2VDKB

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 129
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdkB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdkB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdkB03
4PN7A 3PPWA 3OKWA 5KYYA 3N2NA 1IJKA 1M1UA 2VDPB 3K6SA 3IJEB 5ES4B 1YUKA 3PPYA 1JLMA 3M6FA 1JEYB 1M2OA 1M10A 1BHO1 3EGDA 1SHYB 4C2AA 3V4VB 5E6UB 5KYNA 1MJNA 2ADFA 2NUPA 5KYXA 5KYWA 1BHQ1 1JEQB 1V7PC 4O02A 4JDUA 1OAKA 3FCSA 1L5GB 3ZDXB 1JEQA 3EGDB 4CN9A 3EGXA 1MQ8B 1XDGA 1SQ0A 4NEHB 4Z7QB 1N9ZA 3NIFB 2P26A 1QC5A 4G1MB 1PCXA 2XWJI 1ZONA 1M2VA 3IBSA 1FE8A 4GZ8A 2X5NA 4MMXB 1M1XB 1M2VB 2WINI 2UZYB 1ATZA 2ICAA 3QA3E 3ZE0B 1XUOA 4C2BA 3TVYA 3K71A 2NUTB 4DMUB 3ZDZB 1RTKA 3E2MA 2I91A 2VDKB 3NVQA 1JEYA 5E6RB 3IJEA 4O3TB 3BQMB 3ZDYB 2ODPA 5BV8A 3OKYB 5KYUB 1SHTX 3T3PB 3OL2B 1U8CA 5E6UA 1DGQA 2XWBF 3EOAI 3EFOB 5KYXB 4MMYA 3BN3A 2VDMB 4G1EA 3VI3B 5KYWB 1MQAA 4A0QA 3FCUB 4MMYB 1Q0PA 3PPXA 1CK4A 3EGXB 1AOXA 2VDOB 1L5GA 1DZIA 3HI6A 4F1KA 3EG9A 3T3MB 3ZE1B 1OLZA 4NENB 1ZOPA 2XGGA 3GXBA 3V4PB 3AFCA 1MHPA 3F74A 1IJBA 4G1MA 1IDN1 4MMZB 1LFAA 1SHUX 5HJ2A 1JV2B 4HQNA 4K3JB 1XDDA 3K6SB 4HQOA 4CN8A 4MMXA 1JV2A 1MF7A 4FX5A 1U0NA 1RD4A 1NA5A 2NUTA 4HQLA 3TCXB 2VDNB 2NUPB 1SSLA 2IUEA 3ZQKA 5HDBB 5E6SA 3NIGB 1T6BY 1U8CB 4M76B 2VC2B 3EFOA 5KYUA 3OL2A 3EH2A 5E6SB 2VDRB 2VDLB 3AL8A 4UM8B 3PPVA 3HXOA 2ODQA 4HQFA 3F78A 4UM9D 1QC5B 3TXAA 3BQNB 3ZE2B 4WK0B 2M32A 2WW8A 1MQ9A 2NVOA 1M1XA 1YVPA 5KYYB 4Z7NB 3TW0A 1AO3A 4XW2A 3Q3GE 4Z7OB 4JX0A 1T0PA 1PT6A 2VDQB 4WK2B 4O3UB 1CQPA 2I6SA 2P28A 1TYEB 4FWWA 2I6QA 5LN1A 1N3YA 4UM9B 3HXQA 3RAGA 1RRKA 4IHKA 4C29A 4HQKA 3EOBI 5E6RA 1AUQA 4WFQA 1PD0A 4O02B 1QCYA 1FNSA 1IDOA 3FCSB 3EH1A 4G1EB 4BJ3A 1UEXC 1PD1A 2QTVA 3AL9A 1U0OC 4CNBA 2O7NA 3NIDB 3EG9B 3K72B 1RS0A 3AL8B 1YVRA 4IGIA 4WK4B 4NENA 4WJKB 1ZOOA 3K72A 4IXDA 4MMZA 5HGJA 2B2XA 4F1JA 3K71B 3VI4B
chains in the Genus database with same CATH superfamily
2C4FT 4MV0A 1C3XA 4MNGE 2ZOKB 3WNLA 2VA9A 4IIQA 1WV7T 4JG0H 3RQIA 3WKQA 5T6BA 3M6AA 2HWKA 3NORA 5JCJA 4F33A 2VHVA 3EVBA 4TLBA 1Q11A 1XGYH 4KMOA 4LQ4A 2DYPB 2PN5A 3AT9A 4QFDA 1KCSH 3L4YA 3E2PA 2FI1A 4DV7B 5TDPB 3Q6MA 3BMWA 2N0KA 4FULA 3VX0A 3OEWA 4ODUB 3OGOE 2J6CA 3CFCL 4NQVA 5LBGA 1JBJA 3MXOA 4FFBB 2P9CA 1ZJ5A 4ZGGA 3ZTYA 1AGFB 1XF9A 4MQ7B 4JLAA 3SE8L 5G4KA 4RFOL 2P62A 1NYRA 3D0AA 1JG4A 4A04A 2G6BA 4TMKA 1XCPA 4NPYB 2GN2A 4XUDA 1HKLL 3W0WD 2TSBA 2HWWA 4RM3A 4Y5VA 1QSFA 3D8HA 3LDUA 2KT6A 4G81A 2WXPA 3TR0A 3CZ9A 3TINA 5B39A 2AV7B 2L8AA 1CFTA 4MAMA 3IDOA 2DKOA 5ENWA 1JG2A 3BJ91 2C99A 4JBGA 2WF7A 4DPLA 3G2IA 1BDYA 3O8QB 1IM3D 2AKRB 2V3FA 3ND9A 1ID8A 2GPWA 3ROKA 3VWKC 2P3YA 1I3GH 4FG6D 4ANWA 1UD6A 1WD8A 2P9RA 3RKRA 2WLZA 3SYMA 5DSCB 1IJFA 2F5AH 3DC0A 4EI6A 4UC0A 4V0ME 4XMTA 5JVDB 4P2GA 1YECH 1TK9A 1TGVA 3H8SA 1Y18B 3U1SL 4BH8A 4XPZA 2QY6A 4QPNA 3T6ZA 2VMDA 2QSCH 3GJ7A 3E4CA 3MAAC 4DCCA 4D0CA 1FUEA 3C39A 1A7QL 4L8SC 4AK2A 1DFXA 2FP3A 1XTRA 3QZUA 1ZKAA 3RTQB 4X9FA 1Y9EA 4YWGL 1L9KA 2JIMA 3IFLL 4PGZA 2A9NL 3HN3A 5C09B 1MAVA 5JXWA 3QRBA 2H59A 3FL7A 5LD2C 1DJPA 1NFDF 2ZYSA 4MQ6A 4R2GB 3WGLA 1RP7A 4KNSA 1REQB 3X12B 3SIWA 1T0NA 2UWEF 4OBRA 4MJJA 2ZWMA 5HI4D 5JO0A 3EPKA 2MCAA 1C4WA 1RRMA 3MV11 2JH9A 3AY3A 3G04B 3NAZA 3UV6A 3EVZA 1P5VB 2AFRA 4X7TA 3CFKB 3LLVA 2GVDC 1ZUD1 1WA1X 2XTSA 2WUDA 1M1YA 3P9XA 3OWHA 1BXRB 5JVDA 4YRAA 4JDEB 4DPBX 3CMCO 3CF4G 3B3FA 2XD4A 1U7OA 4J94A 3RE1A 1JAHA 3Q3EA 4EUHA 1Z7EA 3KPVA 3NDYE 1GITA 1NC4B 4EGCB 3AQYA 2H9AA 3RKDC 4GQIA 4Q9JA 3ZY4A 3BP7A 3W6UA 4BFNA 1NDHA 2NVUA 2R751 1NH6A 2WM9B 4OU3A 3D8RA 3L1JA 1SKUA 3C6LB 4FWBA 1R8XA 3KWWA 2BMKB 5DSZA 1DX4A 4GSYA 5B8CA 4N90E 3VYTB 1U8MA 1K2WA 1YJDC 4WDIB 5H1YA 3D87B 1QSED 4QUKA 1P1FA 3ZUCA 2PXHA 5F1KA 4NENA 1HZLA 2AMVA 3OJLA 3WAJA 1NCAH 1RXUA 5G5DB 3V79C 4GY4A 4BZYA 2IP1A 5GSVB 4CV0A 3DZKA 1T5IA 2ENUA 2R4QA 4KDRA 3U9UB 4JKLA 2QLLA 4QQNA 1IGFH 4HAXA 3VRJB 5IJ9B 1KOLA 2DPGA 3IDQA 1LBTA 2UZ4A 3KM1A 1OLXA 2IFFH 5BRNA 2Q0SA 4RA9A 3QNUA 4P23D 4FNUA 4KROB 1SXJB 2UWEB 1UOPA 1Q57A 2PJZA 3U7IA 5FDWA 1SXPA 1BMFA 3GLIB 5TD4A 1E65A 3C3MA 3KPNB 4D8WA 3IAS6 1XH0A 1EAJA 1VPEA 4QULA 2AR7A 4YHYC 2C4UA 5AK5A 3DLIA 4PN6A 1FZOB 3MCWA 3GUYA 4XTRD 4M76B 4XMPL 4HH1A 4X8XA 2BL4A 2RBEA 3HBZA 4I3SH 1PQZA 3HA3A 2D4AA 4U3JA 1NM9A 4RF2A 4K6FA 3R4DA 1TJPB 3S2ZA 1L0BA 2CDGA 2JF0A 1DLFL 1Y8QA 3C74A 4R4NC 5K8CA 3FGOA 1P6UA 1U3CA 4ATTA 1XF1A 1NICA 3FRUA 4QRRD 3F3HA 1B0UA 1PX3A 4G7YH 3WELA 1GPNA 2GAIA 3VOTA 5IMSA 1X7ZA 2I1LA 4KBGA 3S1LA 1BAFH 1NMBL 1IJKA 4KHPB 6PAZA 4R1QA 1QFWM 3MSXA 4RCYA 3QIAA 3MGOB 4B48A 4EHLA 2WLSA 2FU5C 35C8H 3KSBC 4MJIB 5SWSE 1BGXH 1XTBA 4ZS6C 2E0PA 1YMMA 4U1HB 3HG3A 5KDLA 1PYDA 4EWLA 3VFMA 1YAJA 2I07B 3FHAA 3NJKA 2VCYA 3TVYA 1YB6A 1Y5NA 3L9XA 1XPRA 4D45A 5FNVA 1JEYA 4YRDA 4ENUA 2WUGA 4AP6A 2CL0X 2YNMA 3NHZA 3TR5A 1J8RA 3L4ZA 3VMNA 3MJ8A 3EFHA 3P96A 4ZQHA 3ZDDA 2DLEA 1E3SA 2ZOSA 2BE7A 2FQFA 2NX5A 4JZJA 4ODIA 4MMZB 3F71A 3EHBC 3TW4A 5EOCL 1ULUA 1FNBA 1E6OH 3OAAD 5DLYA 3SQNA 5F6HJ 5FFOA 1BS2A 1SBTA 3FHJA 1OOAA 5I17A 1UJMA 2HIAA 2XXJA 1IGJA 2X9QA 2CF5A 1J25A 1YRAA 5KI6A 2H2SD 1RY7B 1WFTA 4ZCTA 4AKSA 1HTWA 1VE5A 4FFVA 4K9SA 2LE0A 1JA9A 2E4AA 7FABH 1BH2A 4M49A 4UEWA 1EDYA 2XGSA 1L9PA 4IGBD 3CINA 4BGDA 1NATA 3IUBA 3DHUA 2VHUA 3CX5K 1MJ8H 4B6EA 3ODGA 5ALPA 2KBEA 5SZKB 4B5LA 3VACA 5ELLA 2HJHA 3DV4B 3DSFL 2VKXA 3AR8A 5D7JA 1JN6B 2IH2A 2ORED 4TKVB 2FFRA 3GZNB 2J41A 3IAFA 1LDEA 4B83A 4TT8A 4BEVA 5HI4C 4E11A 3C15C 3D31A 2WDPA 2W2LD 4K9LA 2VSFA 3AG6A 3RSSA 1Q4NX 3DWIA 4GQPH 4AUMA 3P73A 1V3MA 4WBNF 4OFZA 3FZEA 3PCXA 4RQBA 1OQAA 3OOYA 3EHBB 3CDYA 1E7YA 2NZVG 1EK0A 2D2IA 3ISJA 3WRXC 3LQQA 1DQLL 5KNBD 4G26A 2I4LA 1BH6A 4ILKA 4R7NA 2FWOA 4CF4A 3GUVA 2GEBA 1TIKA 2Q0QA 1S7CA 3LS4H 1MFEL 4LCUB 3NYWA 4OF6A 3K4PA 3T0WA 1F2XK 2ZETA 3VW3L 2HLNA 4R9RA 2ZYDA 4Z23A 3VCLB 3FDFA 1AMXA 1MVLA 1NG1A 5ADPH 2K5UA 2AKAB 3OQOA 1X1DA 3PDWA 3QK0A 1L5FA 3FTNA 5DOZA 2JKIS 3STZB 5EA0H 3WGQA 4BLPA 1I85C 1UOQA 4JLOA 3UJ3X 3OQ3B 4DV1B 3KLHD 4G6AD 4JFFA 1XK6A 3QJHB 1ICIA 1WBYA 1MJGA 4JELA 4B2LA 3M70A 1ZAGA 3VHLB 3VJ6A 3DP9A 3JYBA 4CHGA 4B3IA 2NW3B 4BC0A 5FCUH 4WQOA 4WJ5B 3QELA 1A7NH 4BA0A 4YDSA 2CBOA 3HWRA 1JJIA 1GGCL 2HW8A 3BYZA 3HC0A 4KQEA 4OFYA 1BEEA 4QTZA 3BQ9A 4E09A 3V7AE 1IGML 1LNUB 1T4CB 2Z2YA 4CEJA 1Y1PA 4B9PA 1MCNA 1OAYH 1E1YA 4FHJA 1W6RA 1M34A 1O0BA 2VHQA 1M6OB 4QRQA 1Z5YD 25C8L 2VGLM 3ZTWA 2OHOA 3UMJA 3ZW8A 3PAZA 3DZDA 4TTAA 2SECE 4MZRA 1AQJA 3KOOA 5TB5A 3E9YA 3FGNA 4PRBB 1G5IA 5EPUA 4ONOA 3T0BA 5L40A 3RVBA 4ARZA 3ECWA 5F9FA 1CZ8L 4CPDA 3C3AA 3IQDB 4JPSA 5EOCJ 1H6DA 1GR0A 2A9PA 1GLVA 3LRMA 3W8EA 4P2CG 2JBAB 3QXAB 3MT9A 3WDJA 1YIDA 2HMAA 2VTEA 3GIDA 5LWYH 1MCKA 4LJLA 5ESAA 3L08A 4NO5B 1DVFA 5CZRA 2VBFA 2OZEA 3OT5A 2JCGA 2Y8EA 1DJOA 5FPSA 1QJCA 2BP7B 3WJLC 5EBMA 2OGUA 3NUKA 4LZJA 3CE1A 5AKGA 2AUNA 2FZ5A 2XWQA 4YHZL 3ZHZA 4LMBA 5TVKA 3FTWA 4IFBA 1EFLA 4EUKA 1QCYA 4TQ8A 3MX0B 3CZLA 2PMWB 3ESQA 4PR5A 1N5JA 3RC9A 1DC8A 5DD3H 2NX5B 4PJGB 1CLVA 4JR2A 1M72A 4ELKB 4XRRA 2BXYA 4JK3A 2R8BA 3WFEH 3R9XB 3BIWA 1Q7RA 3MJTA 1RR6A 3LPCA 3VV2A 4KX9A 3BLBA 1HKHA 1EVLA 4BASA 3NBYC 5MN4A 2Z1NA 3C60B 3T2NH 4N3TA 1XDGA 1OAKH 3ETJA 2YD2A 2ZP0T 3C6MA 2E82A 4S35A 2AQ8A 5CGBA 2A6PA 1RE0A 2IPLA 1GJWA 1E6MA 3VW3H 1U3UA 3DV0B 2AG8A 3TDMA 3JWNH 3B38A 3HR4A 5KZCD 5GHWH 4ZOAA 3H9SD 3SBOA 3OIDA 4TVSa 1C5BL 3HI6A 2VR1A 3ER9A 3L9RA 2LIPA 2PU5A 1SEQH 1WXXA 2JD1A 3CVCA 4OKDA 3H9ZA 2CO4A 5LZ8A 2WR8A 3EJ6A 4TKLA 3K9GA 1URIA 1DQPA 4J4PC 3CLHA 3J27A 3NNNA 5ILQA 1KJIA 1A14L 1IVYA 1CBJA 4BFTA 1E67A 2FO4A 3H5NA 2GWHA 2C3PA 2Y23A 2HYDA 5CLYA 1WIOA 4EKNB 4YT4A 4B3EA 3ZY5A 2ZKHH 3PQCA 3E3MA 3GSVB 3T2LA 4R84A 4X4XB 4NVRA 1NJFA 2ALAA 3GFRA 1NT4A 1TIPA 1Y3HA 1ZAKA 1FJHA 2K6YA 3TFOA 1V45E 4JIMA 2QNIA 1Y33E 1XTUA 2YNMC 3HZHA 5IIEB 5IT9A 5ALHA 1YECL 2C3OA 2D7JA 1S9KC 4NQZA 1RT9A 4P2AA 4H1LG 3OOWA 1R8JA 4JFTA 4XX5A 1CXIA 4HUVB 3ZL4L 3S2FA 1H6FA 4GI3A 1R3KA 1WX1A 3CGWA 3C5SB 4P3DA 4Y4FC 3KRTA 4G0WA 2OKCA 4D97A 1JAEA 5JXED 3S2YA 5CVCA 2XBTA 1RQ7A 1HINL 2UZ0A 3OM1A 2XZPA 3FFTA 1VRVA 5AVUB 1JD7A 5GV7A 5F7UA 1E6LA 3L3HB 3VU9A 5JW5A 1C12A 5G1OA 2V8LA 3ULUD 5HYEA 6REQB 2P5EE 2EZ0D 5HGBB 5DF1A 3HXPA 1YA6A 2WWIA 4A66A 3W2HA 3Q0IA 4U0RB 5J4LA 2XN9D 2YMPA 4X4YB 4DF9A 1CF9A 1H1TA 4XJVA 1IAIH 3SOBL 2EXWC 4Y7MA 2WIDA 3MCZA 2B34A 5C0CB 1S9XA 5E6SB 4KE6A 3D9AH 3JYCA 4TV8B 2NQ3A 3G17A 1MQ9A 1JKIA 3DX6B 1Z0IA 4TLUA 4XUGB 5EUBA 2C61A 4UU1A 2P9YA 4RY9A 5IF9A 2JJSA 3BGVA 1UBGA 1OBFO 1TM7E 3H11B 1MIEH 4IQ4A 4XMPH 2QVCA 1PF3A 3M6VA 3O3MB 4DM4A 4P3DB 3KH3A 1Z2AA 3MRSA 4GUAA 4EG6A 3WY3A 4K8RB 5J7CC 3Q8MA 4XVSH 1CDJA 3T3NA 3TTSA 2D7OA 4U9IS 1O9WA 2HDWA 1JWMB 3EISA 2OFQA 1QBAA 2P91A 3KLHC 3I1IA 2QXUA 3VH2A 4N68A 1J5DA 4D0CB 2QYOA 3NCCB 1H3WM 2XT6A 2D7TL 4MI3A 3HE6A 1K5HA 1QKJA 1RVFL 1GPAA 3GGWA 1J0KA 1EVTC 1MOSA 2W48A 4FU0A 3SC2A 4KPEC 1HS6A 2X5NA 4BQ9A 2BNUA 4RX1A 3HNTH 1YZYA 2FSPA 5BZZA 4R3SB 2OXTA 1M0SA 4LSDA 4DP4X 4PLNC 1SM3H 1L6XA 3SHQA 2V17H 4U7HA 4GINA 4AL8L 4BHUA 3UUFA 1DJWA 2B5OA 1AN0A 1NC2A 1YJDL 2E87A 4BP1A 3U7EB 4IFTA 4KRGA 4NKOB 4ZG1A 2NTFB 5GY7A 3KOUA 4U05A 4P34A 1FDRA 5AAMA 2FUTA 1EMTL 2FRXA 1OW3B 2F48A 1C8VB 2O5NA 1ONQB 2YDXA 1FO0B 5CD5C 5IT2H 1GL9B 4W70A 1T0JB 1KYXA 5BS0E 4MUEA 4NS4A 1JR3A 2ZBPA 1HJBC 1IGCH 3PZBA 3HMWH 2PPDA 1KYUA 1PEDA 2X4DA 4R69A 4F3CA 2EICA 5CEYA 4FQPA 1JZQA 2X2FA 2PIAA 5DDHB 3LOWA 1XMQB 5FGBA 2YSTA 4ZVNA 4BK5C 4BWGA 1EFHA 4G8FA 3QEMA 1VJ0A 1RHHA 2PUWA 2Y1WA 4UT6A 2P6MA 5EBLA 3U4EA 1PZCA 2NXZD 2PETA 3QZWG 5KJEA 1P1IA 2GUWA 1O75A 3KXFB 4Q9NA 5CJ8A 3EF0A 1T9HA 1P9MA 5B36A 3DFIA 3Q98A 1BD4A 5JAZA 4NOMA 4Y4KC 2NY3D 2XZCL 5IDVA 3D3VD 1GHFH 4N0PA 4MXWH 4RIFA 1ADQL 3O91A 1UHVA 2OTCA 4WKNA 4R9VA 3ML1A 1W88A 3KOMA 4IU2B 2GD2A 2I60H 3PV6B 4YXWD 2VJ0A 1UKEA 4AY3A 4APQC 3NCJH 3S35L 5INCB 5HA5A 2I78A 4K5LA 3RD5A 1F8TL 4S0HA 4EI2A 1U0NA 3K4ZA 4LHVA 2BM3A 1TW2A 5AJTA 4AK9A 1AR2A 2X4NA 2A7BA 4FXKC 1PAUA 1OAQH 3MTBA 4Y0AA 5IHPA 1JALA 4PNZA 3EQ9A 4WWKC 4GMSH 1HYSD 1PR2A 3KPSD 1RP8A 4W1TA 2H8KA 4U3JB 3LKOA 3DHJA 5J59A 4IIJF 4ZAYA 2BOCB 1VRSA 1RCFA 2R2AA 3X1MA 2GBPA 2HMWA 1DBBL 1S8DA 2BLFA 5L2KB 4PCLA 2JC3A 3VPBA 2V8MA 3LF1A 5D2LF 3EOBA 1J8YF 1FN4B 5FFGA 3EA5A 3SICE 1A0QH 4JC5A 5CLQA 2FEKA 1M6VB 1YQEA 3L5HA 3TA3A 3FB7A 3FCCA 2DBJA 3P0JA 5JYDA 2NY0C 1Y4ZA 1AR1C 1G9TA 1PFGA 1T1ZB 4H1LH 2EG5A 1G94A 3NSCA 4F8QA 3CKMA 3DSRA 2NU8A 5CGZA 4X66B 2Y2YA 3O8NA 1HZZA 1QNZL 1AIFB 4XPTH 4N9GA 3TBTA 3QGMA 1SHJA 3NEPX 1NAMB 1MZPA 3AUFA 5J11C 3BXNA 4WV3A 1RAMA 1IBSA 5F21B 2JFFA 4W9IC 4M5ZL 1QSFB 4UVHA 4M0FA 2JWGA 3ARYA 4YASA 1RIHH 2AYZA 3TZLA 4WMLA 3RIFF 4RZCA 5DD1H 3IJHB 1NU6A 4M5SA 1Q77A 1B76A 2V45A 4DY4A 5LLIC 3QIUC 3OY7A 1L7PA 3VGAB 3U36A 3SNKA 4UQCA 3ANNA 4HQFA 4X7CC 4BFJA 3OC8A 5FYJE 5FGCE 4EELA 1ZLUK 5HYFA 4ZMAT 1VIWA 3PENA 4YX9A 2BP0B 2R4RL 1SNYA 1HNYA 1O08A 3NGBC 1UJ3A 5CVUA 3X1KA 3MLVH 1K6JA 2FZGA 4LFCB 2EYUA 2NY7L 3G5XB 1K7XB 2QD2A 5IJZA 3FY4A 1HH4A 1RJ9A 1WZ1L 4XB1A 1A7JA 5JZMA 1U8KB 2CC2A 3AL0C 4DIMA 4UQ2A 4A2DA 4K3JL 1E69A 5K3SA 3A1UA 1HN1A 4KLRA 3V6OA 1TYZA 3DETD 4S1PA 1K72A 1X5YA 1UL1X 4JBNA 2AQIA 3C3EA 3QI7A 4YWJA 1UUNA 2V9TA 5FHAL 1E66A 5E7IA 5T3XL 4I0PA 4RWYH 4ZVSA 3KSZO 3BP4B 3ZWCA 3SQOL 1CUYA 4RQUA 5AKLA 3OZIA 3NJIA 4DA0A 4I48B 4B6JA 2GBLA 4QSHA 3BP6A 3K5SA 3HGMA 3B5TA 2EEFA 3PU7A 2Q76A 2DD8L 2JD0A 2VDNB 3BKYL 3PT5A 4H2CA 1VHWA 2IUEA 5T33H 1OAOA 4R8LA 1Q7CA 4UI2A 2QVIA 3G6AB 4REMA 5JLZB 3MRMA 1WS6A 5ERYA 2QGNA 3VE0B 2CLOB 4P7BA 3GSNL 2NVUB 3LP6A 3UBXI 4P92A 1KN2H 1TJ5A 5L7XH 2HRZA 4JX0A 4NBSA 2W4MA 2D3NA 3L5KA 4PD4K 1UXWB 1UBHS 4KQCA 4ZARA 3UAWA 1FFPA 2ZUYA 4PGGA 4TNVF 3MLYH 1VGKA 3S3SA 3EYQC 3E3AA 4KFTA 4OB7A 5FXMA 5AVZB 3HJAA 2PTHA 5HIKA 3CVOA 3CX4A 2A74B 4EMTA 2Y05A 1GAFL 4PYNA 3DLTA 3RG2A 1J90A 2DFPA 2W6OA 2ZPTX 5L2JB 1V41E 1K66A 3PXBA 4OCSL 4BRUA 2OR9L 1Z4KA 4RD6A 2O1EA 5AICA 4WXPA 1K06A 2P4UA 3KYOA 4QJ4B 4I1SA 3T1FA 4CN6A 1U1GA 2NAPA 5DOVA 4FN0A 3PNVA 1FLRH 5CX1B 2YPLA 2LTQC 1NBAA 1ZK1A 1VSQA 5HBGA 4JRLA 4NSKB 5IAGA 1YS4A 3V4PB 3I2JA 2AEOA 4JO4H 3MW8A 1HINH 3RYHA 4RSHA 1IG3A 3L8QA 4MV8A 1OH7A 2D3TA 2EKSB 1DKLA 1QVVA 1UWKA 4OQ4A 3UCXA 5C5DA 3COOA 4EA8A 4NZ9A 5H0IA 5KTPA 3ARWA 5E8PB 2VW7A 5DV9A 3NCYP 1RJYA 3QKUA 2VLIA 1PW7A 3I34X 4AZ3B 4QDZA 2CFIA 3ZJVA 5DTFA 2PUEA 1M7DB 4FWTA 1J1PH 2B2XL 1RC8A 3TSAA 4PRHD 4I5EA 2CJUH 3KWXA 4N2DA 1QAWA 4EDFA 1C1DA 3GELA 2W2MA 2NY0D 4PYKA 3UK2A 1KC3A 1PTJC 3QLUC 5ARDA 3IYLW 1C8PA 5KVFE 1XBTA 2HU5A 4AW4A 5CCKH 2HREA 4JT9A 3BRCA 4MV7A 4KXMA 3ZWVA 3JQQA 3TCKA 3N2NA 1CI3M 1WGVA 1ZRNA 4GE0A 3T7KA 2WWKO 2RD2A 1WM1A 5CUSL 1UBSB 1G4MA 1OLOA 3G7SA 4Z7VA 2PWDA 1ORIA 1XEWX 4N7MA 4JU8A 1KR5A 3H9YA 3PGMA 1GYVA 2JB5L 1FNGB 1OWNA 3PR2B 2OG1A 1SF5A 4G8EA 1ZHKA 3IDAA 2MPVA 2DHDA 4XJTA 1E28B 3IPRA 3I4FA 4LCCC 5HDQH 5KTOA 5FLEX 4CN4A 5BYAA 5CUQA 1BIFA 4PFKA 4WO4A 4XB8A 1HSAA 3I85A 4PINA 3BGIA 3H9SE 2Z7WA 1S7VB 3AWIA 1BJTA 1M6HA 1SOAA 5FYQA 4F5CA 4XPBL 3G5ZA 3FWNA 3RDJA 1HTBA 3QQ4B 3EO0B 1WXGA 2AK1H 2QB5A 3H5VA 3KR1A 3NEXA 3X1NA 2P2GA 4XDGA 4NCIA 4DA7A 5AW5B 3NIBA 4A37A 1HE5A 5CDFE 1NHWA 4CHTA 2CXPA 1NM4A 1EAMA 4TTGA 2QI9C 3MWLA 1SOSA 1EJOH 4YO8A 3WNZA 2RIPA 2WKGA 3GIZH 2HJKB 1ZOIA 3EPRA 4RH0A 3JQ8A 4YJZL 1RLIA 4S1TA 1HV8A 3KPPB 3WIFA 3DVRX 5ALXA 2WG1A 4P4TA 2BRRL 2ZF8A 5E1MA 5JXGA 3HBLA 3OAUL 3TOSA 3I39X 3SNHA 3PQYD 4F38A 3GJFH 1R6AA 1X1AA 3APMA 3MHZA 5F72S 1RKBA 3ETHA 5GZND 3KOXA 4UIMB 1ZT7A 1MEEA 4MD4A 2H3EA 2P2DA 4DRZA 5TARA 5GV8A 1VB3A 2P1YA 4JRYB 4KVNH 2JARA 1AZCA 4GVPA 3RSFA 1WF5A 3QTBA 3U2SB 1DJGA 3W6OA 2XN2A 1SKYB 3QIBD 3LOUA 2BFDB 2WUBL 7CGTA 3D69A 5DJAA 1NGYB 4QHKI 4PJCB 2F54E 3N85L 2JLQA 1LVEA 3SD5A 1VIVA 2HA5A 4RPGA 1I8LC 2FX7L 4PZ0A 1UASA 4L02A 3C08L 4FDMA 3GMRB 1QG0A 4LQFH 2QPDB 1WSAA 1EWVA 3TC9A 4JFPB 1X87A 3FRPA 2DQUH 3A1CA 5CILH 1E2LA 4I89A 2VT3A 4PMFA 3HYSA 3SGEH 2RH8A 3P9KA 3L45A 4CMIB 1Q9KB 1M42A 4K23L 3ALWA 1WXFA 3I09A 1SZDA 5F9DC 4YSUA 3M4XA 1U11A 3KHOA 5I75B 1VFPA 1H6EA 3CJQA 4DCNA 5EN4A 3MEQA 3AL9A 1OL0A 4GUCA 3BPNB 4MLPA 5B4VA 1SMKA 4GKBA 4OFDA 2JGEA 1PZBA 5FV7A 2CHUA 4LECA 1SXZA 2FIRT 1WY7A 3DFMA 3CC5A 4YQYA 4E6PA 1E9OA 1SG9A 4FFWA 4L5CA 1XQWA 3V55A 2FO4B 3W38A 1QACA 3PUXA 1Z38A 4WGGA 2HCZX 4TTIA 4G8GB 4IGFA 3MLPA 3FZYA 4MB1A 3KTFA 5HGDB 2ID8A 4JVSB 2EBWA 3DMFA 4S1QL 5YASA 3IXAA 4KXZH 4C56B 3D7LA 4DV3B 3CQQA 2FL5A 4LSRL 5DO2D 4XX1A 4OA5A 1UKVY 2TMGA 3GGOA 3U48A 4NUJB 1JB1A 4HYEA 4YK4B 5D1QC 1SEVA 3E1SA 2QN9A 3TSCA 2GI0A 2B4CH 5EU5B 2CL6X 2PR9A 1IBGH 2BIMA 2AOXA 5GJBA 2Q86A 5I1AB 4A2LA 5FI0B 3LBNA 4ZZKA 1NEUA 4IRSA 4ZS7H 1R3HB 1CULC 1EX9A 4LDOB 2ZXAA 1DRJA 4TN9A 2WVSA 2YKLL 3LNFA 4GS7C 2EECA 5CAYB 1VA4A 4A5OA 5EKSA 4YUXA 3O8XD 3HBAA 4KI1A 4L3EE 5FYKU 4B9CA 2JIRA 1TQWA 1B6TA 1Q6YA 4H1LA 1SEPA 2ZXWB 1YONA 4XT1C 3ZSSA 4O4JB 2OHGA 3ZCTA 4Z86A 3U2JA 3SM9A 1SPDA 3AERB 2A6JB 4QELA 3MLRL 3FJOA 1NAKL 2WSPA 4WDRA 3CGGA 3LMKA 3WIDA 2R29H 2IBTA 3FLAA 5CN2A 2A1TS 2R59A 3BH6A 2GC4C 4BDVB 4RZ2A 1WWWX 3SEQA 1BD2E 5DJCA 4OCXH 4O4HA 1U3TA 5T3ZD 2R2BB 5DU2A 3MD9A 1GUAA 4WIQA 4YGVB 3UO1H 2OFWA 2SCUB 1QR1A 2MOGA 2J55A 5B1YA 4CKZA 4ZFOL 3D3JA 4JZYA 1QIKA 2QP3A 1QVAA 1HI6B 5JS1A 4W5WA 4I19A 3M1BB 1FWXA 2H1CA 5DVPA 3H8WA 2OYLA 1K2DA 4RD0A 5C1MB 3L3KB 3C1AA 4D8UA 1OZAA 2R6AA 4WRRA 6NULA 1M57B 3COJA 5SWZE 1AC5A 1IN6A 4X8LA 2JKJA 2RG1A 3MO1A 3OFKA 3S2UA 5JQ6L 1G0DA 1V8HA 2OBXA 4OFXA 4EI5A 4FNAA 1YHNA 2AV1B 3GCDA 2PMCA 3GDOA 1XDUA 5AZEL 5AJWA 1UMDA 2Z4QA 3RWJB 3F5MA 5ENWB 3OMNB 3EFEA 4HH0A 3ET4A 4I14A 3SQLA 1GSAA 3D3QA 4Y8AA 3HRIA 4HLZH 1TPYA 3F4LA 2UUDH 4H5SA 4MCNA 4G1UC 2JXMA 3DBIA 3VQTA 4NECA 4IGBC 2YYAA 1GDTA 1W29A 2OT3B 4NY1A 3MOIA 2JHCA 5IBLD 4ZFFB 1IAOA 3VPXA 1ECPA 3RBZA 5BORA 1JAYA 5K3AA 3I9PA 3EGIA 4G5ZL 3CH5A 1XI2A 1A2QA 1ND5A 5CB0A 2UZIL 3M1LA 1I1AC 4IOJA 3ESRA 1OT2A 1U3ZA 1NMAL 2YD8A 2F8IA 2Z1DA 4OUOA 1NMXA 2YIDA 4NQDB 2ZS7A 1XU7A 3RDTD 4YJ2B 5LQMA 2JIXB 2H1OA 3F46A 2LT9A 2FJUA 4CJ1A 5F33A 3GLFB 3WFHA 1XTLA 3TTWA 1V8ZA 5F7XA 1YYMH 4LOIA 5ITFA 1H94A 3OB0H 3IEIA 1DFHA 1HLGA 4I7EA 1Z5NA 1RZGB 3RYFB 1D9KB 2B1IA 2IYYA 4LOKA 4ER0A 3RKUA 1MCDA 3OCWA 2HJVA 3KFXA 1BEYL 3FSJX 1COBA 4P4GA 4ZYXA 3EO1A 1B88A 2Q5BA 1TKWA 3AKEA 4Y9DA 3H3BC 4DT2A 2W6QA 3FTGB 1Z5LA 5D93B 4WEEA 4A1RA 4ENQA 3Q6FB 1DCFA 4DMLA 1RZPA 5BSUA 4I2NA 3MNVB 1YB1A 2P65A 5AKXA 2WKRA 3GSQB 3UO1L 3QEBZ 4DIBA 1OWPA 4LA4A 2FFAA 3OG9A 4H8HA 5FPIA 5B2ZA 3ZI4A 2GSDA 3B7UX 3O3BB 4D0SA 3DX7A 2QENA 4HGRA 3WGYA 3A7DA 4EPRA 3VH4A 3LWDA 4LOAA 3CHRA 3OPVA 3H17A 3A9SA 1X5AA 1TZ8A 3ARVA 2XV0A 4PLGA 3DLHA 4C56A 3RNQB 3HU1A 4YJ2A 2J5KA 2MYNA 2H0QA 4EXKA 1NR1A 3H4IA 3PJFA 5M95B 2O61B 4G7QB 5F1SA 5TE7H 3B20A 3SDDD 3QE4A 4R3UC 4BCYA 3D64A 5G5DA 4KAJA 4IXDA 3U4MA 2WQVA 1D2HA 1Z4OA 1M0EA 4Y9RA 1VADB 4PX2A 4PJIB 1DBJL 1Y1KE 1N8OE 1WETA 3MV01 2WVJA 3R23A 3BZUA 1P84J 4LDRA 3FF1A 2F1AA 4B3FX 2H32H 3CLUC 5F7YC 1KG0B 4WERA 3E7DA 1T1RA 3V5DA 1CW2B 4PC6A 1YEJL 3RFXA 1KAEA 5B3JA 2I4IA 4GZ8A 3L0CA 2PMBA 4U00A 4F3FA 5AW8B 3MV8A 3N0AA 3TCXA 2XWBB 4HAVA 5CWSB 3QHTC 1Y7TA 3POCA 3F49S 5J4VA 4O58L 1OAAA 1K8YB 3UZQB 1TT5A 1RM3A 1XD0A 4D4LA 3AJ8A 4YQXH 4ES6A 2FWPA 2EZ8A 1MO3A 2ARKA 4J9UE 3VYRB 1SMDA 1GC1L 4JQCA 3FTPA 1KU0A 2E9IA 2DE0X 1Q0RA 1USIA 2DY1A 4IUYA 3G2HA 1KZ4A 1GP2A 4G5YA 3FSAA 1RHUA 2IJGX 2VLRB 1TJ3A 3TA3D 4YAKA 4R31A 5GZOA 5LHDA 1KDRA 3G13A 3L0OA 2FECL 2ZXEB 4EABA 3LXCA 3UQYS 1UBJS 4M99A 3PX3A 3KNBA 4JJ4A 5K45A 1SEBB 1AOHA 3QUXD 4P46D 1N6QL 1E3JA 2ID5A 5EULV 5IVXE 3WYNA 2CKBA 3ZE2F 3IBOA 2EBHX 2CK0L 4Q1VA 1K9SA 3TV8A 5CJJA 1YR1A 3VU9B 3A7EA 4EN3B 2KZKA 3OHXA 2V7EA 2QKYA 3RHTA 3DYIA 3E0QA 2Y2TA 2FQEA 3I2YX 4XNZB 3WNPA 1GTL1 4YCAA 4HISA 4U7WA 1E7UA 1XO8A 3BXGA 1CRLA 2FWNA 3FLMA 4CBZA 2PN1A 2M2IA 1VJSA 2Q1YA 1S8FA 4XC1H 4GLRI 1PK7A 4V3BA 3I0ZA 5A6VA 1QRSA 3GLGB 4P1ZA 1E3ZA 1OCZB 1Z73A 1CFSB 3QSGA 4US2R 1GLNA 2K6WA 4X1OA 1ES0A 5JHMA 3AVWA 1N3BA 3KPTA 5JRDS 4PZAA 4ICXA 3ZKXC 5CMAB 4F1KA 4R26H 5JQIB 3QORA 4C78A 2YV3A 4AS1A 1MJJB 5HPOA 1X94A 3HXKA 3D3VA 1KE2A 1CJYA 3BCUA 1ZPLA 2Y07H 3GLQA 3AW5A 3QVLA 3TO5A 1NXOA 1YEJH 3H16A 1AF7A 5F9HA 4G09A 4K86A 4U4IA 5ADUS 3HRPA 3OPQA 2ZE7A 1WXWA 4JJ7A 3CMGA 4OK3A 4IU3A 4UILL 3LN5B 1YVUA 4XO4A 1OU4A 4CJ0A 3N2GA 2AQSA 2E4XA 3HE6B 3DMYA 4PYHA 2YASA 3VNQA 3QNMA 2PKCA 5G3YA 3VRJA 1W34A 5EZIL 5E94B 3DV4A 1JU3A 1BAGA 4O25A 4AV5A 5C9JB 3IDJA 5IQMA 4EG3A 4NZMA 3LC7O 4JHWL 4JYBA 4BGUA 2UVFA 4X50A 1S7TB 3LUAA 4P0PB 3P69A 5GRXG 2X0RA 3IIEA 4FSDA 4ZD3H 5GQBA 4Q4AA 3OKLA 5BMFH 3GT4A 2IH3A 4OT1L 3VGPA 4RMJA 1UBTS 2VZUA 4LRIC 2HHHB 2ZRLA 1ZWKA 5DMGD 2A3TA 2QN6A 4RHTA 2QXYA 1NVBA 3HBPA 3T9EA 3S4SA 2APWA 3RVTC 3GLTA 3HI1A 1DHRA 5HDQL 2Z1KA 1TA4A 1BZ9B 4N87A 2PO6B 1ASQA 3PWUB 3QNYA 2BMWA 2WUFA 2J5XA 5F78A 4ZDHA 4ON9A 2XMPA 3EOYG 3OKDA 4P58A 2A74A 1YUKB 2O8FA 4CFSA 1VSUA 4F2WA 1F0YA 4ZQFA 4K5NA 4JITA 3FOEC 2AK3A 2WBJD 1SCBA 4YXHL 3CGTA 4ICIA 2P3OA 1NCAL 3EDOA 2K7FA 2ZB2A 5TPWB 1FFCA 5ALDA 3WHIA 5DYOA 2HWYA 4DUZB 4O3MA 2XCMC 1TYEB 1K7CA 1MCRA 2VYRE 1DL7L 4AOFA 2GK0B 3OZBA 2J4FA 1O9BA 4RLFA 1RPUA 4ROSA 4IBVA 4I4TF 3WA7A 4Z4QA 1NKGA 5EU4B 3TBYA 1XZLA 3RTEA 3WI7A 3R5KA 1P9NA 3X1GA 1JG3A 2JI9A 5BSTA 5CDHA 5D55A 3FUVA 2IANB 4LOLA 4ESVA 3LVQE 3V9CA 3LVFO 4Y4FA 3U0VA 4HMQA 3QU2A 4NARA 5EFIA 4HWBA 5I8WA 3ECBB 1OY3B 1CQIB 4QRQB 1K08A 4L1LA 5AW2B 4HUCA 3AETB 1X7QA 4DJDC 3T6VA 2DI8A 3JASA 3AG5A 4DJJA 1PG7H 4CNIB 3D0LA 4FZVA 4Q0MA 5CB4A 3GF4A 1A1NA 2C84A 3LOPA 2W8BB 4LVOA 1XLUA 4MNQE 1UK6A 3DONA 4F85A 1A7PH 3E8UH 1A9QA 3VXMA 1UM4H 3TJRA 1EJOL 3RVVC 5EC1A 3RUGF 3RAJA 1UOKA 1T3FA 1JJAA 1A8HA 5FCDA 1RKUA 4ZIRB 1R17A 4QOJA 2FQDA 1TF7A 1XZBA 2JZNA 2P9EA 5LQRA 4GMDA 2OO7A 1VMAA 5JLAA 1TU4A 4PYLA 4AMZA 4HMEA 5EJEA 3K1AA 5KOJA 1PG7L 1IJ9A 4IOMA 3OLGA 1GU7A 3IXMA 2VJCA 4HJGA 1ETUA 2G17A 5C0BD 3UP6A 4F4DA 2Y6SC 2HVJB 4YUWA 3PJSA 1U92A 1K8IA 2CO2A 3AQXA 2HMTA 1GSOA 2XBZA 4AKPA 2VWPA 3GLGA 2XY4A 2D31A 2ZKWA 1MXFA 5IOPB 3BUSA 4FQ8A 3NJGA 2GHQA 3OF6A 3V5KB 2PTTA 2HG5B 5HHVL 1QIIA 3VNAA 3EOTL 4FDAA 2DMCA 2R00C 1II8A 3PQ2A 1O7JA 1EZ4A 4YHMH 1TZOA 3HEMA 2C3MA 4KK9D 3NDZE 5KC8A 4RMBA 3VU0A 2ISDA 5ULLA 2BVNA 4AKOA 5DNCA 4UQIM 4FTVE 2WM0A 4XP9L 1OC4A 5T64A 3ESMA 1E2KA 5DZAA 3SYQA 4FYIA 2HFGL 4M8KA 4POUB 3H9CA 2VTFA 2WM8A 2NO4A 5FO0A 2JA1A 1V27A 4JL1A 1SVSA 2G9UA 4L4VE 3BEDA 4YPGB 4YHML 1LQSR 4NRZA 5KKAA 5CEZL 3RF7A 2C4XA 3H9SA 1AGPA 3V4PA 4N2OA 1R0AH 3MR9A 1VL8A 3KKQA 5JG7A 4A82A 1U3HC 2E21A 4YBHA 5CLTA 4UATA 3CFDA 4XP6H 5BMVF 3I9JA 5LBIA 1KJ2A 3E1F1 3KYCB 2HFEB 4M6OL 3WQSB 2VBCA 1S3GA 4DN4H 2YHBA 3U4BL 3Q1LA 2EDDA 2GPZA 5BOJA 2CGRL 1M6NA 3W39B 2XQIA 1DO2A 1HDXA 5IM4F 1EFVA 4FLMA 4M7RA 2VYFA 2BJHA 1BQHG 1XQVA 1XHLA 4W93A 1OTTD 4DTCA 4EL5A 2QRMA 3ZN6A 2RBKA 3VXSE 3QPQC 3CZAA 3W9DB 2HBZA 2H65A 3FB6B 2MSDB 5AVYA 2QTLA 3DVFA 1U8OA 3TUZC 4OM0L 4KV5E 4ZREA 3Q2NA 4Z3OA 2I54A 5EVCA 4TWIA 3MRJA 2Q8QA 3B7SA 4AXBA 1WTLA 2K78A 1TTGA 3LPGA 1DEAA 3MYJB 4GXRA 1NBQA 4YCCA 3SQBA 4JR0A 2ED8A 4IMLB 1GS7A 3QXAA 1BWSA 2DHRA 2G04A 1JYXA 4IRJB 4R90H 1H5BB 1LS1A 1GSIA 2P4EA 4MR7A 2X53A 3IDSA 3HMQA 1DBAL 1WR8A 3NJNA 4FFWC 2R3SA 5DNVA 1EJFA 3WYAA 4TS4A 2J8OA 4K0OA 1ZM9A 3L1UA 4HWNA 4GYBA 4OATA 3WLTA 1QAMA 4IWYA 2IHJA 4JZNA 3X1JA 1KIPB 3N0VA 3MT7A 4ZUTA 3SOZA 5DTIA 2AUTA 3VRIA 3AM4A 3QOWA 1AYRA 4I50B 1S3KL 3JAWB 2G4LA 3U31A 1QGUA 3K6KA 3BJLA 5C0DB 4C3OB 5KVDL 4W9KC 3RUIA 1VPTA 2LU5A 4HCFA 3IAS1 4E5XB 2IEDA 3M6UA 3MYRA 2H6UA 5GJSL 3BKWA 2YQ5A 4X7BA 3D18A 2F58H 1Y8CA 1Z75A 4RTPA 2OLDA 2CSPA 3WJMA 3VPGA 1SUBA 5AXAA 2YGPA 4MCYA 2HTFA 2DQZA 1L8XA 4C4OA 3MA7B 3BUPA 2CJTA 5EC2A 4MYTA 1Y3IA 5DWQA 3LRSA 1KKLA 3CX2A 1QWUA 2VSMB 1MC1A 2C1OA 1E5BA 5LKAA 3TBHA 4JV5B 3WGKA 4C2UA 3V10A 1XVTA 4LLAA 4U49A 2FJUB 3WFHB 2VDNH 2O0MA 4KQKA 2PRKA 1LP9E 3WYCA 4ZUTB 3UOWA 4DPMA 3JYQA 4MJ4A 2AJSL 4BZQA 1NF3A 1VKJA 4J07A 4HLQB 1O03A 4B74A 2X0VA 1L7IH 3QUBA 3SVLA 2F2HA 2JZCA 5G1NA 2Z30A 4CVZA 3O0TA 3P9PA 4QEGA 5IQOA 1CPYA 5GJCA 3PEVA 3U1BA 3BSZH 1ONQA 5F7ZA 5CEEA 3LQZA 2JKVA 5C71A 1F7UA 4HJ0C 4ZX3A 2W2LA 1SBSH 1AMNA 5GJTL 1HAWA 1KDYA 4FLOA 5CN1A 1AACA 5FUZL 3RX5A 1QH8B 1D5ZA 3QXVA 2OL3B 3NBAA 2VBGA 5IJVA 1P4UA 1X4XA 3QUGA 2XVKA 3F6CA 2D4FA 5IESH 3PWJA 2CKNA 2B1OA 4OPMA 4KRMB 1HI9A 2WP3O 3MB8A 2P24A 2ZJSH 4Q52A 1AY0A 4QARA 4YRNA 2RGRA 1MU0A 3FQ1A 4D1YA 4TYWA 4KMSA 3RNQA 5ILOA 4BK5A 4MQTB 1JMYA 2VH5L 3RQ3A 3F5WB 1GKUB 4OGQC 1ZEAL 2BGJA 4N1HB 3LKRA 2X4RB 1E64A 1W93A 4Y0NA 3ND5A 4JRWA 5EZLA 3FFBA 4O4LF 1UKYA 5BSMA 4FFVD 3LQ1A 5A40E 2ENPA 1ZLWH 3S35X 1HFEL 4EARA 2BFWA 4JM2F 4NYJQ 3T09A 1EO8H 3BWUF 1OTUC 2OFPA 3I3OA 1WZIA 1XA4A 3EYOA 4WEOA 3B7RL 4QXPA 1AO0A 2R69H 2ZTVA 1LEGB 1R19A 5L6YL 3ZV5A 5IRCD 3RFCA 2DPLA 4D41A 5TF0A 1U4EA 4TSRA 4EPXA 3GHEL 1CJSA 4W6XB 1ST3A 3D2UB 4EO4A 4HRXA 3MRFB 5D96B 3A1TA 5B37A 4DEPC 2I2FA 3RTLA 4OP3A 5M7EA 3ZHQA 3I83A 4G67A 2WKSA 3EZ6A 4GD3Q 4N3NA 4I1NB 1BD2A 3OH8A 1O5PA 4H44C 5EUCA 2G67A 1HF3A 3LUGA 1NAMH 2FGKA 2GZ3A 4JHLA 2D03L 2JD2A 5LP6C 1BJ8A 1NCUA 2OP1A 3MCG1 5AW7B 4BZ2A 2B78A 1AIZA 1F4LA 3KPPA 3FGZA 4AVJA 4H1LB 3A14A 4ODHL 5CIPH 3LKRB 1NJ8A 4MAYA 5CLGA 1O94D 3NT5A 3DEZA 4ZEOA 4AU1A 5F88A 3A6LA 1QTQA 1DUYA 4DP5X 3OURA 3JVGC 2H1HA 2OMWB 1SC1A 2I7SA 4UM9B 4XVCA 5H02A 3H2ZA 2GM5A 4ANKA 4GE3A 2ZPUA 4M9QA 4PRNB 3KDAA 2HT3D 3O2DL 4Y2OB 3GG2A 4Z9AA 3D4ZA 3AONB 1CYGA 5HYJD 4XODA 1SIOA 1QGYA 5F3BB 4OFIA 5K0NA 2RAUA 1SBIA 4RE5A 3EFBA 3QEQB 1U28A 4TS1A 1F41A 2FPWA 5D4JA 3CG4A 1EDBA 4NFBA 2BAGA 1A8SA 2I3ZA 4WJG3 2R2HA 4J3OC 5GGQL 1TZGL 5CLLA 3TSOA 1B26A 4DLTA 1DVXA 3GCWA 5IF3A 3G8AA 1ASOA 1OPRA 3IF1A 4MSWA 1LJ8A 1NZJA 4JY5H 3O94A 5BRQA 1PR4A 3SKNB 3SXUA 1XCMA 5IEJA 1GZQB 2P8LB 1XF2A 1WZCA 1M1NB 2VAJA 4FN5A 3E7XA 1S7RA 1RULH 4MGKR 5JJBA 1J5PA 1UPCA 4YB8A 4WWOA 3ULSA 3KUDA 1CFQB 5I8OH 3QI9D 4CMMB 3QXHA 5LUAA 4OQTL 1JGDB 1MIMH 3PWVA 1YSOA 3BUDA 3VYPA 5ID0A 1JZEA 2DRIA 3ZC3A 1KXJA 1AIFA 1VKRA 1VMDA 3N0PB 2AN5A 2A5FA 4D2IA 5EWLA 4F56A 1S46A 5BY2A 3R8XA 1FU8A 1MRCL 2X9VA 4APXA 5HEKA 5KB3A 4BYMA 4HWBH 3ABLB 4NNYB 4ALAL 1NIBA 1J8FA 4JZJC 2DQDH 3S37H 2QT0A 4M56A 1BZEA 4HDOB 1W47A 3PC8A 3MXVL 1QF9A 3UAFA 2G60H 4UASA 2FSUA 2GN4A 2HTEA 5EL0A 2O8VA 3D8BA 2X4OB 1YEHL 1PO7A 2J45A 4MVJP 3U9WA 4X9YA 3UKDA 3V2HA 3QHQA 3C8DA 2WO2B 3SDZA 4B8YA 4HZ1A 1C8QA 2DBZA 1J0AA 3FQYA 3US0A 4KSCA 4DYHA 1F5NA 5ALCH 3HFMH 4PANA 5C1IA 2C5BA 1ACCA 4JQXA 4DJMA 3HB3D 3PJRA 2C42A 4FE7A 4PR3A 5ABAA 2BCKA 3OAZK 2VDVE 5J5AA 3LNGA 3CVHL 3CDFA 3K8KA 1E4HA 2FH6A 3PWJB 2CIIB 1UJNA 5FKPB 1H2RS 3QBTB 3ZQWA 1UK9A 3ZVRA 5C8YF 1VFAB 5LYJA 3IP1A 3K0CC 2A6DB 5K1NA 4GOLD 1IVSA 2ZF9A 3W3AA 4KYUA 2FZEA 3LH2H 3U4BH 3KL3A 4CU6A 1R4NB 3GD5A 5ALRA 2WZ5A 1H4VB 1VCAA 1OWWA 3NBQA 2Q50A 4D79A 2Q6KA 4XP5L 2JQAA 4UFPA 3QG6B 2G6TA 3NCXA 2PZMA 4Q7LA 2PT9A 1LQBC 3S27A 2G82A 2B82A 2Q3XA 4LXFA 2WHRA 2W0KA 1CXEA 4FHKA 4D0GA 3RFUA 2GK4A 2W0MA 1CLYL 1OLXB 1M6VA 2V9ZA 1RBQA 4AJWA 2C95A 5T3ZL 2FEAA 3ZUGA 1HVXA 3UK7A 1LVGA 3A32A 2HK6A 5BRZB 1PZFA 5DD0H 4F7DA 3QVSA 1A0QL 1HXKA 1OQXA 3Q0TA 3GI8L 1PVOA 4Q1AA 3GI9H 2ZATA 3BDIA 1QZXA 3G7UA 2EDHA 2AI0H 1Z2OX 2K6ZA 4PIRF 3ZWAA 4XZ4A 3T7RA 3QQ3A 4W9ZA 2YQ3A 4ZI8A 4DDWA 1GIGH 5DMJB 1KP3A 4GQZA 3VGJA 3AROA 1IM3A 2HRQA 4N0DA 1SK8A 3D6TB 4UTAL 1P7YA 2CD9A 5HOQA 5E5MA 4LFHD 2B4CC 2YO3A 5GM2A 2YJNA 3M81A 4LYJA 5F64A 1R8SA 1PSKL 4OI0A 1GRCA 3T3PF 1A5ZA 1V5IA 4M8SA 3VHXA 3O3EB 2OPBA 1SZPA 2F3UA 4KKVA 1FH2A 2VXQA 3ZO0A 2R1YB 1JPJA 2ZSKA 1GTSA 4WNQA 4L8SB 4UYQA 4WNJA 1W2HA 4Y19D 5ITVA 1H2YA 3CZRA 3OZ7A 4M88A 1I7ZA 2XOKA 4Q9BA 3WLJA 4R3WA 4F6RA 3IUJA 2PGIA 2X4UB 5CINH 4Q7JB 3L6DA 1OV6A 4PNPA 3NWOA 4MS4B 1XYGA 3EDJA 2XZCH 4BVHA 2O2ZA 3RDTC 1LQ2A 2HCFA 2ROXA 3VAZA 5K0SA 3HS0C 3JQ7B 5JPIA 4URWR 3SM3A 5E5LA 4C8XA 3C0KA 1Y1DA 3HE6C 3SKNA 2J6BA 3VH8G 4R1LA 1JF1A 1XEXB 3EW7A 3HCNA 5FGSA 3EBIA 5KYVA 3UYRH 2WSSD 2D7NA 4TTDD 3D3VE 3ETBF 4LWPA 3E58A 4KWHA 1J2TA 5HFNA 1HUQA 2XB8A 3PA6A 1CJTC 1DVQA 1U8FO 4Q1DA 4XDYA 3V6BR 1R5OA 3AUSA 3NKLA 4QFBA 4A10A 4TRNA 4X00A 4I99A 1F4HA 4C14A 4GLOA 2ZJYA 5ENDA 1T8SA 1ISIA 3NBZC 1KJJA 5TGBB 1AV7A 2NLOA 4Q3NA 5DFVC 2W2NA 4XCYA 4EBQL 4YV2A 3PX7A 3UMCA 5KYWB 4NIKB 4D92A 5KIAA 5CD5D 4HJEA 1B1AA 4RJJA 2ZKYA 5KTRA 3WFCH 1KLUB 5JPNC 4EEKA 4DLNA 2N46A 3MR9B 1S3SA 3W39A 2AXJA 1KZGB 5JW4M 3PZRA 4J6EA 1BA9A 2H3NB 4H59A 2EXYD 2EHJA 3U4GA 4C21A 4TMZA 1UXWA 2YXFA 1R6VA 2VW4A 3DVGB 2XADA 4OJKA 2X41A 1E8MA 3GINA 4JFEA 1SJMA 5IGXH 3FLEA 2G2NA 3L02A 1GGTA 3CE9A 3MRBB 1EIWA 3B1KA 1F6FB 4ERSH 1QFZA 1KO8A 3COWA 4G0QA 1ES9A 1XF5B 2PL3A 4OXRA 3TEWA 1KGCE 4W8GA 3K0SA 3GAAA 2ZBQA 3PWLB 3VVBA 4ZGBA 1J1ZA 3I1YA 4Z7AA 3WS6C 3TQFA 1VCMA 2Z9BA 5E8DH 1QRND 4X8OA 4K3EL 3H6JA 1CD8A 4OD3H 4XCXA 1J5OL 3Q9UA 4HB2A 4HZUA 2BNQB 2PO5A 4AJKA 1FU4A 3B5GA 3I5XA 4EZEA 5JCXA 3BSYA 1N26A 2IAMD 1MJUL 1HSBA 2XQVA 1NUSA 1ZHNB 3EIOA 4Q6YA 2RGEA 4C7BA 3AF4A 1A6AA 3DVNB 4IDLA 3IN2A 4PTTB 3WLRA 4JOBA 4R96A 5C3IA 1QOPB 4MMXC 1UKAA 3LZFH 5F3DA 4MNHA 2HPHA 5J4YA 4K81B 1HX7A 4JFEB 2R11A 3QFJB 2D2CC 3FE2A 2P78A 4WOBA 3GB7A 4J1TA 1P0IA 3OQNA 1RIHL 4Z76A 4P5TA 2YA0A 4LF8B 4EB6B 4YRMA 1MORA 4R8SA 4XXWA 2GC7C 4UARA 4R8RA 3V2GA 5F8QC 4HHWA 4ATWA 1V5GA 3FF4A 4BMCA 3M7FB 1PJRA 3JQAA 4GIOA 2J4WL 5LQSA 4J3OH 5CR9A 1KWGA 3HZRA 4X20A 4OUKX 2AP2A 1CICD 2DMKA 4OMCA 1P4LB 2ZRDA 1CK0H 1NNLA 4B9JA 2XB9A 2BNQA 1CC3A 3NRFA 2NY4C 4LC9A 3EZYA 3B3IA 4Q4JA 1WK0A 4BL5A 1WFIA 3TIFA 1PWZA 4B3SB 2PRIA 3AY6A 4D7PA 1NFAA 4ZVTA 3HTXA 2JFZA 3M83A 4Z7WB 1EA7A 1LO5B 4WI6A 4BWTA 3DWFA 1CQYA 3FOFC 4ZZ0A 4FQXD 1LVUA 2BHSA 4PSKA 3KWVA 4HPYH 1T26A 3C6ZA 3LP8A 1YI8A 1N4XH 4UCFA 1CFJA 3KJQA 3QXCA 4PWHA 3AEYA 2PZFA 3SO3B 1NSNH 4LI3X 3Q5OA 2ZUCA 3SKVA 5C7OO 2MRYA 4ZYWA 3IIMA 3SO5A 1H6BA 2D00A 4AZ8B 3OF3A 1N2JA 2YWDA 3IBFA 4HMDA 4ADGA 1ELOA 5SYAA 4ZX6A 2ZAGA 3N8KA 1BW9A 4OZIF 5E95A 2HXYA 4LCCB 4D3YA 4I1YA 4XKJA 3ZQXA 4OL0A 5T3XE 1W4LA 3RNKA 5DQJA 3NGLA 5HPYB 1JRHL 3EEIA 2OMYB 4A6YA 4HQQL 3H56A 4FWIB 4TMVA 3QSYA 4XO5A 1T3GA 2QVLA 2VAVA 4LGYA 2B1GA 3H5AA 4LCEA 3MUZ1 2VNCA 3G1TA 4G1CA 3HKCA 4M0UA 3D3WB 3QDJD 1W46A 2EZTA 1NBCA 3BW9A 4ES9A 4HS8H 4Y9GA 2JK0A 3IS1X 2Q5EA 5A3SA 4JFSA 1ABEA 5AK4A 1UZAA 2ZR7A 1ZXBA 1M2EA 3NOQA 1PLCA 4BO2A 3OKLB 4LJ5A 1AG9A 5SWQB 1K4CB 3IO5A 4RCVA 2QHRH 4U2BA 1N64H 4U8HA 4IJ3C 1DUIA 3HEAA 3IAM6 3SPGA 4GKKB 4HHGA 3GBLA 4DTGH 2BCMA 1CDOA 4N8EA 1F18A 4IIHA 1LO0H 1J05A 1MCIA 2E4YA 3M0EA 5EORL 3O9WA 1KERA 3PWUA 1P74A 35C8L 3B9KB 2B7CA 4CI0B 1E7RA 1IGCL 1FNCA 5DQ9A 4DCPA 3L4XA 3C5SA 4L9LB 2I3AA 3JWHA 1ZCJA 4RTKA 4F4IA 3U9PH 2IXAA 5DI8A 2Y5QA 1ODFA 3BWVA 1M3IA 3ZHVA 2XF8A 4CC0A 1KGJA 4ZMWA 4HQ0A 3DXXA 4XOUA 5KOIA 3ZE1B 4IGKA 2CUZA 4YS6A 1MO4A 2QT9A 3OXRA 4PYQA 3ZW3A 5AW6A 3ARBD 1S7WA 3UPUA 4F80A 3PQ8A 4JDPA 1DLIA 1AJEA 3DR5A 2R5NA 3AXLB 3PE9A 1RV6X 5SWSA 4FW9A 3BYTA 3QUYB 5BVGA 3RE0A 1O8BA 1QTYT 5LNDA 2VLJA 1A4XA 3U16A 3MNMA 3AFIA 4ZALA 1RWBA 3C43A 1YEIH 3KG2A 2FK9A 2QVFB 5AWNH 1CLEA 4YHLH 3EAQA 2IKSA 4UM9A 5LDUA 1GFZA 3J7HA 2QSYA 1R50A 1QKZH 1VACA 5ISZB 1A3QA 4MD5A 5F1YA 4KQGA 2ATXA 1BQ3A 1YASA 1M2GA 3R44A 2JLYA 1BQKA 3VFPA 1UBEA 5JAUA 3RJQB 4H7FA 1S8OA 1BEXA 4MNTA 5T3XH 4NQCA 4DV2B 4XNYL 2Z58A 3BIXA 1JECA 1ZCFA 4NOFA 3WDHA 5DXJA 3V5HB 4ABQA 4BZWA 1N6OA 5J2UB 1N25A 4QUIA 1B4TA 2K9UA 4AF7A 5M34A 1KJ2L 1MCOH 4HVAA 1EFXA 1QO7A 4NYIQ 2CLIB 3N75A 3NBXX 4P82A 4D46A 3FKSD 3THSA 2FZWA 1GARA 4ZAGA 5DLML 1DQYA 2VRBA 5AOJA 3VWJB 1YRQA 3KCWA 3LO8A 2ODAA 1UFRA 2AK1L 1WT5A 1QRNB 1NUHA 5GGTH 4F86A 5J2TB 5LYJF 2YMMA 1RURL 4WVFA 4JUFA 4DKEH 3SDAC 3PUKA 1L9XA 4GW5B 1WZNA 4XXDA 4GQ9L 4TROA 1NP3A 5LN1A 4FFLA 3ABMB 3ZMRA 4C29A 1AUQA 2P5EA 4PJCE 2HL6A 2Z6QA 5DIZA 4CXMA 3L3GA 3FQWB 4IKJA 4LCCA 1NCCL 5KBKA 3DDWA 4KXUA 3Q3HA 1XFAA 3L8GA 3KQTA 4RFEB 3LDBB 1XCTB 1DAFA 1EFPB 3H3PH 3B7PA 4HUXA 1D1PA 3ZTDC 3SS8A 5FYKE 4M29A 1C3EA 5T1LA 2XZLA 3MJRA 3QKRA 1UXGA 3WNJA 1KYQA 3WR5A 3QIUB 4I36A 1ZS8A 1IWBB 3EPHA 4ZPJA 3H42B 3BTVA 3P2TA 4BBZA 1IONA 3PGLA 3G0BA 4YSEA 2WTEA 2PGXA 1MNQA 2FEPA 4JKPL 4YBLC 3DDFA 3IDGB 1DQDL 5ER6A 3GMPB 4MRMB 1A6TA 1TT5B 4XYEA 5AM1A 1LLDA 3IGUA 2X1HA 1RLMA 4CEJB 2C2XA 4YMWA 3N8NA 1OOEA 4ZQKA 1WJGA 1ISHA 1AOZA 2P6NA 5D7IB 2Z7UA 2RQ8A 4GP5B 4WSKA 3NALA 2H7YA 3TVTA 2Y0DA 3KDMB 1AGFA 1W80A 4NS0A 4RPHA 1N6HA 1ZW6A 4BZ2L 4JXJA 3LRLA 1R5NA 4B3CA 3GLEA 4C9BA 4HSGA 2QE7A 2CUNA 4ZAKB 3L93A 3TWYA 2P5WA 5BQFA 2WYHA 4EHDA 4PUBH 5LZ4A 1GADO 4Z0XB 3L46A 4G5GA 4K9NA 3C5CA 4Z0BL 9ABPA 1UZGA 2R1VA 1Y34E 4MQEA 1BS9A 3UHFA 1MABB 5K59F 3TMYA 4E41D 4X7FC 2JRLA 4G5FA 1DEKA 1RWNA 5ITFB 1HOCA 4FMKA 5TY0A 1V4BA 3RUGA 4M9XA 4YIQB 2VDPH 2ORBL 2HHCA 2PFGA 4WD3A 1ULVA 2ZI3A 4MRAA 4LSWA 1XN1A 1S7SA 1KQNA 5ALNA 5C8VA 4FOOA 3SN6N 1NXPA 3CF2A 3KB2A 2PT6A 4YMHA 1CR1A 2CMDA 4DN6A 1ZNXA 2EXWD 4ZV7A 3O0RL 1AO7B 5TMDA 2B35A 2P40A 3B2XA 3M8OH 1T5LA 1UCTA 3A9WA 3C3PA 3KUXA 4ZVUA 1LO0L 1E4KA 3HZYB 5BOPA 1QH1A 5LC1A 3QEKA 2HXAA 4DLBA 3H4VA 5IAEA 4UBKA 3R8CA 2D7MA 4P31A 3OWXA 3U37A 1F1BA 1ODCA 1UEIA 4XTRC 3H87A 1IVLA 3L1VA 2DQUL 3SZ6A 2HPAA 4DOMA 4FMCB 2D8AA 1LO4H 5HQTA 2YPKB 3ELWA 4IM8A 1XSOA 4G6MH 3D7RA 1SY6A 4HOMA 2EDMA 3RABA 2BOVA 2ZCKL 1KHTA 4RZCB 1VPWA 3P3UA 4QO8A 1MB4A 1BRMA 5EIIB 4R1OA 3GTVA 1PJCA 3BWDD 1QLFB 2E7CA 5BZDA 2APVA 4KK4A 1T36A 5CX4A 4NNPH 4WW2B 3WTSA 2NVOA 4KAQH 1AYOA 3HG0A 1H0RA 1Q1EA 2C9RA 1V3KA 1CGUA 2QWXA 4BMYA 5DM1A 4V24A 3VFGH 3IMBA 4X9XA 1KG0A 1YKFA 1KBQA 4XA8A 3AOEC 2HKIA 3ZE8A 5J23A 3KKPA 3KPMA 1QKIA 1HEZA 1USWA 5DM0A 4DR2B 3T54A 3JARB 5GS0C 4XE5B 4N28A 2JFWA 3IRUA 2NWQA 3PHLA 4F58H 3HTLX 4EQ3A 3WUWG 2PNDA 4XIFA 5EHQA 3OAWA 1Z6PA 2E0IA 2WKQA 4W5HA 4M7WA 2PQMA 4FR2A 3CNQS 3O26A 3V1LA 2M83A 4A7UA 3MUHL 4OD1L 4ODVL 4YX2H 3DPBA 5IVZB 1T4DA 2YV1A 1XRMA 3L95A 1GCUA 3HKBA 1YT5A 4M7KL 5HHTA 1EXUB 5F7OA 2XA9A 1WSDA 4Z1MD 4FG4A 1FC1A 3WIUA 1T83A 3OSZA 1KY4A 2XNHA 2WIBA 1ONPA 4IDHA 3ZHDA 3ZRSA 1TL7C 3PNBA 3U82B 1ZT4A 4W81A 1CR0A 2Y0BA 1H6TA 4N40A 5A6SA 2PH5A 4EBFA 1U0GA 1KYFA 1S9YA 4QHMA 4X7EC 5EU3B 1UDCA 3I72A 2GPJA 2D9QB 5CD1A 1IRXA 1JTPA 3HE7D 3KXDA 4BE9A 3LT0A 2EUZA 2WLTA 4G5AA 1IKOP 2XTJB 3EO0A 1RUQL 2D0FA 4P2OD 1HHGA 2HLEB 3A27A 4TRJA 5J06A 3R9WA 1ZHOA 2C4KA 2IHTA 1KSHA 5BR7A 3U40A 2GO1A 4PONA 4R7NB 2VRQA 4PX5A 4DT1A 4WW0A 2Z92B 5B6IA 5FLKA 3A6CL 3F73A 1RZFH 1RHKA 1QS0B 5CEZD 3EADA 3MJHA 3AT1A 1YTLA 2KB0A 5CP7A 3CISA 3REQA 4U2DA 5DJYB 2A8YA 4WKCA 3CJRA 1RWPA 1Y3AA 1CICC 1CUGA 5FWXA 2N47A 1NLMA 3GMLB 3K3QA 1SD1A 2WEKA 4YREA 2WHYA 4CIYA 4FL4B 4M7ZC 3TD9A 2G77B 3QF4B 3LYRA 4ND2A 4FHDA 4EK9A 1ATIA 1D07A 2FFJA 3DGCR 1AUOA 4AUJA 1KMMA 3SDCC 2FSEA 1PT7A 4G4JA 4IR7A 4MAUL 5HS6A 2MNJB 3MM4A 2IG2H 2ZYAA 3IT0A 4I9NA 4PPTA 4L37B 5TGZA 2FDRA 4HUNB 2OMWA 1Z56C 2AG0A 4JJOA 4HAUA 1KQPA 1UH5A 1K3TA 3D69B 5DJAB 2W8BA 1ADBA 4PLZA 3C2QA 1QYCA 5ENZA 4JQYA 3V1KA 1G2QA 3D2UD 1C7EA 1MVUB 1NBYB 4UMGA 3AHDA 2WU0A 4JFQB 4R0LB 1E9CA 4D9NA 3O41A 4XP4H 4MGHA 4CEIA 2AJZB 3IETA 3K2MC 2ZVPX 1HWHB 2V3VA 4WGVB 4KH1A 3UK6A 4WKXA 4HWKA 3IB3A 4IGIA 3QGVA 3OLCX 4LXGA 5DMKB 4WHTA 1ZG3A 4GOXA 4FCHA 1FUYB 4TVPD 2E9GA 3GKWL 3GYGA 1VJ5A 5LQDA 1SCKA 1GIAA 2GEQA 3AYZB 3ECQA 2HH9A 4PQGA 2FIKB 3A6OA 2K7ZA 5I1HH 5IM4A 3O8XB 6FABH 1BQHA 1SOXA 5E9DA 1E1RA 2DBVO 3VMPA 2QTHA 5HYVA 5IM5A 1JH9A 1OT4A 2WXIA 2VXSL 5HJ3B 3QCVH 4BAGA 2XFXA 4BFOA 5ESRA 4ILEA 5I15L 3LH5A 3ULVE 2BGWA 3DLCA 2Q7AA 5C0JB 4EHHA 4RF4A 4MQ4A 4EPYA 4B6PA 5I1IL 2XYCA 1GGNA 1QUEA 2NUBA 4C22A 2P8SA 1RZUA 4U3SA 1U3HA 1S7VA 3LIZH 3ZHLA 1IULA 1YEEL 3MMZA 2O5VA 1NCOA 4KDTA 1UC5B 5F5NA 5ICGA 3ZKSD 1OBOA 2ASEA 3DZJA 1VKNA 3PLYA 2X58A 1P60A 4XNUH 4IWNA 2N75A 4YHPA 5D2NB 3VNYA 3LT4A 5L3QB 1CUFA 1YOVA 2J6EH 4S04A 3SFZA 2WBKA 2OK0L 2VDQH 3JWEA 1SBCA 4D98A 1SUJA 2ODTX 3QAZB 5ILTH 3WNBA 5JYCA 1I2BA 3GP3A 1T5XA 1ZT1B 5DHSA 4E5KA 5EFIB 1RK1A 1MY5A 4B7ZA 4PCTA 1VPLA 3DT6A 4MVJA 3I6MA 4KK3A 1LDPL 3HPLB 2XOEA 1NCCH 3HOGA 4NPYA 1EHLL 2O05A 1JWSB 1K9TA 3TASA 2W0SA 1MUUA 3TIEA 3ICWA 5HYSG 3MJEA 2VHJA 3AQIA 3EVTA 2K3HA 2VN5A 4G8GD 1TTQB 3VJ6B 4APQB 5COAA 1NMQA 3GEGA 1E50A 3ZHCA 5FBKA 4ZTBA 1EUCA 4HIIA 1U0SY 1TI7A 2W2XA 3QVWA 1X5FA 5EZOH 1G2PA 4K2UL 5K8JB 2PQ2A 1VI2A 1DZ3A 5JOQA 1TVHB 2XYRA 3DZBA 5I7OA 4KWCA 1RZJH 1ODSA 5ALGA 4UQLA 3IMVA 3E70C 4OZHF 1L8LA 2V4LA 2Q5OA 4AJIA 3PGFL 4OJMX 4Z3HA 4BNZA 2LIVA 4IDEA 4QPJC 4HH3C 1E2WA 3AOEA 5B1KA 4L9SA 4TVPE 2AR9A 4JM4H 1ZMTA 1NDTA 4L5FH 2ZWYA 4JLKA 1YBAA 1A50B 1EXHA 2C9DA 3B70A 1WW2A 1Z7GA 5DZSA 4KDCA 4PHTA 1MHTA 2A4EA 3SYAA 1B2WL 2XZQL 2MQCA 2BMAA 2JVKA 2B4KA 3U2SA 5D8DA 4K3DH 4KZDH 2F8VA 3DBOB 4HXBL 2HUHA 3SKJL 5DUPH 4DUPA 2BVPA 5C2JB 1HTTA 1KCLA 1Q12A 3JWJA 3ZBQA 3JVUA 3WLPA 3NZUA 4JO8A 2LVCA 5FO7A 1ORWA 2CNDA 1XZKA 4XCEB 4L4JA 3BPLB 2I8LA 3K9LA 4U1NA 4HK0A 4OJTA 1TNNA 2Q6OA 4OZHA 1NIAA 2BRQA 3S2CA 2HGZA 5D3MB 2X9GA 1TJXA 5D85A 1W85A 4LAQL 4MWFA 3H9JA 4HX1B 3N5AA 1UM9B 5F1KC 2G76A 5AKIA 5ES3A 1G1KA 5IM7A 1WCQA 2ESVD 2GSGB 4R1UA 4Z9XA 2QPUA 4DYDA 5P21A 4DDUA 3BC9A 3U62A 1CDEA 2FB4L 2FEEL 3GR6A 4UBMA 2ONZA 5DHVB 5E3JA 4DDMA 3B36A 4IRJD 3B9QA 4IDFA 3OLYA 4PWIA 5D1ZA 5EHXA 2GASA 4XWGH 3N2JA 1I5RA 1H0DB 1OXXK 3QB7C 4QODA 3HDJA 1S9VA 2VDMB 2QGEA 2FATL 4NU0A 3IALA 2VHCA 3T1TA 5C1DA 2H1WA 2R2EB 5DX0A 2X4TB 3ASYA 2YWJA 2WY3B 4TZ6A 3NMUF 1AQMA 4OAOA 4ZPXA 2AMYA 1U2YA 4Q2ZB 1OD6A 1L5MA 2IFFL 2HCRA 4DF3A 4GRAA 4ZFGL 2BVYA 4RAOA 5JBIA 1R3DA 1Z33A 5FDYA 3QUCA 4Z4IA 2F74B 2ISCA 3P5SA 4KGZA 4LIQL 2XVYA 5KJRL 1WJ3A 4X6DB 4TYNA 4IQHA 4IHKA 3R06A 3JQPA 5E2UL 3TNDA 5I5JA 2X1WL 1U2TA 3VXRD 1UWVA 4W9RA 4AJ4A 4EIBA 4LRNL 2DUNA 3ROQA 4U1LA 5IFJA 4KZ0A 4L3AA 5CD9A 4PJFF 1OGTB 2XQYG 3T4AA 1M1ZA 4LXHA 3VDNB 2PW1A 1C4KA 4LPSA 4AUUA 5F7FA 3WGTA 1AQNA 2JFPA 5LQBL 3W5MA 3CFNA 2FFQA 2O23A 4YLYA 3D0QA 1E4WH 3DXAA 3TL6A 2FJHA 2MSLA 3OEED 2J08A 3PDIA 3WHXB 5FO8A 2E3JA 4QYSA 1OZGA 3LQ2A 3TLJA 2Z6VA 3PIDA 1F2QA 4AY5A 5HY9A 4YCDA 4EGAA 4EG4A 2QVYX 3KJ4C 3T7TA 1NTDA 4XPFH 3KDMA 3VSQA 4FADA 2H2FA 1W30A 2DQKA 4WW1B 1CVIA 5E6IA 4A1FA 5BW5A 3FPYA 3QWNA 2OILA 2FX2A 2P4SA 3VXQB 2UZ3A 4BWWA 1PCSA 2IH5A 4DCQA 3FCYA 2XCUA 1P1KA 3ELYA 3R1GL 3QX3A 2QKIB 3EPLA 1RZ8A 2PTUA 2WXMA 5F44A 2J0VA 3P2MA 1A88A 4WASA 1GTJ1 3GJEB 4RS4A 2YPVH 2EIMB 4O0LA 2ZBVA 2OGZA 2XITA 2WJPA 1G9NL 2YPLB 4HIIB 2R1XB 2FPSA 4H5SB 4EY6A 2XNJA 5DRNB 1QQAA 2ZGVA 4LVHB 3DKRA 2X40A 3BVXA 4AZWA 3TKYA 1ZM4A 3M1CA 2X3FA 4CE6A 4CCSA 2R0LL 1B0AA 2CCWA 4YFEA 1G3IA 1AXGA 1FH5L 4N3UA 4DSYA 1WHOA 1RJEA 4II2A 4X1IA 1XHFA 4O4IA 2AHOA 4G1EB 4HH9B 3HZZA 1MHPH 1KNQA 4BV8A 1XWWA 5DGIA 1JHTB 5HZGA 1ACYH 1UC9A 3FN0H 1XQYA 5EZSA 4JZJB 3TG2A 4CM4B 1G4UR 1JTOA 2CCLA 1RD6A 4ND3A 3M4ZA 5JI3E 5CBEA 3R7BA 2GM4A 5D5MF 3LIPA 1B9ZA 5TEVA 3F64A 3JCZA 2J8UE 1QEWB 5I17B 3X1XA 1L5GB 1HILB 1MWOA 2A6KA 2A1WL 2EG9A 3FUCA 4XXCC 3MELA 5I4KA 4NU6A 3DURB 4KHZA 1WV1A 4PV1C 1HKUA 1E0OB 3HCWA 3I50H 2AI0L 4J3OF 5HM8A 4AM0Q 1I0LA 2F61A 1KYYA 5LWHA 1MLCB 2YRBA 5L2KA 2ZE5A 2HXGA 3D34A 5FO7B 1T7WA 1ACXA 5ALQA 1K3IA 2OM6A 1GZHA 1FRQA 3SC2B 3SKYA 1W581 4PGAA 1TIUA 2HFKA 2CNWD 2VAPA 4RFNC 2XWPA 2ZJ8A 2F4VB 2QVKA 1M54A 3VPHA 5A2LH 1FY2A 1EZVX 2BSTB 3OX3A 4ML3A 1AA6A 3T1YB 2UV8A 1YMVA 5EIIA 3RX7A 2JI7A 4XPAH 3MOAH 1XX6A 2C8KA 5FBWB 4XP5H 3Q1EA 2R96A 3LZNA 2NZUG 1Z8DA 2F59A 4LY9A 5DWVA 2B1RA 3GCXA 2ZRIA 2VDQB 2DM4A 3HB3C 4PICA 3HXQA 2HRCA 3T5DA 3OICA 4DGYL 3EH1A 2HA6A 3FMIA 4WEBL 2JWYA 3I9GL 1QFMA 3EG9B 1E5ZA 3L13A 3S36X 2DG2A 2PPAA 3KJFA 5I9LA 2Q6VA 3BCHA 4IG9A 1MT0A 3WNNA 5E2VL 2WVAA 2H63A 2OMEA 4CCYB 2J9RA 1KI1A 1TCRB 4WWID 1WWAX 2RHHA 3R19A 3FSEA 3RSHA 2KLTA 4JMNA 4LLMB 2XV1A 2IELA 3O3BA 4BFCA 3T65B 1ZH6A 3WIHA 4Q97A 1SUDA 4RHCA 1S2OA 2AJ3B 1BHGA 2DWEA 3B1XA 3TYGH 3UC0L 5JISA 3FMGL 4HWSA 4UHCA 4AQEA 4L74A 3AY0A 4KXVA 1EFUA 4IIXA 3U7HB 4Q9AA 1JH8A 3SY6A 3ZZTA 3IFLH 4HNGA 2A9OA 3SBRA 4NNXA 1XGQA 1W5TA 4QUEA 3NTCH 4HPYL 3RYCB 2EERA 4H6PA 3GO4A 2Z8YM 3M45A 1ISPA 2DQDL 2H1SA 5I6XC 5C5IA 3CBKB 4ARCA 1E6CA 1FSFA 3B3BA 1QCCA 1PYGA 2JLZA 3A21A 3CRRA 3FYUA 3TP4A 3GBDA 3HG1B 1NBWB 4HBGA 5EIFA 1AH2A 4TOYL 2YOFA 4WUKL 1U2ZA 3LEXB 2OV8A 1CR2A 2EILB 5EBLB 5GSVA 2VSYA 3T6QC 3APNA 4LK2A 4JHBA 2GABA 5DA0B 3T71A 4PLJC 3WGIA 4M48H 3WS6A 5ABZA 4RV4A 2RAPA 2WQ6A 1PTJA 4I0WB 4V1CA 3QT2A 4NC1E 5AOBA 2NQ8A 3RTQD 2H4HA 4RVHA 3FFCA 8PAZA 2VOEA 2VYNA 4HUXB 3NBUA 4X3CA 5HGXA 1CQJA 4PG9A 3HNOA 1RZ7L 2PRZA 3OY2A 3U7RA 2VLKB 3CUSA 4E12A 4ZHSA 3ER6A 1KJZA 1N1DA 3RYCA 5JMTA 1XCLA 3ANTA 3DFZA 4PC7A 1HDZA 3CIQA 3BMNB 1MWAB 5AHOA 1FQ9C 4LKXA 1RJWA 2VXUH 1RQRA 3QUMA 4G9FE 3ENWA 4LY3A 4GFXA 2P4HX 2A9VA 2B8EA 1A02N 1G7SA 2Z2JA 4QWWC 4BXSV 1W8IA 1XB6A 3RZWA 1ZU4A 4W9HC 5LGYA 2TRHA 4QBKA 3KLAB 4RZ3A 3PABB 4FDLA 4CM9D 2IPNA 3PFGA 1QFSA 1OCCB 4PLWA 4B79A 3E5MA 5I5EA 2X2PA 5DHUA 3TT1L 2OGSA 3FTUA 5I2IA 3UZEC 3R5TA 3B6SB 4JRXE 2II6A 1XA3A 1NKRA 3KQVA 5FYLH 4LNRA 3K0BA 3S5LA 3K5HA 1Q8MA 3WGMA 3D4CA 2CLEB 2A5YB 4GZLA 2RFXA 5KAPA 3SPVA 3N42F 1EGMB 3JPWA 3ISVA 3RPIB 1TJHH 4E9QA 5ERXA 2IH1B 3BJEA 4RULA 1M9WA 5J2UA 2CE7A 1MDBA 4BWYA 4HUWA 2N0SA 3RFTA 1IGFL 3V42A 3NVMB 2WINB 2QPOA 1GZPA 1O6SA 2F3QA 3TT3L 3OVMA 1E7QA 3C85A 4L4VB 3K0FA 2EXYC 1S7TA 4JDUA 2NZIA 1OAXL 3T3DA 2V9PA 2HSGA 5EFZA 2CHFA 4YAWA 3UXHA 4PIPA 3IDNB 2CALA 2OZ4L 1C9MA 3UJPA 4I55B 5CFNA 1RRPA 1CE8A 4W7SA 3A4MA 2CPCA 2PXYA 3TLGB 4BKPA 3FT2B 4XO9A 5C9JA 2LCQA 5IWAB 2V5VA 2WMPB 4MW1A 3HSYA 4AZ0A 3VFSA 3M4JA 2JHGA 3GXIA 5IABA 2VJOA 2SHKA 3RJ9A 3S6CA 4H08A 1Y5IA 5CP7B 3T9BA 4AG3A 2JVJA 3F7MA 2EAEA 1F90L 3QKTA 4HPOH 4YPGA 4KJZA 1K7SN 4QT5A 2YWGA 1E1KA 4GUPB 2ZOWA 3HLAB 5I9TA 2DUJA 1FW6A 5DLPA 5FFMA 5FYJU 4HNRA 4YC7A 4BEBA 1L7IL 2X8BA 3QDJE 2IMMA 2J4WH 4H0CA 2RI1A 2YK1L 1AZRA 3PDCA 1O7DC 1T9DA 2FOLA 3GVHA 3O75A 3R6DA 4N6RA 4C47A 1RQGA 1WPGA 3W2DL 4G9GA 2XZDA 5FLVA 2EVHA 3Q7PA 1Q1AA 3JZAA 4F72A 4I0CC 4WKGA 1BCSB 3E2HB 3Q88A 5KHLB 3MERA 5CTAA 3S37L 1F2DA 4HVBA 4LLDA 1VGVA 4NWIA 4WUUD 1NUTA 1N59B 2P1ZA 2P26A 1JDJA 5DTRA 4AROA 4ORZC 3L4VA 4Y9BA 2WINI 2VF5X 1KCRL 1IN5A 2RGCA 4MV4A 3LA6A 2YZ2A 2AJZA 3IETB 2VUKA 3G9ZA 2YQ2A 4EP1A 4FZ8H 2GN1A 1H5QA 1P61B 4PMEA 3G08B 2DIEA 2VZTA 1VRCA 3X2QB 2V7HB 4ZIRA 1HCFX 1LFDB 3MUGA 5A4JA 4BXOA 4RMVA 2RHWA 1R4AA 2W9EL 1EAPB 5KVMC 5A6IA 3T1FB 1XMEB 1L4UA 5AJHA 3EYUH 2YHGA 5I9BA 5FD8A 4MD4B 3RIMA 1KU6A 2DYSB 1A4JA 4L16A 5MENE 1YYCA 5AVZA 2GVNA 421PA 2Z95A 4DNFA 3BPCA 3A6CH 1I94B 1U2DA 4EZBA 4TV3A 4LKXB 4K6GA 1BQEA 1OX4A 2Z3FA 5HJ5A 4YJ3A 3DLQR 4GH5A 3O4RA 4XGNA 1OVGA 3G5MA 1CQPA 3DTVA 4BZ1L 2J9GA 1PD1A 4QXVA 4LRUA 2VSCA 3D2LA 4WEMB 4EG8A 1N8ZA 4KKLC 2ICWI 4GU5A 4HD9A 1SVIA 1AX9A 5IXYA 3EXIA 3WY2A 5FGRA 3QPWA 5DJYA 1FFXB 5DRXA 3PWTA 2PKQP 5KYWA 2IHVA 4MDEA 1I0IA 2HEIA 3SXJA 4MPPA 3Q8FA 4ARSA 4HRYA 2JLLA 4J1UA 4HO1X 5E9DE 1DQSA 1ZMBA 3V4LA 5E6ID 4QQKA 4JANA 1Y5LA 1X9GA 1S2NA 1NU8A 4M6MH 3EGCA 2P3SA 4JHWH 3GK8H 4KXYA 1N8KA 1Y89A 2PLWA 3WKCA 3HWWA 2BEVA 1OP5H 4M83A