 4TLBA 1XTVA 4UHCA 3BDYH 1BKSB 5I8CB 4UCQA 3CEPB 4CGTA 1HRKA 4W82A 4OHWA 3KLAB 4S05A 2H8KA 2F4NA 3C9NB 3TVYA 1JN6B 3WL3A 5KNBH 2WJZB 2WTMA 2PGDA 1BQ4A 3OKPA 4MZDA 5PGMA 1M1YE 2BGMA 4UD2A 4EPWA 3GLHA 3X1FA 3O90A 4JU9A 1LO2H 4B3FX 9CGTA 2ZJBA 4UQBA 2IGFL 2WVUA 2PKEA 3DOCA 5IW3A 1EVQA 4ZX4A 3MV7A 1Q1NA 5DW3A 2HFEA 2H0PA 3MSCA 2BZSA 3HHSB 4JZOB 1MCJA 2ONYA 1ORDA 4QYOA 1UFRA 3N42B 2P44B 2ROQA 5KVQA 5KSAA 721PA 4OZHF 1I1YB 1FDWA 5HIMA 4GI3A 1M2EA 1MHCA 3FSJX 1Y8QB 4HKZA 2K70A 1XMOB 3WENA 2I66A 3O4OC 2HJKB 2F1RA 2PFSA 4Y6QA 4ES6A 2H1VA 1AB5A 1CHDA 1UOVA 1H5QA 3AG3B 1Z9SB 2FFRA 4MRMB 1TDJA 1W6WA 1CZHA 4TMVA 5JQ6H 5E6IB 3FOEC 3X1JA 1PZFA 4AENB 2P7TB 1YZGA 3QX9A 1OBVA 2PWBA 3IAPA 2I6FA 1SCUA 2X5KO 5A4IS 2QRZA 1ORQA 5D70L 1YC5A 1GPBA 2VDRL 2IU0A 2H3KA 3T0AA 4MIEA 4K6GA 1JPUA 3BSYA 4C76A 3IV7A 4G42B 3LYRA 4K5MA 4OGYL 4LWQA 1CIVA 2TS1A 3DWFA 2QGEA 1E96A 2B5IC 3FQ2A 5GSVA 4E1BA 3LZFH 4OCZA 1J1ZA 2A9AA 3O8XC 4NKOA 4ZA2A 2Y1FA 2MQCA 2YGOA 3D7RA 4PX5A 1PR3A 3HMXA 4LU5H 4F8QA 4KAJA 2XVLA 4OIAA 1BGXL 3RDJA 1MKYA 1IQWH 1ZK9A 3NP4A 4K6OA 2R97A 4YDQA 3X44A 1PY0A 4BP8A 4S0ZA 4ZVKA 2BEJA 4M9XA 1IXSB 5G4KA 3FGNA 3SC3A 2YUVA 3D02A 1WB9A 4X8LA 3SQRA 2JF0A 1N5KA 2GA8A 4X6EB 3C6EA 3K16A 4G6ZA 3UH1A 4RSYA 1HDMA 2ITFA 1N18A 1XWVA 4I18B 4UXIA 3CJRA 2H7XA 4IRMA 5BMOA 3MJ7A 5DQJA 1N6VA 1SUEA 3TLAA 5KEIA 3HKFA 4WHTB 2FP4A 4K2HA 3TO4C 1Z0SA 3ASWA 4BGDA 3CD4A 5EN4A 3BQMB 4HU2A 2W4QA 5J40A 4E32A 1BFKA 1D5WA 1ILWA 2ZS8A 2P0EA 4QUEA 1UQTA 4L23A 2VAJA 4XI9A 3VCLB 5DYTA 4RPKA 1LFAA 1MOSA 2WJVA 2YPVH 4O2AB 5CT5A 2MU1A 3ZQ9A 2UUDH 3CFIC 4IZ6A 1HQRA 5DURB 4RBPH 2FZ5A 4Q21A 3ETBJ 2I33A 4V3BA 2AS0A 1XC7A 1W25A 2IV9A 4FHKA 2QN7A 3FCUB 2NYAA 3UT6A 2OMNA 2XZDA 5GSRB 1V11B 5HJGA 4I0CC 3ZDEA 1JS1X 1CULC 4ONGL 3NJLA 1JLMA 3QDJA 4LBVA 2OOSA 1L7TL 2REBA 3G9AB 2VHXA 3S3PA 4LKOA 4N8UA 4N9GB 1KI6B 4BNXA 3KSBC 2AQNA 3APDA 2WGXA 5JPMB 3QYFA 2YR3A 1SLWA 3GLGB 1T9AA 1A7NL 4Q1VA 2Q2QA 1QP1A 2B1RA 4OHFA 3LKQB 4JFDD 4L8DA 4D26A 3TNYA 1LSJA 2GF0A 3LHKA 3IIKA 1QP0A 1USKA 1E42A 5F7EH 2I07A 3DO8A 4IOSD 3V6OA 1DVFD 3OPUA 3UPUA 4Q6YA 1RR6A 1ET7A 3OJ2C 2E7LC 4A7TA 2ZI3A 1NMYA 4B8ZA 3CS3A 1MT3A 1NVVQ 4BZZA 1JNHB 3BFOA 3RYMA 3M3DA 1B8VA 3EVDA 2ECPA 4RTLA 2NXWA 5BQDA 3CUWA 4X7DC 2R4RL 5BVGB 1VG8A 4XVUA 5ISZA 5I0WA 3JWNC 2KI5A 1IAIM 5AKTA 1E1LA 1P6WA 2ERJB 4P3CL 5BWNA 1O8CA 1AG0A 3MC1A 1ODCA 1TVDA 4PPTA 2I5PO 4R01A 2HMAA 3SE6A 3QFCA 3MJWA 1NXOA 4FJ2A 3FTEA 1KAQA 4JFDA 2VQUA 3IF1B 1VOTA 5I15H 1Z5VA 1YQDA 1D5XB 5I18H 3T1WA 3I9LA 2BJML 4HDKB 4QUJA 3R3JA 1KIQA 1ZDQA 3KC2A 2E48A 3E5HA 4X6CE 1WQ1R 4W5RA 2RHMA 5LBUA 1U91B 1MRDH 4C05A 2YFNA 5IMBA 5F7LB 4FMVA 4IBLT 3V6FA 5DO2C 3W5VA 2H1LM 1AC5A 1H2RS 2X4TB 2H5EA 4PJBA 4Y88A 2IS1A 3MJ9A 3K4DA 1Z3CA 4ZV9A 1CNFA 3VVMA 1MPXA 2BNRD 4GR5A 2K8MA 2C5GA 2CLMB 1HDXA 3U2IA 2EYQA 1I7PA 5L88L 3PXAA 2VNIA 3E2HC 1KB5A 2R8OA 2I24N 3B2VL 5GRJH 1Y18B 3IEIA 1EU1A 3LKDA 4DAOA 1M6VB 4YE4H 3VU2A 1UP6A 4G8FA 4M29A 5KPDA 3PYCA 3EQ8A 2XUOA 4LQFH 4Z2AA 5JEDA 1PV4A 1CR0A 3DG9A 3FSGA 5CYFA 1UJ2A 4FD3A 4A38A 2VMCA 1A71A 3WO4B 2HD4A 1YRWA 3P5SA 3M1BB 1PLGL 1CUUA 4M7KH 3ZBTA 3FWHA 4ALLA 1D4AA 2PTTB 1JHAA 1Z9LA 5F9JB 4LBZA 4WAUA 3D6JA 4AZVA 4B4WA 4B3MB 2NNCA 1A7QL 1SOWA 3D0LB 1SLXA 4I9UA 3K8ZA 3TA3A 2V55B 5M5BA 5CEJA 4NE9A 1WBZB 5JW3H 3I0MA 4XIIA 3NH9A 2BP0A 4GY4A 3OE1A 2ID9A 2HWZH 3N07A 3QEOA 3AWGA 2VAPA 3PQ2A 1LX7A 3PHBE 4DDTA 4LHSA 1ORTA 4QUGA 1ZHBA 3GEPA 3F7TA 5IBLC 4D9IA 4XASA 2OJEB 2AABH 4H8WH 1O9VA 1VCMA 4Y98A 5CJPA 1U3DA 1W15A 3SBXA 2GZMA 1ZRNA 4MARA 3ZE1F 4BGUA 3HA0A 3OLVA 2F2HA 3JYCA 4X4KA 5AI6A 1SLVA 4OIFA 3F71A 5AW1A 2AN9A 2NYVA 1YZZA 4BOYA 2ODQA 5IT2H 4TKWA 1GKIA 2NY4D 4Q9KA 1NR7A 3OAAA 3R5SA 1J70A 4P3DB 1UM6L 5ANME 5D93C 4I4IA 2Y0CA 4C78A 5F0MB 3BP4B 4AVHA 4ZWNA 5E08L 1KDYA 3LO8A 1BM7A 3WFBH 1PR2A 4XCCH 1Z0AA 5I0YA 2FX3A 4RVSA 4I3SL 2EKJA 1H2WA 1ZAGA 1NUTA 2HPTA 1T1GA 4IBTA 1OI2A 1FORH 4GI1A 4F8OA 4IMKC 1IT9L 5F7AA 5JW3L 4J6IA 4YP7A 5CTAA 5BN5B 3WIFB 4FP9A 2BKLA 2EXTA 2I6UA 4HIIB 2MWMA 3VXQA 1L7OA 2DM2A 1VGKB 2P24B 2PBRA 1T2UA 1GJRA 1V95A 3U6RB 1YZYA 3O82A 3PBKA 3S2UA 3SI7A 1N9GA 4H17A 1JQEA 2VLJB 3PHOB 4RAHA 1FFBA 3HUJB 2P77A 2NYYC 3IXMA 3KR1A 3KWXA 5EOCL 3RAJH 2E82A 6GPBA 1B0PA 1B0WA 3QSKB 4PFEA 1C2YA 4M02A 4YMWA 3DK2A 2R69H 1LH0A 1OXSC 5FUWA 4KKAC 4K5NA 3SZLA 5CMAA 2CDGB 3D4PA 3P9PA 2EKPA 4OYLA 4OQTL 4Y4FA 2WD9A 1TK2A 5E8PB 1HQRB 4FXGA 1V05A 1JI0A 4HV4A 3TYGL 1WFMA 3GRRA 1NUGA 2C1PA 1Z2PX 4J3FA 4Y9SA 4W9EC 2V5YA 1XVTA 3NXSA 2OZ4A 4DQKA 3V5HA 4K9NA 1N5LA 1N36B 1NAKH 2AK4A 3ES6A 3ENEA 5JORA 1JHTA 3HE7D 1HK6A 4MJHA 1TD9A 3K4PA 1U58B 3BP6A 2CHGA 2PUHA 3CFBB 1ORQB 4IKNA 3P4MA 4GBXC 4FC3E 4PNEA 3P4MB 1XALA 3IXAB 3GD5A 3TFQA 1CC1S 1WP9A 4FIDA 4NOMA 2EIZA 2W9EL 1BXZA 5GJCA 5C6PB 4O2FA 5LGKA 3LRSB 4K9EH 2LP4Y 3D06A 3ZWAA 4RD2A 5BSGA 5TVGA 1G94A 3N85H 4GS5A 1T03L 4O1IA 5HIJA 1Q5PA 2G4EA 3CZ4A 1G7IB 2LUOA 2ZUXA 3WGGA 4KC3B 5TPWB 1T2DA 3MAGA 2Q50A 1I1NA 4R05A 3X1DA 1WCIA 5KJRH 3BVXA 1WOYA 5EEYA 3MJDA 1EZZA 4LAFA 4PG9A 1CUAA 5DYOA 3OTWA 3JWHA 4NCHA 4QASA 4NTZA 5BQPA 1G9HA 1PZ5B 3VDXA 4QQNA 3G7NA 5BZZA 3C6ZA 2W2KA 5IUSA 3TQIA 1R3JA 3ETBF 4CKQA 1GQSA 2WMOB 4HAIA 2ZCLH 1RQ5A 1DANU 4C58B 3QAQA 4PVBA 1MAHA 4GAJH 3MHTA 2W0FB 4R8WH 2LVBA 3CLTC 2R23B 1A5FL 2HJWA 4XQGA 2GAIA 2PVCA 2H2HA 4BYHA 5DD5L 4CLHA 4D6PA 3LHPH 1IEXA 1PKOA 5DX8A 4FJ1A 5DQJB 2VE6B 3ORJA 5D7KD 5LMUB 1AK1A 1MWOA 2B9VA 5FIEA 2VH1A 1GAXA 2DQDH 3JRXA 5HHXL 7MHTA 3O92A 2DH3A 2X23A 4E9QA 3ZKXC 4N2BA 4JJIA 4U00A 4HDQB 1A4KB 5D1XC 1I51A 2HCRA 1T1YA 4GT7A 4JVOA 6PAZA 2VI5A 5L2JB 1Z6JT 1RW4A 4FR2A 1U9YA 2NSDA 1Q0RA 3GZNB 1A5FH 4ODBD 2WQVA 2ARKA 3SDSA 2QAIA 3GO1L 5KSUA 1YFZA 4ZVUA 5CVEA 5C0BB 4AYDC 4PYRA 3BFJA 5TMEA 3U2SB 5L9AA 4YGYA 2OMTA 5DURD 4UTAL 1G291 3B3JA 3QUXC 3BKJL 4UQ3A 3U36A 1I7LA 3OAZH 2OMZA 3QSYA 3T38A 1LW7A 3QDGB 2CDEA 1L2TA 1KGWA 1GA2A 3NNSA 2GPYA 2PZEA 4RZ2A 1FUUA 2H06A 2CYCA 4J29A 1N6RA 3BPLB 1VJGA 4RAUB 2CGRL 4LLVB 4APXA 2CALA 2K6WA 1L0QA 4OGQC 3K2BA 1EHNA 4ZDWA 2CA3A 5EDSA 3LIUA 5JCZA 1UADA 4ZOAA 5DS1A 2C7UA 3VQTA 1ZINA 4PREA 4F8NA 4JFFE 4O5OA 1QO3B 1W85B 2VK1A 4AZUA 3DPUA 3FXAA 4MOWA 1TO1E 2HKHH 3QWOA 4APQC 4AH2B 2H48A 3U7YH 3VQ2C 4M0KA 2GJ6E 4IOFD 1H15B 3VFNA 3KL0A 3H2GA 5CBEB 2A9RA 4NX2A 5DMYA 1O9HA 5TMPA 5E8PA 2OBMA 2IPTH 4B6GA 1SVCP 4PY8J 3D07A 3N41F 2VEDA 4UAGA 4J4PC 4X6XA 5DHYA 2V9ZA 2IF0A 2VDQH 4EPRA 4RA0C 4L74A 5ICFA 3KUUA 3U61B 3EGDA 3MUZ1 4DGWC 3W4IA 1OEZW 3U4IA 4NU8X 2P35A 5FA3B 2EIEA 1BCSB 1WSAA 4DESA 1FMFA 3WO0A 3PHAA 5IRCD 1MW2A 1NGZA 1FL6A 3FB6B 4YFEA 3GSRA 3ZVRA 1OX5A 4TN1A 4BNKA 2V9UA 4H8QA 4NN5B 3DFIA 2IBGA 3GBVA 3A0OA 5HA5A 5AXCA 5TJ9A 1H19A 2VUOA 4AY5A 2BEUA 5F6HI 2IE8A 4NZRH 1YVRA 5KVEE 1Q9KA 4OHPA 2OL3L 4BNZA 4KMLB 1SQSA 5HE8A 4G8IA 1YEDA 4L2YA 3VB9A 1ZR2A 3U4MA 1KY5A 4L95C 5FYKD 2VA8A 6PFKA 5KREA 4IJQA 4ANVA 3IMUA 3ESYA 4GRDA 5TC4A 4KUCF 3E3NA 4W5OA 3BAEH 4MB4A 2O93L 4ND2A 3M1BA 3US1A 3KKKA 3Q40A 3I75B 1IC5L 4C21A 1FFNA 2ED7A 2PJDA 2GYYA 2ECQA 4G63A 1MJ8H 2GLTA 5BVPH 3PWZA 4E2OA 4QM6A 1UMCA 4Y2GA 3KLHD 3N8IA 5JQGB 4EFDA 1AHWC 5F3FA 1MCNA 1N10A 4P5TD 3OG4B 2CE2X 3T0DA 5CYGA 4AOFA 4I8XA 5T5FH 1OLUB 5F7KC 4TLLB 3CE6A 3BGMA 3WXVH 2GRUA 2YD9A 1OKKD 4KPUB 4DOHB 4C88A 4ZJ9A 2FWOB 3U9UB 4TMTA 3RT7A 4XEHA 1LD9B 3WHE1 3W2HA 4LDPA 3PNWA 2IPTL 4KFMA 4YHPA 4WN9B 3CVXA 1U2QA 4CEHB 1EXDA 3GUVA 2ZE8A 2ED6A 4WPGA 3DLPX 3DTVA 4KK8C 3R4DA 4PJXE 1SXJA 4MQ4A 1OTHA 2JJYA 2IAMC 4ZO4A 4IEIA 3JUZA 3IH5A 4JR9L 3MRPB 3O4GA 4JBSA 1AD9A 4P86A 2WM2A 4LRXA 5DGHA 1A4KA 3N06B 4ZU6X 4HB4A 1E6LA 3DC2A 1J0YA 3R4VA 35C8L 4GAFB 1MNUL 4PTYA 4XFDA 4NHEA 4P92A 3DEKA 4P2YA 3MRJA 5FV1L 5K01A 3AU8A 2CBXA 4TLKA 4N2DA 1UD3A 2WIAA 1Q74A 3B5GA 4AXBA 2YPLE 5IBCA 3VFPB 4ARVA 2X0FA 4QU9A 4X99A 4FNUA 4M0UA 3PR1A 3G02A 1J05B 3OZLA 3LQZB 1A8HA 2R23A 3DSFH 1JEEA 1E2FA 4UDTA 3LQAL 4HH4A 3AAZA 3OJ0A 4KMTH 4J4HA 1VJ1A 1YHNA 4TXHA 3OR7B 2UWEB 2A99A 3D8UA 1KLGB 2FP4B 3EMDA 1E6UA 3P9SA 1UQRA 3AKDA 3FQNA 1S5PA 1XXHE 2H2WA 2R2HB 3BESR 3ZT5A 5DMKB 5J5VA 1RBQA 4NBZB 1I7TA 4FQJL 3HCVA 3AV0B 3QEQE 3L3DA 5AVXB 1MZYA 4KLRA 3IJEA 5ADOL 3DVAA 1AMUA 2WIIB 4H1HA 3IMEA 4Z0XA 3PC3A 4HIEB 1U8PB 2ZTUA 4M86A 4ID9A 3WY9A 4TMFA 3ETSA 1MA0A 1BAPA 4ZAKB 2C8JA 2R59A 4Y19A 2P11A 3NKVA 3ULUH 1RWVA 16PKA 4MA0A 3NBNA 3R0ZA 2WVVB 3AB7A 1IWPB 3VGDA 2CNDA 1SPBS 5DW0A 4ZARA 3BZFB 2JWYA 4DTIA 1E6CA 1MF7A 5I1AB 3V0JA 5J1AB 2QDKA 1LV7A 5EIIG 1NZDA 3KT0A 4OB8A 5A1JA 1XCQB 3IR5A 2IS6A 1H94A 4LHXA 1CUGA 5IOPA 4JY5L 4Y89A 4P5TC 1JTTA 1W2GA 5BWMA 3A11A 1RI2A 4LSRL 2HX9A 4AIZB 1JDBB 3VNRA 3HE6D 4PJHE 3RP1A 2AUMA 4I8IA 3CAFA 1SCDA 2GVYA 3PPSA 4RCZA 1XCMA 1I1AC 2VM4A 4KG7A 3HXLA 1UZLA 4QDOA 1HZZC 3PXHA 1IM3D 4FHFA 4XMUA 3E8XA 2P9GA 1TEGA 3A67H 4NZFA 2QKIA 5A1TA 3U46A 3AKZA 2WCPA 1ZNYA 3DRTA 4HIHB 3VXTB 4HC4A 1XZCA 4DCUA 4YJDA 4LNVA 1XTIA 1KPIA 2YMMA 1QTNA 3FUMA 2R9HC 3FA2A 3NT0A 4HHAA 1AN0A 1E2GA 2MCFA 5CCEA 3UF0A 1QX1A 1G7IA 1I7ZA 4BCYA 5E8DH 5A3SA 1TU2B 3FB7A 1PWXA 4LTDA 3S34H 1FF9A 3RC2A 1HMYA 1K5PA 3S3DB 4IIJB 4RQTA 4RELA 2V6JA 2PX6A 1Y1DA 3B9PA 4XE5B 1L9RA 5LLSA 2H3HA 1EZUA 3EG9A 3ZV7A 1Y07A 3F46A 3RRFA 1U1DA 4QRQA 5AFAA 2WKPA 2VO5A 1SXPA 5IESH 4E46A 1Y8ZA 3UMCA 2B36A 5I8EB 5KOVC 1N6HA 2FQ1A 2OHXA 5A2BA 4YEDA 2QY9A 2K7QA 1U8CA 4NB7A 3ICOA 5BWOA 2OBBA 2AF4C 1UKSA 5EO1B 1V96A 4DILA 1ZW6A 3Q12A 1FYFA 1W0YT 3AG1B 3V4LA 2YIDA 3VR5H 3FUUA 3DKIA 3FB4A 2QQEA 3KPYA 4DRZA 5JAHA 3EH4B 4ZQHA 2MOVA 4C3ZA 5E9DE 5I8WA 4E03A 1TJ4A 2Q3JA 3TLBA 4XCEB 4EUPG 3WIHL 4QC2A 3THXA 1LKZA 3CLRC 3QO0B 3TCXB 4X42A 1GCUA 2XWCA 3UTQB 5FAAA 5JBNA 3UN1A 1XQ1A 1PP4A 1V7PC 4R3WA 2ADFA 2D7DA 4R84A 1TLKA 1XK7A 4RWEA 3TEJA 4RFNB 1G7QA 4YHPB 2AR7A 3Q43A 3MLBA 2NY4B 4GS7B 1VACB 2A9BA 3HB3C 2ZT5A 1SCUB 3FZGA 4HRXA 4PCAA 1R19A 2DQHH 1S5HA 4Q9RL 5SZHB 3TR6A 1M6HA 2A9KA 3UJIL 3JWDC 4Q3CA 2WZDA 4PRIA 3WFBL 4LXGA 3VSUA 4PV1C 4I1PA 2Z0UA 3KS0H 5TFSL 2AL7A 3MQ4A 1NGQL 4JFHD 1Y4DE 2SECE 2YWDA 3FT2A 3KPSE 1QO0A 2Z4QB 2WY2D 1QHQA 3IUMA 1FYTE 4X6CF 1H8OA 3U7EB 5EU7C 3NYQA 4BX3A 4FTVA 4MYUA 3PP8A 3VFRA 3LTVA 5AL8A 4F3YA 5AHKA 4EJSB 3N1GC 1W93A 4DADA 3D4NA 1MABB 4QHNB 4ZFOA 3OLCX 1OV8A 4HADA 3HC2A 5JNRA 3PXCX 4NQRA 5I1LA 3ZDRA 2FNBA 4W6XB 3N91A 1PK9A 5F96H 5HYSB 1RIHH 4NAUA 2D5AA 2Z34A 1OIVA 5DEGA 3POHA 4C83A 3HHMA 2XZLA 4YSCA 1C9KA 1JPST 4YSEA 5DJZA 1FH2A 4XP4H 4PWIA 1MJ7H 3Q3GA 3TL5A 1ND0B 3UTTE 5C3UA 4V3CA 3MRNB 4L1TA 5D7IE 2JANA 4X6FA 1T26A 5DS2A 2IEAA 3KWWB 2VPQA 5I1EH 2OQJB 3BC1A 4AXWB 2OXCA 1UBJS 4YLQT 2YLHA 1UFQA 4F2ME 4WXEA 2Y0SA 5BO5A 2I6QA 1UXSB 4G6AD 1OLXA 5GPRA 1PLGH 3U0PA 3TYGH 4G6FB 2XB2A 2OR7A 5L9DL 3QEMB 3GLAA 2JWHA 5I1DB 2D8MA 2Z9CA 1J7VR 2HVKA 5FV7A 2AV7A 4DXAA 3D3WB 4W9NA 4BRWA 1C50A 4IDJH 1RU3A 5IF0A 3RC9A 3T65B 3SE9L 3FRPG 5FCUL 1R5WB 2JBAA 3V0IA 1SWWA 4LOEA 1JBJA 4E5SA 2HU5A 5BXQC 3O2WL 5EI5A 1Z4OA 3RYCB 4L02A 4AZ0A 3ZL1A 5I8ZA 3V4PB 2FEWB 1FRGH 1NXVA 4M7ZC 2REOA 3HAEG 3W9DB 3FOWA 4KR0A 3U4HA 3APFA 3VFGL 4K8RC 1KRHA 2YUWA 2O2ZA 1WLSA 1AY1H 1JG6A 4AYBA 2XZPA 3UW3A 3EAKA 3BDBA 1TM7E 2KHZA 2P2DA 2FSFA 2XBLA 1APBA 1EEYB 1HEYA 3C5WP 5MN4A 1ZOSA 4Y1AB 2O61A 4GL4A 4M56A 4QXTA 4YPGB 4PRBA 5C7IO 1LO4L 3CDGB 5D7LD 2ICEC 3D0VA 4FEMA 2ECFA 2MTBA 3QIVA 3RASA 2OKCA 5LOVF 3P2BA 3HZKA 3QJGA 1N4XH 4JGGA 2P90A 5F9FA 3BVUA 2ZAMA 5KQGA 1K75A 3TW8A 4TS1A 3QYMA 2IZ6A 1PWZA 4K8OA 1DKNA 1S2MA 1P0MA 2TRHA 1CY8A 2A57A 2WWKT 3FRUA 3MA0A 4NATA 3DBSA 5LQAA 3BWVA 1IVSA 3EUDA 2E86A 3JQEA 1MCEA 3VFUA 4RXUA 1OA0A 3U4QA 4N0CC 5HI5D 1SVNA 3M5WA 1GARA 1ND6A 7CGTA 4AROA 2EDYA 4U4AA 5HGDB 3GRGA 2X41A 1ZHOA 1CXHA 4V0RA 3JYLA 2XDAA 5IJ9A 1UT8A 2B4RO 1ZD3A 3G82C 3IRCA 2YXVA 2CFOA 3MILA 2BVQA 3ZTYA 2JIRA 4Z3IA 3RNLA 1A27A 5F7FA 2AFHE 4HCJA 3LBYA 5A0TA 4ZCSA 2R0KL 2W83A 1LP9F 4M1MA 4FDWA 3AQDA 4X1IA 1AHMA 4RADA 3D34A 3QUYB 5J1AA 2RB4A 1P69B 1UB6B 2Q3BA 4X9GA 5LU9A 2WF9A 1NEZB 3RYHB 4BMYA 1I0IA 1WD7A 1PG5A 2NY1D 1IL1A 4Y19B 3VACA 4POYA 3BYYA 2AC0A 4UQLA 4N7RA 3WYAA 5KNBD 5B38A 1U98A 4ARBA 2K6GA 3HWWA 3I53A 2KH2B 1IZ9A 1TC2A 3BQ9A 3JAWB 2HN9A 1KFAL 3K35A 3QQ3B 5EXTA 1YJ8A 2XGMA 1PQZA 2MMXA 3UGKA 1RJWA 3CC5B 1VYTA 4ZTEA 4HISA 4RMGA 5FL7D 3ME5A 4HD5A 1VE9A 1UD4A 1NVFA 3GN2A 1F4VA 3GLGE 3VFMA 5GS0L 2AD1A 2EP5A 3GGSA 3VKFA 1JQBA 5IEKB 3WRVA 3CUEF 5D72H 1XT5A 3QPQC 3RR2A 3N6RA 2XYPA 3JV4A 1R0KA 1SVSA 2D3JA 1D4FA 4CFYA 3LQMA 4UFOA 4KPEC 3FFCD 1SM4A 2FLMA 1ID5I 3B20A 4Y2LA 3TBTB 5FM5O 2HCTA 4UCFA 4YECA 5IW8A 4I5BB 4LVOA 3REQA 4RIGA 5CFQA 3NSFA 1GU1A 1DBKH 3INNA 4O4IA 2X9XA 1QWOA 2FSPA 3MNZB 4IS6B 2OXRA 3BJEA 4NPKA 3BIKB 2YIHA 3KSZO 3PCRB 1N9KA 3MNZA 1YYCA 5YASA 1OZUA 1Z25A 4RIIA 1W0KD 1OAAA 4XAQA 2E7MA 3NHMA 3RG2A 4Q0MA 3KCNA 5C8YF 3T34A 1Q2UA 2OY0A 2PD6A 4LS3A 1OIOA 1XAHA 2WJ5A 3V4PA 2EIZB 1K1EA 3LDHA 3DHMA 2VDPB 3GXFA 2P2GA 3UYKA 2P27A 4P80A 5L45A 3NNNA 2D4FA 3KTAA 1K7YA 4HCGA 4WE3A 1D6EA 2NXZB 5T3XD 4Q47A 4PTTA 1TTRA 3KWMA 4F7TA 3PAZA 5DJ6B 1X5IA 3Q85A 4BO5A 4S1NA 2CRYA 5JHLL 4BK5A 4YLCA 1LD3A 1UKZA 1RXIA 4FQHB 1S7WA 1DEEA 3SX0A 1SMAA 4IQ0A 5HFAA 2Y24A 3PV6A 4BKOA 3CGWA 4GOLD 2LKCA 2PTHA 4GYWA 4Y30A 5J4HA 4U6QA 2EFDB 4MRNA 4HJGA 4V1DE 1V1RA 2XKNB 4X95A 3DOHA 1LLAA 2IHUA 4YDHB 3DPIA 4AC2A 4KROD 3RS5A 9ATCA 2WCGA 1AKVA 1EMDA 2Q6WA 4MJID 5IW1B 1LPOA 1FL5A 3AQYA 5DYIA 4KWUA 2ZU6A 3ESCA 3KXPA 4U7FA 4KNVA 4B75A 1ZP6A 4EMZA 2WLHA 1OGAE 1GITA 1YQVH 1VLMA 3PKJA 3QVWA 4NJ9L 4H20H 3SEAA 4U3HA 1MW3A 4UAHA 1LSSA 3O03A 2ZICA 2HKFL 2XQVA 2WNHA 4RH0A 3J80A 4F97A 3GXBA 2Z8RA 3SZGA 4DR4B 4KQ1A 1G7LA 3OPYB 4K4KA 1ISIA 1K4YA 3G04B 1Z9OA 4JRWA 5A7BA 2BWIA 5B7PA 1QFPA 3MWDB 2JLXA 2CFRA 4BASA 4IKJA 1JJAA 1H9VA 4WFHE 3TCKA 3OMNB 5GZOA 4FMDF 2JI9A 4U0RC 2RGEA 3P0VL 1Z4LA 2R0ZH 2V54A 4QXGL 1ET8A 5C0BD 5K0JA 3PHHA 4S1VA 4OK5A 1WHTA 3DAYA 1Z3IX 3OKNA 3ADBA 3DQZA 5DVMA 3FYUC 3KXFE 5EXDA 3RH0A 3GSOB 1RYNA 1T0JB 4N9QA 5ITFB 2QLMA 1EIZA 1KCBA 3QQ3A 4Z5XA 5HTKA 1P0PA 3DSNA 4B7AA 4H59A 4GW5A 1FFAA 3FPSA 4ABYA 3NVAA 2ZX8A 1GS8A 2A9VA 5SYNA 3N42F 2IWGA 1PDKB 4J0CA 4NU5A 4QYSA 3LQRA 5HI4C 3B2UD 1JMKC 3ESQA 4DLSA 1BMGA 5ESDA 3NSXA 1P2TA 4ZFFB 5ICXB 2ORYA 1UM5L 1TKWB 2PW2A 4A2HA 4XI5D 2FQFA 3WE1A 3GIVB 3VRLF 1TECE 1XZAA 5CDSA 4MA1B 5I6PA 1NXTA 1P6FA 4I0KA 3DDGA 3DC7A 1QHGA 1BXGA 3HN8A 2QQNL 2IPUG 1F6DA 3PDOA 2YXMA 4MNGB 4QCIB 5EIBD 5HGJA 1WNFA 4HKXB 2CVQA 1L5FA 2D7MA 4OCWH 2XV0A 5LXTF 1EVKA 3IR6A 4XD7A 2JH3A 1LWNA 5DSZA 5GS2D 2XUDA 4EI9A 1U0BB 3R5TA 5ICYB 5DT9A 1QFYA 1KIPA 2YV4A 3ETGA 5DS8B 1A3LL 1NLDH 1IXKA 3WYCA 1X5FA 3KYAA 2WTXA 4OZIF 4JX0A 3PNMA 5I6XC 2QMUA 4OJNA 1T2QH 1EJ2A 1NJ1A 1YJQA 2CJWB 4RAUA 1KYUA 4IQ8A 5EJIA 4ODUA 4P46C 4C14A 3B9KD 2MOKA 5I7VA 1NNSA 2VB5A 3JASA 4RQBA 4TKVA 4TSAL 3PJFA 1WXGA 1MKFA 1BA3A 5HRAA 5HI3D 4HCIA 2HK6A 5FEUA 3ILQC 5DRXA 1XU7A 3NRJA 4OHRA 4L16A 1BZ7B 2QFRA 3QEAZ 5JROA 1V45E 3WTCA 4HEJA 3OTTA 1NMAH 1YR7A 2BFBA 1H6DA 4OI4A 3U7YL 2B8WA 3I2HA 5IJBC 3L4KA 3Q0EA 2WAXA 4DSAA 3FU3A 1NQBA 3JQOB 1E3LA 1LO3L 2EDAA 1BHQ1 4HETA 5JMOA 3FI0A 1KU6A 3SZ6A 2AI3A 5AK4A 3QDMD 4KJQC 2KSQA 2Q1EA 1T8RA 3IP6A 3ME0B 3PUUA 1RUAH 3O2QB 1B4JH 5F9WC 4C87A 5KSYA 1E9AA 3E15A 3GLTA 5J4YA 1P7QD 1FSZA 1YEFH 3ANYB 3RTEA 1IEAB 3JQBC 2R3SA 3L40A 4JAMB 1NW5A 4RNRA 2J9YB 3A4LA 1I3LA 2GDJA 4MP6A 1YDPA 3P9YA 1XHLA 2XUGA 2XZZA 5U4XA 2DF8A 5CN2A 5CK4A 1AGBA 3CFDA 2NW2A 3Q98A 3HVHA 1IM5A 4OI2A 3AS1A 1IRXA 5A2FA 4HNSA 4D8OA 4JO2H 4BINA 2AF3C 1LSUA 2ISQA 1QPBA 4AT1A 4OUDA 2EP6A 4Y5XB 3MUNA 3ZE6A 1IMOA 4RVUA 3DCYA 2ZWNA 1IFHH 5SWQB 2Z5FA 2FF5A 4FKZA 2H3EA 4JOCA 4AQEA 4XTRA 4QO8A 2WP8J 1DOAA 1Q7EA 3B9AA 3BTVA 4FOOA 1JLKA 4BNIA 1DJQA 4X6BB 4DMHA 3KFXA 2R85A 4CTKA 2FJPA 3K6FA 3Q9NA 2AXQA 4ZDHA 3Q3VA 5F7DB 4IRJD 1P1FA 4FQIL 2XI9A 2DLEA 4P04A 3WWEA 4BLTA 1WT5A 2ONCA 1YZKA 1Z7GA 4MVWA 3N8DA 1RUAL 2VUYA 3N3AC 1DG1G 1GA6A 1GKLA 1IEHA 3RV3A 3W5BA 2LWIA 2DEUA 2QPAA 1URPA 2FW9A 1SZPA 4G3YH 2R62A 3ULUC 3E7WA 2RGAA 2YWHA 5H82A 5EJGA 1SF5A 1P73A 2V7NB 4M99A 3HFRA 1YBVA 5TMBA 1JZ6A 2G0KA 4U6XA 2C7VA 4DBLE 1TQUA 1YUHB 4PHZA 3CFKA 1KXVC 3QUSA 4N1HB 3GMDA 3P9LB 5I73C 1CICD 4N2KA 2J0EA 1NCBH 1LLQA 1QDEA 1QORA 2DBRA 5JO0A 2KE5A 1MPAL 3ESDA 1XRQA 3M9XA 2VITB 3NTXA 5IIEB 1E4JA 1LRLA 1PNRA 2FFJA 4F58L 4LGVA 4AUMA 1X5MA 3T5GA 2EVGA 1AZVA 1GTL1 3LUDA 2H1SA 1QLRB 4NO3B 1JVLA 4B3DA 4ZZ3A 1CDDA 3DYVA 5TLSA 3QG1A 4CTJA 1YXMA 4Z7JA 5IZ4A 4JO5A 4QARA 1W34A 4EVQA 3R6DA 3NHUA 3C6MA 3DDSA 3RZCA 2QROA 2DJ5A 2J9FA 1QV9A 3WGVA 1RUML 2YRPA 2XH8A 4DIOA 3KOYA 3TJMA 4OI7A 25C8L 4U1MA 2Y6SC 4TTRA 1V3JA 4X9YA 1L9NA 2KX7A 4E07A 2Z6UA 3WAJA 1HDYA 4LPXA 4L22A 4TKVB 4RV9A 3OLDA 3WMRA 2B2XH 2ARJB 5ENDA 2WDPA 1X3SA 2ZUSA 4O3MA 3J7HA 5CCBA 3RJMA 2I85A 3UJ7A 3I4CA 1H05A 3QJXA 4G7SB 1V1JA 1IVYA 2LGJA 4FA8A 4GRAA 2H57A 3MI6A 3USCS 1G8AA 3AGQA 2PMFA 1TSHA 1TZHA 2XMBA 4UM7A 4DG5A 1AFVH 3EA4A 4G37A 2BJWA 3PXLA 1R50A 3PV6B 1OSPL 2GFQA 3R74A 4NQEE 3CHYA 3I9V1 2IMMA 2G6TA 1TTCA 2VR8A 2VN8A 2YRLA 3QZWA 1QKJA 2H63A 1N3IA 2AX4A 1SGWA 3KDMA 3QG6A 1NLUA 3PL1A 3RWBA 5F96L 1D8TA 3K09A 1KO7A 4PX3A 2RIPA 2P1ZA 4JAVC 1U9IA 1HTWA 4DCSA 1TSRA 2KDGA 3ROEA 1A7OL 1T83A 4LCIH 2O6LA 2JK1A 2BNUA 2ZG2A 5E8DL 1UJ4A 3L7CA 4N18A 1XTUA 4LLYA 3PF8A 1Z4KA 5SX4I 2BNUB 3GJTA 1OPOA 1S5IH 3OIGA 4DY4A 3D39A 5BRAA 5L8JB 4Z7UA 2BUBA 3PWSA 4N7BA 5KOHA 5FLVA 2ASVA 4RXMA 4R98A 5LAPA 1C8KA 4INOA 3IGLA 5KSWB 1RULL 2XWBF 1A2OA 4K7FB 4JREB 1PZAA 4EGAA 2O7QA 5DC2A 1EGJH 2UXFA 3I6GA 3RANA 1QX3A 3KLOA 2A0WA 4WLEA 4RGMB 3DC0A 3F5SA 1K8DA 7MDHA 1FVFA 1YASA 3NBFA 3F7KA 1TIUA 2J6BA 4XVOA 2FJSA 4RZ3A 4PSVA 1NM5C 2C3UA 2QBYB 2E6PA 3OJVC 2NYRA 4UUQA 1XVVA 3UANA 3CW8X 4E22A 5LNK1 4L18A 1EKXA 4NGHH 4FDVA 1RZRA 2HDHA 5FYLD 1FFGA 1FLRH 1I53A 3T9FA 4BHTA 1A21A 4RZXA 1HZLA 2Y4NA 3GA7A 4D46A 1LJ8A 3C5SA 3NP7A 4MKIA 3ROXA 1CB7A 3HRKA 5CJOH 3MT7A 4OH1A 2O54A 2OENG 1EBUA 4V1CI 4LC0A 1IQPA 3BJZA 5HM6A 4PGJA 2GCIA 3EVGA 2WXFA 2VJMB 5JZBA 2K0RA 1KGYE 3RWCB 3GT6A 7FABL 5ITWA 1NJ9A 4CM8A 4JT4A 5AOJA 1ZGGA 4JRXE 5CLJA 3HC4L 5DE3A 3DM9B 3TD6A 4GXNA 4CF7A 4M4PA 3K1YA 4MK4A 4EFMA 1K66A 4WJZA 3U3DA 4YZWA 4TTIA 4M0PA 4UQ3B 1KCRL 2GAAA 5FBHA 4TV9A 2C2GA 4JLWA 3DI2B 3ISRA 4MQBA 4XA8A 3DYOA 4P23A 3EGVA 3NTCL 3WL9A 4WK4B 3PHQA 4K71B 3DUWA 4EI6B 1AZWA 3UJPA 3QBVA 2ARJQ 4ME6A 3UB4A 5F9DC 4M0MA 4CILA 3HDTA 4ARSA 3F00A 1YR9A 5CLZA 3O6KH 3ND9A 1YVUA 1L9XA 3IDMB 5D9SA 1FTGA 1JDTA 4WGFA 2C9DA 2I07B 5IANA 3LXAA 4YBLB 3C8KA 4JB9L 1ZA2A 4IBOA 1NCIA 4TUOB 2FW8A 4BV3A 1Y0LB 3GSWB 4YRFA 5D2CA 4OB5L 5KDOA 4KH1A 3SGDI 3QPXL 1DXYA 1N8KA 4AX8A 2C4NA 4QXGH 4U6XB 1MQAA 1S2DA 3ATDA 5SWZE 1ZS8B 1ZU4A 3GLQA 3MLYH 1FQ9C 1ID8A 2RCSH 2DMRA 3B7YA 2P5SA 3JALB 1E5TA 4XN8A 3LPPA 1C8LA 1ZSVA 3QCVL 4RFOH 5TPWA 4KB5A 3S4SG 4L5YA 3F9CA 4JLDA 4JGIA 5A2QA 3WN5C 4ZEMA 4AJVA 2OB2A 5FP0A 2FN4A 4BYGA 1UYWL 4U3SA 3DWEX 2HXYA 1R5IB 2O5NA 4WI6A 2VF5X 4YV2A 4PYLA 2XXJA 5AOMA 1VKNA 2V7WA 3B1XA 2ZJ8A 3FF1A 1KMQA 2ZBVA 3PR2B 4MWFB 5J4LA 3PJDA 2EDHA 2XTJE 4KE6A 5TEVA 2E49A 2BONA 3L3BA 5DTJA 1UC8A 1FS5A 4UIMA 4G9BA 2OW6A 4KVCL 2NNXA 2WZ5A 1EPFA 2IP1A 4CVXA 4WUKH 3UH8A 1Z7JA 1OIWA 2VIIA 5AHOA 4I8DA 3AP3A 1ZG3A 1PJ9A 5DFWH 2ZUCA 1P1VA 2XQYA 5BVPL 2DY0A 1LVUA 1G4AE 4Z3TA 3ECWA 4MD0B 1L0XA 5I8OL 4F37F 2IH1B 1Y1LA 5DRYA 4ZI2A 5K3AA 1KDOA 4GAEA 1GYAA 4H1WA 1BXKA 4P99A 3V55A 2PIDA 2TMGA 4GPEA 1GGYA 3CN9A 3MWYW 1KTVA 2SCUA 1WKVA 3KEFA 4GKSB 1QE0A 4JO1H 1XDGA 4LVNC 4XUEA 3OX3A 1YR2A 4LGYA 1MFEH 5JQWA 3FCAA 1IM2A 3LW8A 4HJRA 3F7QA 4OGXH 3EXG1 1C7IA 1DO6A 4X90A 1WFJA 5AIAA 3QU4A 3NS7A 2WWGA 1NGWA 1IQDA 3BAXA 3F49S 1T22B 3VR3A 2HLPA 3ESMA 3E8MA 4G11A 4G0ZA 2WHYA 2GVZC 4RX4A 3QY9A 3PEYA 4L4ZA 3UAOA 3LZOA 3B78A 5K45A 2IPKA 2VH5L 1PJ4A 2ZXWB 3L3DB 4WA7A 2IYYA 3DDOA 1TVMA 4TSFD 3KVDD 2GN1A 4QRTB 2AA3A 3N41B 4R8MA 221PA 3C75A 5SWSB 2SICE 3ETJA 3NWPA 3WTVA 4RGQA 2RIRA 1ZMBA 3T5WA 3W8FA 4FEGA 3KDPB 3GC6A 4MQ7B 1WAMA 2IYSA 3GPSA 4FMDB 1M7XA 4JP3A 4EUPA 1K8DB 5HY9A 5LBSH 5CH8A 3G2HA 3K5IA 1YHYA 4ZYLA 1W48A 3I3DA 3MYYA 4D9JA 1O96B 1G9TA 1INEH 3UGXA 1T2FA 3DBVO 1ARZA 1XXLA 3UTSE 4IILA 2O5YL 3SVLA 1I2ZA 4OZGB 4HBQA 4OFYA 4NYLB 2VYVA 3FQRA 3ECVA 3QK0A 4O4LF 2VZVA 4EOWL 4CIAA 3VH8B 4XPZA 3RX8A 4JZJA 1V41E 4XMLH 3JRWA 3QE2A 1Y9DA 3ZLUA 3H4HA 1CIJA 3WBJA 3I02A 1OMOA 1O5IA 5CNKA 2DX7A 2X05A 3SHFA 2C5SA 3VGHA 4PYNA 3ZDFA 2O2GA 2PQ6A 5IESL 3OAWA 1AXSA 1RZKH 4D7BA 2KLTA 4ZZIA 4P07A 3LKNA 1SXBA 3QH3B 2N3ZA 1ZLWH 1Y1QA 3JY6A 3CSPA 3R77A 1SBHA 5F2FA 3B3AA 3GDBA 2ZSUA 1LEKA 4YCAA 2D03H 2VVTA 3HFMH 3E84A 4OLUH 4MUXA 5I47A 4OGFA 4J8PA 4GSLA 2YL2A 3BTUA 4QFCA 1H2XA 1ZXQA 2CFIA 1N59B 3ML1A 4R2GD 1VCIA 1J07A 4YDVB 5C0BE 3H6HA 1FFDA 4IM8A 3W2DL 2I1WA 3VNBA 1V3UA 5FRDA 1UKTA 3IIIA 1ZH6A 5GIRB 1JVBA 5LYJF 2ICCA 3QLEA 2GN4A 2GEEA 1QVOA 4HAOA 2EARA 4F3RA 3ZNOA 3F8UB 2LLLA 5T8KC 4FNPA 5AMXA 4F86A 1OUMA 3WEOA 4G09A 4GXFA 1PFGA 1MO6A 2COEA 4QPNA 1R6AA 1QKZH 4X0EA 3BXGA 4R3SA 1NOKA 3E2MA 1EZVX 3I2FA 2V2XB 3G7UA 3QKWA 4EHAA 2ZX6A 4DKDC 2PWGA 2TMKA 1A9VA 4L9SA 3BSWA 3BB1A 1GGEA 3X0DA 1OTYA 2AHOA 2G9KA 3QOFA 2ORBL 3BCHA 4ND6A 1RHHA 3HUTA 1XDSA 2AJSH 1WCIB 2CBPA 5KG9A 4DIEA 2QSTA 4AIOA 3NT4A 4FK8A 2PRYA 4A2CA 5A3RA 2L17A 2UAGA 3EGSA 2JAQA 1NN5A 1G6HA 1T5XB 1NW7A 3NVMB 3RFTA 3QVGB 1K3UB 5K0ZA 3ZK9A 4LIQE 4WW0A 4LVEA 1ZI9A 2QSCL 2OP4L 3AUUA 2JF1A 3VPXA 4FMFA 5IZCA 4DQUA 2C07A 3VE0A 2QZPA 2IDFA 3PRZA 1M9NA 1S7TA 1CUZA 2MHAB 1U8NA 2KJQA 3E9UA 4HF5H 4LFCB 3BUTA 1MJGM 4B0MM 3IJRA 4YH1A 3VMPA 4BPBA 1FJ1A 1H0SA 4DR7B 3U9PL 4FF9A 1MN4A 4PS4H 2W9XA 5BZDB 3TV3L 1LBQA 5BNZA 1HAWA 2D5LA 2GCEA 2A9ML 5DNVA 2N1KA 3B6ZA 3L7AA 4HGMA 4LRSB 5C0CB 2OXEA 3BIOA 5G3ZA 2UV3A 1XH3B 3D4LA 4MPTA 5AJTA 1DRJA 4YQFA 4HQQH 3TQCA 4OQXA 3BWBA 4YSTA 1A9PA 2LU3A 2QT6A 3NN8B 4TSRA 4EG1A 4R4FH 1Z0IA 3CNKA 2FN3A 2B3TA 2FPWA 4H4DA 2QNBA 4ODXA 3WGHA 5G4OA 3IUJA 1AS2A 5IHHA 1WPXA 3SSMA 4JHUA 3SG0A 1R3DA 4PG2C 1PLAA 1PX2A 4QBHA 5GS1B 2XRAL 2C2YA 4ACAA 1U4SA 1MZPA 2Y9MB 4HRAA 1PJ8A 3MDJA 2FX7L 5EU7E 2OQ2A 1FBIH 1PEZA 3K0SA 1G3RA 3T77B 4XLZA 3THXB 3TMKA 2VBIA 1BA9A 1SKMA 3KT3A 2YGVA 1SRRA 1J2JA 3EZGA 2QD2A 4LLWB 3U30C 1G6RL 3QKSA 4R2MA 5AH0A 4B83A 4LPTA 3MCUA 4LXHA 4JJ7A 2CJYA 2WIMA 5DA4A 2ZTHA 3SOZA 3ULUL 2IY8A 3C6XA 2ZANA 3Q8FA 1YS7A 3E5RA 4F72A 4NUJA 5BOPA 2E4XA 4JJZA 4P2BA 1CJTC 1Z17A 2D2VA 4WBNB 2JHAA 4FFZL 1RAFA 4N0EA 3RHSA 4XMLL 4LRWA 3TN0D 1GZHB 5J4KA 1BMQA 1FFWA 4V11A 2FGWL 5AQEA 1BGVA 5ALBH 4F6LA 5K8IA 4KXZI 3UACA 1XDWA 3LS2A 5JOPD 2A9PA 4TSKA 2JBWA 3FC8A 2BTOA 5BO0D 4Y1GA 3UJJL 3I39X 4M36A 5FTKA 3VXNB 4DQAA 1N2HA 4XAWL 1V3LA 1PL3A 5CM9C 2F9MA 2WQXA 4ESEA 3D9AH 1U8QB 2Y69B 4D2NA 2ZWVA 3ARFA 3EOBB 1G3MA 1KJQA 5FBWB 2Y36H 3LY8A 2YN5A 5J63A 3WLBA 3SKOA 2OXHA 1KBOA 2H3XC 3ETTA 3M1AA 5LC1A 2COUA 4EVSA 3KM2A 2ON6A 4AG4H 1I4FB 3SZRA 4Q9AA 1JZIA 2WJGA 4K0OA 1UH4A 5FO7B 2V9CA 1RYHA 2PA3A 4LIPD 1HOTA 2A3RA 3K0CA 2PUJA 1FL3A 5ANMA 2BFGA 1N9GB 1EDOA 5E2AA 2NW2B 4AGNA 1YEKL 3QEJA 1BZ7A 1E2LA 5C09B 3BSFA 4KC0A 5I9QB 5JHHB 2PPFA 3I58A 4V2UA 2H16A 4DGVL 2I7CA 3S7ZA 2HMYB 3MV01 1T8YA 1RCTE 3QWBA 4OLFA 2O2SA 1J24A 1QAWA 3DVGB 4BBWA 5G0VA 1J8RA 3FYHA 1BYNA 3H55A 4QTYA 1JQJC 1CLOH 4F2MB 2RGGA 4LY6A 4QELA 1L5GA 1FF5A 2I4IA 5FPQA 5KVGH 5JBQA 2DHQA 2PLFA 1II8A 5C8DA 4LKCB 4W8HA 4YBQD 5JPDA 2VMFA 4TWBA 4M93C 2WXNA 2EVIA 3MOGA 2RJ3A 2IUFA 2XICA 1KEKA 3VDCA 5ICYA 4YHNB 1RJGA 5DT1L 1KVQA 3QGMA 5GY7A 3D0OA 1WBDA 3QH4A 2ICWI 2AVDA 3CNLA 3AR3A 5B1KA 5I6LA 2ZT8A 4KPGA 1M7DB 1OF2B 3AERA 1FTWA 4UAOC 2B35A 3P4XA 3R3UA 1WZMA 1O58A 1GQ2A 1O3YA 4L2IB 4Q1DA 1DQSA 2QMHA 4MV8A 5IFJA 4OOEA 4PGCB 2HSDA 4MBOA 4EGFA 4CC4C 1OTTC 1LI7A 5D1XE 1NXSA 1QEXA 1DCLA 1ZSDA 3F0TA 1OLSA 2Q5JA 4C06A 5MGNA 3N44B 1UJNA 2GEBA 3K9WA 4Y19D 2B2CA 2QEQA 3ICVA 3OCWA 5CEZL 4KOBA 4IRZH 3O2VL 4PJIA 2X4UA 1J6UA 4I3RL 1X87A 2VISB 5ADWA 1PFVA 4JELA 2RHLA 5E1BA 3OB8A 1AQKH 1BU8A 1FH5H 4HS8H 4AWBA 4G43A 1SXZA 1RLJA 2BTEA 3OSVA 4G9EA 1VJRA 5CTJA 3VSAA 1Z15A 5F88A 1GPAA 4I4CA 3ME0A 2KERA 2H1CA 1UA3A 3ABKB 4DGYL 3OZDA 1YY8B 4Y9GA 5D5PA 4WUUA 1FK8A 3ZDCA 3HDVA 2M98A 5HRCA 4G0VA 3TO2B 43CAA 2XWSA 3B2UC 3EXAA 1J8SA 4S11A 5KVGE 3ZYJA 2HHCA 3BOVA 1CRPA 1VRCA 1PG2A 3RFZB 1IB5A 1OSPH 3AADB 4OK6A 1ORSA 4MV6A 4XEUA 5JD5A 2Z57A 4I1IA 3CX3A 3X3GH 1XNRB 3Q10A 4Y5XA 2ADFL 4N1AA 2YJQA 2CXUA 1T9GR 1IFHL 3S2YA 1DX4A 1CW2B 3ZHYA 2AC7A 4LEOB 1YA5A 5C8JA 1KAOA 4HZLA 1VSVA 4ANFA 2QQLL 2IHNA 4KQWA 2F8LA 4PV8A 4CV2A 2R69L 1RJLB 3SDCD 1G18A 2QR0B 4MRMA 1NJ5A 4NZMA 5LBGA 3Q7PA 3RUDA 5BW7A 1HY3A 3X3GL 2ZBQA 2CXHA 2OP4H 1PQPA 1ECBA 5KJCA 3QEKA 4C56E 1A0OA 1TNNA 5I1EL 4YBHA 3D8NA 3SCMA 3CT6A 3IPYA 4HJEA 1V1MB 3MNFA 1EMTL 2NXEA 1BIIB 3ULVF 1LWRA 4PRIE 1L8AA 1NV9A 3TPUA 3MRPA 4EUPH 4CKEB 5JH7F 2ZJ4A 2BCKB 4EJ1C 1D6EB 3HRPA 2GERA 1AR2A 2C3VA 2JI3A 5M34A 3KVQA 4PX9A 3A10A 1TQDA 3TNLA 1GGUA 5KI6A 3DE7X 4Z7UB 3DZBA 4TF4A 3AXIA 4QQKA 2XXCB 1DEAA 1RZ3A 4C7OA 1XBDA 1SKYE 3GRCA 4X7SH 2BNQD 1BOGA 1ZKAA 4X2UA 2APWA 4GI9A 10MHA 1BVOA 2I7SA 1JMXA 5JVDF 4HUMB 3LRPA 3QBJA 1MJUL 3EMVA 2H4YA 2D2OA 3FBQA 4ZOBA 4QRRD 3R5XA 4BN5A 3SQXA 1N3NB 4GR4A 1R75A 4XGZB 1R5WA 3R8QA 3TONA 1EAOA 5HVFB 1A2QA 4JWKA 3ARSA 3MRKB 5LHDA 4OFXA 3EJTA 4RQQA 4HS4A 4DR2B 3HLAA 5E5RB 1BRMA 5CIPA 2QRHA 1JLSA 4WGWB 4BEJA 3KTAB 3KGSA 2OL4A 1CQWA 2NX5E 2D74A 3OCVA 5ILOA 4KO6A 3AHJA 1L7XA 5ALZA 4FP8L 2IWKA 1T03H 5E7QA 4H6WA 2V8OA 2VERN 4P4RB 2AOTA 4KKCC 4L8SA 3V32A 5TQ0H 1SY7A 4RFSB 1X4YA 3IVAA 1XZJA 3VFWA 2IQAA 5E2BA 2QU8A 4C08A 3GPIA 4BWYA 4AJ9A 5ESVA 1G8GA 1JG1A 4JY4A 4PR5B 4Q89A 1UK7A 4MV9A 3KKEA 4CLRB 4F15B 3RC7A 4YCMA 1K8QA 4UNQA 3WS3A 3EF0A 1D4ZA 1PWHA 4CRPA 4MQLA 4RM3A 3I32A 1DIRA 4KREA 2LW3A 2P79A 1MCOL 4H0NA 1LK2A 5T1MA 2DD8H 1SEPA 1V2HE 2BSXA 3SMVA 2VSFA 4JJ5A 5T4EA 2P3SA 5IAOA 3K7EA 1M34E 5F3HB 2HJ9A 3U4BL 2VUKA 2BZGA 3TF7C 3C7CB 4GOJA 4AYGA 1NULA 3JWOH 4AX3A 4PXAA 3EDKA 4P84A 1G7PB 5JANA 1DJOA 1OLZA 4WL0A 4MV7A 2NZYA 1ZTXL 2K45A 3FTDA 4DCPA 3RWGA 4MTMA 3VH3A 4F8JA 2J30A 2UVFA 3MPCA 1OSZA 5GGRB 5FKJA 5AXAA 2UZIH 3H2SA 4HJUA 3C09B 2FNAA 4KVGA 3RUHA 3MACL 1NY6A 3P9LA 4NCIA 3W05A 2XCSB 2J1KA 2JHPA 3MO1B 4JASB 5AK6A 2FBRA 4RFOL 1JAZA 2LAAA 4KPHH 1JKXA 4IFBA 3O8RA 4PG5A 3L84A 1E43A 2Y36L 4P08A 4ODSH 4HRVA 4LOJA 5H02A 2YEVB 4QRPA 2X0WA 3UZQB 2GWHA 4TMZA 5FL3A 1Q22A 3P9MB 3G79A 3QHFH 3S3CB 4XTRC 1MH9A 1EXMA 4WESA 4J3NA 5G0TA 3EFHA 2YRXA 3DWTA 3IQWA 1BP3B 2EIKB 4BNVA 3MUJA 3C3JA 1CFQA 3DULA 3UH0A 4Z0TA 2C3XA 3KPPB 5TGDA 2HLFC 2Y6UA 3DCJA 1T6BY 4MUHA 3GUTA 4AF7A 3THWB 4MA8H 1FQWA 3ST7A 2ISDA 3MT0A 2YOGA 5LR6A 2VWHA 1O96A 2V7GA 3FWPA 3IS0X 1WG8A 3SYCA 2CCWA 3MS4A 5E5LA 5IV2A 4WTZG 2V59A 4R8VA 5C35A 1IXYA 4GE0A 4K6KA 4PZZA 3KW8A 3LN5B 3V0VA 2LZ0A 4ZP1A 3MERA 3F96A 5DLML 1B74A 3OAAD 1S4IA 1GJUA 5FOQA 4FYVA 5CB0A 2BZ7A 5I73B 3ES9A 1H1TA 5B57C 4P3XA 3TIVA 1GL9B 2IEZA 1VPTA 4JOBA 3IMSA 3CFJA 3DEZA 4LHZA 1OYVA 5FPKA 4BJ3A 2H07A 4R2JA 1XGUA 2EDLA 3K1AA 2OBNA 5KBPA 3RU7A 4Z3GA 3HKCB 4BQOA 2YA2A 3NMUF 3UT5B 4PPNA 1Y4ZA 4AYEC 2DEYX 4PJAE 3GCWA 3BD5A 3V6ZB 3CKKA 3GSXA 4KXYA 1XL6A 1SKBA 5ACLA 1LWHA 1KHTA 3T4PA 3NJVA 2VHQA 4YRTA 2ETWA 3L9RB 4ZAGA 3HACA 2O5YH 3BH8A 5EFZA 2E75C 4BRZA 1DANT 3O74A 2WSDA 1MCLA 3TXAA 4NO0B 3LWBA 4Q3AA 1KLFB 2XRFA 1UUFA 3R6TA 1J12A 4JGNA 3W2FA 4NJEB 1L6PA 3UQYS 3J7AC 5E8NB 5DRXB 4QLBA 1C29B 2ESVD 1Z7BA 5A6VA 2AW5A 3SOBH 5B5SA 6AT1A 5EU5B 4N39A 5FYKH 1KB5L 4A3SA 3TLRA 5HCNA 1Q0TA 1GTRA 1UXGA 1PBNA 2IAND 2VZUA 1ED3A 3IESA 2OX5A 5F7YC 1PT7A 3ETDA 2YPLD 2EKSA 1YE8A 1ZI6A 2J20A 4BBAA 2IW1A 3GJFB 3R4RA 5AVKA 4HS6A 4PSAA 2A0FA 2W0SA 4OW6A 4EXPX 2ILVA 4NBTA 1B88A 1M3IA 1QRND 1A02N 3Q3GE 3MAAC 5I1GH 4O1HA 1D7DA 5IW6A 4WSOA 3VKVA 1B8NA 3JWOL 4IJVA 3IVRA 3C8MA 3W9YA 5A5VA 3U7JA 1LNUA 1X6VA 3L4UA 4IKLA 3PICA 2EDWA 1ROCA 2DM4A 3MODL 4N0PA 4M5ZL 1PDKA 4KZDL 3QE9Y 2YAMA 1D6VH 3CWQA 1AZSC 3GAMA 1Z32X 5GJTL 3AGPA 4IHJA 4U1GB 4OU4A 1XJ0A 3QDMB 1CDIA 4UDYX 4DPCX 4KX9A 3AVXA 1UTDA 4LLQB 1EXGA 2EKLA 1ESZA 3OZVA 1KEGL 3CZCA 4FNLH 1BVZA 1YOBA 4QOJA 1YEFL 1SY6A 4LPUA 3VUAA 2WU0A 1I8UA 3BZEA 2EDDA 3MBEC 4HBGA 4UFNA 5K6AC 3NHZA 4UTBL 4P2GA 3JVFC 5D1NA 1E6OH 3VW3L 2F1EA 1CQZA 1KIMA 4PSRA 4HJXA 4GAJL 2IGBA 2HZHA 1J0EA 2RHWA 3MLRH 3ZH2A 2X6MA 3ZDXE 5IQ7H 1C1EL 1B73A 4HYEA 4PJAB 1C1HA 1GSMA 5ECGC 3R1GH 2XSZD 4JOQA 4KXMA 4DEPB 1LNZA 5B2FA 2F62A 4CM4B 3HCNA 1RAEA 2C4HA 4CM1A 3ZVMA 3G1UA 2VRCA 4M9PA 3Q41A 2KQUA 1ZESA 4WOPA 1P1ZB 1X5KA 2F3PA 3ZE1B 4FGJA 2CXRA 4LZNA 4REQB 4KACA 1OH5A 4M43H 2IV7A 1L3CA 5HPYB 3PFBA 3CUPB 4AICA 3RSSA 1D2HA 3FNFA 1MNQA 3KYJB 4K28A 3GTNA 1AS8A 1OW0C 3O8OB 1KLUA 2DTDA 4NC0B 4MXWH 1SXGA 4ARZA 3KPLA 4TQUS 3BKMH 4DR5B 2A5GA 4KO5A 1N0VC 3U0BA 4Z4GA 3W9BA 5DSCA 1CFBA 2V7XA 5IUJC 2OSLB 1Q9LB 2PY6A 5E8OB 1CY6A 3LE8A 4YAFA 4XWGL 3JVEA 2OZ4H 4BFRA 4XQCA 1OVZA 3CX5J 4CIBA 1J9CT 4MB3A 2QVBA 1BAFH 2CYBA 3BAEL 4N6RB 4PRHE 4XOIA 1A7OH 4LCIL 3QWIA 3ISVA 1L8OA 3DARA 3D3NA 3P5BA 5L3RA 2ZCHL 4NDMA 3JQAA 3ZHXA 2UZ1B 4FADA 2L82A 1PGOA 4MD4B 1GTJ1 5JYCA 4FYTA 1JGUL 2O8FA 2ZUTA 2GAZA 3USES 5C4MA 2E46A 1R0XA 3UC9A 3OAYK 5CINL 4N3NA 3I72A 1GLNA 5FYJD 1DLJA 2XWBA 3BGFC 1THMA 1FOEB 4L4VA 3OLIA 2X1XR 4HT3B 5J13C 4E4TA 3DT9A 2X1HA 4FN4A 4S3MA 3MS7A 1KC1A 1KEML 4ONHA 3TKLA 2XA1A 5FDWB 3NTCH 3KHKA 4WFKA 4BL5A 4UM5A 2JQMA 4NEHB 4Z99A 2VYRE 1DQLH 1AP2B 3OQJA 4UOQA 3VXUA 3HZKB 5D2NC 1R3JB 3NPAA 3BXOA 2X4GA 5IP5A 5FUXA 1DBBH 2CXOA 3IA2A 4KKRA 5THKA 3IKJA 4GX1A 3TCXA 2GAFA 1ZICA 2OK7A 3EGEA 2PYED 4LMBA 2GJRA 3D69A 1DZIA 3VR2A 4KAQL 1VCNA 1YIAA 4Q66C 1SK9A 4BZ2H 1WEJL 2ZUYA 3F05A 4U1JB 3HUJA 4U33A 2ZOOA 3C60D 4PBRA 3SJUA 2H65A 3ZDAA 1DBSA 4YHOH 5BS0E 4C5CA 2UVPB 2A3TA 1R5NA 1JRHL 1DHTA 5T64A 3RSGA 3ZGYA 4GGPA 3ED1A 3FDFA 1FYXA 3I1IA 1AJEA 1XELA 2HIAA 3VTMA 3FQ1A 2JJUA 3M6AA 1P4BH 1FQJA 1KSGA 4Z18A 4KUHA 3SEQA 3BD4A 1CF8L 3ESAA 1EFQA 4UEOA 4G97A 5AB0A 4I46A 4QLAA 1GSAA 1UJMA 3H53A 1AYRA 4YBRA 2X9QA 2ZAIA 1RADA 4M8VA 1URIA 4UT9L 2UX6A 4P81A 3EPJA 1BYUA 1KI6A 3TEZA 1BQ3A 1PGPA 1QTSA 2JCCF 3DZDA 2H59A 3VJ6A 5ECYA 4OJDH 3OZEA 2DZEA 4RBPK 1E3SA 4XH2A 1MIHA 2GM3A 5KYUB 3QV1A 2DAVA 5FYKU 5D5MF 3QVVA 3S8FB 4F2WA 2XTJB 3QUZD 1D2PA 3BH0A 3D1MC 4X5XB 1TLFA 4DCQB 4MXQD 2VZEA 4DV6B 3F62A 4JO3L 1AF4A 3FKSA 3GHBL 2QKIB 1XG5A 3ELYA 1JZJA 4A8JA 4GG6B 5CCHE 1IBZA 1NVEA 3T6WA 4DMMA 3HQ4O 4KPYA 2FZ3A 3WI9A 3FIJA 3AVWA 3RKDD 3RF7A 1E9OB 1BZDA 3G6DL 1JZ5A 3I5AA 3WMSA 1UWLA 3IDNB 1RFDL 3G5ZA 1HHKA 3GGOA 3GJRA 2MR5A 2M8XA 4CKXA 1EP9A 4KXXA 2XRAH 4V1DA 3WHXB 4TLCA 2YD1A 1FFHA 5I1IL 2FEOA 3RK4A 1DJNA 3EBPA 3KAPA 4A6DA 1R18A 4OXYA 4WEUD 3TYFA 3BQNB 1IAII 1ODKA 2JAUA 1E65A 2RAUA 3ZUPA 4KKLC 3TEFA 5CCJA 1P8JA 1R16A 3SXPA 5ALYA 3NGLA 5I15L 3H84A 2DGDA 5AB1A 1T6VN 3K2KA 4TRNA 2EQBA 3WEAA 3VU9A 4XVSL 4U0KA 4Z23A 1J5XA 2WV7A 4EO9A 2G3YA 1CS4C 3GFUA 3VO0A 3DUSB 3FTXA 4PRBB 2AXJA 1OTUC 4O2EA 4DDWA 4NCNA 4BAGA 1W0JA 1L5HB 1YNTF 2WBXA 2WANA 3D2UD 4KRNA 4RMTA 1DDGA 1I8IB 4AC4A 2ZCLL 1HJCA 4QOEA 5HBRA 3UUEA 1WV0A 4GW1A 2JE8A 2BY1A 5DHMC 3P4YA 1P4GA 4KVNH 2D1FA 4N82A 1HKLL 3HKBB 5JQGA 3NUKA 2WBWB 4PVLA 4TTVA 3SBEA 1IUKA 2NAPA 2JLZA 4KGJA 4CL8A 1OROA 4Y2PA