2VDKB

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 129
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdkB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdkB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdkB03
4MMYB 2VDLB 2NUPA 2VDOB 3PPYA 3M6FA 4NENA 3FCSB 4MMZA 1SSLA 3OKYB 4O3TB 1Q0PA 3PPXA 3ZDZB 2M32A 3EFOA 1DZIA 4HQLA 3T3PB 5HGJA 4WK0B 3EGXB 1U8CB 1XUOA 4HQOA 1JEYB 3TXAA 4O02A 2ODPA 1BHQ1 1M2VA 1L5GB 3NIGB 2ADFA 1T0PA 4HQFA 4NEHB 1CQPA 2VDPB 3K71A 1JV2A 2VDNB 1MQ8B 4C2BA 4CN9A 1UEXC 1RD4A 2XWBF 3Q3GE 3F74A 3K72A 1YVRA 2I6QA 3ZE1B 1IJBA 3RAGA 4Z7NB 5KYUA 5KYYA 2VDKB 3FCUB 1IDOA 2IUEA 3VI3B 1ATZA 5E6UB 2XWJI 3OL2A 1QC5B 1SHUX 1TYEB 5HDBB 4UM8B 3IJEB 3T3MB 5E6RA 3QA3E 3EH1A 1NA5A 2QTVA 4FWWA 3EG9B 3K6SB 1PT6A 5ES4B 1V7PC 2NUTB 1YUKA 3AFCA 1MQ9A 4MMYA 1OLZA 3ZE2B 1PD1A 2B2XA 3BQNB 1IDN1 3PPVA 3AL9A 3V4VB 3EOAI 3FCSA 3BN3A 3N2NA 4MMXB 1M1XB 1RRKA 4G1EB 4F1JA 1XDDA 5E6SA 3ZE0B 3HXOA 1M10A 4BJ3A 1FE8A 4CN8A 4Z7OB 3EGXA 1U8CA 4Z7QB 2P28A 1ZOPA 3E2MA 1IJKA 3EFOB 1AO3A 1BHO1 1L5GA 4O3UB 1JEQA 2WW8A 1RS0A 3AL8B 2O7NA 4IXDA 4G1MB 4C2AA 1YVPA 3TCXB 1ZOOA 1JEYA 1MJNA 4FX5A 5LN1A 4F1KA 4WFQA 3EOBI 1JLMA 1MHPA 4HQKA 2P26A 1N9ZA 3K72B 1N3YA 1RTKA 5KYXA 4HQNA 4UM9D 1QC5A 1DGQA 5HJ2A 4DMUB 3EGDB 5KYWB 3IJEA 4GZ8A 4C29A 2NUPB 3ZQKA 3TW0A 3EG9A 3K6SA 1AUQA 2VDMB 2NUTA 1SQ0A 1M1UA 3NIFB 4NENB 4A0QA 4MMZB 3HXQA 1M2OA 3OKWA 3VI4B 1LFAA 3ZDXB 4IHKA 3NVQA 2I6SA 2WINI 3EH2A 1OAKA 1M1XA 2I91A 4WK2B 4IGIA 4UM9B 4G1EA 1PCXA 4O02B 1MQAA 5BV8A 1M2VB 3TVYA 4PN7A 2VDRB 1PD0A 3PPWA 2ICAA 4CNBA 5E6SB 1JV2B 3V4PB 3K71B 1AOXA 1MF7A 3AL8A 1T6BY 4WJKB 1U0OC 4G1MA 1JEQB 1U0NA 1XDGA 4K3JB 5E6UA 3F78A 5KYUB 1SHYB 5KYYB 1ZONA 4WK4B 1FNSA 2VDQB 2UZYB 1CK4A 2X5NA 2VC2B 3NIDB 1QCYA 3OL2B 2XGGA 3GXBA 3IBSA 4M76B 5KYNA 3BQMB 5E6RB 1SHTX 4JX0A 2NVOA 3HI6A 3ZDYB 2ODQA 4XW2A 3EGDA 5KYWA 4JDUA 4MMXA 5KYXB
chains in the Genus database with same CATH superfamily
4IGAA 4R7TA 4JFHE 2WI8A 2IWGA 1K9TA 2NXYB 2GWHA 4NICA 3MYRA 4ZJYA 2B4TO 1DBJL 2V9UA 4QRSB 4MWDA 3V1YA 5I4KA 1MAVA 1OMOA 1Z4KA 1BAFH 4C6HA 4P2OC 1H8OA 1QNFA 3RSSA 1O94A 3WP0A 3T2OA 3S1SA 1ZAKA 3WB1A 1LU9A 1MPAL 3MINA 3KDPB 1E2PA 1SOAA 1A6UL 2C77A 4LPXA 4C3VA 1RULH 2YHBA 1G7CA 4S2SB 4QHLB 5CJOL 3EDKA 2P4UA 1ISHA 3FB6B 5GS0L 3H56A 4YPJA 3EMVA 2BP3A 3CZUB 3SO5A 5JNUA 1I8TA 3NEOA 1FSGA 4EEKA 2IW3A 3QSGA 4AMUA 5BV7B 2F7SA 2WM8A 1FUNA 4RC9A 4DM7A 2YV5A 4N2AA 1W49A 2ZE7A 2FYTA 4HIIB 2VUTA 5F7JA 1CZOA 5F2NA 5HPYB 2XT9A 2UUBB 2PG3A 1EUUA 2MWCA 2FJHB 1T6BY 2CLCX 3GJ3A 2RQEA 4HKZA 4U0RB 5A6LA 3CVIL 4MGYR 5JR1L 1A8ZA 3P0VH 2W6ID 4QBFA 4TLUA 1XH3B 3A6BH 4FMCF 4X8MA 4ZVQA 1MOQA 4QWMA 2WG2A 2X0RA 3NSJA 3O1IC 3UK2A 2V3EA 2OFWA 4L8SC 3TA4D 3OKNB 2ORWA 5DMGD 3U1QA 4DDHA 3QQ3B 4JGIA 2HTKD 4MVJE 2VDMH 4UASA 4M7KH 4RY8A 3NMEA 3E2HC 4AURA 3GFBA 1QE5A 3TEMA 2FJPA 3DX3A 5E6RA 3Q9NA 1J48A 1XTLA 1TQCC 4BK5C 1XD2A 4N0QA 3S6JA 4J6IA 3O9WA 2FPIB 2QV4A 4LLVB 1R4ZA 3ZDAA 4UTOA 1E7VA 1T5WB 5C07D 1T1IA 3L0IB 3TTTA 2FBOJ 2QQGA 2JFCA 1TVMA 1MWAB 1Y7HA 1DVFB 5IBCA 5AOZA 4MWFB 3L0PA 3K2IA 1G0OA 2P75A 1O8CA 3EOBA 4NO3B 2R48A 2E21A 3Q01A 4DETA 4NFHA 4YAGA 2VERN 2QX9A 3OD5A 3VO0A 5DTQA 4IZHA 2P90A 2R8YA 4XXCA 4MAYD 3LEVL 5EMMA 2J32A 1NCWL 3GK8L 5IQ7H 3UJBA 4BNTA 3Q6FA 3ELAT 4KKAC 3KX2A 3IEAA 1CW2B 2I6SA 5DB4A 3O4LA 3RIAK 3CFIC 3C14C 1AUPA 4UINH 4Z0BL 3SYPA 4FI7A 5D1XA 4RVBA 5I0XA 3DO6A 3B1WA 1OP3K 4JBWA 5FQNA 3HAEA 2ZFUA 4RZQA 3T0AA 3E81A 3S70A 3LTNC 1JXMA 2D00A 3EY9A 3S97C 2PUBA 1FTYA 5TF1H 1WF3A 3NHJA 4TMKA 3O11A 4JI3B 4JUSA 1FRQA 4YUXA 3GIZH 5KSVB 3DOUA 2I1WA 1HHKB 4JFFB 4PG5A 1FUUA 3FMVA 4RETA 1T8WA 4W6XB 5TMPA 2CEAA 2CIIB 2B8TA 4PJXE 3EJYD 2NV0A 4BNFA 3SQLA 4FEMA 2FZKA 2OD7A 4HAGA 3CVDA 4MDYA 3TTSA 2Q3ZA 3AU0A 3TWCH 4PJ7B 4Y19B 1Y5NA 2G4EA 1WXDA 2FX2A 5BUAA 1QU3A 1NVMB 5MFZA 2N7SA 4C0WA 1AO7D 3TA3B 3ROOB 4M4RB 3OFKA 2R1WA 4K3JL 4ALIA 1RSZA 4KO7A 5DFVD 1SKAA 2O0HA 5KQRA 4CL3A 2ZYIA 2VQSA 2NYYD 3O81A 1E6LA 1XL0A 3QDAA 2XZOA 2VJQA 4Y9GA 1D2RA 5KJRH 2HA5A 2VDLH 2FX7L 3WEXA 5AHRA 1PCSA 1ODLA 5E9NA 1JI1A 2GQ0A 1OAZH 1N57A 5H9WA 2FZLA 1A98A 1P4BL 1M2JA 3BCHA 3DWGA 1L7NA 3EJUA 3B51X 3FUEA 2JKRM 5BN5B 3NPZB 3IIKA 1WHSB 3GT4A 2X2PA 3ONWA 4OLBA 1QOKA 4G8IB 2AMLA 2GILA 3MV7A 4PI0A 5KEIA 1OXUA 1KPRB 2TMKA 4PAGA 5FYDA 4KXAA 4V0MA 2ZJ0A 4HGQA 5DXFA 2AE1A 2BVOB 1HT3A 2OQJB 3X2SA 2BVQA 3IL2A 3E5RA 1FU4A 4WI0A 2WBJD 3BSHA 2X3YA 5B39G 3WJ1A 3DOIA 3RL1B 1URIA 2JXMB 2ZVQX 3QRGL 4C7OA 4Z76B 5I17A 1YL5A 3QS2A 5L3QA 2PZBA 4UT7H 4QXUL 1P7VA 5C0BD 5BNXD 2WZAA 2AP2A 2YFNA 1V11A 1P31A 3TW8A 4O63O 1GG9A 4F37K 2AUMA 2XWJI 1K68A 4UQCA 3UQYS 1UFVA 2JL1A 2V45A 1YL7A 2JGRA 1BQEA 3UZEA 4Y1RB 4FMDF 5K3CA 3U4DA 3K1DA 3DXAE 3AR2A 3TL6A 2WB1A 3B4NA 4OZIE 4URKA 4ADGA 1H9DA 4L9WA 2VDOH 1UJ3C 3FH5A 2BSAA 2NQ2C 3RWHB 1A7BA 3U36A 5K9KA 2ARJB 1SJMA 3Q6GL 1X0VA 2ABWA 3TECE 4Y9TA 2GZMA 1KXTB 4XO8A 4AM0A 3NIWA 5B7FA 3FCYA 2RFXB 2EWVA 1EFRA 3CFEA 1CUGA 1YKSA 4C14A 1X5IA 1P2FA 3CC1A 4UHFA 1MWOA 3FKJA 3I1YA 2YTZA 1FYEA 3C7CB 2ZETA 4R98A 3V4UL 3MNDA 1XRQA 3LIIA 3OKAA 4HXFB 1XU9A 3V34A 3IV7A 5JHDB 5K5YA 1MPXA 3CLRC 2C3MA 5HGDA 4LEIA 2R7LA 3PDUA 3ATEA 3WISA 1SQ2N 3QG6A 3QS3A 2XGGA 3UMJA 3RAJA 4BEIA 3L81A 5AW2B 6PAZA 2Q41A 1X7QA 3SPXA 4MS6A 3CWGA 5CNMA 3LZ6A 4LXGA 4POOA 4MQ4A 3WO4C 5EJ6A 3QA3A 4ARIA 3N43F 3WIIH 1UOPA 1E79D 5AWNH 1F20A 5TPWL 1A7QL 3MLUL 1PF3A 1YC8A 1X7YB 2RKWA 2R1TB 3RIAF 1ESNA 5ALPA 2MYTA 1W91A 3H5IA 3ZCUA 4XQCA 2ZKMX 3QUMH 4GZ5A 2HU7A 4CT0A 5JG7A 2VO8A 4OOFA 4BGLA 3HFFA 1MORA 5E3HA 5TFSH 1Z3GL 2QKIA 4KZ0A 4V0QA 3AY4A 2Z31B 4FFYH 3ZZMA 1ZOPA 4U7SA 3CCCA 2O1XA 3HQ4O 6PFKA 5F7ZA 3NS7A 2FUTA 2IANE 2FK8A 4OI2A 3DTXA 4PP2A 4ZO9A 2ZJ6A 5KOYA 2V8MA 5CGBA 5CZRA 1NZRA 2C4KA 4IXTA 3OZBA 3KKLA 4B2YA 3LWBA 1QD0A 5BZDB 4KZEH 3I9GL 3G9UA 5IIEA 2Q28A 5BQPA 4ANFA 2AN5A 3IJ9A 3M4ZA 4HLUA 3VFNB 2ES4A 2CLKB 3BDXA 1TF5A 5DR5L 4LCWD 1CQZA 1AHWB 1AXEA 3OE7A 1IJEA 4YP5A 3BEWB 1G4RA 2EQAA 3OE5A 4XGNA 3OT4A 3ABLB 4FJ2A 5IVPA 4ZVMA 4EN2A 4JFQB 4HAFA 4JCWA 1VPDA 1JB1A 3KK0A 5KOJB 4PV1C 1SULA 4GX0A 1Q2XA 3WOHA 1QATA 2W7TA 4R5HA 2HD4A 3QC6X 3QJTB 821PA 1BVNP 1BIHA 1CIVA 4PRLA 4UVHA 3T8YA 4G5OA 3N2KA 4C2BA 4JQIH 1IPHA 3F6CA 5DD6A 1V37A 3DOOA 2N0MA 3NBMA 4L18A 1U0HC 1DC3A 2AEFA 2H9YA 2IP2A 3HSKA 2YOFA 3M1BA 2IHNA 1RRCA 3DPUA 3ZE2B 5EQDA 5I6NA 2EXXA 2BLLA 1X39A 3TSWA 3WKYA 3TCKA 4M6AA 3NRBA 2NSLA 1NZFA 5A06A 1JG2A 4TSBH 4ARVA 3HKFA 4D92A 1LYQA 3BKMH 2DY1A 1R64A 3NTQA 1P9WA 3PQ6A 1ZUIA 5DYNA 1E63A 4K5OA 3V6MA 2OR9H 3MCG1 2HPZA 2DY0A 4A38A 4AJPA 4PREA 4YDQA 1DL7L 1OPXA 5T64A 3WGZA 2W9LA 4Y2GA 2NTFA 3SQWA 4F37F 5EHGA 3MKGA 3K7EA 2FGZA 3V4ZA 1CLCA 1GMIA 1EFPB 3AKCA 4BRZA 5H80A 5KVDE 5E9DB 5ESAB 1FSKC 5DMIL 1YDPA 1V27A 1P3Y1 2YYAA 2ACVA 4I5IA 2C0CA 4JYAB 3AEYA 1QUEA 3EFEA 2C8JA 2AQNA 1P45A 2VDWB 1CO1A 1CUHA 3ZLBA 4B7ZA 4R26H 5GSRB 1SDDB 4LRNH 3MV8E 4DBZA 1NH6A 4REQA 4EL0A 3RWIB 3QZPA 3GBML 3U82B 3N8HA 4PPGA 2P4QA 5LQAA 3V6ZA 1ENZA 4IIHA 1UGNA 2VMFA 2V97A 4XCYA 1UC8A 1V25A 4G9BA 4APQB 4AECA 3CLUC 1XEXB 3G3LA 4PVDA 5HJ3A 1KSRA 3W6PA 3WICA 1KS9A 3SZRA 1H6UA 2H2FA 1ETB1 3L1IA 1CDYA 2I9KA 1G18A 3KPWA 3L6FB 4I50B 3RHWK 1I7UB 1OXSC 5IESL 3WIHA 4PZZA 4B3DA 3HSYA 4BKLB 3GX1A 1QU2A 1MG5A 2CNYA 4DEWA 3CHPA 2ZJFA 1MQ8A 4V03A 3EYQC 4PYKA 2P6UA 5DUPH 4BK4A 1C4WA 1FGNL 2VLRD 4PJBB 4QGFA 3M0EA 1R18A 5TQVA 4HLJA 3WDJA 1I8LA 3CNQS 2QQQA 1D2NA 3L7JA 3L9YA 5DYWA 5IEKB 1VSTA 4TRNA 4W8HA 3FPFA 3BZFB 4G5ZL 2OHGA 1SCKA 3E3MA 1AQIA 5HDWA 1E65A 4JRXA 3P54A 3A4LA 4TMPA 2HFEB 2FTAA 1H93A 1SUAA 1EDBA 3K0AA 3QK7A 4RKYA 5E0FA 2CWWA 2FPMA 3AF1A 4BO8A 2FLBT 1XVVA 2HSJA 3ZLVA 3QTTA 3CG8A 2X23A 4P9HH 2AJSH 2BNUA 1R0BA 1DN0A 5DPMA 2C9CA 1NN5A 3MZTA 3D6VA 4ZO8A 4IFEA 4PRHD 5EU5A 2AOXA 2WUGA 3CH7A 1MCLA 3T3DA 4TXLA 2B0SL 3WGJA 2ECFA 1HYBA 4I0PC 1XDWA 3KE0A 3G6DH 5FX3A 1VE3A 2BMJA 2O54A 5LPNA 2P45B 4DPRA 4Y5VA 1D2MA 3EDDA 1JAXA 1KMQA 4WXYB 3GPLA 5CJQL 5JLZA 5DRNB 2QP3A 4LKOA 4CTOA 1QPKA 3WQSB 1A5ZA 1C1DA 3UZQA 3UZVB 3BHNA 4PWYA 4DE5A 1A4KA 1CF2O 1PLCA 4BKRA 3CMGA 1F8GA 3CXRA 1TVEA 2JLPA 4NKOA 4ENED 5EINA 1KZHA 4JDVB 3GT6A 2RKBA 1EUDA 4N2IA 3KP1A 2OV6A 3GN1A 1R5VB 5FFMA 3SD2A 1I8UA 1SD1A 5AI6A 3RWFA 2BFFA 1WBYA 5KBYA 1SUFA 2XB6A 1GGCL 3RT7A 4QWWA 1YFJA 3HU1A 4KMRA 4ZFNA 2KX7A 3HZVA 2GMWA 3G9ZA 3B8YA 1BKDR 2P8LA 4W9NC 1GVHA 3H87A 2I07B 4IHJA 4YXFA 5C8XA 2ITDA 4K9QA 4GI9A 3I6GA 3MB8A 4HWPA 4DXHA 3OKLB 3OM0A 1LILA 1POXA 1MHCA 4Z3FA 4YAFA 4KO2S 4QRPD 5EEWA 1N70A 2P1DA 4TUYA 4YUWA 1R0ZA 2VIRB 2QG4A 4BCBA 1HQRA 2Q3HA 2VR7A 3EHBB 3NBFA 2OC9A 4F2DA 1VGKA 1F4XL 1KXVA 1A6ZB 1SBIA 2ZIGA 4HWKA 2I2AA 3KQTA 2Q3FA 4EE2A 1U8ZA 4O5LH 1SDYA 3WFHB 3GGPA 3WLKX 4EKNB 3NGMA 5D3MB 3EZYA 4P4KD 1RJEA 4GIPD 4PBXA 3DXXA 4A03A 4JG1L 4CSTA 4KVGA 5KSYA 1V8HA 3O4IA 4ONHA 2RARA 3SAJA 3IQDB 4QTXA 3CDZB 5MEOA 3LXUX 2HSZA 3FTWA 5F1SA 1E1RA 4QYIA 4U2ZA 4LVNA 1ZT7B 5C31A 4KJWD 2D2IA 3NJGA 1GV0A 3E6HB 4CU6A 4YHYC 1T2VA 4GXUN 1WY5A 2E7BA 3IDJA 5I7EA 4RESA 1D2EA 2PCPB 1ZIDA 4HFUH 1A1MA 2ICEA 1AY0A 1TJMA 3VFOB 3IQIX 2QIPA 3MRMA 3BH9B 4UFPA 1RK0B 5BUGA 4CMJA 2HXYA 1BO6A 4TTPA 1FZJB 2QW1A 1V5JA 1AS7A 5AKGA 4ER5A 1W9HA 3H84A 3WN5A 1EB9A 2YMOA 3TRKA 3FK3A 4DV7B 3P9SA 4YPGB 1ZRSA 4HLQB 2OB2A 3EOYG 3W81A 4ACBA 4JQXC 2DPLA 2YKLL 4FN0A 3V55A 3RHWF 3EC7A 4LBYA 2GITB 4NN5C 2ILLA 3EJTA 5HG0A 3I92A 1CBVH 5AAMC 1FB5A 1SJHA 2M1XA 3ZWNA 2O5RA 1VCIA 4N20A 1DIBA 4TNFA 5AK0A 4O4IA 3INRA 1ZC4A 5I76A 5NULA 4OJTA 1BMDA 4AW7A 2VO5A 1WETA 4DEXA 4ZEOA 2IQ9L 4KJQC 4XWOC 5HYSB 4DV5B 3U48A 3PRKE 4RDHA 5T5NG 3FQTB 1BVUA 4MI9A 5ALSA 4MYPA 4HZLA 1T2FA 4GBXA 3TBHA 2IDFA 2R1ZA 4HJ1A 3WFJA 4P32A 5E6SA 2CG9X 3KJ4B 5HJBA 1FPQA 4R90L 3AP2A 2DW5A 3TC9A 3UCEA 1TZHB 4HUQB 2QD4A 4Y5XB 3STLB 2HNAA 1Y8RB 4YCCA 3E5NA 3PU6A 4ZW5A 4JFFE 2HA3A 3MLXL 1KEEB 3QKSB 1NPJA 2GK3A 2XICA 2Q7YA 3GHEL 2WUBL 3RZCC 5KSBA 5IMMA 4PJ7E 4Y19E 4YJDA 1H6FA 1L5RA 4H1HA 1BA2A 4RLSA 3RWOA 2BDEA 1QA9B 2C2YA 1XH2A 2VAJA 1GTJ1 2YD1A 3QYCA 3MJHA 1WVIA 4LY6A 3JQ7A 3LEVH 3VYTB 4TSRA 4G6KL 3BZ5A 4Y7OC 1U8IB 3VAAA 5C1IA 4Q9JA 3RZWA 3B2EA 3MGTB 4U7TB 5E2JA 3BUQA 3L4KA 1LVHA 2K7ZA 5IVKA 1O58A 3DHNA 1UZNA 1VBKA 1KBOA 3M2PA 1O1YA 3PT9A 2O3RA 5AVUB 2FP4B 2FLRT 4OKSA 2UYYA 1XR8A 4FHGA 5B7PA 1UIRA 4OW6A 1P7QA 3IJRA 3FPAA 5T8IA 3VG9C 2W5UA 3OZCA 2AI0H 3OKEB 3MLEA 3OOWA 1W5TA 2YBDA 1U7PA 5AW3A 4LZLA 1QF7A 3GSXA 3INGA 5CGQB 5F72S 1DOAA 1MIHA 2C4NA 1GRNA 5KWJA 4TQAA 1HWYA 2APJA 2R7MA 2COQA 2A58A 2W6JA 1G21E 3FN0L 4B32A 3HK2A 5FO9B 3PVCA 3OM1A 3AB0B 3CQ9A 4LSVL 4MAZA 4D0DA 4DV6B 3TSAA 1T8PA 3BWCA 5IKEA 5LDSA 1X7WB 4K3JH 4YAQB 5I16A 3DLIA 3H6AA 4M9CA 4X41A 2FPOA 2W9XA 2YFYA 2HN7B 4A6YL 3A1DA 2C1PB 5CP7B 3S4YA 2G5BA 3HP7A 3WB0A 1KV3A 3QTBA 1OAOC 2WQ7A 1L3BA 3LPMA 2E7ZA 1YNTA 1A14L 4PAWA 2Y68A 1YJBA 5C8YF 4I0WB 1KK1A 3GJYA 3LY5A 5EZJB 5DHTA 5HJ7A 2X2JA 2FX7H 1E7YA 2G9NA 3G5ZA 4XPAL 1SVKA 4MB1A 2CUNA 1GSMA 3IR5A 1KG0B 3VQLA 4PS4L 1P4BH 2AEMA 4DJEC 1NDTA 2FHCA 2FSVC 3GXIA 3IAQA 4J8RB 2VF8A 2G7ZA 2CBOA 1LEGA 1A9BA 4HB3A 3R8XA 2EJ1A 1OFUX 4DBLE 3TURA 2CDAA 2Z34A 5I1JL 3QEBZ 5BPPA 5FQOA 2UYQA 3G5XB 3NHMA 4NCC1 5K05A 4MA8H 1UXOA 3PU7A 3JVGC 3NOOA 3EDEA 2ZW9A 2XVXA 4NM4L 4NX0A 1M1SA 4HPOL 5CIYA 3MMEA 4TTGA 2OWEA 1L8LA 2HRBA 3D1VA 4POAA 4EUHA 1A5BB 3QKIA 1WOMA 2AERT 3ACBA 1A9SA 2NW2B 2OP1A 5EIEA 1NRIA 1XL1A 4GKBA 4UAJA 1HYQA 1FCGA 4DTCA 2DTML 2CHXA 3SZ6A 5C0FB 1FRZA 2J08A 1FVHA 2LBPA 2VUUA 4KBPA 5CMAA 1O54A 1DVYA 1T03L 5JHDE 4JM2C 5CA0F 1ZTXH 2GD1O 4QXUH 4YT8A 1LJ8A 3IHWA 1KOFA 3I37X 2SKCA 1EZZA 3S3SA 2Q6VA 3P9IA 2Q7XA 5C53B 1EFVA 5D7JB 4OUKX 3LXRA 2XMBA 3ARYA 4DR1B 4XN5A 1HDRA 1M6WA 2ONKA 5KS9A 1Z22A 4FFMA 1FIGL 1X9RA 1W96A 4KQKA 4L1TA 1KCBA 4F6RB 2DM4A 2CXXA 4MKGA 4TVPH 3PYCA 4KGVA 5T1KA 1AHIA 5GRWA 2YCBA 5E2VH 4PQXA 4JT9A 3RFVA 2UAGA 2IYNA 4NJ9L 1AGEB 2QB5A 2FGJA 2EARA 2HDHA 4BNUA 4HT3B 1IQUA 3I2CL 2TS1A 2NR6A 4L3EA 1YCHA 3EZJB 4N0FA 3VZSA 1KGIA 5TRTA 2RB5A 1IHYA 3DC0A 5C71A 3IDGB 3ZZSA 3UMYA 1AR1B 2YIMA 5E7IA 5FNVA 3V4UH 2GPSA 4FC3E 1QPBA 4ZUTA 1MX9A 2QQLL 1XDZA 3E8XA 3K1TA 2B3TA 3LK7A 3BJLA 2VLLB 1BVYF 4FMCB 3L5HA 3AUUA 2R1UA 4PRZA 3GLSA 2ETWA 3UH8A 2ARWA 4M03A 3PXCX 3GMPA 3EARA 4RKQA 1UT8A 3GKZA 3D8NA 4EI5C 2LVEA 2YPLD 3T6ZA 5G4KB 2V7GA 4R8WH 2X6UA 1RYMA 2WUDA 1NLMA 3MLUH 4HDRA 3RYIA 3H55A 2OORA 1H85A 1ZOOA 4F3KA 5F21A 4AQYB 2J9FA 1TT7A 4NBXB 1VDGA 2CO7A 1P4HA 5L3RA 1QG2A 2BW0A 2V3CC 4EW2A 4CUKA 3ZE7A 3QQ9D 5TMBA 1GU1A 2OVFA 5E4AA 3L8HA 1OZFA 5AIAA 3SLRA 5ALRA 1R0AH 3FQUA 3T77A 4H1VA 3O2JA 3L04A 2ZUQB 4OH2A 2EXYD 3BJZA 1LDMA 3T5MA 4EKIA 2YNMA 4G1MA 2H6PA 3K9FC 2IOFK 2DLCX 4KDWA 4XD7D 4QM7A 3BEDA 2EEZA 5IFAL 3I9GH 2ITEA 3ZE2E 3SQBA 4UATA 3GA7A 1SEBA 1AF7A 2WIFA 1TQVA 2G8NA 4CE6A 5DR5H 4ZBJA 3ZR6A 2XVZA 1UC4B 5B6PA 1FC2D 4N40A 3IVAA 3TS8A 1KTLB 4C06A 1N26A 4N6RA 3RJQB 3H3XA 4F3CA 3A3OA 3ZZNA 3FZEA 3CLFL 2VZLA 3G2NA 2WABA 1H3EA 3DEZA 4QNNA 5C09B 1Q95A 1Y80A 4QRRB 4XB2A 4A66A 4XXWA 4PUBL 1U11A 2QZ5A 3F5DA 4UT9L 2J7KA 2Y9MB 4G6MH 3D08A 1R5IA 2A9CA 4AX4A 3T3IA 3LX5A 1ZMXA 1YJDL 3BGDA 1JHTA 4IDNA 4OSUL 3OZ7A 1AZLA 5E9DE 5ESQB 4WZBA 3BAYA 3D81A 1WYJA 3BH8A 3HA5A 3HJBA 5L95A 2I29A 5KTRA 2EHJA 3QBEA 3T0GA 4YEFA 1H2XA 4I4NA 5C97A 1I1AB 4J0KA 2RGYA 2OK0L 3CXUA 4OLFA 3NRCA 2BFBA 1JNNL 5HA5A 5H5JA 4IJVA 3HNVH 4PCVA 5FBKA 3JZYA 1HDEA 4YEDA 2XDQA 4IUYA 3TVTA 4IDOA 2PKXA 2PT6A 1Z7GA 3OETA 3FRPB 4IBVA 2ZIEA 4UNIA 4A8JA 2F08A 2J67A 4EBQH 3L2LA 2WWIA 1RBQA 4Q4AB 2XOKD 5AG8A 1CD8A 4QBGB 1CLVA 2PNFA 2W0FB 2GYVA 4Y16B 1CVIA 4FQ1H 2ZTBA 4XI5D 2IXAA 3O6KL 3STZB 4JAMB 1HDGO 4ESEA 2BMAA 4X95A 1XVLA 1GCYA 4C4TA 1M05A 5DMIH 3FGZA 4KDEA 4BFZA 5K39B 5HYSG 1YDEA 5LQBH 3RWJB 2YV3A 1MI5A 1O4VA 2VR1A 2WY2D 5IANA 4EDWL 5C32A 1P5JA 2QEQA 3MCLL 2I3AA 5BVHA 5F33A 3T1NA 3MJEA 4Z9BA 4R4ND 2GOYA 1IJKA 2PMWB 3U7FB 3NUZA 2ZIAA 4FIDA 5FYKH 3NRFA 9MHTA 5KKNB 3WGHA 3MRJB 2VISB 3P4OA 3A26A 2QX7A 5J06A 1Y63A 3CNLA 4FMDB 4C4ZA 2HLFC 1JR3D 4U00A 4H27A 1VEMA 5BN1A 5IKPA 4TWJA 4CDNA 3E70C 1IHDA 4MDRA 1SAYA 2OCCB 4HAWA 3LRMA 1VIYA 4R2JA 3FVTA 4Y9CA 4CR8A 3DOEA 5INDA 4RFEA 3B3BA 3ZNPA 2V3FA 5DJ8B 1AXGA 4XPGH 3IQGX 4YWJA 5J1SB 1PX4A 1TYRA 2QBYB 1WCYA 2DKOA 3A06A 5A9TA 1HMPA 4F5ZA 4CM9A 1PJBA 4EQ6B 1J22A 5SX4I 4U6SA 4OMUA 3WHXB 1J5OL 1ICIA 3IUMA 4G5ZH 1RAEA 2VBIA 4MROA 3EDFA 3DDHA 3RIHA 3PG2A 2XNDD 3H3KA 3C60B 1G3MA 1U95B 2KZKA 5CHNB 1G5IA 2B15A 3UGXA 1FL5A 2FZEA 5EO9A 4JO3H 5C3LD 4N2NA 4M0MA 5HI3C 1G7LA 5IB4A 1QJCA 2YH2A 3MACH 3UG4A 5C34B 2OZLB 3N43B 1S7SA 2R8SH 1M54A 4E6PA 1TKBA 8GPBA 2WNHA 3SXPA 4JEIA 4XN2A 3OHSX 1SVIA 4LSMA 5LMZA 3D87B 4UQLA 3WTBA 1A64A 2FNWA 2KBGA 4X9YA 2RCSH 5IHBA 2A9VA 3OURA 1KK2A 2BIMA 3FB7B 4HP8A 1U3JA 2RHLA 3G0HA 2WHXA 4KWUA 4R2XA 4YCDA 1CVSC 1LVEA 2V5MA 4UTAA 3WIFB 4I1VA 3WL4A 1L8AA 1CY2A 4RULA 2F3TA 2PL1A 3HA0A 2REQB 3QFHA 2V6IA 4AQ7A 1X77A 1TJGL 2E6QA 2AG8A 3ARVA 4CKBA 3BTSA 4IHOA 5KAQG 2QT6A 5E7FA 2X3FA 1DJSA 4KWHA 4JO4H 2VUOA 3K5HA 2VT7A 1NC3A 3VHRA 2XX1A 3DVIA 1DL5A 3SYKA 2FPXA 2GPYA 4INPA 4V2IA 2CHQA 1LLDA 1VSUA 1YS6A 4KG7A 4KIJA 5F1OB 4KKLC 5A6IA 1NYQA 2V9CA 1KERA 3W9SA 3EGDA 1YQGA 3PUUA 4FKKA 4HZIA 2BKUA 4QLOA 5E5LA 1M2HA 4DMMA 4URXR 1KCKA 2UZXB 3ELBA 3D05A 4AEIL 3BEVB 2FVNA 4Q3LA 3T1VA 4D0CB 5COQA 1J07A 1BAPA 4J90A 3KL2A 2NWQA 4PJCA 2A74C 1I7ZA 4PJHF 2P44B 2VSFA 3DTYA 4BQQA 4KWEA 3KAQA 5B6JA 1JJBA 1QX1A 2AVGA 3QWHA 4M6WA 2FB4L 3EHEA 1Z7YA 5IJKC 4ELMA 5KYTA 2AOUA 4QNRA 4E9QA 2DYPB 4KUZH 2ZX7A 5KTEL 1F4XH 4B3JA 4F2PA 5HYIA 1WSAA 1H5BC 1Q4NX 3ENEA 3O1LA 4LSQH 3NANA 5K0BA 4D41A 1BRTA 4CQLA 1QFYA 3TZ6A 1E6OH 2X4PA 2NVBA 4BMDA 1E2LA 4GE0A 4DGUA 5BN4B 5FH9A 4BQFA 2XTJC 4YXKL 1L9KA 4L4XA 5BVJA 3DD5A 5IJVA 2X8JB 4OZ4A 2DPGA 1SPDA 4E7OA 1U8OB 5FYLE 3FOMB 5HHPB 3S4SA 2IGBA 1IQDB 4EPSA 2Q5LA 4PGFA 1HNGA 4JLWA 3ZI4A 4ARZB 2C98A 1H8HD 4N47A 4O58L 1R19A 4ZT6A 1JPFB 4ZC8A 4J3WA 1MJ7L 4AH2A 1HINL 2JIZD 2B39A 4RKFA 4LNHA 3TCLB 1X9HA 3IU3A 2FX8L 2AHOA 4GMSL 4H25A 4MXVF 3EOAB 3NBZC 3IFSA 1T0UA 2IYQA 3UGEA 3SQOA 1E40A 2P9HA 3RVWD 4YCAA 3T3MF 4NS4A 4FR5A 3OB0K 2Z0BA 1T9KA 4BCXA 1BXUA 4ALLA 4EA6A 1E8DA 3V9AA 4MS4B 2ZIDA 4HJRA 3MRXA 2JGNA 3PQ7A 4TSKA 2JD0A 5AYVA 4OZGF 1UJCA 4P2RA 3IMRA 1SUDA 2ZPAA 4F3FA 1UDWA 3V8RA 3EO1B 2YAHA 3VWKB 2PWBA 2WINB 2QJWA 3LHSA 4CQMB 4OKVA 1N2XA 4DN4L 1J2UA 1HTWA 1FFSA 4NT6A 3CSTA 2BR4A 4DIDA 3AHIA 1HFKA 3OAWA 4QYOB 4ZMPA 2J8ZA 5EE3A 2RK4A 4GLBA 5K4GA 1NGWA 5KYGA 2YV2A 3W5VA 3ICWA 13PKA 4X4MA 1EJ6A 2V2TB 2F8VA 4IDAA 1A96A 2OV8A 3VYPA 2XVYA 3GYRA 3L2OB 3NACH 2I60L 3BHBA 4OO3A 3S2EA 2MIIA 1XDSA 5G3YA 1DBWA 2VITB 5AJYA 1XGTA 3BRWA 5DJCB 1VJCA 5C0JB 3PDOA 1TTUA 2VJNA 1F3JA 3WRXC 2DQCH 1QHSA 4OBEA 1A2YA 3RX7A 4PGDA 4OHBA 4IIUA 5ARDA 1ZJBA 2ZYRA 5DRXB 1I6WA 2QE7D 5JH7A 2JA2A 3L4JA 1WTGT 2VDQB 2ZPKH 4WI6A 4IG4A 2B61A 1KY7A 4L4JA 4P2AA 4V1DA 4RTNA 5HTKA 4LVCA 3WGIA 4L78A 4K94H 1R27A 3REOA 4EQ2A 4KQCA 1X5MA 5BPHA 4MMYB 4L1KA 3X3GL 4PYHA 3ILDA 3B1ZA 5EWLA 4N03A 2X4OA 4LCYB 3EBOA 4LBWA 2BXZA 2WM3A 2GAZA 1JHZA 2QYSA 1RD4A 3CNKA 5L9DL 4G6KH 3CVHH 4LLMA 1UM9A 3TCNA 5EF0A 2ZWOA 4RYDA 1KH3A 1HZZC 4UU7A 4WO4D 3NCJL 4BJHB 3DMTC 3FJ1A 3CMOL 5DRZB 1XGQA 1BD2D 3O4RA 1RLBA 3KWMA 3LGSA 4EHNA 1B2WL 1WE2A 4GL2A 3GJ6A 3D4BA 4KBYA 4N1EA 4QXVA 5DK6A 1D7DA 1WXFA 2GAFA 3T0EA 3EFFB 3HKZA 2FJFB 3LSOA 2NCEA 3ILQC 1W8NA 1D6JA 2P9YA 4FDTA 2XVAA 2OBLA 1ZA6A 5ISZD 1BZDA 3OVUB 3D3JA 5MGNA 2PFSA 1WBDA 2AKRA 4GT1A 2HKFH 4P23A 5LGHH 5E38A 3MRQA 5D93C 1QORA 1DSFH 5D9SA 1BMFD 1HZJA 1YHYA 5AOKA 4Y2DC 2Z6QA 4PHTA 1CR4A 3ZVNA 5I2IA 3GSOB 3U30C 4U7DA 4V0LA 3CFCH 4X5LA 2XYQA 4INJA 3R5TA 2OS7A 2A1IA 1L6ZA 3RC1A 1T2QL 1GSHA 4ATWA 3R0QA 3NQIA 2F48A 3QIWC 1HEJC 5KYYB 1I6LA 1I5RA 5TGDA 2QSCH 1OTTC 4TLCA 1S9VB 2I87A 3NSCA 1P0IA 4PHHA 5E5MB 3UACA 4RPIA 3QJZA 3NYRA 3EXHA 2ONJA 3DL7A 4NMMA 5AVWB 2G82A 3TD9A 5AJZA 1KXZA 2CNWD 1M34A 3FRHA 4JB9L 4AM0Q 1LS6A 3NP9A 1CDCA 3DCJA 4WLCA 1IVSA 1KSJA 3QWRA 4LK4A 2K3HA 3UGKA 4YT2A 2OL3H 4S1SL 2GEUA 3CH6A 1I3GH 3QRLA 3ZG6A 2BOLA 1YONA 4DLSA 3GPBA 5BV0A 1XYVA 5I1JH 2CUKA 1KCSL 4QRUA 1TEYA 2XV3A 3I85A 3SHTA 1L1EA 4RPLA 1I31A 1M73E 3E0XA 3ARPA 4JI1B 1EEZB 2JGDA 4Q9RH 2WVHA 5LLTA 1CE1L 2VF7A 4HPOH 4XWGL 5F3DA 3BC9A 1J90A 4Q97A 4JJ5A 4AL8C 5LN1A 1I14A 3ZWQA 4WW2B 4OFDA 4NZDA 3P9ZA 2K87A 4IXMA 3GXUB 3RS8A 1FDVA 2ZS8A 3L3GB 5C9JB 1K72A 5F3BB 1LH0A 1OASA 4WCFA 3TMKA 2DUJA 2WVTA 4KXQA 1NBOA 1M66A 1MCJA 4XNBA 4X3CA 3DZDA 4FFWD 1H66A 4OMFG 2ID7A 5E23A 5I3CA 2ISSD 5JAHA 3HI5H 4ZFFA 5CLWA 3N76A 3QEHB 1D6NA 2BEUB 3QQ4B 2YZ2A 4GYJA 1O6BA 4MRVA 5AKXA 4ID3A 1Q16A 3LX9A 2NT3A 5E08L 5ID0A 4X90A 4M1EA 5JPMB 2Z65C 1IGFL 3I74A 3T5CA 2LW3A 3I2CH 4L05A 5FYJE 1W46A 3IN0A 5A2LH 3FBWA 2VAXA 3K72A 3H2IA 1C7TA 3OCJA 4PLZA 3FCUB 1VE5A 3RWGB 4Y4FC 1IM2A 3I6KA 1ZMOA 3VR6A 1P2DA 3B9QA 2HHLA 3BE4A 5C0DB 4MW7A 4M6OH 1E4WL 1J99A 3EXEB 4Y67A 3IUEA 4WI5A 3FFCB 2R27A 4KYTA 5AICA 3DLBA 2NY2D 3N6XA 4IOIA 2M6RA 3CZPA 2Q6KA 2JJ2D 3QI9C 3NFNB 1KVRA 1HI6B 2CFRA 3RHSA 4F1KA 4TNVK 3CDFA 2L0XA 2H6UA 4V1CB 3ULVL 4I99A 1ZGBA 4R0LC 2AHIA 3MMXA 2J0VA 2JAPA 2XI9A 1E3FA 1TVBA 2PZGA 4ICIA 2NNWB 5I4CA 1QTPA 5HUJA 4OJFH 1JZGA 3HHEA 1A77A 4HUVB 3NJJA 4OLUL 2X8BA 4XH2A 2YIVX 4PJFA 3V6OC 3DB1A 5C09E 4QRRE 3EQ8A 4QOFA 2V8LA 1XJCA 1PGNA 4CEHB 2PNDA 5D84A 3FDWA 4FG6C 2C95A 4Q05A 1ED3A 2MCG1 3PPXA 2XNCA 3FPGA 2ZTVA 1UMKA 1E3WA 1KPVA 3JCZA 3VWJC 4EDFA 4GKVA 3JY6A 1INQA 2H26B 3DNFA 1E7RA 1TM4E 4C2UA 3F5SA 2RI6A 1FFTB 4WI7A 2RR3A 1X5ZA 2TECE 3ETBJ 2P4HX 5H81A 1TM5E 1ODCA 3QUZD 5LXTA 1EFXB 4ZEWA 2VPPA 1YBMA 4WSGA 3ZWBA 5AOAA 4Z4FA 1LPAB 3MCAA 3AR6A 2BZSA 3CEHA 1XZ0A 3MRIB 3QKRA 1DKNA 5KSAB 3LN5A 5HJGA 3LCJA 3KR9A 4IUBS 2QTCA 4OM1L 2N1MA 4TZTA 5I9TA 4G9FD 2TMDA 2IOIA 4MKFA 4ZO7A 3V95A 4EFDA 2GJAA 4P0QB 1RRPA 1P5ZB 4UT9H 2H2SC 2XIQA 4MQUA 4UUQA 4XCFL 4EYEA 3QWOA 1OZHA 3HGTA 3GA5A 2QN3A 2XRZA 2QMHA 1YJDH 3VU2A 4KW7A 3STYA 4H20L 2BTOA 4U1LA 5EZ5A 1XTPA 2YMMA 5CBPB 4JREB 2XMDA 4LQ4A 3V7AG 4CEJB 3SOPA 3IRCA 2WF5A 3T9FA 3N04A 3OTOB 4AE1A 3R7DA 2OK0H 2AQPA 5DZPA 1Q9LA 3HMQA 5C8YB 4MVJI 4R7GA 1JNNH 4Y1TA 3FA2A 1L7RA 5E70A 3CSFA 4RBNA 4Y1AD 2XMPA 5ESVB 1FQOA 3JTEA 2P8MB 1CLUA 4PJBF 4K8RL 1RAGA 2WLKA 2B1GA 5KVSA 3BYYA 3RWEB 3HG2A 4M5ZL 5ADUS 1SU7A 4HWZB 5A9RA 1OQAA 3HG1E 4NMHA 2W90A 4C87A 3PPIA 1SG0A 3QMWA 1JGVL 1M3JA 4FE3A 2ZCHH 5A71A 4Z53A 1OT4A 4N8DA 2C54A 4LOAA 4BBZA 1IU1A 4YHOL 3VXTA 4IFTA 2CALA 1YZYA 4XNQA 4JFUA 1VOTA 5JAPA 3OAZK 2B82A 2Q5OA 4CM4A 1KHTA 1R3IL 5AL8A 4UUBA 1Q6ZA 1NC4B 1JGIA 1LQUA 2GTPA 4YHML 2VN6A 5GRUH 4ZGGA 1DBSA 1UMCA 2FEJA 3DO8A 1F18A 1BF5A 2WAOA 5C2BL 5CA0B 4Q0XL 4Z2AA 2J5KA 3FBQA 2CUMA 1ZUNA 4Q66C 3H5OA 5C0GB 4H7VA 1SQ0A 5CXXA 2LLGA 1F60A 4B79A 1X9UA 2VWEE 5JA9A 2JFGA 3TP4A 3B12A 5GZ6A 4GH7B 4HU8A 1QCCA 3N2GB 3BRDA 4YBQD 4PY8J 3B8EA 4DWWA 1XDGA 1SQGA 1U80A 3ZOKA 3V7YA 4YE4L 3WGLA 3NHLA 3S27A 2BELA 3ZV5A 2X28A 5HHOA 4Z77B 1TVKB 3BPSA 2YOAA 1XVSA 1E7WA 5LWYL 1RE1A 3GMOB 5HGJA 1AHMA 3SBEA 1GOHA 1DAOA 3I6LE 4U1RA 2P5EA 1KDJA 1T21A 5D7SL 4MV5A 4S1OA 1X6NA 3RVKA 1UM8A 4B3FX 1HY3A 3TO4C 1C2YA 1IN5A 2EKSB 4UT6A 4KGJA 4N12A 1W5BA 4NUGH 1QTYT 4ZIRB 2QDXA 2Q3CA 4IXWA 2R84A 2N3JA 1GYUA 3H1EA 5E8NB 1Q0HA 2IC2A 4I1IA 3LEYL 3HVDA 4Y2PA 2FQEA 2O2ZA 4CN8A 1LGYA 3G9XA 2DLIA 2QVMA 4MQSB 2C5DC 3K73O 4NAUA 4IXDA 3VG0H 3WTTA 4X98A 3T0XA 3MRLB 4JMXA 4E5DA 2OVBA 5T1LA 3QHFL 4YUEL 1HK6A 3VPHA 2HA1A 5KPJA 1C3OB 3KEGA 4I2VA 2X1QA 2OMWA 4NCJA 2H3EA 4UZEA 2XNJA 3SDYH 4RW0A 1L0YA 1O94D 3IBEA 4EW6A 1IBHA 2NSDA 3R7FA 4IJQA 4GT0A 4L29A 2VZUA 1T7ZA 2AC4A 4URZR 2AC0A 2E4WA 3UZUA 4AXXA 4JJHA 1WDLA 2O6HA 1ESMA 3P97A 5I8KH 1KLGA 1RHUA 4HWTA 5EBMB 1HORA 2UZIR 5CFPA 1C1XB 3DEIA 3Q6NA 1TVDA 3VD4A 3RFZA 3GSUB 1TJGH 5M5BA 4ZDKA 3G5YA 1W0YT 5AVRA 4Z3JA 3HB9A 3RY6A 2H5JA 2VLJB 2NW6A 2IALA 2NZUG 4GSUA 4HEHA 5G0SA 2HM7A 3DETC 2Z4SA 4D45A 4AYSA 3P1VA 3PFGA 3TR6A 2YLHA 4RMIA 3FM9A 3PHSA 1PNOA 4KQXA 2K8MA 2EZ0C 1UQUA 2XZTA 4ER7A 3H4HA 3T7CA 4DKTA 2EWMA 3K0EA 5SYNA 3RPIB 5AXCA 3GEBA 1MFCL 3P7MA 4GOXA 4Q3NA 1VJSA 2GXQA 1N1DA 4MVXA 2YGOA 3HA3A 1TFHA 4S1DC 4PTTB 3MV9D 5FAAA 4AGLA 2WQZA 2I7SA 5ACMA 3V7AE 1VPEA 3KQWA 2OFQA 1R3UA 3KBEA 4RQQA 1FIEA 1WCBA 3RVTC 3ORQA 4C0LA 1I1FB 1UURA 1GZ3A 4C0SA 2UZPA 2DFDA 4W70A 3WJMB 1QEXA 2ZB8A 4NWUL 3PC8C 2DQIL 1JPGB 4I3RH 1I24A 1YMVA 3WFBH 4RF5A 4AM8A 5KTEH 1O89A 2ZE5A 3LH2L 2XKBA 3GSWA 1Z5LA 4WTZG 5E1AB 5HWSA 4H0CA 4PGGA 2D7PA 1E7QA 4PC1A 1OGSA 3TGXA 3WD5H 2BINA 1M1XA 3KLBA 1F45A 5JORA 4FHBD 2BKAA 1IN4A 3ZU8A 1IWOA 2WJVA 5B3AA 4YRAA 1JSRA 1K6EA 1QR6A 2OK7A 3TIFA 1FL3B 3O9WD 5DF0A 4IRJC 1YB6A 4TLAA 5D51S 2G9HA 3ND6A 3IH5A 5MFPA 4RZHA 3IETA 5FFOA 5BO1L 4MMXA 2VIIA 5AEAA 4PLTA 2R86A 3SZ3A 2OYSA 2J1KA 5JDSB 5D70L 2EIBA 4O58H 1YUMA 1ZSHA 2OX5A 4EPXA 4R69A 3GZNA 2WMPB 3O3DA 2W2TA 4M9QA 1F0LA 2ICCA 3U0PB 2OPHA 3D3QA 4QPEA 2FX8H 1TLMA 1RJLA 5ERWA 1ID8A 4TMZA 3KVRA 6TAAA 3O4LD 1O2DA 3QWFA 5IAGA 2HQOA 2NVWA 4K05A 4M9SA 2Z8VC 3N0XA 3T0IA 5D1XD 2HTFA 3TTYA 2B16A 5D7EA 4TGLA 3QMPA 1JMZA 3LUDA 4ZFOB 1QXSA 2LE9A 1BE0A 2C5EA 4HC1A 1KZYA 1B6SA 2V0AA 5HK8A 5BR7A 4HMEA 1L5WA 4OAWB 4ND6A 2CJXA 1EDOA 1RRMA 4G4IA 3NYIA 3MMPA 5HHNB 3AI2A 3DE6X 1XG5A 5A0VA 1E5CA 2OR8A 4DCOA 3T38A 1BSIA 3AY3A 5C8JA 3V52L 1C9SA 4DN4H 1IYZA 1NWPA 2NX5A 3WL8A 3TH4T 1KRXA 3MXTA 4C88A 3ZBMA 2OAAA 2F5BL 2R6GA 2J8UA 4RVDA 3DSNA 4M87A 5JMOA 4TTRA 1RZIB 4BH7B 4HKJB 4LYGA 3HN6A 4JVSB 1XXFC 4A0RA 2W65B 3HADA 1Q9WA 4OD1L 4XARA 1ZUWA 3IDYC 3QQDA 4HWBL 5T3ZH 1AKQA 1YFKA 1WIUA 1BEXA 3D4CA 1FU7A 1U2GA 4RPJA 1E18A 5CH3A 1W7AA 4EHDA 2P1YA 4X6BB 5LQNA 3MSXA 1BMWA 4Q3DA 4POUB 3MRNA 3TK1A 421PA 2PZJA 4HQFA 2H1XA 2ZAHA 1R10A 3BKYL 1KYYA 4CMCA 2OJ1A 4BFNA 3RREA 5A1JA 2PUHA 1H9BA 2BFWA 4JO2L 3NBYC 2LU5A 4GPVA 4NP9A 5JHLH 1FNMA 3X12B 4F5WA 3MV7D 3N2LA 4XCCL 4KNTA 3HKBA 3RU2A 2JHAA 3ZL4L 1KDIA 3LU1A 3MTGA 3FXAA 3OKKB 1E20A 1PWXA 2AYYA 1AV6A 4E9XA 3GFRA 4JP3A 3SC4A 1GXSA 5JRZA 5L9DH 3L7FA 3H9YA 3IUSA 5TT1A 1DBKL 2X0NA 1Z25A 5IKOA 1TKAA 4C22A 3WYRA 3O31A 3RJTA 1QRKA 2FO8A 1V1RB 4K03A 1GT91 2C3PA 4QO1A 4M43L 1N3BA 4QY8B 3RGWS 4M7WA 3HUJF 3LX8A 4BNMA 5B8CC 3VTMA 3I4CA 4WJ5B 1EK5A 2Q27A 4O02B 3BC1A 2I33A 2JHCA 1ZMTA 1AV7A 4FULA 4JKOA 3UIZA 2ZSIA 3VMOA 3DKHA 1SM3H 1UB6B 4PJ8C 2C00A 4HBQA 2JGFA 2GSGB 1FNGB 4FBMA 3FUNA 1KH1A 3NIGF 1WOYA 4NHOA 1Q3KA 4WHYH 1MCPH 4M3NA 1W8DA 5MDHA 2E7DA 4D9CA 2XV2A 4O2AF 3CKLA 3GDFA 1Q0PA 2CMGA 2C5BA 2QVCA 5IEJA 2MFNA 1VHPA 4OU3A 3WXWL 1NKGA 1EFRD 4NBWA 3QORC 2GBLA 4HIJB 1ABEA 3GN2A 3TESA 1U7DA 2ZRHA 3LKPA 4ODWB 2WUCL 4DQAA 1NVEA 5EZYA 4N0CC 2GS9A 4BKPA 2J3HA 2PUCA 4F8OA 1PYWB 2PD4A 3PJGA 1QHPA 2QPDB 2HK9A 2QTEA 1C8BA 3OECA 1FVEA 1LHZA 4PJHB 1DANU 2CCKA 3OJDA 3WY3A 3L3DB 5KDLA 5BO5A 2D0HA 4X66B 4IQ4A 5FLVA 4WAUA 4Z8FL 1TCRB 2E8YA 1SU8A 1EMTL 1T3ZA 4BINA 3TZQA 3CCBA 3E9UA 1GTRA 1O7DC 4FSHA 2D9CA 4CVUA 1LDPH 2QSUA 3F6YA 4Y9UA 3DTUB 4LAFA 1JGEA 2R85A 3EH4B 5EFIA 3ZQ4A 4BN4A 4ZW8A 1W1UA 3L3JB 3HKDB 4C0AC 3FN3A 1LSJA 3F5FA 1EBPA 5EFZA 1NFFA 5TGTA 3RK1A 4XVSL 3WK8A 1V4BA 1XH0A 3ELDA 1J8FA 2H3NB 4EZEA 1SBCA 1Y1TA 2Q7OE 2O8EB 1CF8L 1DSSG 3IYLW 4XXDB 1AY1H 3UK7A 5K4HA 3FFCE 5C4MA 3WU1A 2ZM6B 4BTVA 1WXQA 4NV1A 2UYGA 4MA3A 3CZSA 3UVEA 3RS5A 3R3YA 4ZAKA 4J4HA 3T8XA 2XJ4A 1X7ZB 4H1LB 1EK3A 1Z0ZA 5E2BA 6REQB 2IIVA 1B76A 1NL0L 3ILPA 3QE5A 1A7RH 3UOGA 2A3TA 3WUWB 3EQ7A 3PNWB 3P0GB 3WB2A 4Q4IA 1WVGA 1R5WA 1F2UB 3OE7D 3T3MB 4BSWB 3KSBC 4PNHA 3LQYA 1T3FA 1CXEA 4BNIA 1P1RA 4OZGB 2J7LA 4L2IA 3KD4A 1AFVL 1LP9F 4FQIL 3GARA 4MKHA 3DL0A 3Q88A 5EIQA 2ZBVA 1R00A 1XGUB 1N77A 4YAUA 3K0KA 3SLGA 4TN9A 2JI2A 3F2IA 1N2OA 2CJSA 3LDBC 1LF0A 4UQDA 1IUOA 4WRLA 1Z3CA 3S28A 4OI0A 2AQ2A 1XVIA 3VPFA 2BBSA 5HXAA 2F53A 4PN7A 1RQ7A 2Z8YM 1AKUA 2FWSA 2GN9A 3WMGA 3AVTA 4H8HA 2QD3A 1T5BA 3SCMA 3WKQA 3NLLA 3C1AA 2C7GA 3SYQA 1XC7A 2ADJA 2ANBA 3MQFA 4W4OC 1I8KB 3EAQA 4M1KA 5GS2D 3D39B 2GPAA 2QN6A 4UPEA 4LNVA 4AXBA 2GR9A 2FZ3B 3VQ1C 1NUPA 3E7FA 5CD5C 5T5FA 2RCYA 1S7QB 3VU9A 1NW7A 1SOMA 1RZFH 4F7EB 3A67H 2XW6A 4OLUH 5FUWA 1EUQA 3G04B 4UM7A 5B21A 3GOQA 4F04A 3KU4A 5BSFA 2JH8A 2VDNB 2VERA 3SKMB 2O7SA 1JF1B 1CN4A 1JBJA 5E8EB 1YHNA 4AQOA 5AAWA 3MBEA 4ZMVA 1L7TL 1FFHA 4MV8A 1CT9A 1VAHA 3HNRA 3O4HA 2G04A 4K5NA 4WI1A 3H9GA 3VNSA 1ACMA 2CXPA 4ETNA 1I9IL 4OAOA 2M6KA 4BDSA 2FYVA 4ZYKA 1T6VN 3O0DA 4JVWA 5LMCA 1HOEA 1XA3A 2XADA 3OR7A 1C0EA 3M4XA 5E8DL 1OSNA 1NQUA 2PH5A 5D7KE 1J8HA 3NGBC 4AP6A 3VXOA 1KKUA 3G8YA 3IKJA 4GEKA 2ZQYA 1N5LA 4E15A 1DBML 3MW8A 1MDFA 5KOVC 2A14A 4WOKA 3WI9A 3U4EA 3UYPA 2DU8A 4EW3A 4UTZA 4NU8X 2XQJA 3UWDA 2CAKA 3ZQ6A 3DJRA 3RWDB 4ZZ2A 5A16B 3OX3A 3QYFA 2Q1TA 4CMHA 1FDRA 3U3XA 3PNMA 3VXUD 3RJDA 3FTYA 1U9CA 4I9FA 4A0FA 1CFNB 4K5PA 2FSSA 4UVDA 4XCFH 1E7MA 2ZYTX 3CISA 2FH6A 3DDUA 3C4JA 4FQ7A 1D2OA 4ZFQA 1PBNA 4AROA 4X5WB 4Q7EA 5FCDA 1S89A 5EB9A 3OKYB 1NIJA 2K7PA 3AEQB 4AYID 1YI1A 3Q7RA 5DTJA 4QEZA 4D4IA 1RP8A 1GTNA 2WU8A 4JRXD 3ARGD 5I7AA 2CLSA 2UVPA 2XLBA 5CP3H 4RWEA 5HIMA 1JLKA 1TNDA 1YBHA 2HJSA 3AYXB 3VFPA 5CX4A 2J30A 2B2XL 3PEWA 1P69B 2X7HA 2XITA 2AQ1A 4JQCA 4M5ZH 4Q7JB 1YMMB 3B8HA 3LI2A 3QXSA 4Z0XA 2NTEA 4PTUB 3CFTA 2PO6A 2GHRA 1JGVH 3KQVA 1J8SA 2VSKB 4N90E 5EC2A 2ORIA 1W6RA 2ZJSH 4ODVH 3CZFA 5I1IH 4XHQA 4MS8D 4DK3A 2AVDA 3L8ZA 5EL0A 4EYGA 2OGUA 3AQYA 3BVPA 2FW7A 3B3QA 2A1UA 3AWIA 4J4TA 4YDJA 2VRBA 3TLKA 2NXNA 3HS8A 1W2WB 2EP7A 3VBCA 2OV4A 1TZ8A 4ZUUB 4C4AA 4ARSA 2LR0A 3AAZA 4B96A 4RMGA 5KG9A 1RZQA 4XW2A 1RWQA 4U4AA 4XLZA 4PFQA 1N2CA 4RKWA 2E59A 1D4ZA 3G0BA 4BP8A 1AXRA 1GKUB 1X3DA 1Q83A 3QVWA 4QWWD 1NZDA 4HDSA 4L3CA 1BLNB 3NA4A 4G6FD 4DT2A 4HUTA 3VGBA 3VXMB 2WSSA 4PPNA 1E2UA 2B3IA 1Y1RA 2GF0A 3BUSA 4FI6A 2X9VA 5FOJA 4Q74A 1EUZA 4UTBA 4HXAL 1ZWIA 2OM6A 5DJXA 3SGJC 3LLSA 1BBJA 2GTZB 3W2TA 4AENA 5EZPA 2CCJA 3TUJC 1HXMB 1NLBH 3MLZH 1S0UA 1NANI 3ZIYA 1HETA 2FQYA 4MW6A 2UZ1B 3UMSA 5LOVF 4AZ3B 4I1OA 1RHHB 3T9WA 1KB5L 3Q8CA 4X7SH 3RDTD 4BXOA 3KXDA 4YVFA 1UGKA 2MOKA 1RTKA 3GP3A 3BWEA 2HF2A 2VLJE 1IUPA 5AVJA 1ZGLM 5DD5L 3EADA 3TNNB 1R6UA 3M34A 5JW4R 1LPOA 3WCYA 2H1LA 3A3PA 4JFPB 4Z3TA 4HAIA 4QTIH 1DUVG 4MW5A 2XUWA 4Q6IA 1IT9L 5M29A 2VZ3A 1IBCA 4KAQH 4H4DA 2V96A 3S5LB 1D3AA 1E1RD 4JBLA 2AAAA 1HSBA 5I26A 2WTXA 3KQPA 4YUEH 3IS3A 3THXB 3U4QA 3BZ4B 2VHCA 4H4CA 3BLBA 4KACA 2K9UA 4HJXA 1VFAA 3KJ6L 2ZSJA 4OL9A 4KK8D 1SBQA 2Q3JA 2X0IA 5CYPA 1G291 4ECNA 3ZWXA 3A9RA 4FYRA 4S1VA 3THYA 4Q47A 4H0GA 1YA4A 3KWWB 1KO4A 5I01A 5ER9A 4RH1A 4ZVLA 4BJ5A 3YASA 1U0GA 2ZONA 3U0WL 5IHHA 1W34A 3T3GA 2C9BA 2OO7A 4F9TA 3S5ZA 2FDXA 3OF3A 4HCRH 3I9FA 2NUAA 3PDCA 3CPEA 1Q90A 5L88L 4OBWA 3BIFA 1ZK0A 2Y1XA 2J85A 3IT1A 3JQ9A 1L5HA 2Q9CA 4ZHQA 4ZW7A 4HS6B 1A9QA 5JD5A 5EKTA 1HHJA 3WKBA 1X94A 2C29D 3QJFA 4QHPA 3CXDL 4FA8A 1X92A 4G5AA 1EK2A 5FK9B 6CGTA 2GK6A 1JBKA 5JW4Q 2SKEA 4W9KC 5LNGA 3CUYA 2YQ2A 3RRQA 4RZKA 2DQJH 1Z0NA 3SGEH 1ESCA 2RGGA 1KJWA 4BE4A 1DXQA 1BOGB 1DJHA 3MJ4A 4FP8L 3TQOA 4YFYA 3BWDD 1F86A 3GEFA 4YMSA 5F6IC 3OPZH 1C12B 2QRHA 3IFPA 2NY4D 4GBXD 3GUYA 1Z2PX 1JI3A 3WN6A 4G0XA 5K0SA 3MOSA 1KGUA 4P57A 2AZUA 4EA8A 4H3SA 2UUAB 3VR5H 3I61A 3QOWA 3IF1B 4K88A 5J11B 2QT0A 3TX6A 1MO4A 3ABZA 2NXZD 5EP2A 1ZJ4A 3ZMRA 4UM9A 4XAWH 4NXNB 1S02A 2QAIA 3IAS6 4I4WB 3EPPA 3GLZA 4H1LG 4ZMNA 4YOKA 3GZOA 1YJ8A 3AHGA 5BW7A 5HS6A 4OUUB 1PJ9A 4QD2E 2C92A 1PZGA 3WUWG 3KOOA 4ALAL 5GGTL 2EG5A 1IEBB 1OLSA 3QIUA 2R39A 1Q3TA 1FH2A 2WLMA 3BE1L 4EVQA 3EYVA 1CU4L 3T7IA 4IF6A 3PNRB 2Z93B 2WT8A 4X3OA 5J9FA 4YI5A 3KFXA 5SY9A 1XMEB 4EJSB 3S35X 4O2FA 4QAJA 2XECA 5I6OA 3G13A 3SD5A 4QT0A 5C5DA 3SKNB 5EU4A 2CNLA 3MX0B 2HYDA 1TIBA 2Z08A 4Q02A 3KZXA 1J7JA 4GXRA 1A8UA 1YAJA 2WU4A 4QLAA 5FJJA 4TTJA 2XTAA 1J2EA 4UFNA 3GLIA 4M5SA 2BSTB 5EKXA 4YIKA 1C5CH 1HL5A 5LN8A 1JLLA 1P7QD 1FL9A 3THRA 1VGEL 2ZD0A 3FYUC 4B84A 4J3NA 3I9OA 4MV1A 4A7QA 4PGCB 4BV8A 4DPBX 1G3IA 4NAVA 1HG1A 2FVYA 1PGRB 1GGFA 3LNDA 3GH3A 5TK4A 1CXZA 4FZEL 4F58L 3E8VA 4KV7A 1DAMA 2W6JD 1ZSDB 1DU4A 3LN4B 1J1OH 4MD4A 1MQKH 1QH1B 4EBBA 5GGUB 2DSNA 2XHZA 3MJ7A 4J7AA 3FDJA 2F68X 2HH9A 5LMUB 3MNVB 1XAKA 4R96A 4IWNA 5EXEA 4KQHA 1HE8A 1OUMA 1NY5A 1ORQB 5DNWA 1W0KA 1NUFA 5G0TA 2X76A 1J8DA 1PFUA 4MAAA 3CZ4A 3MCYA 4OD1H 4K71C 1DT3A 1ETZA 4AJKA 3KYOB 2OGTA 4E6EA 1L4HA 1H23A 4RMTA 1GNQA 4IKKA 1ZEJA 3E84A 2QX8A 4XRCA 4LVOC 4NJOA 3LY8A 2WWMC 1T34A 1C16A 2VPYA 2XBMA 2I80A 5JNLA 2I9PA 3HB7A 1FPTL 2VP5A 2J5QA 3ULSB 4JO2H 2P3YA 2HJLB 4WQMA 4UOJA 2O1SA 2WJGA 4PE5B 2EYRA 2C4HA 3BA6A 2RB8A 1ZVVA 1MNUL 5DCUA 5E6IC 3TRFA 1OWPA 1FFYA 3MXVL 5AOBA 1S9YB 2WHYA 1FSSA 4GOJA 3GJFA 4P9HC 3V4VA 4NH0A 4FLEA 3GFFA 5F6HI 4J3OH 4GQRA 3CN4A 2L8AA 1S7GA 5CFQA 1G20A 4IKLA 1EGJL 1T9DA 5AHXA 2QQ5A 5FB3A 3BESR 3W82A 3MJ8B 1S5IH 7MDHA 3MZGB 3K6JA 2P41A 1KORA 2L2QA 4OG2A 3BQMB 2BY0A 3UAJC 4PJHE 1ZHKB 4AT6B 3TB6A 1FNSH 3GMRB 1UJNA 2NZJA 3PL6C 1UBJS 3B3GA 5B1EA 2X77A 2BHLA 4QDZA 4JFEA 1HPLA 4L9LB 4CADB 2R25B 4WW2F 5IJBC 1DBJH 4OIIL 3TIVA 2GAOA 2I2CA 1WXHA 2VM4A 4N0UB 4R51A 3GLGA 5T1KD 4LJAA 5KJ6A 2EKLA 2IBSA 4B0OA 2NY0C 1IHXA 1MPAH 3IEPA 3SKJL 3B2VL 1JR2A 3WGTA 1A6UH 4LSDA 2R2BA 1G64A 3CWZA 2IPNA 2NZIA 1UEYA 2QM3A 5F9DC 1ZJAA 4PJ9B 2NR6D 3KJEA 5CJOH 1FFWA 3WXWH 1G1YA 4KE8A 4B9EA 1OEZW 2HIAA 3D9QX 2QHRL 2QI9C 5GS0H 5IUJC 4MRAA 4G36A 4ANXA 2MSDB 1X80B 2WTMA 5GGYA 2HA6A 3H1GA 2WUCH 3MJGX 3OAYK 1Z16A 3ZGLA 4I1NB 4JZJA 3U79A 5LBVA 4HIXL 1R8QA 3IAM1 5EO0B 1IRXA 3L48A 3T4AB 3W39B 1DVQA 1F0YA 2WK1A 4MQ7B 1NGZA 1GRWA 3QIBC 4E12A 4NHUA 4QHMA 1ZMRA 1U3YA 6GPBA 1U63A 2HLNA 4MQEB 4XUCA 3X1MA 4ZICA 4MXVE 2CPUA 3G7UA 2Z5GA 3W06A 2YBEA 5DHVB 2HQSA 4IMKC 5B58T 4C4UA 1UPAA 3T3ME 1NJ9B 3FO0L 1EM8B 3CVIH 5DMKA 5JR1H 4NBKA 4MPRA 4D99A 5HX7A 5F3HA 3G5MA 1IIKA 1JYWA 2YYYA 3DM5A 1A9PA 2Y1FA 3TBTB 3EF7A 5AW1B 4ODSL 5B4MD 3HI1A 4P3XA 2DOCA 3D0VA 4NQXB 2WXLA 5A9SA 1BHQ1 4RVFA 1DV1A 2OA0A 2PP7A 2CWDA 3FMFA 5EG5A 5H94A 1CF8H 3LK6A 4R7NA 3LPDA 3ESDA 3WG7B 3X2EA 3B34A 5G1NA 1JZEA 1QPZA 4A2CA 4KKCD 4KVCL 3S29A 3O83A 3P4UA 1E8XA 3I6YA 2E85A 5HSGA 4CXMA 1AHKA 4JCOA 2W9EL 5LL6P 2YNMD 3ZHTA 3QVTA 2HJKA 4GSQA 3W79A 3BE5A 4JL5A 3FWYA 3GIWA 5AM4A 2GXSA 1SHZA 3ORYA 1KDTA 1RWMA 2GBVA 2WD8A 2KPNA 5FM4A 4NE7A 3D39E 1MHPA 1IE3A 1TETL 3DMDA 1UBLS 2ZBQA 2Y3IA 5HGGS 3ND8A 3K94A 1NCWH 5DOVA 3GK8H 1CFSA 4MTMA 1VIVA 2NRDA 3KR2A 1XRNA 4P3DA 4CM7A 4Z0BH 3QUXA 5FBLB 2EECA 3SE8L 2YZMA 3RL2A 1W0CA 3S5LG 2HBRA 3MRGB 4FDMA 4HWUA 4I9HA 3GDCA 1HBJA 2VZVA 3DT9A 4U0JA 3PKIA 2LW7A 3KNBB 3N86A 2GTWB 2EDCA 5C08B 3ZH9B 1I4OA 1TEHA 2QZQA 4ZI7F 2ZCUA 2AMGA 3W5UA 3C2QA 3HZKA 3DYMA 2A1TS 3PB3A 4F57L 2QR2A 4DC9A 4NU0A 5BV1A 3LXMA 4NBUA 4PTZA 4CKWB 1HRKA 1M8KA 1XBTA 4YHPA 1NY6A 1C8VB 2P5PA 2Q76A 2XDHA 1EVQA 4NYIR 3L7YA 5L3ZA 5AW6A 4A15A 4DF3A 4GRWF 1DAEA 1G6RL 4PWJA 2NPLX 2DQHL 1YF3A 1IEAA 5I18L 3ETEA 5L6YL 2PZMA 2YJNA 5DQDL 3ZTJH 4CJ1A 2MSKA 1FO0B 3D2UA 3WAJA 3AG5A 2BX5A 5AVVA 3X13A 3NJVA 4UNNA 5JQGF 3S55A 1E3SA 1PR5A 1NAIA 3UP6A 1DBQA 1LPMA 3GAFA 5TS2A 5CDHA 1QACA 2ZOKA 1W29A 2C34A 2CHVA 3OB8A 1XCQB 3ZXAC 3NK3A 4GDMA 1ZCBA 2B9EA 1MI5D 1LBQA 4GPAA 3TX4A 5AW0B 1QP8A 4PAQA 4AUMA 1OOEA 3KYNB 1DBMH 1L7VC 1THGA 2BMVA 3HUJB 1TTTA 3IBSA 4XI9A 2HVJB 5GGSY 4D96A 3KXPA 3H1PA 5GPBA 1QPXA 4XZUA 3ZIUA 2HX7A 3W37A 5CAEA 1YMME 2W94A 3QRGH 3NIGB 3QPQC 2E0IA 4FOMA 1DFBL 4B7AA 3C3EA 3JTSA 4F91B 4INZA 4O2AB 2VDKB 1U0LA 2BKXA 2RJMA 1C7FA 3ZBQA 3A6JA 4CKYA 4CLRA 1O6VA 1CTNA 3ZGNA 2B08A 3DGGA 3AGVA 1JEEA 3JWEA 4JQZA 3OEWA 3CB4A 3M5DA 1DV2A 2C1ZA 4KI5D 4ETQA 2FWOA 1BLIA 5LIPA 3CJRA 1BF8A 4BFVA 4X7EC 4ZXBA 1X5XA 1MH1A 1TYZA 4ZJ9A 1QFHA 5GZND 3IU4L 4OIBA 2JIXA 3TZCA 3Q6GH 3KZVA 5IQLA 1XEFA 2ZI7A 3B9KB 1Y3DE 3AIKA 5ALJA 3TN0B 1NBYB 3IMUA 3FU8A 4UU0A 3A4IA 5AW8B 3WSQL 5JZVA 1L2TA 4MXDA 3UTSA 4IGBB 1D2AA 2J71A 1YMHA 1MIOB 3VXME 1OAKL 1VLHA 4NC2B 3T7AA 4E1AA 2Y5TB 5AALA 1MO3A 2QRNA 4TTIA 2M8XA 2E49A 4KN5A 1KC5L 5EWMA 4XMLL 1UM5L 3ZHFA 4R9SA 1JR6A 2A92A 1AGBB 3UTTA 4Z6KA 1Q7BA 1HXYA 3QF7A 2FX9L 4OKNA 3X1YA 4LXQA 5TPWH 1PZEA 3B6EA 5DYFA 1PZFA 1A7QH 3H75A 3K0HA 4I9XA 3LZFL 4LHVA 4O2RA 4X7TA 1G8YA 3DO7B 4LPCA 1MFDL 4MRMB 1PD6A 2B8OT 3MUNA 2W2LA 1LO5A 2FWMX 3KYDB 4PY8I 2NLOA 1ORDA 2J45A 3CFKA 4G80A 3KPUA 1S8DB 1Y8QA 2CJUL 2MSWA 4MH0R 1Z3GH 1D9KB 1PX3A 1Y0BA 1B4DA 4I8XA 3EY4A 2LVCA 1I13A 1R9FA 3E3QC 2QV2A 3LB6D 2BSXA 4LCVA 3Q3GB 3R8QA 1GNRA 1IE4A 1BXZA 1UA6L 3AF4A 1LP9B 4OF5A 2ZVPX 3JVUA 3TUIC 4HWGA 3G5AA 4XN7A 1ZKAA 1CYDA 4TVBA 3QU9A 4YVUA 2ZXWB 3WDLA 3V4LA 2XUIA 1GC1L 2A78A 1FYTB 1EXWA 2XYVA 4XAKE 4KOCA 3B1UA 1TO2E 5KSOA 2FP3A 4X1IA 4W5NA 3V33A 2E9BA 2F43A 2VHVA 5INCA 5B36A 2GY5A 3QOYA 2DD8L 1NM4A 1E5UI 2G0KA 2Q1UA 5LLSA 5D85A 3CX5J 1XJ0A 4D9QD 2W2KB 3FZUD 2HBQA 4ZTOL 1IT9H 3UERA 3FOWA 3DURB 2GLTA 2W0LA 2RJNA 2BNRB 4PONA 4RBPK 3SGKC 5JFOA 1JLHA 4MEJA 1N6RA 3V80A 5ICYA 4LHXA 1UACL 2X14A 1D7BA 1VCBC 1LNSA 1YRWA 2OCKA 4LJSA 1CY8A 4TLSA 2PL9A 1HEYA 3UENA 1ATZA 4X8CA 4F7KA 2D1RA 3QFSA 1NRWA 3KKEA 3KJ6H 2C57A 3ARFA 3WHIA 1OIWA 4UMDA 3VPGA 5EIWA 1OB2A 3FJYA 4KKPA 3L02A 4K9PA 3VSEA 1D5XB 4PX9A 3EYUL 1T5SA 3H9UA 1V3KA 3DLCA 3T7EA 4UBDC 1QSFA 4ELKA 2QRUA 5F7FA 3U1SL 2FBJL 3HE7A 2K8QA 2YN2A 2YIDA 3AUFA 1E7SA 2A73A 2DQEL 3RGVA 5L88H 4JZOA 4M37A 1FMLA 4X20A 3TM5A 1FP4B 1BQRA 3CC5A 4Y30A 2P0YA 4AV5A 2SEBA 3B20A 1DL7H 3N8GA 3ANNA 1OJ7A 4MAUL 3U3JA 4P2RD 4MX7B 4D7BA 1O6GA 3OPXA 3B8SA 5ALCL 3CXDH 1FNEB 3MRDB 1SA0A 3KEOA 1WZLA 2ICWB 3U1PA 4ONFL 3KPNA 4PJBE 5TLSA 2ZBUA 4MYHA 3IGAB 2VCHA 4YO0A 2AK2A 1YG9A 1L1RA 2DWUA 2LIPA 1XH1A 2V2XA 4P2QB 3QR2A 1V43A 2BSRB 2W6NA 3OJXA 2HWYA 2OQIA 2VYCA 1TJ5A 3IDMA 2X09A 5F35A 3GBMH 3VSBA 1RMQA 4S2UA 4ZAFA 4QRTB 1YT5A 4OF3A 5I9BA 1IEWA 3TEWA 1L5YA 3MA0A 4TNGA 2G2PA 1GIGL 1XF2A 4BMVA 4B4WA 2HLEB 2AIRA 3BRWD 4FNLL 2Q7NA 4R9UC 3DKRA 5DRWA 3IIMA 1KDVA 5C4GB 1KCUL 5ILTL 1Y0LA 4BCCA 2FEEI 4PWIA 2JFWA 4V1DD 5IESH 5LBGA 1CJVC 3H0EA 4U5XA 4QTHB 4WKZA 5H3LA 3EH5B 3N5AA 1NIEA 4DIBA 3D50A 5EIXA 1KJ8A 4NNXA 1FGNH 1BU8A 4J1SA 2RA1A 5DYYA 1CTQA 1OF2A 5L4FA 5ETJA 1UXSB 2ZG6A 2VJ8A 1JHKL 4YRJA 4R3UC 2QROA 1OGAA 4FBGA 3PWUA 3UCXA 1KKLA 2FEWB 2OSLA 2XGJA 2GN2A 4PLJC 4DLYA 2G1UA 3HUUA 1JKXA 4L75A 1HM5A 3KPMA 5J1AB 2HTLD 1RCFA 1T15A 4NOKA 1ZD2P 3T15A 5IN5A 1RM4A 4FDVA 2IY9A 3SNHA 3ALPA 2GA9A 3T0ED 3V2GA 2HFGL 3AW5A 1JPSL 1SKUA 3PQYA 1PHPA 1IGJB 2Y69B 1ACXA 4IQHA 4YHIA 3IS0X 1ZVNA 4DWJA 3I1IA 5I7VA 4X7MA 1VGEH 1MRZA 5AD0A 2EFGA 1HH6B 3WTXA 1X74A 4LYHA 4WZ9A 4AJ0A 2FWAA 4P23D 2JJTA 1PZMA 2B0SH 3FQ1A 4HRYA 4U31A 4Y4HB 1PP4A 3E9EA 2PW1B 3VKHA 4XCQA 4FZEH 1HH9B 2X6QA 4BUQA 4PBDA 1EBFA 5EQFA 4AGQA 1I9CA 3JQGA 3AETA 4PWEA 1XSJA 2V3WA 3GP8A 2Y2UA 1E2KA 4NYJR 1BQUA 3ZK7A 5CJQH 2V65A 2EERA 3KV3O 2OZ4L 2RC5A 4JHVA 1T1XA 5B7QA 5LGKA 1T8UA 3L4XA 3N06B 3PREA 1O3YA 4PC2A 1L5FA 2QPTA 3ODPA 4DP0X 2VDRL 5LIRA 4Z7UF 4FGUA 1Z15A 2Q1EA 4BO3A 2P2ZA 2ZG2A 4LTNA 3J7TA 5D1QC 4ZXFA 4YGYA 5LVAA 5FGSA 4MS3B 2IAMB 4J2TA 4EHFA 4IIEA 4OF8A 1A50B 3NDJA 2X8AA 5LOVB 1GGCH 2R00C 5HF9A 5A2BA 3FTGA 3QWRD 3ZTTA 1DO8A 4CU7A 4MV6A 2R2CA 3NHZA 1FLTX 2AWNA 1FPTH 1PU0A 1QS0A 4N0UE 5K9OB 3I2KA 5JYEA 2ZWYA 3FHEA 2ZZMA 2F7QA 3RF7A 3SHVA 1E64A 2NYZA 1HUQA 4B7CA 1IAOB 2WFAA 2B94A 2Y1YA 3OL2B 2XV6B 3KPJA 5J6GA 5GY7A 5BO0D 3WO3B 4WEBL 2F3PA 1G8FA 4LJKA 5ITZB 3AQXA 4L5JA 3U1TA 3KOXA 3LDUA 4XGIA 3PIQA 4XNUL 1EGJH 5AVYB 3IJ7A 3H6KA 4JL2A 5FI0B 4PO1A 5DGTA 5TV2A 4EX7A 5TDNB 3FYSA 5D1ZC 3VXRB 4G6AD 5DJ6B 1RQLA 2MYNA 2M9MA 3NHUA 3EYOB 4JG1H 4X5OA 2EXWC 2DFVA 1UKYA 5FO8B 3SKOA 4IIQB 1IN8A 5FW7A 3ZIMA 4IGKA 5H2BB 1YZ3A 2FA9A 4GKZB 3I9PA 2OMYB 2I3ZA 4JBHA 4ZGBA 2ZJYA 4X8OA 2NZ9D 4Q7LA 3O6LL 4RGMC 1XRPA 2OM5A 2HXGA 4AVYA 1WXXA 2V4ZA 5E4TA 4TTDC 1VYVA 4G0PA 1XAUA 1X13A 3SKJH 3B2VH 2OD2A 3BSZA 1G1CA 1BFTA 1GCUA 5C7ZA 2XHNA 1UWKA 1RI8A 1JMXA 3O8XA 1FG2A 4U6TA 5DMXA 5EEXA 3NP4A 1IPFA 5BOVA 2DIEA 3CE6A 2QHRH 1EGHA 3T34A 2X0FA 5CCBA 3VR6D 2GARA 2BDNL 2CNNA 1KOAA 2O48X 4E22A 1D5ZB 1HFUA 2PSHA 2WLLB 4HIXH 2N47A 3I9AA 1CR2A 2IXDA 1F41A 1CE8B 3F3MA 2YKLH 4GKJB 1A88A 2GG1A 4PRIA 4HN9A 3EOZA 3KZMA 1OALA 2ASEA 4P98A 1YNLL 1NR5A 5CDYA 4X50A 1O6SB 4Q4DA 3BFVA 2FLKA 1I2BA 2CCGA 4R1TA 4K4KA 2RFLA 4HSQA 3IJYA 3Q5EA 4EARA 4JHWL 2M6SA 5MHSE 1GEGA 3BB4A 3VFTB 1O5IA 3CZ9A 1ZGGA 1ASPA 2IQ9H 4FNOA 4QMEA 4AC4A 3AW8A 4S0XA 3M17B 2BFAA 1K8DA 5WRFA 2YUVA 2AG1A 4AO7A 2Q86A 3HZOA 3GTVA 1B42A 1GARA 1M2WA 3LS5L 3LGXA 1QJ4A 5CSGA 1FNHA 2YICA 3E9MA 3W9UA 3RWCA 4DMKA 3CFDB 3OKDB 5J12C 1G8GA 4YRRA 2L7UA 1RYBA 2Z1PA 1HWHB 2K2QB 3LS4L 3RD5A 4EKYA 3AJEA 4X6YA 4R90H 1SJ9A 4HDOB 1LW6E 9CGTA 2BEVA 7YASA 2AOWA 1Q1PA 1XCBA 3RG2A 3TE6A 5C08E 4H4EA 3WI7A 2JGLA 4ZPTA 4P5SA 4DG5A 3FHQA 4QDOA 3N59A 3MLXH 1RAMA 4MRPA 2W8BA 3D3WA 4QYSA 3K9NA 5EV7A 4EI6A 3GHEH 2WUBH 1KI1A 3HS9A 1CICA 4I4TA 3QPKA 4N86A 1CWUA 1M4KA 2F7OA 4EMZA 9LDTA 5I1LB 1A4XA 2Y27A 3CBGA 1T6NA 3AKZA 1WRFA 1VGVA 3OM9A 1CUUA 5EF3A 1WMSA 1KKMA 2YAMA 3V7NA 2CU9A 2SHKA 1K85A 1FXWF 5L51A 3W5CA 4NUPA 1WA2X 4GBED 4R31A 3M6XA 2JTDA 1WV0A 4NPCA 5F6HJ 1NLZA 3QFGA 4PGEA 4GPBA 1U81A 4F15B 1CRQA 4PBTA 5DXWA 5C7OO 3LY6A 3REGA 3CLSC 3OH8A 2XIBA 1Q12A 3OQIA 4EF4A 2AD1A 3EZLA 4PQFA 2A94A 3KIPA 2O8BB 4LL1A 3V4PA 1Y33E 4LF3A 1KF0A 5JJCA 2FJGA 5E1DA 4Z9YA 1W72A 3WRVA 1VB5A 1WC7A 2VXTL 3L1EA 2FOXA 3QJHA 2EVFA 3D7NA 4P2OA 2J6HA 7ABPA 4WUUA 2DLNA 3RIEA 3LWDA 3EOAI 3OQHA 1YPZF 1JH9A 3DBLA 4F57H 2R83A 3MV11 1RRKA 1Z73A 3OFVA 4RK1A 32C2B 3GFVA 5LZ5A 3K4HA 4E4YA 1BHO1 3FN0H 1SFDA 4DF9A 3ZNQA 3RK0A 3HUJE 4LSVH 3UJNA 1VE9A 1LEIA 1QW8A 1SVOA 3QAZC 2XGMA 5JVDA 1I1HA 2R6R1 1T89C 4P92A 1QZZA 4YK7A 4A6YH 5KEZA 2WYZA 2OLEA 4AF8A 4ACAA 4GLRH 2I2WA 2VRWA 1A8IA 4H3HB 1WULS 1G6RH 1A14H 4P5DA 2ITCB 4YMUA 3NIGE 4U6YB 2WINI 4FXOA 1OXBB 4K94C 4NCIA 2VUKA 1U7OA 5L6YH 4PJGA 2IUYA 1KQGA 3OIVA 5E99L 4XPAH 1DCEA 3W9DA 4AIIA 2C8NA 1U8LA 4PS4H 4IRSC 2GK2A 3GBNL 3G02A 1KZ7B 4PG2C 1GZHC 4QR7A 5KUMA 2IH2A 1GS6X 2DSTA 3DX8A 3QK0A 1EP1B 4CTJA 1MHTA 1YOVA 4G7QB 1JFLA 4YR6A 1K4MA 3IR7A 1R6TA 3V2AR 1US8B 1XQ6A 4JBYA 1Y4ZA 1AE6L 1PNTA 4MNGA 2H08A 4WHMA 3KYBA 5FPTA 1NP6A 2LD4A 1QWUA 1ZS9A 4L8SA 4NM4H 3MODL 4OFZA 3PEEA 1F2TA 4AIZA 4D7PA 3C8UA 5ARBA 4PY7A 2C1XA 5EHQA 4TQUS 1FI8C 1PFOA 3ZK0A 1IMHC 3LRGA 2GNAA 3FZNA 3JALA 3QG7L 2GCOA 1T4KA 4M00A 2DTMH 4TUOB 5LNDA 5HRUA 4BV1A 5TH2A 5KQGA 4AG6A 1KJYA 5K45A 1T03H 4O6VA 2A1WL 4BK5A 4BGDA 1NAMA 4B45A 4QGBA 1VCAA 2WC1A 5IK3B 3KYAA 3RC7A 2IDCA 5FO7A 1YR6A 1DEEA 3SJVB 1FIGH 4XR9A 2MU1A 2NYUA 1WUJS 3DK0A 3FN4A 4UM8A 4NO0D 1CDOA 3FCTA 3HC2A 1ZHLA 3B7RL 2GZHA 2P5ED 1ENYA 3KTOA 3KW8A 3UFXB 3IKVA 4YDVB 4JW3A 4B8ZA 1ZV9A 4C0XA 4NJ9H 1IM9A 1BJ8A 4E09A 1QBKC 2BSSA 2IIJA 1PR6A 4B31A 4BH8B 2JK0A 5CPBA 1KCVL 4FGLA 3OQBA 2ZRIA 4QBIA 3PNYA 3PXUA 5CWSB 1TQHA 4HFJA 4BQ6A 5EU7C 3OTGA 4MQMA 4DYVA 3RGHA 4ARCA 3DZKA 1OXMA 1JN6B 5C0EB 1OI3A 1VHLA 2FECI 2QQLH 3ZKQD 2NO6A 4MP3A 1HSAB 3R5XA 4FR0A 4NSNA 3MFFB 3Q3GE 2VQEB 3AVEA 3ZKMD 1JDTA