2VDKB

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
total genus 129
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdkB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdkB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdkB03
5KYXA 1N9ZA 4C2AA 1YVRA 4HQLA 4IHKA 1PD0A 5KYWB 1AOXA 3V4VB 1SQ0A 3ZDYB 4UM9D 3FCUB 4C2BA 1QC5B 3GXBA 5KYUB 4NEHB 4MMXA 1U0NA 4JDUA 4C29A 5E6RB 3EGXB 3T3PB 1SHTX 4HQFA 2VDKB 5E6SA 3K72A 4GZ8A 1N3YA 4O02B 3RAGA 3AL9A 1AO3A 3IJEA 5KYNA 4DMUB 2ICAA 2QTVA 1CQPA 3NIGB 1TYEB 5ES4B 3ZQKA 3NIFB 3PPWA 1MQ8B 4MMYB 1RS0A 1MQ9A 1M2VB 1PT6A 1T6BY 4WK2B 2WW8A 1L5GB 3NIDB 2ODQA 1DZIA 2VDPB 2P28A 1FNSA 2XGGA 4Z7QB 4CN9A 1JV2B 3PPVA 3FCSA 5KYYA 3TCXB 5KYXB 4A0QA 1JEYA 2VC2B 3EFOA 1XDGA 3K71B 2VDQB 1MJNA 1T0PA 1IDN1 1ZOPA 4F1JA 3QA3E 3ZE0B 4WJKB 4WK0B 1YUKA 4CNBA 2VDNB 3AL8A 4G1MA 3V4PB 3AFCA 3PPXA 1PD1A 1UEXC 1V7PC 4MMXB 2X5NA 1U0OC 3OL2A 4O3TB 1MF7A 1ZONA 3BN3A 1NA5A 1SSLA 3F78A 1M2OA 5E6SB 4WFQA 3K72B 3ZE1B 3EH1A 4MMZA 4G1EA 2ODPA 3N2NA 1YVPA 1MHPA 4FWWA 1RD4A 2I91A 1ZOOA 2NUTA 3EG9A 1M1XA 3IJEB 3ZDZB 4F1KA 3TVYA 2I6SA 4FX5A 4HQKA 1QCYA 3HXOA 3PPYA 2M32A 2O7NA 2VDOB 3T3MB 2UZYB 1XDDA 1BHO1 2VDLB 3BQMB 5HGJA 1CK4A 1MQAA 1OAKA 2NUPA 1JEQA 2XWBF 1ATZA 4IXDA 3BQNB 5E6UA 3K6SA 1PCXA 4Z7OB 2VDRB 2NVOA 3FCSB 4UM9B 3VI3B 1LFAA 1JEYB 3EFOB 1U8CA 3HXQA 1XUOA 2XWJI 3EGDA 4NENA 2IUEA 1SHYB 3HI6A 3F74A 3NVQA 2P26A 4XW2A 1JLMA 3AL8B 5KYWA 4G1MB 3M6FA 1IDOA 4HQNA 1BHQ1 4M76B 2WINI 5LN1A 1RRKA 3K71A 1QC5A 3OL2B 5BV8A 5KYUA 2ADFA 2B2XA 2I6QA 3Q3GE 4BJ3A 1Q0PA 4JX0A 4MMZB 4G1EB 3EOAI 3EGXA 5E6RA 5HJ2A 1SHUX 3VI4B 1M1UA 2NUTB 3EG9B 1M1XB 3OKWA 4O3UB 4O02A 1FE8A 1OLZA 3ZE2B 2VDMB 4IGIA 1DGQA 4Z7NB 1IJBA 4HQOA 5KYYB 4MMYA 3ZDXB 3EOBI 2NUPB 1JEQB 1RTKA 3TXAA 4CN8A 3EH2A 5E6UB 3K6SB 3OKYB 1IJKA 1M2VA 4WK4B 3E2MA 5HDBB 1L5GA 4PN7A 3TW0A 4UM8B 4K3JB 1AUQA 1M10A 1JV2A 1U8CB 3IBSA 3EGDB 4NENB
chains in the Genus database with same CATH superfamily
1E3FA 1JLLB 3HB1A 5FV7A 2PF6A 2WMOB 1T6ZA 4QYXA 1R0ZA 3CNOA 3UO8B 3UHFA 3IXTB 3EO0B 3LY6A 5CGZA 4I5BB 2GK0A 3VTTA 2EHJA 1CJBA 4LQ4A 3KXFB 1JI3A 4R2GB 4DKFL 1P7KA 1WTAA 3RAFC 5MERA 4JLRB 3MRCA 1U2EA 4IIJB 4AMKL 4AI7A 2E0PA 2CQVA 1EHKB 4MD5A 3C98A 3RDJA 2GM5A 2FMUA 2BR3A 1QLHA 4JVOA 2QXUA 3OMLA 2G17A 1PV4A 3F4BA 4CODB 1PCSA 2GK0B 4GVXA 5DRTA 1K1EA 1GTG1 4M29A 3RL1A 1P7KB 4KLRA 5MERB 5IXJA 4CILA 3MRCB 3JQFC 4DB2A 3RLFA 1EAPA 1YUHA 3DX3A 3EIFA 4RPGA 4TQPA 3D39D 5T1DH 3NAQA 4AENB 1XWIA 2G5PA 4GECA 4PS4L 1GPBA 2AR7A 1FNEB 1Q1EA 3ZNOA 2QLYA 4MD5B 1SXJE 1QCCA 1EJ6A 1PDKA 5SWSE 4NQDA 1THAA 2WAAA 5FTNA 1MAAA 1EA7A 2V4LA 1OCZB 3RL1B 2WWGA 1OQAA 1QH1A 1F8YA 4YGVA 5T1DL 1FDVA 3FVQA 1EAPB 1YUHB 3DMMA 3MMXA 4NDMA 4W5RA 3QTTA 1I53A 5BRZA 4S1RL 3IMVA 4F04A 1TMKA 2RK3A 5T4FA 2XOEA 4IIBA 5IEHA 1S5IL 3IT8D 3ZU2A 3VXUD 1PDKB 1YK0A 4PYNA 2JAWA 2DPKA 4AJNA 1XT6A 4HS3A 3T4XA 1HE7A 3ME0A 2WXFA 1Z6JT 1E7SA 2YJZA 4FHFA 3QE2A 2H0RA 3I5YA 1QH1B 1ZW1A 3OLYA 3ZQKA 1WIPA 4N5LA 4YGVB 3ARRA 5AOIA 1EXNA 4ODXA 3DMMB 4N3CA 5E3JA 2LE9A 4NDMB 4M0DA 4NNJA 1HE5A 5BRZB 1QZTA 4XBMA 1YQGA 3P2JA 4WY7L 2H9GA 2IPMA 4UVHA 2JCYA 1J1UA 4K8RB 3LF1A 3MUZ1 2OYSA 5IEHB 1WJ3A 4WJKB 4KUHA 2NY3D 3O2VL 3FHEA 5DD3H 2PPLA 1NMZA 1I3VA 4HS3B 1Z0MA 5I7EA 3ME0B 2H1RA 5D7LE 4WSGA 1UWCA 4K9MA 5FB3A 2HADA 4OKSA 3WEBA 3VU3A 5AHXA 4OK6A 3THMH 2Y0SA 4ODXB 1JIKA 3L7FA 4KWCA 5AI0A 4HIXH 2H9GB 2CNKA 4L5FH 1PG7W 2H29A 4HDCA 2EDYA 1CU1A 1ZD1A 2OEPA 5GJWC 1JJVA 1WHPA 3O8XD 1P9NA 4G1CA 5DD3L 4Z77A 4MYDA 1FDUA 3LZQA 2GHTA 3K6IA 1BREA 4X4YA 2PMEA 1YCHA 1PFQA 4LYGA 2VCYA 4HIXL 3L7FB 2GSIA 2G9VA 3KZ1E 1P2GA 2QGFA 2C7PA 1F0PA 1JU4A 5CW1A 2JNWA 2HA0A 5KC9A 4NKQB 1X5AA 2KLRA 1GQ2A 2H0QA 3CU5A 4BQRA 1L3WA 3M5CA 4D9NA 4KC3B 1C8QA 1YWGO 2NAFA 3JWHA 3BTSA 3QRGH 4DT2A 2ZCVA 1A6UH 2GSIB 3F5FA 1BU5A 3BVPA 2REBA 3B3GA 3O95A 2CR3A 4WRRA 2W5PA 1Z0IA 1T22A 4RQQA 2FIRT 4B33A 1E67A 4AV5A 2QHLA 3QQ9C 4OQTL 2OUIA 4M0KA 1SUFA 3AG5A 3OZFA 4L0DA 5E6ID 1K7XB 1NA5A 4J0EA 4F3CA 1A6UL 4UULA 1LTXA 1P7YA 3S4SG 1E2FA 2A99A 3MUNA 4MTLA 2X1PA 3MRRA 1TM7E 2GKIA 2J20A 4BX9A 1PGOA 2IUTA 1KB5A 4LMPA 1ZD3A 4TWRA 2ADMA 1ZWIA 2CO1A 1YRQA 4KDEA 4ZMPA 2ZX8A 3T9BA 1T22B 4RQQB 4BQOA 3EARA 5LAPA 1FSGA 4G0WA 2QTEA 3UO1H 4DQOL 2QQFA 5AKRA 5IEBA 3AR7A 3ULVD 5AKIA 4DUZB 3L4SO 3HBGA 4JFOB 3EASA 4W6ZA 1MJFA 1F42A 2NXNA 2DKOA 1T1IA 3ICWA 3IETA 1ML4A 3MRRB 1EJ8A 5DFAA 1CDBA 1KB5B 1NW8A 4PW3A 4MDFA 1U8NA 1ZWIB 1DO8A 2ZJ2A 1V41E 2X53A 5FYQA 1N2XA 3WFDH 4OCNC 3SKOA 3CN1A 3GXNA 1OVZA 2PUEA 5D7IF 3TSCA 1JVBA 2G1UA 4MAYC 1N92A 2QLJA 1IGJA 1GGYA 3BAKA 3TLCA 3A3NA 1COWA 4ZA2A 3AG3B 3G9XA 3MILA 5C51B 3OQJA 1I5OA 3IJEA 5C80A 4KMLB 2FJFA 4X8GA 1HYBA 3QX8A 1G19A 3OSKA 1S9XA 1U8NB 3WFDL 1WXDA 2F8XC 3CSBA 3DMRA 1K27A 3SKOB 2J32A 3A2NA 3HR8A 5DVKA 3B9AA 2CHZA 1PIWA 3WEXA 5KKNB 3QJFA 1XR8A 4PJ5A 3M7OA 1IGJB 4Q4LA 1P17A 4MWTA 3EH1A 4JJGA 3IJEB 1A98A 4JIGA 3IQFA 2FJFB 4LHXA 5C08A 4N01A 2OMVB 1SMDA 3QDJA 5ISZA 3GMLA 5EFOA 4QXOA 2AZ4A 3MLYL 2R83A 4BZ1H 3GZPA 2O52A 1Z5ZA 3PEFA 4FQ5A 1E2QA 3WEXB 1LC0A 1QG3A 3QJFB 4GU5A 1XR8B 3LPAA 2VQ4A 4PJ5B 4D4IA 3FUUA 3ESBA 4Q7LA 4RMGA 4FFZA 3S4SA 3I9AA 1SZDA 5AW6A 5KCZA 4NPAA 5C08B 4GSRA 5ISZB 3GMLB 4HCFA 3OHSX 1TTRA 4WFIA 3A0OA 2GTPA 1FA4A 3ZVKA 4BKPA 2WYUA 3HYLA 3KOMA 5KQSA 2P69A 2W2XA 1JNNH 3HKEA 1K89A 4FLRA 1M05A 3EPJA 3IGKA 4KX3A 3V8OA 4EI9A 5KAQG 1FPTL 4JUDX 1XZIA 4C0JA 4C21A 4P1ZA 5D7BA 3S4SB 4OGXH 1WUIS 1PWHA 1IZZA 2CJPA 5AW6B 4Q3EA 3H56A 5A3ID 3EYAA 4MDJA 2FJSA 1R18A 4PLJC 2FSPA 3NCMA 4PZUA 5GHWH 5AYUH 3HKEB 1XH2A 1M05B 2WU1A 2WY3B 2PEYA 4OGXL 4OZIA 4IJTA 2WB1A 3WKNA 2FNWA 4Q9RH 3D2UD 4PVLA 3VX1A 1SKYB 5HHXL 4YHYC 2AEFA 1VMIA 1WTGT 2D5IA 3K6RA 3K0FA 4MDJB 4HX5A 4HUQA 3U4BL 5CB4A 2G9RA 5FGBA 4TZTA 4I1YA 2O5EA 5GHWL 3AI7A 1YVUA 3PJDA 3SE3C 1DJIA 3OSZA 2IPTH 4XMVA 2EDTA 1L8QA 3ULUE 1Q74A 1YIAA 3O7WA 4W5WA 1V6CA 2Y68A 4OZIB 1X5ZA 2QIPA 2L7QA 4K3EH 3QQNA 4E32A 3IVGA 3JTMA 2O5VA 3EGXA 4KXVA 1VYHA 3K0FB 2IIQA 3PPSA 4XAWH 4HUQB 3ZR5A 5CB4B 5T1KD 4DMCA 2IPTL 4RVSA 3T99A 5LBGA 4X5PA 2K7PA 3SGDH 3W2DL 4IKLA 1HKUA 3A3KA 5SZHB 5FYKE 3IMFA 3IAXA 1M2HA 2WLSA 2JCXA 1DE0A 5M29A 1X7XB 3EGXB 2Q20A 4MWOA 2C3GA 3QEQD 3C1UA 3D02A 5AOAA 1K06A 5A40E 2LGJA 3BPOB 4IDFA 5EC1A 5EE1A 1MCPL 3HXTA 5SYAA 3MSCA 3G1WA 4R98A 4QXTA 1HAWA 3KEOA 3JBG7 3JQQA 1S7SA 1IWPB 2FW6A 4NR0A 3AGVA 5BR8B 3UWSA 3HHPA 2VRNA 1O57A 2HPTA 1FA9A 2G5CA 1DI0A 3CGWA 2DBJA 3EMKA 3F6JA 3M8OH 1XEAA 5I5JA 4NO5A 4DCMA 3JAMA 1OTSD 1ONBA 1H3EA 3X3FH 2ZBFA 2DLIA 3EDJA 1USVA 2MOKA 5E9NA 1THGA 3WTCA 2E3VA 4HUCA 1JU9A 2QPLA 3QIBD 5EC1B 5HKBA 1Z8FA 4QXTB 1F0KA 1NMXA 4RA9A 1GILA 2WHYA 3GSNL 4FEYA 1S7SB 3ECBA 3TV3L 3UG5A 4ER3A 3TI7A 1A8JH 2YCLA 1QBAA 4N8EA 1S3RA 1DAHA 4NO5B 1AKTA 2N7AA 4G5SA 1QVRA 3MNMA 4ZMBA 2MQCA 3PGJA 4EPTA 4Y2NA 1GGKA 5A3QA 4RA9B 4EPWA 2LVCA 3ECBB 4HRAA 2ABWA 3VFDA 5JAUA 3IJPA 4OZIF 2R15A 1D7FA 3CG0A 2YOHA 5BSMA 3JD1A 4FXGC 3QUCA 5AQEA 2YOGA 2QZ4A 5EZIL 5TDHA 1EX6A 3QEOA 4L9LC 3QPQC 1QK4A 2YPVH 4IOKA 3MYJA 3JD4A 5CB4F 4MLIA 3N2GA 3IGAA 2VXOA 1P8AA 4OIMA 2IMNA 3DMTC 4H8HA 2JJMA 1JQBA 2WINB 5HYEA 2IAND 2AV6A 2OQ2A 4XD7D 2IY7A 3IM1A 1G7SA 1LI4A 4RK6A 3Q13A 4TLDA 1YE5A 3C6XA 4B6RA 1P1IA 3FO0H 4HI0E 5K20A 4NYMQ 3MYJB 2BGKA 4MDHA 4IIQA 5HRAA 4BMZA 5C9KA 1YZFA 3N2GB 2MHAA 1KJIA 3IGAB 2VR1A 1TEVA 4L3CA 1ZESA 5K0GA 3KXLA 3SHTA 1AE1A 1F0YA 4J2OA 2HA4A 3O3OB 1OWOA 2P27A 3TTWA 5KVMC 3RSQA 4EO9A 3MWFA 3IMBA 2C3WA 3FHAA 3QJHA 5EJIA 3ARQA 3FOBA 1MH9A 1COZA 4OJMX 1SUWA 5JOQA 5FEBA 5FXMA 4X0EA 3FTNA 3ZVVA 1OTUC 4IIQB 3PDOA 1NFKA 5B1KA 3TBVA 2MHAB 3ZDZE 2NY2B 3G2OA 4JKKA 1V95A 4L3CB 3IJYA 2Q7XA 5EQJB 2EW8A 4X97A 5IABA 3P77A 4FFVA 3VFSA 4L3EE 3UAVA 4AJWA 4S1DC 2VN5A 3GH3A 5FW7A 4ONFL 2MMGA 3BGVA 4FHKA 1OTXA 3VMOA 1M1YE 5HGDB 5GGSA 2W83A 4I0CC 4PONA 3V7NA 1AOZA 4MWCA 4HJGA 3CVCA 5K3AA 3GPIA 3IIJA 1Y1TA 3QBJA 1S8OA 3I53A 3PDOB 2JH2A 4CMIA 4J8RA 3TBVB 3I42A 2K4WA 1NEUA 2XPGA 5MDHA 3IJYB 2VSYA 2NWQA 4XPGH 2BEJA 1BOOA 4ZK6A 4ZDJA 4JK0D 4WQMA 3P77B 1NDQA 1PF7E 3VFSB 4ZO7A 1HQCA 4TTRA 3KWTA 4AUJA 1JS4A 3PWPA 2F43A 5LBVA 4ZO8A 1M9WA 5GGSB 5ILTL 4HJGB 1LDBA 2HPAA 3HG1A 4CMIB 4J8RB 4GSLA 4ECEA 2N0MA 4XPGL 3L0BA 5A2LH 2XPGB 5KB3A 1UFGA 2KMLA 4LCYA 3IL2A 5FUMA 3ZU3A 2XAAA 1SQFA 2ZT9C 3KHKA 1AB5A 3A1CA 1YQWA 1FAIL 3QJVB 2XKJE 3BEVA 3FSWA 3PWPB 2F43B 3GSRA 3ZD8A 1G7RA 2AHIA 3M9XA 2XMSA 3K71A 4CVWA 3S35L 4AUNA 4UBNA 4BFFA 3TD2A 2FHBA 3HG1B 3BD4A 5GV7A 4I1VA 4MA4A 5KVVA 3NABH 5A6VA 2E4ZA 2EHDA 4KDFA 1HZJA 4HAWA 4LCYB 4Z1MA 4M43H 1B0AA 5I5GA 3QSYA 4AQZA 5AL8A 4AU1A 1QGUA 1J1XH 4F7MA 1Y8ZA 4C20A 4NQCE 4CMEC 4PGZA 2IL1A 5FOXA 3BEVB 3PWVA 3FTYA 3GSRB 1RI1A 2CN1A 4FA7B 1NZDA 3AO0B 4U7KA 3NABL 3TLXA 3AY0A 5E6SA 4FFBA 5FTJA 4GZ8A 5JZSA 1CR9H 2V59A 2QYTA 4HNAA 4XIJA 4JK3A 4IHJF 1Z38A 4ILEA 5E70A 4A55A 5C8VA 2B0CA 4Q6WA 1C3JA 1G5TA 4AKIA 1QGUB 3W38A 4U6VH 4F7MB 1L9PA 2ZSDA 5A2IH 5G41A 3ZGIA 3MJGX 4U7FA 3PWVB 3EEIA 1DJOA 2DG2A 1CR9L 5KJ6A 3FHLA 1UMDA 5F7WC 5E6SB 4FFBB 3D9AH 3A37A 1KDZA 3CDZA 1O9BA 5T3XE 1MHEB 4HNAB 4BZQA 1I1CA 4YUAA 3DDZX 2C7FA 2I78A 1ESCA 1SUEA 1V0JA 1UA6L 2FYYB 4PQEA 4D9KA 2VL7A 4V24A 4ZPVA 4LCBA 4QFDA 4K28A 1S3IA 2ZQZA 2AKEA 1RMTA 1FLVA 4PREA 4RSYA 2MIZA 1NBQA 4J29A 3S34H 3P9SA 3O4IA 1UMDB 3ZDAA 1MB3A 2ZJSH 4M56A 3DQPA 4JAVC 1QF6A 3IMTA 2DYSB 3CDZB 4LRUA 5DJ6A 4BL5A 4B3TB 1CLYH 2P9EA 3IE0A 3UIYA 5DJ8A 5IS2A 3JT0A 2WQ7A 2J5XA 4ZPVB 3CG4A 3Q10A 4EZMA 4PREB 3S34L 4F71A 5ABZA 2CJUL 2ZJSL 4TNWF 3RJZA 1R6BX 3BE5A 2W8BA 1OH7A 1RK0A 3QWQB 1CLYL 3FYTA 4ZOLF 5DJ6B 2Q2LA 2H2DA 4IIVA 5DJ8B 3IS1X 4CN9A 2HF8A 3L04A 4A8TA 3L84A 3LN9A 3H5AA 1KTIA 5TF0A 2Y3NA 5E1BA 2BFGA 1JDVA 4N2EA 2I7XA 5IB1A 4QOKA 1C7TA 2AV1A 3OL2A 1TCUA 2G1AA 3KKZA 4IM8A 5D4HA 4FMFA 1RK0B 1FV1A 3DI2B 1MRCH 3WA7A 4J0IA 5L0QC 4MHTA 3MNVA 3DE6X 1VQ1A 4D3CH 5CVEA 2R0WH 1E1LA 4YASA 5DZAA 1GY1A 3QLTA 1P1JA 4UHFA 5EZQA 3WX0A 1QQTA 4QOKB 5EHZA 5H59A 4FQXD 2JELL 1VSUA 2AV1B 3OL2B 1MRCL 5GRJL 1ULZA 3Q3JB 1FV1B 2XCSB 3FPFA 3QCTH 4D3CL 3MNVB 3ZR4B 2JTDA 3BIBX 2R0WL 1KH1A 2VDMB 2YKGA 1SBCA 5I8PA 2EWWA 5DZ9A 1OWWA 3Q0IA 1NVUQ 2QTHA 2HKIA 4H7DA 2BJHA 3Q7TA 5FO1A 1UH3A 4RKEA 5LQAA 2F6AA 1W0KD 3V4PH 3N6XA 3GY0A 4HKZB 5LD2C 3M5PA 3U83A 4YV1A 4C0LA 3MWGA 4ZVTA 4GI2A 2G30A 3QG5A 3WFCH 1E2ZA 3UJAA 4G72B 1RPJA 1FFCA 1UD4A 3H9ZA 2H2PD 2PTVA 3NDZE 3ZE2E 2HJ9A 4F45A 1KYQA 2QADD 2ZS7A 3GK3A 2OA9A 4JLUA 4FE3A 2KQUA 1YR2A 5DRZA 4XSVA 2D8MA 5FBHA 4CV3A 5BY2A 4JMNA 3WFCL 3HBJA 4MQSB 4BK8A 2ZI3A 5TK4A 1XRSB 3ORFA 4AKHA 1GU0A 1M2GA 3BK2A 3QLUA 2RBLA 3BDYH 4OFZA 5JLAA 2OHIA 1A25A 4WZ6A 4RMHA 4EB6A 3PVSA 5GAJA 2QN7A 1RUAH 5DRZB 2QUZA 3D09A 2YWYA 5I9IA 1UODA 1J49A 4ALMA 3BDYL 1RACA 3N0VA 2X09A 5I45A 5KSPA 3FKUS 4AE0A 5F78A 2IPUG 1WMSA 1OASA 3DV9A 4MR7A 2FPIA 5CIYA 4EB6B 5LQUA 5A3SA 1KGCD 2XZAL 1JL8A 4FP8H 1PD0A 4URVR 3J2PA 1Z6PA 4BASA 3UT0A 5G4NA 1Z35A 4GH5A 2PL1A 1BLNA 1B2LA 1GFSA 1VTKA 3QWFA 4MZ3A 2QEQA 3HB3D 2NTEA 4B2YA 1H8NA 5FHAL 4H4DA 4EG4A 3PQCA 3NZUA 1U8MA 2WWKO 4AIRA 1Z5HA 4MR7B 2FPIB 3HAEH 3OQ6A 3FRPG 2D0IA 4TVPL 4FP8L 1DAEA 4FQJH 4NJOA 4AM0A 2MSWA 4M9QA 4R97B 2HSWA 3KVVA 2IEAA 1BLNB 4LXFA 1MF7A 2O19A 1JZEA 2WQVA 1L8OA 1R6UA 3OCWA 1OI7A 2OFXA 5JH7F 4BE4A 3GEWB 4H16A 1N0VC 1N0UA 1ZK0A 1U8MB 3MSPA 1AXSA 3HCDA 1M6OA 3MTXA 4IU2A 4FQJL 3BP4B 4JQOA 4Y2TA 5JW4Q 3LCCA 4AM0B 1HHKA 3P2YA 2A1IA 4PIRF 4ZRNA 2JIBA 5AD1A 1JN6A 1SHKA 2UZ3A 1MVOA 4MDRA 3NHJA 2BISA 2GZDA 3B1JA 1RM5A 4KQMA 1KCVL 5CDGA 1AXSB 4WCFC 1M6OB 4IU2B 4DYHA 5B6IA 4GSQA 2RGYA 3I2KA 2X1QA 3AS2A 4QREA 1CE8A 4U00A 1WSWA 3K5HA 1HHKB 3ZN2A 1OLXA 3QEBZ 2QMKA 3NC0C 4Z8FH 1KZGB 1JN6B 4LJ9A 4EG0A 2ENUA 2C9UA 1FS5A 4P2QE 4RHYA 1WDLA 3BGOS 1XWVA 3Q5OA 2VJOA 1QFOA 3F9RA 2JKIS 4LCUA 2JGAA 3DSRA 1WX1A 2VLJB 3NT5A 2K7QA 1CE8B 1RZFL 4Z8FL 2E5WA 1VFNA 1OLXB 3S4YA 3MLPA 2XN9E 4PVDA 1T1XA 2OX5A 5HEKA 1TQ6A 4I55A 1W19A 1D7BA 2VR9A 1SZNA 4PCTA 1F3DJ 2C3YA 3WNNA 1B0WA 4LCUB 2WSSD 3FRPA 3ZIDA 3DEYX 3MUEA 5CEEA 2V7HA 2ORVA 2Z1KA 4XXCC 1B8OA 1HWWA 3WHPA 1MI5A 4JA0A 4OR1A 2PCJA 2Q8NA 5BUZA 5JJ5A 1RZVA 4PYRA 4OBSA 3MV7D 1T1XB 3X14A 2FQQA 2OX5B 2I6QA 3PNPA 4I55B 3L1OH 1QR4A 2J21A 3QUMH 4CV2A 2UXCB 4Y4FD 1A7QH 4N0DA 3U1VA 4PRPD 3FRPB 4RXTA 1UEJA 4ZEMA 2EH7H 4BEIA 5A9SA 2V7HB 5DGIA 5AOMA 1NPNA 2X2IA 2JPDA 1T6XA 4D7PA 1MI5B 1KPRA 5CJ2A 1MFNA 4LUCA 1MN6A 3CSFA 1NKTA 3X14B 5CWSA 5J13C 5DXJA 2PPFA 1VGKA 2EFHB 2XXMB 4QELA 3QUML 2ZS9A 4X84A 2OTCA 5DNWA 2ZBGA 3ZE8A 2QDVA 1R64A 5JQGA 4JKYA 2EH7L 3GKWH 4FYTA 1ZD2P 1QKKA 1E0OB 4FGWA 5A9SB 4BC1A 1XAIA 4UU8A 1KVQA 1TEFA 3RU3A 3ZWBA 2Q6VA 4RS4A 5K3SA 1KPRB 2VRWA 1KQ3A 3W4IA 2YHSA 4AX4A 5CWSB 5BW5A 3QUTA 4I2XE 1N33B 4HN4B 3BDBA 4DF9A 4DABA 4OIIH 4OLXL 2HWYA 5JQGB 3AR3A 3IMWA 1DANT 2XKUA 4LJ7A 1QLJA 1NVWQ 4EJSA 1BW9A 4O0MA 3SYTA 5LDHA 4MXWH 4LJAA 2A7QA 5DF1A 2QX8A 3QYAA 1BPLB 2IIVA 5CT5A 2DLFH 4TLKA 3WLAA 3GM0A 3H17A 4EIUA 4QRPE 4OIIL 2CJSA 1YNSA 5K3EA 2TRSB 1XZ8A 5GM1A 2CUTA 1MOZA 5J2TA 5T64A 3UGXA 3HRPA 3FYHA 3LUDA 2HV8A 4ISBA 3L49A 1C4WA 4NN5C 1Q19A 2X7LA 4MXWL 1QV7A 4U5QA 4IHOA 4EJSB 5JO5A 3P4LA 1BW9B 1XCPA 4DCSA 2DLFL 3ZE6A 2HRPL 4OLUL 1GRNA 2WM2A 5EU5A 5JOPD 1IBLB 4XCVA 4FE9A 1T9GS 2AUMA 2FK7A 1Q17A 4XWTA 1OSZB 4G5OA 4FK8A 4Z8YA 1ZIDA 3NSFA 5J2TB 2EE3A 1Y8CA 3KRTA 5DHDA 2AL7A 3T5DA 1S7RA 1S7WA 4B09A 2E1PA 1ZDSA 1NURA 2X7LB 4IHOB 5JO5B 1RKVA 1DQKA 2JHCA 2VK4A 3PUIA 5EU5B 2ARJA 4H59A 5FW8A 4MUNA 4X90A 3A32A 4R8WL 2D3LA 1XSJA 2AFVA 4HPHA 4I3SH 2C99A 2D03H 1KY3A 3M89A 5EN4A 4EY6A 4O3TB 2JKYA 2FZGA 2PLFA 2ZKIA 4JOSA 2C5LA 3DL0A 3UKJA 2JJ1D 1S7WB 2BSQA 4KRPB 4OSPA 3EH4B 3Q0TA 2MR6A 3BIKA 2WZ6A 1GGCL 3CQPA 2JFPA 2ARJB 4KBYA 3UB4A 1LFAA 2YXEA 4I3SL 3LRXA 5D85A 3V4VH 4K5NA 1D1TA 4DDUA 3NGMA 3ZZQA 1P9RA 2A9NH 4Q47A 5ADWA 2F19L 3L0IB 4KTEL 2AXQA 4NBTA 3OMZA 1IT9L 1CDUA 3RNQA 4CC0A 1VG1A 5IC5A 4L78A 2BOCA 3CW2A 2AJDA 3ENKA 4JASB 5GGTH 5I82A 4LF3A 3BIKB 3OO0A 4NZPA 3V4VL 1TJHL 5DX8A 2JCCE 1RWBA 1I9RH 2PXCA 3H2WA 3W79A 3SOPA 1HM5A 3EQ7A 4KXFB 1QUEA 2XWQA 2ZJ7A 4RJKA 3K2IA 3EO9L 3MLWH 3RNQB 3BE8A 4CVUA 2AJUL 2BOCB 4Y7CA 1DTUA 1O6FA 3SGEI 3F98A 4ZMRA 3B5TA 1YHYA 1CICA 4LF3B 1XEXA 4F33A 3HNSH 1TIKA 3VXRA 3DXAA 3VM6A 4JM2D 3MLZH 3C3KA 1NLMA 1J0IA 3OUZA 4AQAA 3MLWL 1KEMH 4KC0A 1FFHA 4L8WB 1RRPA 3ADBA 4H4EA 2OMEA 5J2TF 1ZUIA 2FF5A 1R66A 2JFXA 3GH1A 5L4NA 2DYRB 4DLYA 1CICB 1XEXB 4F33B 3CT4A 3FOLA 3VXRB 3DKIA 1JVLA 4KODA 3FWZA 3DXAB 3RVWD 1RJEA 1YONA 4KLAA 3VOAA 2P5WA 1JZDC 1KEML 4HGYA 1A7NH 5HHMD 4AQAB 3D8UA 1WK0A 3G5VA 2NQ3A 4XCFH 4NYIQ 3ZSSA 4C57C 4G8AC 5JZBA 2Z92A 4ZEWA 1X9UA 5KS9E 1VRVA 3EUFA 1E0SA 3DVAA 3B7SA 1E6JH 5T5NG 3RWGA 1E5AA 3FOLB 5GRVL 4AIZA 1SUPA 1OXYA 4WUVA 4BZ2H 1A7NL 1BFUA 1C1EH 4H26A 4GPEA 2P5WB 4NYJR 3HBZA 1VCIA 4OMDA 4OCYH 2QNBA 3GCDA 3G5VB 4COOA 1CBJA 2WQAA 1DKPA 3W5MA 1P7VA 1KGDA 3BCHA 2Z92B 1P0FA 1LF5A 5CIWA 3S55A 3ITDA 1X1AA 1E6JL 3TWYA 1EGJH 1FVCA 1Z9OA 3DVAB 1WLHA 3PE4A 3RWGB 4Q3KA 5ULLA 4AIZB 1N7JA 4B95C 4BZ2L 1BOYA 4OCZA 2VLBA 2JWGA 4IIXA 1TO4A 3FG9A 4H26B 4DJEC 1WXWA 5EWIH 3V1UA 1I0LA 4XCNA 5IWAB 4QT5A 3V7AE 2FDCA 2AQ3A 3AS0A 3ZWOA 1RIUL 2XQJA 4LT7A 1WCXA 2L42A 4ITUA 2ZUUA 1XJQA 4DR1B 1EAMA 1YMQA 3QNUA 5SWZA 4HZAA 3T7KA 4XCCH 3O6FC 1EDBA 4HNQA 5D5ME 4BV8A 5I8EB 4C5CA 4PJ6A 4QKXB 1FVCB 2JI1A 5KZCD 3ZBTA 1P4UA 3HHSA 1DS6A 1C5CH 2DQKA 1GPJA 4FD2A 4WASA 1HL7A 3O9WD 5I5MA 1TUIA 1QPBA 4FINA 4XCNB 3NSCA 4QT5B 3WNZA 2BRQA 4NE9A 1GC1H 2DE0X 2NUBA 2G72A 2V55B 4HIEA 2CXNA 1PJZA 3GL9A 1RKXA 5SWZB 1A5AB 1FVXA 2Z58A 5K2OA 4ZYTA 3JQ9A 4XO5A 2WPGA 1SVOA 2F1KA 3HHSB 1DNPA 1C5CL 4JITA 4D74A 1IN7A 2Y71A 2WIIA 1PWEA 1WCQA 4JENA 5CGQB 2I7DA 1D4OA 1Y6ZA 3VWJD 1Q11A 3M4NA 1L7AA 3SK0A 4HIEB 3X44A 2H1OA 1V6SA 4M9RA 2QKIA 1MJUL 3L8YA 4CGUB 2VDKB 5JLZA 4RGBA 3OKEA 3CWQA 4Z53A 4ZO9A 2B6NA 1XLVA 1AIPA 5B1HA 2K45A 3EVZA 2WIIB 1FXUA 2HXSA 4WFGD 1LBEA 1IL0A 5EZLA 3V52H 1F14A 3ZTTA 1CCZA 4ES9A 1HYSC 1MOSA 4EJ2A 1EX1A 3RVUD 4ZAKB 4MZDA 3HR7A 2QKIB 2YDYA 1SBNE 3IMGA 3M8KA 2Q1SA 4MEJA 2FW7A 1IBKB 4O2BA 3UMGA 5JLZB 1DSFL 2W6MA 1FL3A 3OKEB 2GIYA 3QXUA 1YE3A 3PPYA 5AIBA 4CKQA 3AB0B 1RQPA 4FR2A 3I2CH 2W71A 4H18A 3DVGA 4TX1A 5C9ZA 1O6TA 5EZLB 1SHYB 3KOZA 4AN1A 1X5FA 3RTLA 4KRFA 2Q3ZA 2B78A 2F15A 5FYJH 4JB3A 4V2IA 4N28A 2JFHA 2AEOA 1TJ3A 1I7LA 2FYVA 4WO4C 1PJSA 1NCBH 4O2BB 1CLEA 1Z2EA 1FL3B 3WV5A 3G6AA 5F1KC 1RWMA 4X00A 1V7MH 4IBLT 2RAMA 2VJMA 3GI1A 3K9FC 1E3IA 4HC4A 5CJXC 3DVGB 2HPHA 2G9UA 2ZTSA 3FF8A 2CO4A 1CFVL 2Q27A 4RPLA 4RDXA 2EBHX 1T9DA 4ZW5A 2R25B 3DG9A 4JYZA 1NCBL 1IM3D 4EPVA 4GKAA 3KYMA 2A2ZA 1WLYA 2W2QA 5B4VA 2CDAA 2IDUA 2AW3A 3BE4A 1V7ML 3HBQA 3G6AB 4AP5A 1ZXQA 2HMYB 3BILA 4XMLH 1KIUA 2VJMB 2AN9A 4JQZA 1KEUA 4MQTB 3O2WL 1TTHA 4Q89A 2AFRA 1BH2A 2WQ8A 4EG1A 1WCYA 1EEQA 1VJ5A 1R5WA 4UQOA 1GUZA 5E8EA 3UAAA 3KYMB 3DM9B 2JLQA 1MO5A 5TE9A 2QJWA 1OILA 4E21A 3TOSA 5LQSA 3RBSA 1Z5YD 4XMLL 5HJGA 4X7PA 2DB3A 3GMMA 1KIUB 1O75A 2JJTA 4C7VA 3ET4A 3MXWL 1X1SA 2PWGA 2Z31A 1N7IA 2NSYA 1R5WB 4UAUA 1H4QA 3QT2A 4EYOA 3BKYH 2JLPA 4PLOB 2BWDA 2Z95A 5E8EB 2OYPA 1FXWA 3S2AA 2I60H 621PA 1UEMA 5AI4A 4MJLA 4MTCA 2F7PA 2O6DA 2PLAA 3QE3A 4Q7DA 3GMMB 3HVJA 1FLDA 2ZRNA 1NI5A 4KQWA 3ESRA 4GMFA 2AZXA 3E1GA 3F9IA 4BVFA 4XHQA 2Z31B 3SQXA 3BKYL 1HE8A 3CKYA 2HU7A 2EP7A 2WUDA 3J7AC 4LHSA 1H2AS 3FONA 3A9TA 3MWJA 4HWRA 4I2NA 2NXYD 3X2EA 2BHNA 3WG7B 1SQ0A 1N6KA 1Z9MA 4V1CB 3HB9A 3QDGE 1I0IA 1LM8V 1HOCA 1LPBB 1Z6ZA 5JROA 1A4RA 4O2BF 2PWDA 2HBRA 3A4IA 3SAJA 2B35A 5ABAA 1SOUA 2NVUA 3O03A 4YQEA 6ADHA 1HE8B 3BAXA 2VRQA 1EX9A 3QFHA 4XNBA 3G23A 3FONB 4OFYA 2EQBA 2CXGA 1QSEA 1SGWA 1IZ7A 1R8SA 4ZD3H 1FMFA 2WUGA 3T8YA 1ZLUH 3Q05A 4NULA 4FS0A 4X5QA 2Z9CA 5JUWA 4ILKA 3N5CA 4P53A 3GS4A 1YEGL 5BPFA 3MA9L 1ZK5A 4F1KA 2F3TA 3E7XA 3CH1A 1XZNA 3UH8A 2NVUB 1GTL1 2A14A 3AAZA 2IVZA 2BKLA 5LP6C 3WV4A 1IXYA 2DJ5A 5AKTA 4ZXBC 4KZEL 1YYLL 2FWNA 5CLWA 3FTSA 4ZD3L 4KYVA 1QSEB 4D4HA 3COVA 1OE3A 3ZV6A 4GG6E 4HXYA 2DH6A 4RVBA 2NY1D 2A78A 1YZVA 3DBSA 7ABPA 4JJOA 3CH1B 4JY6A 3QDHA 5P21A 4BO0A 3K2MC 3AAZB 1XRLA 2GPAA 1QIDA 3IAPA 4GRAA 2PBZA 2P1ZA 1N5IA 2JHAA 3QPKA 2WTAA 4JLVA 1RYDA 4BQFA 4X80L 1JVKA 3ZVRA 3LD9A 1E79D 3F67A 2H2IA 4IKIA 1IRAY 1KJ8A 4JU8A 2BM1A 3LZDA 1DTWB 5AK6A 4Z3GA 3X11A 5LJLA 2QVZX 1HFWA 3HA3A 5LM3A 5B5SA 4JY6B 5A3VA 5KSOA 5DRYA 4KGDA 1P9OA 1GT91 4BFVA 4PN6A 4LOVA 4N90E 4UV4L 1MENA 2ZTLA 3OFKA 3K5IA 1FQWA 1I1FA 4LCCA 1G8YA 4HIPA 4UT6A 3X11B 2H9AA 2HZBA 1MVNA 5DYOA 3NIWA 3AWGA 3IBFA 3G6KA 1ZHOA 2CGYA 2NY0D 3H9QA 2M32A 1B42A 5JXEC 5IROA 1JW9B 5D1ZD 5HY9A 4NFCA 4BFGA 2Q5BA 5EXEA 2I6GA 4C2TA 1ZG3A 5I9MA 4DTCA 3CKMA 2L7EA 4KO4S 1O87A 4BSWA 2AOTA 5E2VH 4LCCB 3TJPA 2NY4B 5EA2A 1C3EA 4BQSA 4J3NA 4AXWA 2OQIA 5DYOB 3TQCA 2P8MB 4BBPA 4M5YH 1L7TH 2PJRA 4LBAA 2ZPAA 3TZVA 4JJ7A 5HY9B 1HOTA 4E4TA 3IV9A 3DH0A 5KWEA 4MSUA 1VSQA 1XDWA 4KKCD 4M4PA 4CL8A 4GRWE 2ZXGA 5E2VL 4BO5A 4BSWB 2AOTB 3P7MA 2ATVA 1JFHA 4MAUH 4ABQA 1H5NA 1O94A 4UXIA 1H15A 2ADYA 2CHVA 4ZU3A 3OQNA 4M5YL 4AXWB 2PU7A 1TQTA 2XKBA 4DAEA 4ZGBA 5IDXA 3STTA 3QHAA 4DB4A 2OV0A 2E18A 1AUVA 3VD7A 1AD9A 3ID6C 1BQLH 5I1LA 1VJSA 2UZYA 3RVXC 3CF0A 5LIRA 3QKUA 5MENA 3IUNA 2KQMA 3ZHTA 1PJ2A 4MAUL 1ORTA 3IPAA 1Y34E 5E3IA 1I8MA 1NXQA 1H15B 3D85A 4RH4A 2QMZA 3EA4A 4PXSA 3CFCL 4ZT7A 4F5WA 5AW3A 4ONEA 1CDCA 3CUVA 1HZZC 1WISA 3RHSA 5I1LB 3VJMA 1ADWA 2UZYB 3GARA 3ZE1E 3K8LA 5MENB 1ISRA 4CYMA 3CN4A 1EO5A 1FFOA 3TVMD 3VFNA 3RHZA 521PA 5T1JA 2FFHA 1I8MB 3Q3CA 3D85B 2XTJA 2WTUA 2G3NA 3PCRB 1MLDA 3KDAA 4RMRA 2BINA 4CN1A 5LDGA 2C1OA 1JHMA 2C3PA 2ZIGA 2HLDA 3ARWA 5HOQA 5AW3B 1NFRA 1UANA 4EDFA 1LVHA 1VZIA 5G0SA 1AO7A 3MBED 1E4OA 4OCXL 2AOUA 3MIZA 3P0VL 1QCZA 5IAOA 2Y1XA 5BT8A 1JGVL 1FFOB 3VFNB 1H65A 2XHZA 1NG1A 1C29B 2ZRJA 2BS71 3QVLA 4JFDA 2YSTA 1SXJD 2EVWX 2W11A 4ZZ3A 2XTJB 4E5MA 2QI9C 2PUTA 3K8ZA 2AJXL 2SICE 3L1UA 2C1OB 5HD8C 4GICA 4HQFA 5DYYA 4XWOD 4M86A 4XH9B 2BF7A 3QUXC 4I3GA 3CZPA 1AO7B 2HM7A 4S35A 2AOUB 3NWEA 2E4YA 4L7QA 1JPEA 4LF4B 3W6UA 3CDFA 2J56A 2RJOA 4JFDB 2EQDA 1KYVA 4BQ6A 4AK9A 2QTTA 1IFGA 4BUJA 3G5WA 1TLMA 1FK8A 2H18A 3I3SR 3DLHA 1SUCA 4KAXA 2V0AA 3DXFA 4CIBA 2P0EA 5COAA 4ND7A 5IHLB 2QUHA 4CUZA 2P5PA 2ZJ0A 4AECA 2DPYA 1UB5A 3HLKA 4KK6D 2FEKA 1B8UA 3BSSA 5AYQA 4MICA 2NZWA 3QWIA 5AR1A 4DPBX 2AYXA 3TZEA 3CF4A 1LSJA 3NM4A 3WOHA 2BFNA 4B9YA 4TV9A 2IDZA 4U63A 5UKDA 2O2DA 1KYYA 3BMVA 4J7AA 2L3BA 3B3AA 2A4CA 3HZOA 4A0FA 4RY0A 2O4CA 3SQDA 4DLBA 3H1EA 3UVEA 1S3KH 1JNHA 4PAGA 1UB5B 4M1OA 5J6GA 2OK7A 4V02A 4WMLA 2NX5D 3AKDA 3US9A 3LXXA 1H23A 3U6BA 4XPAH 2VTVA 1HEHC 3OM3B 4UOZA 3VUEA 3CH7A 1VKRA 3N8IA 1HS6A 4RRPG 3WSQH 3A28A 4TV9B 4DV7B 4OI9A 2AB0A 7ADHA 1B90A 5DYNA 4AJ9A 2NV0A 2WP8J 3FGOA 1GC1C 1J8YF 2C5GA 4HKTA 3EFBA 2V37A 1JNHB 1YNKH 3N7AA 3CH5A 3M17A 3KYIB 3MJTA 3AT9A 5J6GB 2P9ZA 2DT8A 3C43A 7CGTA 2IBTA 1X80A 4FB5A 5JSKA 3EDEA 4XUDA 1SBZA 4KPUA 2JI3A 3WLJA 1CDHA 4ZI7A 1M6WA 4F2DA 1H3XA 1E6MA 3ZZ0A 4KXNA 4UUNA 3ONNA 1U0OC 4MKHA 1RFGE 2ZR7A 3BT2H 3OKOA 3B83A 1FLRH 2ZZNA 4JHAH 4KH9A 4PRNA 3OGOE 4OY9A 5NULA 4MUHA 1NBMD 2VDLB 3M17B 4MJ3A 3ENQA 4LNVA 2WHVA 1S9WA 1X80B 3L0CA 4L5CA 5DASA 4F4CA 4PQXA 4KPUB 1XUOA 1P84J 1JB1A 3M1LA 2YD1A 4ZI7B 3ISTA 1VHWA 3TFBA 4NE2A 5I1CH 1Z2AA 5L9DH 4HLQB 1FLRL 4JHAL 5BP7A 3OKOB 3BZFA 4Y5XC 3L2LA 2GNOA 4MO2A 2R84A 3AEXA 2O8DA 3DKVA 1GYRA 4PRNB 1ZRUA 1XRRA 2FX8H 2A1TR 1VEOA 1GCGA 5JI3E 1RK1A 1S9WB 5KBLA 4EQ6A 1U1GA 4CQMA 2A6KA 1XJWA 1YBHA 1JE1A 1KCRH 3I3DA 5I1CL 2WSDA 4PGEA 4DCVA 2CUIA 1PZNA 2FEMA 2OMWA 4H3HB 4ZHSA 2G6BA 2XICA 2RI0A 5CXSA 3ABOB 2QORA 4MBRA 4YUZA 3MCUA 4ZTZB 2FX8L 3O93A 2O8DB 3PJSA 1G6OA 1HCFX 4LSWA 3JQRA 2C2XA 3W2HA 4DMMA 4BKRA 5KJ1A 4AXXA 1RK1B 1AR1C 4IGAA 4Y9GA 2QLMA 4YDRA 4EQ6B 2GPJA 3FMGA 4O4YH 2P5UA 4CQMB 2A6KB 5KYKA 5GPBA 2HW8A 4PGEB 3RG1C 2OMWB 4WT7A 5JSYA 1C41A 2NO5A 1GR0A 1FJHA 1EPUA 3D05A 1U6KA 1SY6H 2I03A 3A6PC 5D71H 4XNMA 3PJSB 3KB6A 1QP0A 2GKOA 3E9CA 5I6NA 4IO0A 1E50A 1ANUA 4MR9A 2V5VA 1FSFA 5FUCE 1NT4A 2QVTA 1U28A 3G5UA 3JT2A 2NW3A 3KLNA 2Y93A 4S2UA 4NQEA 3T5AA 1MEEA 2GYUA 4XNMB 4OQZA 4HC1H 3O2DL 3HCAA 2ZRFA 1PZEA 4KWIA 1KQPA 2B94A 3FQXA 4IINA 1OQXA 1EANA 2J44A 4MR9B 4XFJA 1U91A 2IF7A 3D1MC 4UNRA 3ELUA 5IK2A 5B37A 4PC3A 5J7CC 2WYZA 3MRGA 3IKCA 4HWBH 4XPFH 2WT8A 4YAGA 2NW3B 2P9BA 1O6CA 1GYQA 3PT9A 3WY1A 1LB1B 3F5QA 2DQTL 4NQEB 2HSGA 1O6VA 5KINB 1LL1A 3FPSA 5CNIA 3MB8A 3E5RA 3FQXB 3LLSA 3B9KA 1L0BA 2ZI7A 1U91B 4N8CH 2IH5A 2B0SH 4HWBL 3A1SA 1WBDA 4NL4H 3MRGB 4J3VA 3IKCB 1PI3A 4OTXL 4UM9A 3AU1A 1S78D 3O3NB 3DRTA 3UKDA 1T0HB 2AG1A 3ZDBA 1T26A 3LLMA 3LW8A 5AVOA 4PX5A 3TPFA 2HLNA 3APCA 2VAXA 3QWNA 2DWYA 3B9KB 4N8CL 1G7LA 2VF4X 3SCMD 2B0SL 1WA5A 4X62B 3U7FB 2O57A 3KM1A 3WGKA 2EARA 3G85A 4UM9B 3AU1B 4MUEA 3DRTB 2TMDA 5ICZA 3HUTA 1XL6A 4JJ4A 3FOMA 2AJYH 2Z8VC 1DL5A 2VKTA 4LISA 3OZIA 1T0BA 4KN5A 5HPYB 1L4GA 2I8CA 4YLQT 4G8GE 1GLGA 2P80D 5CGBA 3TF7C 4LEEA 2EFEB 1N26A 1G7LB 5E94A 4E31A 1U4NA 3EZ8A 1WMBA 2WG1A 1V5JA 3HHMA 1C9MA 4RABA 2HHHB 4GAAA 2H5EA 1RZQA 4Z9BA 3E2PA 1NP3A 1T6WA 4KE7A 3GSOA 5ICZB 2C42A 1UCBH 3FOMB 3GRVA 2C2KA 3B37A 2GAOA 1DQLL 1NBHA 4NZ9A 1INEH 1GTVA 5E94B 4AULA 1TA9A 4P23A 5BN4A 2XG5B 3L0ZA 2ZRPA 5CM9C 2H6UA 3AGQA 2MH4A 1HDGO 1ZVHA 5K1NA 1EAQA 3WHKA 4Z49A 2N56A 2BMVA 3VW3H 1W44A 2VZ8A 4FNOA 1UCBL 3GSOB 3TX6A 3F9CA 3ND5A 5GS2H 2Y0CA 4NZNA 3GNMH 1JHDA 5FYKD 3ATBA 1DWPA 2QMYA 3DTNA 2FD6H 1QH9A 3HHEA 1GVIA 5D7NA 1T5TA 6PCYA 2QOEA 4P23B 5BN4B 4IOFC 1BIFA 4YFVA 3VW3L 4HAYA 2J2ZA 1ZH6A 4IIUA 3COWA 1W4RA 1FRFS 4EB8A 1CR6A 4P84A 4J16A 3SBDA 4M1DH 5C5EA 1E18A 4JC0A 4XR8C 3G6JA 5C09A 4F97A 4F4DA 4ENRA 4ABVA 2FD6L 4JRWA 3R5JA 4L72A 1G5IA 2XNAA 1FL9A 2W4MA 3VFRA 4C6RA 4ZPTA 2RI6A 3T54A 4OZ4A 4Q48A 5ISMA 4CKZA 2B6HA 4HWZA 2J2ZB 4AQOA 4M1DL 3QJUB 5DLLA 3ORHA 4L8FA 3G6JB 5I0XA 4R8VA 5C09B 5AJYA 1XCMA 3LUFA 4AENA 2XNAB 4KYIB 3VFRB 3CUKA 1B93A 3FVVA 4ZPTB 1FNEA 4DKXA 2D0GA 4OZ4B 3S97C 4ANUA 4UHJA 3CXHJ 3T0DA 1JYVA 3OZXA 4Q9IA 3JWNG 3CB4A 3IN2A 4FG6C 4HWZB 3OTIA 3Q40A 1NUAA 4NV3A 1NJ9A 5F52A 3PVZA 4FXOA 1WY5A 1WXIA 2QYOA 3DONA 3CISA 3Q6IA 2QDWA 2VQEB 5FLYA 3R6WA 2XEXA 3P3RA 3N0XA 2X5NA 5CZKA 4N2HA 1GHTA 2C5FA 1TO2E 3OKNA 3BC1A 2BKVA 2RHOA 1A4AA 1X6VA 1P4LA 1NJ9B 5I71C 3F84A 1CERA 4M21A 5FAAA 4IIFA 4BUCA 1MFCH 3PUYA 3VMMA 4NAVA 2VBFA 3QXCA 4D2NA 3BRGC 2HFKA 3BVTA 2IPAB 2EJWA 4G23A 2XQKA 5IJCC 2AJBA 4LL1A 2VGLM 4F2EA 4LXQA 2RHGB 3OKNB 3NFNA 3WNOA 1SYSA 4WF7A 3NPZB 3B1UA 1TMGE 1P4LB 3MAWA 3G0IA 4N0EA 4NECA 1MFCL 3JQDA 5JXIA 2WK1A 5BV7A 2HQ1A 1P31A 4KJWD 3FCBA 4DS3A 5TQ2H 2WWMD 2PH5A 2X58A 3VFTA 5K9QI 3KE8A 2EXWC 1KJ9A 3RAPR 1YE8A 3RU8H 1C1DA 3GXFA 1Z75A 4I99A 1H3UA 1V10A 4J3BA 1OIXA 1Z7EA 1G1MA 1KXTA 1K85A 4ZKEA 3NFNB 1SYSB 2UXFA 4C06A 1FFYA 2NTSP 1P6QA 4I1NB 3QORA 5BV7B 3OWOA 1UOQA 4L3ED 4BYHA 1N2GA 1OQOA 4Y6RA 1U3CA 4B7ZA 3VM7A 5CFNA 3G6JF 4OB8A 4FNTA 2XW6A 1TPXC 4WVRA 2QT6A 4WI2A 4IIJF 3VFTB 1P0PA 4GG8A 3RU8L 2P43B 3EZ7A 4C1NA 3TO5A 2OKMA 3JWGA 1C1DB 1TQ4A 2YMQA 1KXTB 1NEPA 3FTQA 5E56A 3GQVA 5BYAA 2G60H 2EKLA 1R5VA 3QORB 2YJNA 1DBPA 3THML 2XJ9A 3FQ2A 1TFRA 3VJLA 4AN4A 1Z8HA 5CB0A 3T09A 1TD9A 3VNUA 4L5FL 5DURD 4GG8B 4JFEA 4ZEOA 3KZ8A 3PDUA 3TH3T 2LWIA 1HNFA 4Q7MB 4FEEA 5LN1A 1WETA 4HLJA 5E4IA 1SNRA 4LOIA 2LFGA 1C7RA 2G60L 4PJ8A 3H84A 1KYDA 4X7TA 2KT6A 4RHCA 3R7WA 1R5VB 3OAYK 4AJHA 1FEZA 5CLHA 1VCNA 4MIKA 2XUKA 1BX2A 2YD6A 3DX1A 3RVVD 1HNXB 1G7CA 1U4OA 1NR5A 4HUNB 2D2CC 4JFEB 1JZ3A 3PC8C 5CP3H 4REQA 2KL6A 3T5GA 4PC6A 4TQ9A 5A1JA 3L5JA 2FBJH 4GRDA 2GB2A 4PJ8B 3KPLA 4YLCA 4X7TB 3R7WB 5FJIA 3QRGL 4JFOA 2B36A 2WWFA 4ARUA 2WPDA 1BX2B 3OTHA 5I7SA 1UFUA 4R3UC 3PR3A 3D30A 1BQKA 4LTNA 5KIAA 1UPBA 4NQCD 4Q1DA 2XA1A 4REQB 3IP6A 5A2KH 5TS3A 2PEZA 5I6XB 1I7ZA 2FBJL 1E98A 4QXMA 4NIKB 4BKQA 3PPIA 2ID7A 4B4DA 3BM5A 1DZBA 3B8HA 3KPLB 5AJHA 4UHHA 1D6MA 1QFWH 4BYGA 3T94A 3ZWPA 1KMMA 4KR3A 3N8HA 1TQHA 2NO4A 3OKKA 2RK4A 2IFFH 3EAQA 3R0ZA 1GZQA 4M5TA 4B6SA 2H1SA 3DO3A 2XTLA 4C0HA 1XPUA 4YVNA 1A0QH 4JUAA 1JTTA 2FOLA 4N4AA 1W48A 1HE1C 5AUQA 2UXTA 2WJ6A 4FZ3A 3UO1L 1OAOC 1I7ZB 1BECA 2V8LA 1Y98A 1QFWL 5BV8A 8MHTA 4AJ0A 4IIHA 1QFJA 3GYBA 1HWHB 2LW7A 4DXAA 4YDIH 2RGWA 1H2YA 4NFBA 3OOSA 1G3IA 3OKKB 4O4JA 2CBMA 4YCLA 3JVFC 4WIAA 1QYDA 4ZYLA 2R8ZA 1GZQB 3P2OA 1A0QL 2OMVA 2LRHA 4RKWA 4XSGA 4D9BA 3QF7A 2ZTHA 2PRKA 4PGDA 2DTEA 4ZCMA 1XZDA 3LB6C 1WR8A 4HGKC 1MDAA 4YDIL 3GXOA 4W4NA 4JREB 4DEPB 3N5KA 4NBKA 1QA9A 4O63O 3MJ9A 1DYZA 5LGHH 3L16A 4O4JB 4ZT5A 5JWHA 4YYEA 4Z7JA 3OLIA 5KNBA 4N18A 5DK2A 4F5DA 4H6WA 1ZCAA 4D0RA 2HWKA 1ZQ9A 4PGDB 3T4PA 5JSHA 2G36A 4JDTH 5J9FA 4U6YA 2GC7C 4KG7A 5TARA 4ZMWA 1JBQA 2V8BA 4WFQA 2GBPA 1H3GA 1QA9B 3EG5A 1KMIY 2Z7YA 4YXLH 3L5WA 3LRGA 2DKUA 3BZUA 4C04A 3PABA 2R56H 1PL3A 3WIVA 1YZQA 2Y7QA 4P2RE 4UNTA 4K9QA 1DJSA 3VG9B 4DUYB 4CG1A 2XF2A 1XTZA 2L7JA 4BZ1L 5DK2B 5K99A 5FF9A 4JDTL 1B76A 4Z7AA 4J7CA 4YRGA 1J70A 3IIEA 4YZWA 4WHTA 4AVHA 4U6YB 4YBHA 1GUBA 3KC2A 1K5NA 1I2ZA 5IARA 4PV7A 2CMFA 2VWHA 4MVBC 2D9CA 3CM0A 2ZKLA 3L5WB 1QMPA 1R16A 2V7PA 1T4WA 1R9FA 3PABB 2Y7QB 1O95A 5C1IA 3RANA 4KR2A 3FGNA 2C2HA 2OR9H 4Z0BH 5IHZB 1JNNL 4HX2A 2C5BA 3LNDA 3K80A 1PIFA 4WHTB 3LY5A 2JAQA 1ORRA 1K5NB 2IU6A 4ZV7A 1MCKA 3OD3A 1XZFA 3ANXA 3PDJA 4XBGA 1E58A 5JW3H 4L3WA 2ZBPA 3ZDWA 3MJWA 2V7TA 4R2WA 2VUSA 3QIUA 2NYZA 2K9UA 2ZIUB 4Z0BL 1UOLA 4JGGA 1JGDA 3IBYA 5DZJA 5AYUL 4JKIA 2DFNA 1WUKS 3ZY3A 4CF7A 4M1QA 2AK4D 1SWWA 3AMLA 3K09C 1D6VH 2Y7LA 3TTYA 1PX0A 3MGTA 3W3AH 5JTWA 4Q9RL 5JW3L 4CR7A 4XBGB 1ZS8A 3IJ9A 1ECLA 1X7XA 4HGWA 5D1QD 1LQTA 1IN5A 3QIUB 3AJ9A 1Q0ZA 3TO2A 1JGDB 3D5QA 4YEDA 4DR7B 2B77A 4BDSA 2BC4A 4GS7C 4G4SP 3FSRA 1D6VL 1VB5A 3ZE7A 5FV2A 5JLJA 3VAEA 2B2XH 1R5OA 2F18A 3WSVA 3MGTB 4K3EL 4BWUA 1XELA 1E32A 3FH7A 3T7CA 3SN6A 2Q2WA 1ZS8B 2ALAA 4XAWL 2LZ0A 3DJTA 3LCMA 4HGWB 1GZ3A 4XN5A 5GGSY 1GXSA 3WIHA 2AX3A 3TO2B 4Q3NA 1KGIA 2ZNXA 2Y7NA 4PN7A 4OCLC 2XYBA 3SGKC 1FX1A 3D5OF 3K1TA 2BC4B 3CW9A 2B2XL 4WWKD 4Y6GB 4BO7A 2A4KA 2JIZA 4YT2A 1YVEI 3ZMEA 4PY7A 3W7AA 2EICA 2H1FA 1GG9A 2WOJA 1TA4A 2VHCA 3DS8A 2WUFA 3HG3A 1GXSB 1GN9A 2HFGH 3HBFA 4O2EA 4FHGA 2QGEA 4FG0A 4C7JA 2ACWA 1H1DA 4H77A 4DQDA 3TQFA 1QSZA 2VZVA 1CVSC 3CLUD 4XVTH 1PS0A 4PY7B 2IC5A 3DFKA 1R9MA 3D08A 2WXMA 2IYWA 3GJSA 1LRLA 3FOEC 3ONEA 2KBEA 2R4QA 4MV5A 4OGAD 1CFMA 2X15A 4U0RC 1J2EA 3M8OL 1DVTA 4YO7A 16PKA 1CJTC 3HKZA 3GEDA 1Z28A 3X3FL 4KZ0A 3RIHA 2DHCA 1CK4A 3VQLA 1JZJA 4L1KA 1F8XA 2OFQA 4O2EB 2X44D 5H8DA 2B21A 4D57A 4XVTL 3B5IA 3RD5A 5AW9A 3GBLA 3R44A 3LO5A 3LKBA 1H3NA 2EX1A 5GRVK 2FPGA 2WINA 3SSMA 3L9RA 1TPZA 4N5UA 2HTEA 1QGAA 2B8TA 3JQ7A 2FRVA 1XXHA 1KI9A 3T1VA 3JUZA 3IVXA 1KBOA 2WE8A 2X5OA 1KR2A 4DQXA 4US0R 3MHTA 4K0KB 4WERA 1Z3GH 1NN0A 5L53A 1K4DB 4JY5H 1LY1A 2QLVB 3PLRA 5FO9A 3BREA 5AW9B 4MQ6A 5ICGA 5B3JC 3UROR 4WV1C 4HLDA 3FHTA 2V2XB 3UK7A 3G59A 2FPGB 3PY9A 3L9RB 4MI3A 2HSZA 4PFSA 4NO0A 2XMZA 1ITCA 2XVLA 5LSAA 3JQ7B 1XXHB 2B37A 5IFKA 2YPVL 2C4KA 5GWXA 3VH4A 2DQZA 1IEHA 1ZK4A 3LYRA 1QD0A 3DZKA 3LHSA 4JY5L 1GD1O 3O41A 2C9PA 1MHHA 3CXDH 4N5MA 5CT6A 4I9XA 5FO9B 5I48A 1LNQA 2BJVA 1TTCA 2J8OA 4D9GA 4FN5A 2X5KO 2P42B 3UA4A 4M1EA 2XDAA 2ZX6A 4O5OA 3IYLW 3AR6A 4FDMA 1F7UA 3MUY1 1VBMA 1W8IA 4BDTA 4NO0B 3DJRA 4RGVA 4UOEA 3HE6A 1UH4A 3FO0L 3PZRA 2PAAA 1JSYA 5IP4A 4W68A 5HGDA 4PSRA 4IOSA 4TT3D 3O41B 2WM8A 2VQ1A 1MHHB 3DX4A 1UKCA 1JR3A 4OF4A 3HV2A 3V2HA 4OXQA 3BYTA 4ONHB 2XN9D 5GZNC 3VR0A 4WL0A 5KAQF 4BFNA 1SEBA 4J9UE 5EZPA 2ADFA 3HE6B 2Y5TA 5IJKA 1JKXA 2H52A 4AWAA 1U8YA 3NYWA 2VQ1B 2WU3A 5IFLA 4G9FE 5TPZD 5DWDA 1HCYA 4BPRA 1S7UA 3HY6A 1QVOA 3RDPA 4WTXA 4W4TA 1QO0D 4MQBA 5AM2A 1B26A 5FOJA 1IWBB 2NYRA 1SEBB 1V1MA 2E7BA 5T5FA 3SDDC 2Z2JA 1C5DA 1ZI9A 3NESA 4NXSA 2Y5TB 2X9QA 3FY4A 5E4AA 3T1FA 3MAJA 2MCMA 5IASA 2HVKA 2WWOA 2HK8A 3UJ6A 1NUTA 3V2UA 3VXTA 2ENJA 1S7UB 4FA6A 4WOCA 4P2CG 1QVOB 5ACZA 5CH3A 4YSCA 2E27H 2R7AA 3DBIA 1BMTA 1U2GA 1V1MB 1UZ6F 5CYGA 3ML9A 1X2EA 2IUFA 1C5DB 1YDHA 3AX6A 2BW5A 2ZULA 3MRQA 2HVJA 2C7OA 3T1FB 1A7JA 2HVKB 2K6ZA 3VR6A 4B5ZA 1FFNA 1PZCA 3PIQA 2CPCA 5EI5A 2I07A 1U0JA 3VXTB 5EUMA 3I34X 4Q7KA 3FTXA 3L6OO 1ATZA 5FEMA 2E27L 5ACZB 2JMRA 3TFKC 4TVBA 4FQQA 1HKLH 4KNWA 2H1WA 3SBWA 2NZ9D 3MRQB 2HVJB 2ATCA 1PSWA 4X42A 1VE6A 1FFNB 4HJ0C 3PIQB 1OBOA 3RWOA 3OPUA 3CO0S 2I07B 2J0UA 2JF0A 1XGZA 1JCVA 3BWCA 2H7CA 3DDFA 3UPAA 1MHEA 2K1MA 4M43L 1I1HA 3NNDA 1HKLL 3S8FB 2B5IB 1VPWA 1J1XL 2FYYA 4FQQB 1W73A 3SYLA 2B4AA 1KVRA 3D6MA 2H1LM 3AHCA 3OFVA 4QRPD 1JLSA 3ROLA 1QTYT 1CNEA 1MCIA 4XVUD 1UADC 1ZQ1A 3ITKA 4PLGA 3BSZH 4DV6B 3CSPA 1C1YA 2B34A 3SX4A 3HCEA 1ZGZA 4A73A 1QHHA 4KIUA 2G7MC 2HGSA 2R79A 2QMQA 2J0UB 4OZGB 3D6TB 2IZ6A 1G5AA 5JQ6H 5K4GA 4J7RA 3AM3A 4MA5A 1PZGA 5TGBA 2PJUA 4U6VL 3D8MA 2XVKA 1ZOPA 3IXLA 1S9VA 5HP5A 3WJLA 3ROLB 3BSZL 4OQFA 1X5KA 3T8MA 3PICA 1EM6A 4YSRA 5LLSA 4BNJA 3D9AL 2VP0A 3HN8A 4DIOA 3RK1A 1QHHB 1Z7WA 5JQ6L 3QLVA 2IHKA 4B45A 3E84A 2DXIA 1WZLA 5TGBB 4E4RA 4Z7OB 5BWBA 4B84A 2YD8A 1PG7X 4HK0A 3GCGA 3IDAA 3CPSA 1S9VB 2X13A 4UFNA 2OTPA 2WINI 2PUFA 5DK4A 3DVQX 1CF8H 3QFTA 1PG2A 2PA0A 3LY9A 3TSZA 1WWAX 3ZX4A 4EZJA 3PGVA 5IAAA 3PFFA 3ES6A 2B9VA 5B6JA 2YWFA 4KO1S 3G6DH 4Q9JA 2BDUA 3IILA 1X5HA 3T0EC 2HTLC 4HK0B 4LYHA 1SXIA 1ZC4A 2W8ZA 3I09A 2YK1H 2EGGA 2PLTA 2C88A 1CF8L 4Y9RA 2QL1A 3OF5A 2ZKHH 1K4KA 5JG7A 4FJZA 3WAGA 4LG1A 2QRPA 3OMWA 5I7RA 1UC5B 3KB8A 4ZSOA 3RURA 3ES6B 5JXAH 1WUTA 1NXXA 3T9FA 4RZIA 1N1EA 3U1SH 2AN3A 2Q10A 3NM6B 5DC2A 3NHRA 3NIGE 3WHLA 2YK1L 3VI3A 1U8JA 2ZKHL 3COYA 4DWHA 3DO7A 4J1NA 1FTNA 2R96A 1H1TA 4A6EA 5KNCA 3VSUA 4XASA 1DTSA 1EBUA 1T66C 4ZZKA 4QDKA 4FJYA 4FNLH 4HKZA 4PYKA 4EGJA 2MSPA 1HL5A 5JXAL 2DLGA 3D25A 2FJGA 1BJKA 4ZSOB 2M98A 1ZLUK 3U1SL 4LF5B 5J3HD 4M9ZA 4ELMA 3DZGA 3ICOA 2FAUA 5DYTA 3WGNA 1QMUA 1WUYA 3VI3B 3NEOA 3L7OA 1U8JB 2EXYD 1OK8A 3DO7B 3R20A 3ZBPA 3TURA 3QEMA 4FNLL 5LWYH 5F89A 3NJNA 4F8YA 3DZFA 2VSKB 1PS9A 5D1XA 4M89A 3GDBA 4BUGA 5HXAA 3FT9A 4Y1TA 2GI7A 3D25B 2FJGB 3PDWA 1QWOA 3QCTL 1Z56C 2RKBA 3IP9A 1Z82A 1RIFA 3X1MA 2VT2A 4EEXA 4ZUSB 4JI3B 3GJ0A 1L7BA 4ELMB 1E43A 1XL0A 3SO5A 35C8H 3A26A 1G9NH 1Y63A 5LZ7A 4F4JA 2G40A 3DR5A 4CI0B 3DNKA 3RUHA 3DA0A 5LWYL 4D82A 3FCYA 1D0VA 1ACCA 1Y9DA 3QEMB 1E3LA 1G291 3V4PL 5DTIA 3SSOA 5F89B 3ARYA 2V7XA 1Z9NA 5CG1A 5D1XB 2J85A 3FOCA 1PZUB 2DFKB 3CA8A 35C8L 3BPNB 2Q3BA 3PFHA 3GJEA 4Z7WE 5FXCH 4C58B 3D0KA 3W2TA 3HH8A 1UC6A 3H9SD 3ESVF 4DF3A 1DVQA 2W95A 3REQA 3X1YA 1KIPA 1T0IA 2ZRLA 3RJQB 4PP1C 5F3DA 1OBHA 1NVVQ 4BWGA 2JIPA 4B48A 1RD4A 2WO4A 3PWLA 4MA1B 4OI2A 3B2VH 2EW2A 4M0UA 3GJEB 4J23A 4RFSA 1UKQA 1H2EA 1UIRA 2ERXA 5B1AB 3REQB 4OIAA 1LO4H 1KIPB 3LRKA 1RUAL 2M6RA 2WVHA 3G79A 3IQDB 2BBTA 4PCAA 3VMPA 4TPRH 3O47A 2HKAA 3JSXA 4I9FA 1EJOH 3ABIA 4Z4QA 3CR7A 1BDJA 1COBA 1MHCA 3PWLB 4HAGA 2HA3A 4JBXA 4Q1CA 3RPIA 5ALPA 1J0KA 5C31A 3CJJA 1QQ6A 4NV1A 2R4TA 1I7DA 1CGTA 1FYTE 1UC8A 4RFSB 2EZ4A 4QEGA 1LO4L 4NJMA 4TF4A 4JB9H 2YUIA 2GBCA 3VI3F 3OLDA 2F54E 4TPRL 1UZMA 4WW2A 3PREA 3BP4A 3M7IA 4BNHA 1TM3E 4ODUA 1AKNA 1EJOL 1QIMA 1EU1A 3O1JC 4K1XA 4X20A 4TQIA 2JAUA 2KDGA 4OU5A 3O4LA 4TTIA 3O3BA 2Q5IA 1MHCB 1KJ2A 3DPSA 3RPIB 2E5LB 3ECQA 3V2GA 3SO3B 4EG6A 2XODA 3J8F7 3KKKA 2DQGH 3EVNA 1IHYA 1TCMA 4JB9L 3G82C 1TVBA 3AHJA 4NJMB 2WWKT 2ESVE 1KO8A 2CUAA 1UBMS 1TKBA 1JZ4A 3U7IA 4WBSA 2VR3A 4WW2B 1CEEA 1G20A 3M6MD 5HZKA 2XUZA 4YBQD 1IBGH 4ODUB 1PDOA 5DLDA 4Z5RA 4H2DA 4X20B 5B8CA 4TRRA 3QJ5A 3JTEA 3O4LB 4OD1H 3O3BB 1KJ2B 2ZJ5A 1V3VA 4O9HH 2DQGL 2QXTA 1VLLA 4AZWA 1AXTH 4LTDA 3KTDA 2QKYA 3H8WA 3WLIA 1FDSA 3B7RL 2PKCA 1E1QA 1TVBB 1MFPA 3ZDDA 5TDNA 3RSFA 1IBGL 3GHPA 5E3HA 2F9BT 1G20B 1HIMH 2VLJA 3ZQ4A 4Z5RB 2Q1TA 1YB5A 1VPEA 3QPAA 4U3CA 5B8CB 4OD1L 3U62A 1WT5A 2GCIA 2X5XA 1AXTL 1CYXA 3C6YA 4MW5A 3X1WA 5MGBA 3G13A 1L9NA 1QBMH 3THRA 2QD1A 1NLDH 1X8KA 4XB8A 1X0XA 3AT8A 3ILHA 2PSHA 3H9CA 5TDNB 3F7TA 4J6FA 1HIML 2BFWA 3TW0A 1U9KA 3LBNA 4JFRA 4UNIA 3PJFA 5CSBA 2IWGA 4ZT6A 4KK5C 3CX7A 3ZVMA 1J5DA 2YGOA 2LDBA 2EO7A 4R6XA 1CUSA 2YOCA 3GLHA 4DTIA 5JNVA 1WO8A 1S3GA 1UURA 3KHTA 5FOUA 4QQNA 1D5BA 4XMPH 1NLDL 2MQ3A 4M99A 3CUTA 3O8BA 2Q4DA 4XTRC 5DW3A 2A5GA 1XPRA 3PCTA 2P8LA 1NXOA 4KFSA 3S8YA 4AJ1A 1FNSA 4U02A 1CUHA 4HPOH 1DG1G 2BUBA 4A0QA 2M2IA 3FU3A 4LSPH 1G9TA 2DZEA 1F7VA 1F5SA 5CFLA 2G04A 2RJMA 5B1BB 2IOHA 3GLHB 5EXTA 4XMPL 1AZZC 1ETB1 2XZQH 3E9DA 1D5BB 4AQ1C 2XBLA 3QQXA 2IOQA 1I8AA 4KXQA 1SCAA 1ZAYA 1ECCA 4AP6A 3AVEA 1Y6FA 2P8LB 3G5ZA 2IUYA 4HPOL 1R0BA 5MP6H 3ZJ5A 3FRHA 5L8KB 3ZT5A 4HW6A 3HFJA 1PT7A 3UGEA 3V42A 4D4MA 1FUEA 3MZ0A 2VNSA 4IS3A 5L6YH 4BTVA 1UP6A 2XZQL 2MEJB 2VDNH 1KI1A 4BE6A 3L1OL 4FJ1A 2P7TA 3QXTA 2HT3D 3E03A 4KI1A 1A7QL 3G5ZB 5C0EA 1PU0A 1BQSA 1NW3A 4GOKA 2AW5A 2ZXFA 4P6VF 2IH1A 5KVFE 1KMQA 3HLAA 3AY4A 1ZK1A 1HHIA 8LDHA 2WKLA 3UACA 2VDNL 4MV9A 2BMFA 3EW3B 4XP9H 1ADCA 4NJEA 4U7PB 3BX1A 4MIYA 1I85C 3NP3A 4A2FA 4XPHH 4FFWA 3GLTA 2P7TB 2D31A 5JW5A 4PYLA 1Q90A 4UUOA 3ESAA 2YNMA 3WJ2A 2R44A 5C0EB 2X4RA 3UK1A 3GKWL 1OLSA 4ESKA 3IKLA 2HF7A 1EZLA 4G8EA 2IH1B 1N6HA 3HLAB 3H2SA 4W1RA 2ZFUA 4R0NA 4EFLA 4B9IA 1HHIB 4JLWA 2G28A 3L0YA 5H4YA 4NJEB 3QDGD 5IMOB 4XPHL 2UZ0A 5AAPA 1NOLA 1YFKA 3JYHA 1S2DA 4YRCA 1KEEA 1ULTA 2D31B 5JW5B 3X1EA 1OSZA 3ABSB 3PXAA 2X4RB 4HPWA 1OLSB 3EVAA 5IKEA 2CCJA 4INPA 5DM4A 4G8EB 1IVNA 2IYTA 5ANME 1BZYA 5F2OA 3HXQA 2IPNA 1BXKA 4KVGA 1FVOA 3R7LA 4NBLA 1QFSA 1RZUA 1I1AC 3S3CB 2CHUA 2HN9A 3RFCA 4RJLA 3UMRA 1KEEB 3CH6A 2BKUA 3Q0HA 1G7QA 3F3YA 4YDJA 5EKUA 4Q1VA 1L6IA 2Q5HA 2BHUA 4I55F 1KCWA 3HHRB 3KYNA 3DDWA 1PZ3A 3ZPDA 5CR8A 3VNSA 1XXFC 4LCVA 2AC4A 5A9RA 3CN7A 3GFUA 1IZYA 1ST2A 3U1TA 4ITRC 3QOXA 4XC1H 1E4EA 3QIWA 1L7QA 2BGRA 4WNQA 4HAFA 4KN6A 2FOXA 5FP0A 1UK6A 1G7QB 4L0ZA 4YDJB 2IEPA 1U2HA 4KITB 1NAMA 2X4NA 2FN7A 5IVIA 3CRNA 2GXUA 4CRPA 2WT9A 3KYNB 1UZLA 1IGCH 4DIXA 1CF2O 4YRNA 3X1XA 4XC1L 2RGGA 3ONWA 1ZANH 1RC0A 3WGIA 1XX6A 3VAZA 1E4EB 3QIWB 1H3PH 4WNQB 2D03L 1FW8A 1HV8A 4QRBA 4YVFA 4E36A 2A8YA 5A16A 2H06A 3T06B 3TN0C 1NAMB 3ECUA 2X4NB 4CM1A 4GINA 2BUAA 3EGEA 1IGCL 1DLJA 4ITVA 1UPUA 4F46A 1QAMA 5JQGF 4Y6LA 5H4HA 5A5VA 3VXME 1ZVJA 4YBZA 2FEJA 1WSST 2GN0A 4HFMA 1G7PA 3VYUB 4OBEA 2A9NL 5K09A 2OV1A 1QORA 3TQTA 4ZVLA 5A16B 3GJ5A 1SC6A 1WG8A 4F58H 3US1A 1GL9B 1UASA 3B5JA 1ZK3A 3EJYD 5AH0A 2YWEA 4KFCA 5GGTL 1HN1A 5C6PB 1ZNZA 4HAOA 3WMWA 4C1BA 2DD8H 3R4DA 3HUEA 4OQXA 3W8FA 2PX0A 4Q9BA 1I9RL 5CXPA 4QTXA 1FSZA 4M22A 1G7PB 3B7GA 3LQYA 4W4OA 4XNYH 2K87A 1BXRA 4YY3B 4F58L 4KVPA 1M8JA 4LZAA 4Y1GA 4AM0Q 2JD0A 4X65B 4DDVA 1U4EA 5FLVA 1FX0A 1JYSA 3PU6A 3TCNA 2GX6A 3HC7A 1ZK9A 1G94A 3PDCA 5EE9A 2FFJA 1MJ5A 2DD8L 1KTRL 4MV3A 3FNHA 4EHKA 2JEOA 1CFZA 3HNSL 1YBVA 3TCTA 5TJWK 1K3ZA 3MRIA 1IM2A 1WPGA 4C59B 3MLZL 2JZOA 1BXRB 3P40A 2Y1DA 3TFWA 5D7SH 4PRID 3GBMH 5G5DB 1FX0B 1OXSC 4K07A 2AG0A 2XETA 2Q6OA 3QKTA 1WD5A 1KAQA 3RL2A 3O83A 5I51A 4AS3A 4ETYA 2IKQA 5A1AA 5LQRA 2DMKA 2JJSA 1EG7A 2C9YA 3ED5A 3MRIB 4YMSA 2ZSVA 1LUAA 3EGDA 4UBKA 4ZZ1A 3E5MA 3KZNA 1E42A 5D7SL 1UT6A 3QH3A 2H6PA 4IRMA 2X4OA 1ASQA 2C3OA 1T9BA 3PJGA 4XCFL 2Z2YA 3TFQA 1H05A 3IAAA 2ZREA 1H2WA 2QM8A 1SJEA 2VW6A 3RL2B 3E9NA 1B4JH 5IKCA 3OU6A 5I8EA 5A2AA 1DJWA 2I4OA 2IWFA 1U2DC 2DAVA 1HWGB 2ZSVB 3B85A 3EGDB 4XCEA 1E1KA 1C1EL 3TQQA 3QH3B 4K15A 1KH3A 2H6PB 3C09C 4EQ3A 3VGEA 2X4OB 4OCYL 3UV7A 3LZRA 2I4MA 1M7IA 2HUEA 3ND6A 4P5MA 4M55A 4AH2A 4U2ZA 2FUNB 2MTAA 2AHOA 4YE4H 5JNUA 1SJEB 1EGJL 3KW8A 4UBDC 4ZW8A 3F7RA 5IKCB 1TCAA 1YA6A 4ERNA 1VESA 3R7SA 1C4KA 1OT2A 1X7QA 3Q2KA 4MWGA 5K9KA 4XCEB 1VMAA 5EWIL 2R0QC 9PCYA 2QYHA 2C9MA 1NF8A 1G9NC 1M7IB 2Q2EB 4P5MB 3RVBA 4AH2B 4JFFE 4YE4L 2XE6A 4M61A 4MZRA 5KDLA 5E7JA 2V8MA 3OE7D 4XCCL 5CFMA 2I91A 1DELA 4N2IA 3BGIA 1LPMA 5CCEA 5LL6P 1O8BA 2FR0A 4KZDH 2GM9A 1MIMH 5F51A 3I84A 1UH5A 3RIXA 1X7QB 3HBPA 5K9KB 1Y3HA 1N0IA 1U0QA 3OX8A 3NJFA 1EO7A 3DOEA 5LCVA 1DCMA 1YB1A 4U1GB 2QT1A 1N36B 1CJMA 1B74A 1YN6A 4WFHE 1GC1L 1T2UA 4ESHA 2HYIC 1AHWA 3C7DB 4F2WA 3E23A 2G2RA 4HRVA 3E3QE 3E2HC 4M61B 4FOSA 2WM0A 4ZAKA 2W6IA 4EMUA 4MRNA 3R3UA 4WI4A 4KZDL 1H69A 2I1WA 1OZAA 2UU9B 3MRHA 3SE4A 4GL4A 4BFYA 4MXVE 4TULH 3RSSA 4GUPA 4JBSA 4ZDWA 3OX8B 1JILA 4EXKA 1H8HD 1VAHA 1YN6B 2YMOA 4LE2A 2Z3ZA 1AHWB 2XXJA 2VE6A 5C81A 2G2RB 3P8ZA 3F58H 4UMFA 5AZEH 4ZT2A 4F7PB 3LKQA 1EEYB 3FPXA 1UZ8A 1HZHH 4K8OA 5EXSA 3MRHB 4TULL 5DMIH 5ECGC 1V1JA 4XWAA 2QYSA 3ZEAA 5ITWA 3N86A 4GUPB 2EEPA 3EWNA 3UBGA 1R0KA 2Q4EA 2W37A 2X7JA 3V52L 4N0FA 4KOBA 1JFFA 3BZ4A 1UKYA 3F58L 2R87A 2R5NA 5AZEL 4YFEA 2VE6B 3K53A 3OZUA 1HZHL 3ECCA 5AHKA 3LKQB 2ZE5A 1UZ8B 4WHDA 2DJ4A 3L7IA 1NMBH 3CVIH 2H5JA 4RWZA 5K5YA 5AUOB 3ZIAA 1UBJS 4YHIB 3NP7A 3E9QA 3KVDD 1QIJA 2CMGA 1PLKA 1VBKA 1QI3A 2VM3A 2OJEA 3I2CL 3HLTA 3NH9A 3GJXC 1L0QA 2XQYG 4N0FB 5DEZA 1JFFB 3BZ4B 2WJIA 2F08A 1FW6A 5FYJL 1DOHA 3W82A 1NMBL 3CVIL 5KKAA 2OHXA 1QW9A 4X6DA 1KMCA 3I1YA 1G4UR 1VKZA 2PGAA 4IZIA 3ZQWA 4R1UA 1UAGA 2C96A 4QU9A 3NZ8A 4KK8C 3KOWA 1U31A 2DPMA 4J4PD 4C01A 4JE4B 2OJEB 2Z43A 4G9BA 2K7FA 2E55A 3BWVA 5FOSA 4IBYA 4DY4A 5C0BA 4DL9A 5M04A 1L0PA 4WGKA 3MQFA 3DJ9A 1CNMA 3NM5A 5EVJA 3OSVA 3GZKA 3K70C 1GV1A 5IF9A 4HSAC 3HE7C 2Q3XA 4BE5A 3A8TA 4AVJA 3VZSA 1UFRA 5IT0A 4X6DB 3EOBA 4EHFA 3KJ6H 3DHUA 2R86A 4J3FA 1F6DA 1A4XA 2HRQA 3B1FA 3NZ8B 4EJ1C 3UTPD 4TOIA 1SOKA 1ENYA 4D6YA 1GXEA 3S0PA 5JHDA 4ZQEA 5IM7A 5C0BB 4EPXA 2J3JA 5C7YA 3WN5C 1YHZA 1A71A 3TYXA 4QUKA 4M93B 1XF1A 3QUQA 5HI5C 1JZ7A 2CFSA 2B1GA 4LCIH 4PV8A 3KJ6L 5SYNA 4V1CA 4BO8A 3QZWG 4ZVKA 3EOBB 5IVXA 5DBFA 1W94A 4I85A 2TSYB 3NRPA 1AN9A 4HXEB 1XVUA 3KOOA 1XLTC 4GPZA 1JBKA 5T5NF 5JZOA 4G84A 2PH1A 4UHBA 4F8EA 5JHDB 4OFKA 5IM7B 4KFRA 3N1MC 3MMSA 3UB2A 2DYPD 4PV8B 2I60L 3STUA 5JIDA 2QGBA 3VJKA 5IVXB 2WDPA 1RLUA 1W5SA 5FLXA 4YRMA 3VO1A 4BP3A 1ZMXA 3VNQA 1S1CA 2Q9AA 3W9SA 4TLUA 3FZUC 4B6QA 2IY9A 1YA8A 2Y0PA 4EY3A 2ZWPA 1DQTA 3SC2A 3QNMA 4XO9A 2ZJ3A 1Y80A 3C2QA 4RW0A 2D1SA 1SUSA 5AKXA 4CC4C 4FNRA 3RC9A 2WSPA 2A94A 5B58T 1LSOA 3OJEA 2FK8A 4ZX4A 4S0HA 1AQ6A 4OQQA 5GJTH 2V7QD 3AV3A 2BKXA 4AO6A 5T5QA 1YVDA 3WB1A 4EATA 3UAZA 1RURH 2AJVH 1XO8A 3VPCA 3BRCA 3F2LA 3SC2B 2O2JA 1AGNA 5K0TA 4B80A 2HJRA 5HUHA 4G11A 2PZLA 2QG6A 4HLZG 1XROA 1T8YA 3FUHA 1BZ7A 3GIDA 3C6SA 3KP1A 4FONA 4L75A 4X6DF 4HOYA 1DTWA 4WGVB 3M6WA 2WD8A 1RURL 1GPH1 3A06A 4MB6A 2AJVL 4ERSH 4A7VA 2AQTA 4CNQA 3TIFA 4FTVD 3VE0A 3HTXA 4TUJA 3K4QA 3WSTA 3PQYA 3TVTA 1CXKA 2P9JA 2NXZD 1EVZA 3SDZA 2WVVA 2IY8A 4GMTH 3RI5F 1G41A 2Q2VA 1XEUA 1LZKA 4MP8A 1NIPA 2YOAA 3VU1A 4OJQA 5KVDH 5KI6A 1BZ7B 3C6SB 5JSQA 5EWLA 2QW8A 5IKOA 4ERSL 2WQSA 2BDTA 4IEFA 1XJCA 4PGAA 1PEAA 4PJIE 2PYED 3VE0B 1P6UA 4TUJB 1KULA 2DFLA 2WBJD 4JBIA 4XI9A 3PQYB 2DBLH 4UPDA 4YDQA 1BFDA 1P91A 4GI3A 3VHXA 4B85A 5BSGA 4GMTL 2WVVB 5AJWA 5KVDL 4PU2A 3QZWB 5FUOH 4G8GD 2AP2A 2GHQA 4BRZA 2ZXQA 2H4HA 4R84A 3RSZA 5EWLB 1FXWF 4ZOCA 4DWOA 3MMZA 2ACKA 3ZJUA 1P8JA 4PANA 4IEFB 2ATEA 4RF5A 2P8MA 2VMFA 3UV6A 2DBLL 4RD1A 4EVSA