3ZDZB

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 111
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3zdzB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3zdzB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3zdzB03
1IJKA 5HDBB 2NUPA 3N2NA 1L5GA 3GXBA 5KYUB 1N9ZA 3EFOA 4HQNA 5HGJA 5KYYB 2NVOA 1M10A 1M1XB 4MMXA 3ZDZB 3EG9A 5HJ2A 4FWWA 1JLMA 3AL8B 1MF7A 1L5GB 3OKYB 4MMZB 1SHTX 1RD4A 1TYEB 1U0OC 2VDOB 3EH2A 5KYYA 3ZQKA 4NENA 1JEYA 3IJEA 3ZE2B 3K71B 4C2BA 1IDN1 1Q0PA 3NIGB 1M2VB 1T6BY 4CN9A 1XDDA 5E6UA 4F1JA 2O7NA 1ZOPA 4CNBA 5KYUA 1JEYB 3BQNB 3FCSB 3IJEB 1AO3A 3K71A 3F74A 4HQKA 1M1XA 4PN7A 1CQPA 2VC2B 5BV8A 3EGXB 2VDRB 3EG9B 3QA3E 3HXOA 1LFAA 5LN1A 3AL8A 4HQLA 3PPXA 4WK0B 2VDNB 3OKWA 3E2MA 1ZOOA 4Z7NB 2WINI 4JX0A 2I91A 1M2VA 4M76B 3TXAA 2ADFA 3NIFB 5E6UB 4NEHB 3ZE0B 4Z7OB 1UEXC 2M32A 1MQ8B 4Z7QB 3IBSA 2XWBF 3ZDXB 4F1KA 1U8CA 3V4VB 3FCSA 4WFQA 3VI3B 3K6SB 3V4PB 1IJBA 1MQ9A 4UM8B 1SQ0A 2B2XA 3EGXA 4MMYA 4FX5A 4A0QA 1XDGA 4GZ8A 1U8CB 3EGDA 3EOBI 5KYXA 1AOXA 1SHYB 2WW8A 4MMYB 1YUKA 3TVYA 3M6FA 3HI6A 1BHO1 5E6RA 1PD0A 5E6SA 4IHKA 3PPWA 3OL2B 5KYXB 3K72B 1SHUX 2ODPA 3BQMB 3T3MB 1AUQA 3K6SA 3AFCA 4HQOA 4O3TB 1BHQ1 1T0PA 3PPVA 4JDUA 4UM9D 1SSLA 1U0NA 1PT6A 2QTVA 4XW2A 1RRKA 1YVRA 4C29A 1MQAA 3OL2A 1M1UA 2VDMB 3EGDB 4UM9B 3F78A 3Q3GE 1OLZA 3TCXB 1OAKA 3HXQA 1RTKA 3FCUB 5KYWB 1NA5A 4WJKB 2XGGA 1MJNA 2XWJI 4G1EB 1XUOA 3NIDB 5E6RB 5E6SB 2NUTB 2VDPB 3K72A 3TW0A 2ODQA 2VDQB 1JEQB 4K3JB 4BJ3A 4O3UB 2I6SA 2P26A 1JV2B 1DZIA 2X5NA 1DGQA 2P28A 5KYNA 4DMUB 3RAGA 2VDLB 3T3PB 3ZE1B 4G1MB 1JEQA 4O02B 1QC5A 2VDKB 2ICAA 1PD1A 5KYWA 1MHPA 1N3YA 4C2AA 1JV2A 4G1EA 4WK4B 1ATZA 2I6QA 3EOAI 2UZYB 1FE8A 1FNSA 1PCXA 3NVQA 1IDOA 1QCYA 2NUTA 4O02A 4WK2B 1V7PC 4IXDA 1QC5B 3VI4B 5ES4B 3ZDYB 3EH1A 2NUPB 4MMZA 3AL9A 4HQFA 3EFOB 3PPYA 4NENB 1M2OA 1RS0A 1ZONA 3BN3A 4IGIA 1YVPA 1CK4A 4G1MA 4MMXB 2IUEA 4CN8A
chains in the Genus database with same CATH superfamily
5EKSA 3ABRB 1XN4A 4K0OA 1YKSA 2WWWA 5E2TL 4OGFA 5BW8A 1TCMA 5LXVA 3CMOL 1IVSA 1HDMB 4LPUA 1DO2A 1L8QA 4B95C 4LJ6A 5CAEB 4FCHA 4PRZA 4GKJB 2X8AA 2XPYA 4PS0A 1QJCA 2EX4A 5FLUA 2YAPA 4CA4A 4KWCA 1K4YA 4KLNA 1X8LA 4AMKH 4L1KA 4RFLA 5E4JA 4O4JB 2QRVA 4D3CL 1LPSA 1XROA 3R7RA 1XR8A 4NK4A 3QYPA 3F6LA 2UY6B 3B7WA 3C5VA 4IIXA 4YO7A 3UOAB 3QUBA 3FVTA 1AS7A 2VXQH 2YC4C 2O23A 4MPJA 4A7SA 4EECA 1CFQB 3AXHA 3D0KA 3FZUD 2A6JB 4LZWA 5IKXA 1O94D 3TNNA 4ITVA 5MGBA 3IDXL 4UZEA 5LAXA 1H0SA 5HF9A 1JJAA 1OSNA 1P4GA 1W93A 4XKJA 1PR4A 4X94A 2EQDA 5ECDA 3MXOA 1VZ2A 2H2HA 2XLBA 3TIDB 2H07A 2R5FA 2UZXB 2Y07H 3S5ZA 3BMVA 5ALBH 4DGYL 4FNUA 5A5GA 5J2UF 1IZKA 1CE8B 3V8OA 3EAQA 1YUHA 2AI0H 1H5QA 3GEIA 1BA3A 2WP3O 4MHHI 2HSZA 4LRUA 4NHEA 2KB0A 3K8MA 4GMSH 3RBXA 2N7BA 4FG4A 4KY2A 1L5GB 3T1WA 4N0UE 2YUTA 3AHGA 3ZRSA 1LLFA 5JS6A 5FW7A 2Z95A 5BSRA 2NXZB 2WMPB 1XZQA 2W2NA 4JYAB 1DG1G 1S01A 2J6BA 3CIFA 2DSTA 1JZJA 3MMNA 3X1MA 2R8SH 4QYIA 5J1SC 1DJYA 3AS2A 5HK8A 4PYRA 3MJEA 2FJPA 2JKXA 2YIMA 3D85B 3F12B 1UXGA 4WFIA 1MABA 3EULA 2GM9A 3DETC 5FFGA 4P3OA 2BY1A 1G21E 3LUHA 4MEJA 1PJAA 3EB9A 1XB3A 2G4EA 1GDDA 3D8MA 4DH2A 4OGLA 3T1TA 1LD9A 4EI6B 2G9UA 1JUFA 3O3UN 4TZ0A 1NJFA 3FNEA 4LF6B 2WHYA 2P5ED 3QDJD 2CXPA 2VDKH 3V5DB 3GZKA 2CBXA 1JXJA 3L1JA 1S9XA 3RWGA 1XAKA 1EDBA 4INJA 2I62A 2D0DA 2DPLA 2V7NA 2XXFA 3ZZ1A 3HE6D 4GQQA 1B1AA 1XRQA 1VECA 2Z9DA 4RVDA 1RXEA 2Q4EA 2CLIB 1QNZL 3FUMA 1AKWA 4UUPA 3H5IA 4JM0A 4HCRL 2COQA 2VQ1A 2BMKB 2B4RO 4EO4A 4RWYL 1XPOA 5KYYB 4NOBA 4WHCA 1E6JH 2DFPA 3HUJE 3TWCH 5B3AA 2IS4A 4HNSA 4KX5A 4FQLL 3IKLA 1MO2A 3CMGA 3OMAB 3IBCA 1E1CB 2EKZA 2P5UA 4U2FA 3DROA 2FK8A 2XCQA 4Z7JA 3O6LL 2GETA 5BV7H 3JRWA 5SYAA 1CIUA 3Q6IA 4QUAA 1KOAA 3VWJD 3PNOA 5KW9L 1UMDB 4DJDC 3NQ41 4US0R 1DXOA 4JC5A 3RAPR 1NQBA 2P40A 2F1OA 2Q4RA 3GZNA 4OKVA 2IS1A 4MQFA 4QHSA 2HF2A 4XLTA 2DX7A 5GS3A 2GXUA 4QUIA 2N1TE 5A9TA 2RI1A 3QQNA 4PTZA 1IAQA 4JJ7A 4FKBA 2A1TR 2NNLD 2QL5A 2MYUA 3DYBA 2VISA 4HDIB 5LBUA 1MC8A 2P5EB 2I6FA 4B9GA 5SZIA 4CWAA 5TV2A 1A9TA 4WLVA 1BYUA 4OX9B 3FK3A 2G40A 4K94H 2I1LA 3F7NA 1F4XH 3MLUH 4HAXA 3LFUA 2HA3A 1Q77A 1CP2A 2EDCA 2JGAA 5K0FA 2OXEA 5AVSA 2OCCB 4ROTA 4TLKA 3VTAA 3QTTA 2ZCUA 3K81A 5AVZA 1PQYA 1RZJH 3R4RA 3RGVB 5F9OH 1K92A 3ECSA 3LQRA 4IIJA 5D2LE 2R0KL 1KCSH 2JIXB 4GXUM 2CNZA 1ZTXL 2OV3A 1JU9A 4OLJA 4P7KA 1X7GA 5HHOE 1Y9AA 5KQLA 3W5DA 4XO4A 1RABA 2GD2A 3G2LA 3CUWA 2V7QA 1FZKB 4QTIH 2OHJA 3Q41A 3BKYL 3PR2B 1GTG1 5FBRB 5JQ6H 1HRDA 2PNFA 5FYJE 2XLLA 3PEFA 1LK2B 1UDWA 2QR0A 2MFNA 4F4DA 4IUYA 1XZFA 1D7DA 1GS7A 2N42A 3AU0A 5FX3A 4HSQA 1E6WA 4IICA 4MUBA 4R90L 4I0WB 3S99A 4OFWA 3I45A 2QX6A 2X9GA 3DCJA 3WFIA 4ARZA 3BWYA 1OAAA 4DIDA 4UQIM 2V7TA 3KYDB 1RC1A 4JANA 5IQMA 3GEHA 3VD9A 3TVYA 2OCFD 4CIDA 4K3DH 4OM1L 4ZANA 1QG4A 3VHLB 1Z9LA 1W4LA 1MWAL 4DLXA 4E41A 3FNBA 5CYGA 2VM3A 2A57A 1GSKA 4EJSA 2WIKA 3RI5F 5EORH 1GOHA 4MS8D 1E94E 3T5BA 5ELXA 2KKQA 5HP4A 1N5KA 4I3SL 1LL1A 5KWJA 2F54E 2F43B 4UPDA 2OK8A 1M9NA 2QVCA 5EBWB 2A9QA 4HUCA 1NSFA 1Q0UA 4D6YA 2A6KA 4JEUA 2OAQ1 1IAIM 1R0YA 3N85H 3JAWA 5D1ZB 2AL7A 1V25A 3MGGA 2J5KA 4BEIA 2VLKB 3G0GA 1NC1A 1T7YA 2WIIA 3WP1B 2BKLA 5PAZA 2M1KA 5D70L 3SKMA 4M61B 3QWFA 2W8ZA 3I2JA 1F4AA 2G07A 1INEH 3HCEA 4S3MA 4G42A 3REFA 3MUHL 1VHQA 1SHJA 5JATA 4WJG3 3HMXA 1W9MA 4S1NA 2AABL 4MS6A 4W8GA 1YGYA 1KJ3L 3PL6B 5ICYA 4AAYA 5J58A 3WICA 4MJ4A 2P1ZA 3VVCA 3RAFC 1CL7L 3GPDG 3DEFA 4B75A 4KNVA 3FT2A 1YCDA 4ARCA 1TUBB 3HVNA 2PKXA 4GI7A 1JTFA 1V5GA 4GSQA 4DGVL 2IBTA 4PG7A 1WW8A 4DETA 4EMBA 4CEIA 3MV8B 1J1OH 1OE2A 2PMZA 2ENWA 2XCSB 4XX1G 4V1CB 1YPZA 3KXFA 5IPFA 4FCAA 4WEEA 1CCWA 3G2QA 1IAOA 2D73A 4PGAA 1HH6A 1WCBA 5IFJA 2J0QA 5HTOA 1KZ6A 2W2XA 5IF9A 3TBSA 2J8UA 3B3IA 5EFZA 1XDWA 3FPJA 1KFCB 2YGNA 5IREA 3IT3A 4JEMA 3KWFA 3OIDA 2BSXA 1RP8A 1WETA 2BJWA 3VQLA 1X15A 5EC1A 1KTDA 3ZKSD 3VFPB 2XJ4A 4ZAWA 4FZ3A 3N7AA 3HR5A 3A8TA 1TMGE 3FWPA 1T91A 4L3CA 4XPBH 3C3BA 3K9FC 5JDSA 2Y0EA 3QQ4B 1BX0A 4FFSA 5AVVA 2ZJFA 1JGTA 5G0TA 3V4PL 3JQFA 2V0CA 2Z1KA 3QY9A 4XCNA 4I99A 2Z04A 5KQMA 1XF2A 5EVCA 1O57A 1EO5A 3PVCA 1SXNA 4A2MA 2GJSA 1QSZA 5I30L 3WNCA 4KXAA 1YRWA 4KPGA 3N28A 5ALPA 3WMPA 4BE5A 3M9LA 3SPGA 2HHLA 3UJDA 4A3SA 2ZI7A 3SYNA 4YASA 1KTVA 2CMRH 5HM6A 3H1BA 2I4LA 3TQFA 2ZSWA 1OBVA 5EGNA 3NOIA 2DM2A 1XQWA 3I6QA 2FO1A 2WINI 3HE7A 2IDKA 4RFOL 4RH0A 1QO0D 3VPGA 1XMWA 4AZVA 1OFVA 2VZ8A 4N7BA 5EZYF 2CD7A 3A26A 2XV0A 9PCYA 5I1CH 3LHDA 3Q5EA 5DYIA 1TZ2A 5ALCL 2N3JA 2I2FA 3NJ4A 5C0AE 3PIDA 1BYIA 1W5EA 5DJDA 4X6CA 4PRPD 4LLYA 1K8XB 2Y1EA 4OATA 4PC6A 2XD4A 5DEFA 1A98A 3N91A 3Q7JA 1NCUA 2FPUA 1XFPA 3MFFA 3QO0A 4B5KA 1BZYA 1XCMA 3DV2A 2B82A 1WUKS 4MKFA 4HX1A 3RR2A 2FRDA 4OGZA 2CMRL 4IDAA 5E9NA 1E98A 1XWFA 3OUZA 4E36A 1GSOA 4UATA 3BN9D 5DNWA 5C97A 4AMYA 4Y2OB 3KSMA 1H4TA 1ZK0A 1ZHHA 1NCWH 1ZXXA 3DBVO 4L3ED 4RF5A 3FRPG 3OR6B 4GUDA 2R27A 2IADA 5L2KB 2QADB 4EVNA 3UJAA 5CLFA 3FRPA 1OF0A 3ORHA 5TT0A 1GGBL 1FGVL 3WHE0 4H2AA 5CB8A 1DEKA 3A11A 1PGOA 1VBNA 3EF4A 4ODSL 5KVQA 1OBOA 1RC8A 2D7NA 1BM3H 4QHNA 4PIPA 3FNRA 3SBRA 4C1BA 1RRPA 1JNHA 3RY5A 2ARWA 2WF6A 3FT2B 1IZ0A 4GPTA 1EB9A 1OMOA 5J06A 4AP5A 4UB0H 2J09A 1R7RA 2OBNA 1JAXA 1NWCA 2DEWX 5AKYA 4HETA 3P77A 4BUHA 4AVKA 5IEKB 1I4TD 4Q9QH 1J24A 1F12A 2HPOA 5EN3A 1YUKB 3WMSA 4P2GA 1SN0A 1Z56C 2JJVA 2VRQA 4G63A 5I8OL 1JMZA 3VRJA 3OBIA 4EG0A 3TMAA 5T1DL 4PRPB 1IEBA 5DC9B 1YUMA 4BQQA 2XUIA 1M56B 2K4AA 1CXKA 2OLKA 3CEAA 5BXYA 3QIUA 1UOKA 3EXLA 2ZYAA 2ZEJA 2GN6A 3VWKB 4IVPA 3BAJA 3ZDWA 1T0UA 2FO4B 3B3FA 3CMMA 5BWBA 5I8EA 3G9AB 1HRKA 1QSEA 3JQAD 4KOBA 5I73C 2NQ2C 4ARBA 3NTLA 1I7RA 2H08A 5JTTA 2J1KA 4QTXA 1BVNP 4L4TE 1MFPA 5EDSA 3IIJA 2IXQB 4P86A 3UDWC 1FC1A 3LQ4A 1KZ4A 5EWJA 3KELA 1GGMA 2A5LA 3HMWH 4BWVA 1R0XA 2GO7A 3IETB 1SJMA 3JTSB 3MTRA 1Z4OA 4DDWA 2X4QB 3R19A 3A3NA 3K5SA 4B40A 1GFSA 3JCZA 3R4CA 5D2NA 2WY2D 4W5OA 4UD6A 3TVMB 4PSDA 4X8LA 3C7CB 2D31B 4KJQD 2XWZA 1ESEA 1E2ZA 1FGNH 3IO3A 2HU5A 4OO3A 3RLFA 1JA0A 4EK9A 1RZ3A 4UEKA 1MY7A 4MDYA 3QSKB 2EDNA 1XK6A 3DX8A 4MNQD 4QPPA 4IZ6A 4GSKA 4QRPD 1ACLA 4BH7B 1X7QB 2XE4A 1KCUL 3ET9F 1H8ED 3FSVA 1V5FA 2QGZA 3QCTL 4A15A 4HGYA 2B2CA 3HM2A 5E3HA 2ADJB 1RYNA 1N2RA 4KAQH 2XTJC 2ICEC 2FZWA 4YAFA 4C14A 2WJWA 2EP8A 3C74A 3QFTA 4BNMA 3IPXA 2YPLB 2H7VA 1UJCA 3G5ZB 1EFPB 4A2CA 3BS4A 1JIUA 1PD0A 2FWAA 2B5OA 3DMGA 1U7ZA 1MR3F 1QFWM 2Z0MA 4N3NA 4KO8A 3RJTA 1KTKE 1SYSB 4TWRA 1JK8B 4H1TA 4IX9A 1MNUH 4B27A 3QVVA 2J55A 3N8IA 1TPXC 4H6XA 2EKSB 5KVAA 2P65A 2Y6UA 2D2FA 4JXXA 4E3ZA 3ZDZE 5E1BA 4G43A 3FYCA 1HO3A 4FFWD 2FWBA 4ZCSA 2FATH 1P0SE 3QUXB 2IDQA 2QUAA 1MCRA 4PZCA 2QROA 5ELMA 2VXVH 2AR9A 5J43A 2DY1A 1TJHH 1EK0A 3O93A 4BUJA 1D6MA 2FOXA 2GTHA 4HIPA 2BCGY 2FWIA 2V2TA 5GGUB 2VHWA 1ZVJA 2APVA 3GG2A 2RALA 3AHDA 3Q5GA 3P9LA 4TLLB 1MX9A 3D1MC 4KG7A 3IO5A 1II8B 2X4GA 4XNXL 1QV9A 2W9DH 4GW3A 1EAMA 2FDRA 3NC0C 5F9JA 5IBTL 4LE1A 1VRSA 2VUYA 3QPWA 3NABL 4FQIH 2JJ8A 1SIWA 1GNTA 1UZAA 3D7PA 3QG6B 3TD9A 5ICUA 4Z3KA 3HKBB 2Z34A 4UUOA 4TV3A 3LS4H 1JXQA 3OHPA 3L6EA 1Q0XH 3MC0A 4NQDA 2YXMA 2UKDA 2IDFA 3PP3H 5J12C 4OJKA 3UGQA 1A7UA 5I9MA 4UTAH 4FSXA 3ULSB 5DM70 2QMQA 1JHYA 5FD8A 2YLHA 3HV0A 3E05A 1U2TA 4L4VB 1G55A 4B31A 4GGPA 1DCEA 1X1CA 1HQRA 4GPEA 1BXRA 5CTAA 3W1VA 4ID9A 1U8NA 4OQTL 3OQPA 3CG0A 3FWNA 2L18A 2Y7SA 5K0BA 1CBJA 4RE6A 1AR1D 4NV0A 4IIGA 3FUKA 3DZJA 2Q8PA 1WAEA 2YQ5A 2BNUA 4C4KT 1MI5E 1FV1B 5E4YA 4R7DA 1LO0H 3GLHE 1H6UA 3BCRA 4C7OB 2ZUFA 4WSKA 2H7XA 2OKMA 3JV4A 3NIGB 3PRYA 5KAMA 2X4NA 4BWYA 2UZ4A 5JISA 1A3LH 4MW6A 1NXXA 1ED3A 4JE0A 3P0GB 5C0DA 1XMEB 1Q7EA 3GMLA 1RYEA 3G7UA 4LFCB 3KL0A 5DVZA 1V16A 3UH8A 2QRGA 2R7NA 2UVEA 5JIKA 3FQXA 3AILA 1MFCL 1RC0A 3QP3A 4UQ3B 1Z0MA 1ZLUK 4FR0A 3F7OA 5DJ6B 3EBOA 3S28A 2Y9MB 3KVNA 1GZ7A 4HIJA 5I7SA 5IFJB 4GX0A 4O4LA 2YV1A 3KAKA 2J8UB 1JI3A 5GRXG 3MREB 4LLDA 4BYMA 4DHWA 1W0JD 3A6GA 5GGVH 1OFTA 1FX1A 3QDJE 5ALDA 1K4DB 1J2YA 5JVDA 5D7SL 3VVLA 2P2YA 1G9SA 4FDVA 5F9MA 4FG0A 4FNSA 4V1DD 1Q83A 3INRA 4LSTL 1VCNA 3U30C 1UK7A 2OR9L 4N2EA 5GIRB 4PLTA 4BX0A 4EYOA 4JFEA 5DX8A 2I4MA 1MCKA 1PJLA 1CQXA 4DREA 1GQOA 4JKLA 2Q3JA 4G1EA 2LWIA 3ARXA 5A16A 3NM4A 3ZBPA 2QBYA 4NXMB 2J6WA 3U60B 1H2HA 1NW7A 1A1MB 1RDFA 3SWWA 3S8WA 1B93A 2WAOA 4F8NA 2QLTA 4PYNA 2WIAA 1UXWB 1Q38A 2IP2A 1DEDA 1WP6A 1OCEA 2P5YA 5ULLA 2YDXA 4W99A 1Q0YH 5L3ZA 1YMMD 3K5RA 3MJ8B 4KWHA 1KJVA 4MH0R 1Z2NX 4DPAX 4IK6A 1JEYA 1OAOA 3CFUA 4C6TB 3RAJL 4LA4A 1I1AC 1MGPA 2GF0A 3LLVA 2VZEA 1ZBDA 4IJ6A 3VSCA 1RHUA 4YWGH 3Q9UA 2BP0B 1L2TA 2ZOSA 1O95C 3LPLA 3CBJB 4GUPB 4KZ0A 4YJ2F 4HPOL 3O6MH 3CLTC 1E3XA 3ILQC 1PV2A 4R8RA 4G5RA 3QC5X 1JSCA 4LMQI 1GTMA 3UEZA 3GJFA 1PKOA 1OA0A 5ALWA 5C4GB 2MPAL 5TPZD 1AZWA 1MG5A 1BXZA 1GJRA 4K5PA 3KH3A 2COKA 4JG9A 1PGRB 4PRPA 3K7EA 2ZG6A 3QHZH 5K3FA 4G6KH 3I83A 3MSXA 4JKMA 4P2QE 1N2CB 1XIWD 2MJWA 3B82A 4FC6A 1G20E 4M29A 2EHJA 5E5MB 5B4UA 3BK1A 3KGTA 4I88A 2D4HA 1KWGA 1PIGA 1FZKA 3KT3A 5K3CA 1EFHA 4UUJA 2GEQA 1KXTB 3Q9LA 4CM8A 3GNMH 1ZI9A 3GRKA 3WFHB 1N0IA 2IEIA 2DC1A 1AURA 1DBAL 4ZPVA 1J11A 2ATXA 1C3EA 4MV3A 3RYMA 6PFKA 3KLNA 2J9RA 3BE1H 2MDTA 1J9TA 4UMSA 4PAQA 1JTPA 5FYKU 3EYUH 1WRFA 4KQFA 4HUUB 4QATA 3TNDA 2PCLA 2ODEA 1GJIA 2FPOA 4PXAA 2W42A 1Y1UA 1NN3A 3TZHA 1CETA 4Y2GA 3MA7A 3NBMA 4D9NA 1I6MA 3ASYA 4ESVA 4JRYB 1N6HA 2ISCA 2I5YH 3S1LA 2AX4A 2WMPA 1FE8H 2CN1A 3SF0A 3OT1A 1SUSA 1QTSA 5BOPA 5DRNB 2Y77A 1CZ8L 2DIEA 2XUJA 1JT9A 3ES6B 4WH0A 4B3SB 1YOBA 2CDBA 5J3JA 1GD1O 3NIFE 5D96B 2CKMA 1DSFL 4ZQKA 4M9ZA 1F8XA 4RMIA 4EJ0A 2WB2A 2I1VB 5GPBA 2PYEE 1GQRA 5DD5H 1ZQ1A 3HEBA 3FTFA 4WUVA 1H0DA 2BVPA 5HIKA 3VDCA 3OX8B 4P08A 1XHFA 1BMFA 1D09A 1WMFA 2ZXUA 2BEWA 5JPCA 2WJPA 3QI9B 1JGDB 1MFAL 3V6OA 43C9B 3DVGB 1JV2A 1HEYA 3HYTA 3MUUA 3TV8A 3C5HA 4NHOA 5FOSA 4O0MA 4ALIA 1K8DA 2HAEA 1I0ZA 3VU8A 5I1LA 4JQIL 4R7NB 1R5NA 1QLWA 4XWOC 4OG2A 1MF2L 3HLKA 3PL6A 3H8SA 2AC7A 5E70A 3F5MA 3P9CA 3F90A 4ONGL 3BL8A 3FKSD 1H3UA 3OHXA 2EIZB 5CCGE 3BXGA 1N0LB 2DF3A 2CDFA 3N74A 3O0LA 2RKWA 2BS8A 1Q0ZA 2X0WA 2IDSA 3FTGA 4GJTB 2FPIB 3VR0A 3RFUA 4PUBH 2EKDA 1DVFB 1ZSYA 3AT1A 3V4PA 1KJIA 4NQEE 1C7JA 3E8UH 2BRRL 2JFOA 3WLTA 1T1EA 4HWKA 2X3BA 4N9WA 3DX6A 5I1KL 2O1AA 5THXA 2CZCA 3VFMB 3DC7A 4N85A 2Y9PB 5ERYA 1MZVA 2YRLA 3NPMA 4LCBA 3ROTA 3VU9A 3KHSA 3AV3A 3WLQA 2ZSIA 2O19A 2ZAIA 3WGYA 4PB9L 2C20A 1X4ZA 3GDWA 5A3JA 3OBBA 3H6JA 4NP4L 3QQ3B 1LQSR 1S4MA 4INAA 5HVWA 3ET4A 1LQBC 3OX4A 4AKQA 3N07A 1XCGB 4X20A 4QOFA 1F1JA 3QF4A 4PINA 4JI6B 4LGYA 1ISSA 2NXEA 2XQKA 4OOEA 3RWJB 4BEBA 3F5WB 4I4NA 2BJML 5F1OB 4B7CA 2Y2TA 3R5HA 2EVGA 4NCHA 5J1TC 2JFCA 1KEGH 1CBUA 5IV2B 3RFZC 2V6GA 1FO0B 1ESZA 3L13A 3VX0A 3MBWA 3UUGA 5A4DA 4GL2A 1NGXA 2H1PL 4DUVA 3T0AA 1JDNA 1QX3A 5CBAA 2R87A 5JSZA 2CD9A 3FW6A 3ZKAA 1T1IA 2E8ZA 3FX2A 2C97A 3B51X 4F2PA 4DV7B 2RJOA 3COWA 3DZKA 5AI9A 1T6XA 2ZSAA 3VXSE 3TJPA 3BFOA 1ULUA 4R01A 2ZWMA 2WIGA 4BLOA 1S5IL 4I50F 5D2NC 4ZW6A 3CVDA 5F1NB 1C7RA 3R0XA 4JLMA 6GPBA 5C5CA 4FXPA 1QE5A 5EQTA 2GM3A 1KGWA 1TOXA 4JQVC 1V3KA 1E89A 1NMCB 2WG0A 3IE2A 4PJ9B 2VYVA 1NJ9A 5LBIA 3E9TA 3MN1A 3EYOA 2VCEA 2BT4A 1IWBB 2YUXA 4TRNA 1SC1A 3VTTA 3CBGA 2WFAA 1JS1X 1UGNA 3PHQB 5DLEA 4C4SA 4OCSL 2EC9T 5FKAB 1GKKA 4I9NA 5HFNA 1OGTA 4YE4L 4YO8A 5H7XA 1UA6L 1M66A 2YFNA 2ZIWB 4L6IA 4KDRA 5J11C 1HY3A 4X7RA 2O3JA 4MNGA 3KKPA 1EEUA 2LLNA 3RQIA 4HT1H 2L42A 4KQWA 2XZCH 5EPMA 1OGPA 3WN5C 4RAOA 5H1YA 5BW4A 3FQRA 1Z5OA 2FWOB 2B9BA 1KI7A 3CEMA 1Z0UA 5KVEE 4TS3A 4BUZA 3ZQKA 4Z76B 2Z3WA 2WYIA 1EDZA 3LT1A 4XR9A 2Q0XA 5SV4A 2MR6A 1L7PA 3ELDA 3FT4A 4UQ2A 3KZMA 4M49A 4XM0A 1Z0KA 1PGNA 1M2WA 3K20A 5SWSB 3QJUB 3VX1A 8MHTA 2CYAA 4G2AA 4Z4IA 3FAWA 1U8AA 1S7WA 1U3VA 4AMZA 1PZEA 3SR0A 1GOGA 4IYJA 4TS1A 1J8HA 2ATKB 2M1ZA 1QYGL 2NY3D 3CK0H 5D3QA 3V2AR 5TQ0H 4KN9S 3SF8B 3KQHA 1GPH1 4K9QA 3AQDA 4MGZR 1RJYB 2IWHA 4NCAA 3CIOA 2Q7OE 1JYEA 4KFZC 1R4NA 1J2RA 3IFNL 5GIRA 1Y6RA 5ADOL 2G17A 5A9RA 3PFWO 3NIGF 4DDVA 5HYSA 3MV9E 3QKTA 3H65A 3ED1A 3JASA 3EMVA 5E99H 4PJEE 1JG7A 1IGYA 4GECA 2ICWJ 4D80A 3LKDA 2BR5A 2EO1A 3AVTA 1AHNA 1I3CA 2B1AL 1G1AA 4I18C 1ZXKA 3HZMB 4ZTEA 4JLAA 2D3JA 2D8KA 2BCJQ 2B4AA 4L6AA 5JYDA 1P69B 4QXOA 2H0FA 4OHYA 1JAIA 1IT9H 1IQ0A 4PJ8C 1TKCA 5JHAA 2J8UF 5BMFL 1XDDA 1OH5A 1TU4A 3RRZA 4WN9A 4Z9XA 3UADA 4XQ9A 3AY3A 3SXJA 2MHCA 1KBBA 5T5QA 5JQWA 2GZ2A 4NNOA 3L1HA 1X44A 1REQB 1ZGGA 2DPKA 1S2NA 4ZMQA 3AMKA 4U33A 4CNQA 5CP7A 4JJEA 2RC5A 1OTTC 4HH4A 1J5HA 5HIJA 3DURA 4PRHB 5TPWH 4L6CA 3HI6L 3AG3B 1NM5A 1EGJH 1OV4A 1N1EA 3ARQA 4IMLA 2OS7A 1W91A 1OSPH 3V5DA 4G8IA 1QZ1A 4IU2B 5DEJA 1KPVA 2BIPA 5LJLA 4PY7A 1O96A 2QDKA 1WHSA 2O8EB 3CZ9A 3LL7A 2IODA 2EKSA 2YINC 3M86A 10MHA 3HA0A 3NGMA 1AZTA 4MTCA 4TRRA 3FHEA 2BEJA 3KFVA 1LPMA 4F2GA 3RC2A 4KQCA 3HCVB 2YKLH 4LLUB 5IHWA 3S5LA 3Q3EA 1SFHA 2LU7A 3OIGA 3G6DL 4UTBH 4ZSOE 1TZ8A 1Y6KR 5KC8A 4QJ5B 4XJSA 1MB0A 1E4EB 2D1YA 2DGDA 3WMGA 2RQ8A 1MEOA 3NB0A 4OLBA 3EWNA 1UAAA 4JUTA 2ZBQA 1GRNA 5TS3A 3LWZA 4EJSC 4EVNB 3KYOB 2X58A 3BP4B 3BJZA 3N2NA 2C9AA 5E5RB 3DMPA 2OM2A 3R8CA 4UUNA 4F9TA 4P07A 5AMXA 1L9QA 4O9HL 2P24A 4ND3A 3HCBA 1NDQA 4KO1S 3LZRA 2W59A 2FBJL 1X7ZA 5HXAA 5D72L 5PGMA 3C7DB 1NC3A 3D4BA 4ES8A 5CURA 1S1CA 2VDOH 4Z7OE 1NASA 2DJIA 1QQDA 1AGPA 2BZCA 1VYTA 1ZPUA 1MQSA 1W581 2P90A 3UGTA 2ADFH 4HKJA 4OJNA 3FDFA 4W6WB 4H16A 2AJSH 1BJ1H 3OIWA 1U42A 1XKLA 3G8YA 2O8CA 5C08A 4JP1A 4I1IA 1Y7VA 5HJ3B 4E31A 3C4VA 3R06B 3S34H 2IZ6A 3AF3A 3TF4A 4J2TA 4YCNA 5DYOB 2O48X 2BFEB 3OV6A 3JPYA 4O4YL 3NCEB 3JARA 2Y68A 5AW9A 2E46A 5CFOA 2SNIE 3UAXA 1EYZA 2OHXA 5EKDA 5I1JH 3VH8B 1A9QA 4NCJA 2WZAA 3CQ9A 4KUZH 2CJ3A 4W81A 5IXJA 1KU6A 1R3KB 4ODVH 4YPVA 3MLYL 4PQGA 2E6QA 4A23A 1TB4A 3D7KA 1TK9A 2YLKA 1WUJS 5ALJA 4KR9A 4ICWA 1CY8A 5AVXA 1IC7H 5ALSA 2Y1ZA 5C0DB 1E0DA 4MJ2A 3TGLA 1XB8A 4ALAC 4LF9B 2GTIA 3ZO9A 1WW3A 4OLFA 3O4FA 5JBIA 2DS4A 4ZC1A 1WDKA 3DMNA 1R6DA 2C0PA 4NRYB 1CU4H 3WP0A 4PNHA 1WZAA 1TTBA 3IPFA 1CD1B 2VS1A 1UDCA 3AJAA 3FMGH 4GKLA 1UZ6F 2BFCA 5HPMA 1PKXA 1GGIH 1TT5B 3QFJD 3ROKA 3W04A 3A47A 1UJ6A 3RQSA 4A6YB 1SVBA 2CALA 3DMHA 4TUYA 1M8KA 1AHIA 1WDWB 1ZJ5A 4FTVD 3FOEC 1XBRA 2DY0A 1M0SA 2N7SA 4R2IA 2Y9RT 1A6UL 4X6FB 4NBVA 2J67A 3RANA 3DLHA 1JNYA 3LUFA 4DIKA 5JQHC 4EI0A 1XCTA 2YAEA 2VDQB 4UUMA 4V38A 1L7IH 2KX7A 2V9QA 3KG2A 1XTQA 5FWXA 1GG2A 2ZJ4A 4BV1A 1ZRNA 2VABB 4OT1H 2X86A 5CVUA 2UZYB 5JYLA 1YS7A 3RHWK 4WNAA 5ES4B 4XGNA 2AI1A 3BLPX 5GPRA 3RZWA 4CVUA 1T9GR 3KPLB 1CLCA 3T0GA 3QYCA 1XNQB 1K6XA 3SN6N 2ICCA 1M67A 5C8JA 2QM8A 3OJMB 2ZAGA 1LLDA 1FEZA 4Y9EA 2X4UB 2VP6A 3HJUA 3A2MA 4XP1H 1T5IA 2R60A 3TSCA 5J13B 3T5GA 3F46A 1M34A 5IJVB 1VE5A 1Y4UA 2R00A 3S68A 3NC4A 2H4EA 3VXMA 1DP0A 3QMMA 1NXOA 1C5DB 4TVUA 3KHOA 4KPYA 3VQTA 5MP6L 5C5DA 1G1OA 3N5AA 4EDWL 4KO7A 2AJDA 4K7FB 1D0SA 1QHOA 3OOSA 2VAJA 4ZARA 3PF9A 5HSFA 5HCUA 1VG0B 2C4XA 3OQ3B 4K28A 1ZTXE 2BTQA 4YGYA 3T08A 5ETJA 2PYEB 3RC3A 4KQGA 3SJVB 5LIPA 3DV6A 1MIEL 2V8OA 2BKXA 4B43A 1A6WH 2Q1UA 3VAAA 4GRWE 6ABPA 1P4IH 5FO7A 2EAEA 1Y9EA 1HNZB 4LAQL 4R16A 4Z7WE 3UJNA 3PDIB 3VTZA 5I9SA 1PJWA 4FMPA 1C4XA 2FJHA 5D5HA 2AFNA 3PWPB 4YSDA 1HOXA 1M2OA 3WJLA 1DCMA 4B6OA 3N50A 4JRYD 1L7TL 4FLFA 2MCG1 2G60L 35C8H 1MH1A 1XP5A 3S40A 1DUYA 1EWYA 4JR1A 1XXLA 4K9RA 3T77A 3VXUB 2AJ3A 1F6DA 3V0VB 1S5PA 4K8RB 3TLJA 1E28B 1AMUA 5KTMA 4ZO9A 3JVDA 1F11B 1HYSC 1Z73A 2NY2C 4MDIB 4Y2LA 3IPCA 3FFXA 3DKHA 3OKNB 4HDOB 1INQA 5CLLA 3WUWB 2Q49A 3BUYA 4HQQH 4B48A 4DNOA 4YOKA 1UBMS 2PIDA 1QBAA 1RNLA 4PN6A 5CM8B 3WKEA 3QJHB 4MJIB 3V0AC 3FOFC 3WTBA 5EIIA 4LVUA 1WV7T 3LZQA 4S1TA 2A4KA 1LO3H 5IVXB 1ECFA 3H2QA 3HJ0A 5F7JA 2YAOA 3IDJB 3AXTA 3DP7A 1ASPA 1T80A 3H1GA 4Q12A 4KXZH 2VZ9A 3TS1A 1VGKB 4G5ZH 1RKQA 2LAAA 2PRIA 2XNKA 4V02A 4PJIB 1EK3A 1MAHA 4OIIH 2QTEA 5K9QI 1NVXQ 4CG2A 3S8MA 3U9PH 1QSFB 1SZDA 3TH5A 1U58A 1ZHBA 1NRIA 2JVUA 4G5HA 5EP1A 2WSMA 6PAZA 2IV7A 5DBIA 3B38A 2P45B 4G0NA 3GLDA 3FO0H 2GJ4A 2CDFB 1ZVKA 3PUIA 5BVGB 1M7DB 4I08A 1B6SA 1ACJA 2X2EA 1QFHA 3B1ZA 4APQC 2WKQA 2EATA 4OCNC 4Q4LA 3DKRA 1PJ9A 3JZIA 3DGEC 1VJCA 1AKYA 4V03A 2RQEA 3KVQA 4JSTA 3ZDQA 3DC0A 3G23A 1E0AA 1CD8A 1I2ZA 3PGFL 3BHNA 3SEFA 3JV0A 1A7NL 3TUIC 1IVLA 1KLUB 1ZOXA 1VRVA 1OB5A 4DCVA 4NPJA 3MGCA 4HS3B 2I78A 3WDLA 4POYA 5KDOA 1UJ3A 1BMFD 5D7LD 1XDGA 4KQ6A 4UBDC 5FDFA 1AZSC 2L0XA 5F7KC 1Q2XA 2C07A 3G3LA 2NUBA 4LLWB 3GLGA 4EM6A 2PRSA 3I5XA 1XNJA 1P2CB 5JW4M 1QBLH 3UUFA 5SWQB 5F12A 3MTGA 4AT6B 5TPWB 1OLOA 1TZJA 1GYPA 2EDWA 4HKJB 1LMIA 1KYTA 2F3UA 3QDGD 3DOUA 4K03A 4MR8A 1YECL 5DCLA 3RUDA 1RK7A 4ZPTA 2OMXA 1W46A 4V2IA 4ELMA 4JHBA 1XZLA 2QVMA 1GXEA 4ETNA 1JVBA 1KBPA 3O0RL 3GZOA 2RMNA 1ST2A 3OZ7A 1KN2H 2E47A 2BRUA 4X93A 2OV1A 4EX6A 2NNRA 4LV6A 5EO9A 3P45A 3QWAA 3DPIA 1F0NA 3MNWA 3ZDAA 5DK4A 1ZOSA 3TLAA 4Z23A 1DI0A 3THXA 1OQXA 2LVBA 2EYQA 1DADA 4O2BF 3UIEA 4B73A 5IDXA 3NVKI 4S11A 3EO0B 3DOIA 1LVEA 1JN6B 1K5HA 4J2QA 3OLVA 3UXMA 4MKHA 3ZYJA 2E7MA 3ZDFA 1DKRA 1M3JA 3JQAA 2XGOA 1CQJB 1DBKL 4MCYB 1KR2A 2TECE 1IOVA 3RJ5A 5D71L 1EK2A 1NF2A 4I1OA 2E6KA 3HWWA 1RSFA 4QYXA 3AR7A 4JS7A 3GELA 4PPFA 1MVOA 4K4KA 3W2IA 5I71B 1S4QA 1JHDA 2H6PB 4A6YH 5DI3A 3HHPA 1TEZA 2ZRMA 1H0KA 4YFLF 2J3MA 1JKIA 2WC7A 1XIVA 4F1ZA 1GAJA 1D2RA 1RM5A 3X1XA 1QKKA 4OP1A 3EYOB 1Y7LA 3CXDL 2PS1A 4GRDA 4JAMA 1NR5A 4C7JA 1F90H 3NG5A 1CLZH 3WFJA 4GXVH 3DXAB 3FB7B 2QTCA 3HMXH 3BXFA 4XNDA 1KSHA 4F46A 3B3IB 2CNDA 5I0DA 3L0PA 3K8LA 1G21A 2O2JA 2R69A 4XNZB 3D6NB 4C1NA 1ZJYA 1KOFA 1HNNA 4HX1B 1NAHA 1ZJJA 2EXYC 1NQXA 2A3TA 2GAZA 4DC1A 2VLRE 3SE9L 1DOAA 1KV3A 621PA 2A2ZA 3RBZA 1SDAB 1XCWA 1I1RA 3IAFA 4NCBA 1H3PL 4KQ0A 2CLVB 3PNSA 4XZUA 3KL4A 5KU1A 4FFYL 1VLQA 2C2XA 3TEXA 3IDMA 4S1RH 1N57A 3ZDDA 1J8MF 1FRFS 3KJZA 4WHMA 3MRIA 5KOVC 3R23A 3ZIUA 2DI8A 2CXSA 2E3VA 4L28A 5H9VA 3CRRA 4JG0L 5M7EA 3HU5A 1VL1A 3K31A 3B9KB 3U4AA 3KPLA 4OHRA 2VLME 3WIHL 3NNDA 3L01A 3Q2WA 5A2IH 1G7IA 2C88A 3L1EA 3TN0D 4AV5A 1OARL 1MDTA 4BFZA 4BNNA 5EMLA 4S1SH 3IGAA 1G0YR 3GEFA 3Q40A 1K3FA 2BC4A 1PKQE 4LBAA 4KJQC 4XWYA 3MQIA 3R7AA 3HE7B 3P4UA 1QVAA 4G9BA 1KDIA 4HG4K 2GSMB 3OPXA 5GOTA 8OHMA 1ZZEA 4GSYA 1KJ2H 3FQ4A 1W7AA 3TPZA 2RIRA 2JAHA 4JY5H 1G5PA 5I76B 2VTDA 3N0WA 3LSOB 1LO4H 2OULB 4KHXH 1GZDA 2H3KA 1HOCB 2GN1A 1JI2A 4OI7A 1EIBA 1VLMA 1VP9A 3SS8A 2ZIZA 3SZLA 4KRPD 4Q37A 5DYGA 3AX6A 4F5ZA 4RMVA 2FWJA 4N0CC 2I6SA 1I8UA 4MUMA 1HZKA 2AQKA 4YEDA 3LRSB 3BPNC 2Y23A 3CQQA 3LW7A 4YAQA 1QLEB 3EGIA 3OKCA 2GEEA 1CT9A 2R44A 5FGSA 3RK1A 2DQFB 4FE9A 1QC5B 1TTRA 4Y2YA 1DG9A 4F4HA 1C7QA 5BO1H 1GADO 1E2NA 4QBIA 4LK2A 2GRAA 2FQQA 1S89A 3SE9H 3WFBH 1NH6A 1E3IA 3GRVA 1BJ8A 4AL8H 1DQSA 4XO5A 4JOCA 4XVCA 4IOSA 5A02A 4HDQB 1PHRA 4RAUB 2GHQA 3DLCA 4OLVH 4ZGBA 5FGBA 5BN5A 1AFVH 3G89A 4XIYA 3VXTA 4IYRA 4YDRA 3LPOA 1AHKA 4NJEA 1G4AE 4NYLB 4CU8A 4ECEA 3D3VE 3NHMA 1ZTMA 2WNKA 1OXYA 3GINA 4B2IA 2XTJE 5FOXA 1VKXB 4YAWA 1QRND 4QUEA 7REQA 5IROC 2ONYA 2PWEA 2VYFA 1CUSA 3W9DB 4DTIA 3EZXA 3ADDA 1Z9NA 3FZNA 4XVUD 2YMPA 1KJWA 1U5BA 4WAFA 4A6YL 4CC1A 4M7LL 2QUIA 1AY1H 4NWUL 1K9VF 1ORDA 2WIDA 3AMLA 5F33A 3S7ZA 1SOQA 1AU9A 3RRFA 1GAFL 1VHLA 1EX0A 1NV8A 3LEVL 5JO0A 4O3MA 4W9FC 3HS3A 1KC5H 1RWNA 2HREA 3OBAA 4WOJA 2ZOKA 4DUYB 1KB3A 1CR9H 4YR9A 2R1WB 4P46D 7AT1A 2OMUB 1EFVA 1CGWA 1IUZA 2HK7A 3DNKA 4D0GA 2P26A 3BTUA 3MACL 5EZ6B 5IJAA 3LGAA 5JD5A 5LWHA 3I02B 1Q0EA 1MC4A 5TQJA 5AW2A 4R4NC 4PS8A 3KS0H 4F7TA 4YUEL 1SU8A 1X9HA 3BWZA 5EOCL 2PR4H 2YRBA 3PHCA 4LXTA 4R7XA 4R0LA 1X5JA 1E5BA 3QFJA 2ZWKA 1O5PA 4WE3A 1I9IL 2H1XA 4YHMH 2R2GA 5HDBB 1NBMD 2X4TA 2R11A 3UT5B 1T6VN 1FP4A 4HK0A 4K9EC 2R2AA 3BGMA 3MHZA 1L5WA 3P9RA 1W85A 3KVRA 4FG6C 4FMCB 4K5MA 4MA4A 4Y2DA 3BHIA 2FF5A 2AXHA 3D5OF 3L3BA 4QUDA 4PJGA 1DT3A 3WR5A 3VC3A 3A4YA 3OEHD 1CFVL 2BWJA 1NAKL 1MH5B 1DBBL 5EHNA 1ELOA 4R5MA 4O5AA 3QJFB 1D5CA 1QA9A 1EXNA 3O4OC 5K0ZA 2HPAA 5EOCH 2OAEA 1ZVVA 3Q6MA 1U3WA 3IAUA 4G83A 4EN3D 3VGDA 2M8XA 5LBSH 3PGFH 1A9BB 5IGXL 1VA4A 5ITZB 2CK2A 1TYAE 4X83A 5EJFA 1WUTA 5KQSA 4CMCA 3N8DA 1N25A 4LZPA 1CR9L 1SQSA 3ANYB 2R1ZA 3DQZA 1KXQE 4LDAA 2FEEI 4OZGB 2X0NA 3RU2A 3E7FA 4CW7A 2YK1L 2CDCA 3GVIA 3AK4A 3FUIA 2QM3A 1J48A 1OAZH 5MN4A 4PSKA 3U2SA 4WY8A 4ZV9A 1GAFH 4TMYA 1I3MA 1N59B 4D26A 2CVFA 4TTSA 4J3OF 1XZ8A 5F7EH 1F8GA 1UZ8B 2XWRA 5ALEA 2R69L 3AZQA 2PW1B 2DI7A 1FZQA 1HNWB 3AREC 2FH8A 2BJVA 2C9BA 2XRAH 3OQIA 4ZIRB 3DD5A 5F97E 2DFLA 1QASA 2JF0A 5IBUB 3S9DB 3ZHFA 3BZ5A 3ASVA 4UM7A 3WDMA 3WMFA 1RADA 4Q19A 2BRUC 5KVFL 2H32B 2WB4A 1ASOA 4TL6A 4MA1C 1HL3A 4M6NH 3ES6A 3BKCH 3O6FD 5KKAA 4QR7A 4GINA 1R10A 1E7MA 5I0ZA 1MORA 2BJHA 4KKAC 2PD4A 2HJGA 2CLSA 3CNNA 4IG9A 3O8RA 4Z4EA 1L9KA 1SOXA 3EH4B 1Y89A 2HSJA 4ZZ0A 1RYDA 1HMYA 4S1VA 5IM7B 5J5EA 1RZGB 3ABLB 1N0UA 2IPMA 1E3ZA 2QE7A 3C5XA 2D7TH 3ZL4L 4TV9F 4TL5A 3BUQA 4G5GA 1O7DC 2ZWOA 4D8UA 1S7UB 1P2BA 2G76A 2WKPA 1PSWA 2MTBA 1JHZA 1T9KA 3I72A 1AI1L 1B0PA 5HY9B 2VRCD 5CFAA 5A06A 2OZNA 3G6JE 4WWPA 3PJFA 1KQ3A 1YQXA 3CR8A 1IN4A 4W9KC 4KHXL 2L7JA 1BXRB 4B7ZA 3MINA 4CIVA 4RZKA 5ANMB 2W07A 3TOCA 35C8L 2X9VA 4KR6A 2IYUA 4UU1A 2NU9B 2XPZA 4G0YA 3CFKB 4GRLC 1DIHA 4L75A 3C6KA 2UUDH 3QX8A 5EUOF 1QZZA 5B3JC 2APJA 1QFOA 3W90A 1TKWA 1KBQA 5CFZA 4LAQH 1N64L 3R3YA 2DQGL 1OARH 2X4NB 4KKAD 2Y2WA 3DZBA 1ZHNA 2ED7A 1Z22A 2FPGA 4HI0E 5IKPA 3ZK8A 2FA9A 1Q4NX 4C9BA 1JDDA 1UODA 4Y1GA 1DC3A 4AKPA 5JAPA 4KXYA 3GMTA 3OOWA 5BR7A 3FQXB 3VFMA 4I50B 2FFHA 3FPHA 1WV0A 1T1RA 5K93A 4GLJA 3EYFA 1X5HA 2C2BA 1IQPA 3N2ZB 4P2BA 3L54A 1Q94B 2K7FA 4EL0A 4PJ7B 3ZDXE 2IYEA 2NY0C 4FM9A 4IGAA 3D54D 3OURA 5TDNB 2JAXA 4WVRA 1T2UA 3T6ZA 1MN4A 2FCRA 3H97A 3OL2B 3SBPA 4MGEA 4D81A 5JMOC 2IOQA 3Q48A 4QT0A 1CJTC 1UACH 1TEGA 4LVOB 3WHE1 4YBLB 4WEQA 3CN2A 4O2BB 2EYRA 5E1IA 2P30A 1T2EA 5CJ8A 2FUG6 1JHXA 1TMCB 3RYTC 4XVUA 2FN9A 1TC2A 2BVEA 3T0ED 2B5WA 1R2QA 3IJHB 2E55A 4KKBC 2ZXQA 2HO4A 3L1FA 3L7FB 2H17A 3CU7A 4GRWF 4K8RD 4JB8A 5BN4A 1NOIA 4KO2S 3CPJB 2JTYA 4K05A 3S27A 1UZMA 3D0AA 1JEDA 3KYOA 4I48B 1PN3A 5K9JH 2JH9A 5JOPE 4XVOA 3VXUA 2WA2A 5A16B 1JQLB 3RJ9A 4DABA 4YLBA 3L7EB 3VG9B 5C1DA 1D8AA 4OHWA 3ZN6A 2NZ9C 4K6GA 4M61A 4OT1L 1CUGA 3QKRB 5EUCA 3RUEA 3RX9A 2IV2X 5L3SA 3RKPA 4PANA 4JELA 1GOTA 2HRCA 3V97A 2O1EA 1NMXA 2XW6A 2PBLA 3ARGD 1KPRA 4NQCB 5GZ1A 1JDPA 3IP8A 2PO7A 2CF6A 4N65A 2VYVD 2IYAA 4DY6A 4KTDH 3B83A 3KOOA 4QTZA 3CC1A 1G6KA 2XQBH 4WGWB 1ZLWH 1E8MA 2NYUA 4DJTA 4RBPK 1BYNA 4CQMD 3CTMA 3IMEA 1RLMA 4XCYB 5LWYH 3B6SB 1P5UA 2DOCA 5B1CA 1KP2A 5K8VA 5I6DA 2YAHA 3ACBA 2AMFA 3ERCA 1VGRA 4PJXE 3K9BA 3KYBA 5ID0B 5C08E 1OV8A 2IANB 3O0RH 1TTQB 1NN5A 2VDMB 4B7LA 4Z7WB 5ALMA 1UOEA 4EG8A 1ADWA 4GIAA 3BE4A 4W5QA 1AM4D 1E5QA 3UJHA 2IALB 3DSRA 1UOWA 4BFBD 1UG9A 2OBXA 4JBSA 4GP8B 3FPKA 2V3WA 1RKUA 3P3UA 4E9WA 3GFFA 1G7RA 1XRMA 2RHLA 1NGZB 3D18A 3SFTA 3UAWA 4UZGA 2HDWA 3FB8B 3AI1A 2WPNA 4IXDA 4AUMA 1XD9A 3N44B 3SCZA 4ZVSA 5CLTA 1PWHA 4KO5A 2E9GA 1A4RA 3LAWA 4RQQB 4KWEA 2PP8A 3HBAA 4JZNB 2HYDA 4UQ2B 3WDIA 3D31A 1S7XA 5DC0A 4PGBA 4HUVB 3P0JA 3HB3D 4UMDA 1A7NH 2IHUA 2VXCA 3NM6B 1TQBC 3HFFA 3SOPA 5A2QA 2PKRA 2EEFA 3F4BA 4DEUA 1KGSA 1W0KA 3PNLA 2PX8A 5BR4A 1G9EA 4FCTA 2A6DA 4N3AA 1YNOA 3WMEA 1M3IA 4Z8FL 4YRBA 3AJEA 5D7BA 3RPKA 4LEOB 1S5HB 4C58B 5E2WH 3THMH 3KKQA 1YNKH 1MHPH 2R79A 1QQ6A 4DW8A 3WEBA 3HRZA 1JUDA 1JW9B 1WB4A 4D9CA 3NG1A 5IESH 1R0BA 3SB3A 4W5HA 3ZTTA 5I0XA 2P67A 4DCGA 3MFYA 3LYHA 5J6HA 4EI5D 2J59A 3I92A 1HV8A 3B2QA 4MAUL 1S3FA 1AXSA 4ZFGL 4OD0A 1JQEA 4PJXB 4HAYA 4R2WA 4HJEA 4YWJA 1DXYA 2G30A 5IULC 1QA9B 4U6VL 1U8JB 3GHPA 4RSGA 1U4OA 4J3FA 1NW8A 3T4EA 2FT8A 5E6SB 3E81A 2NW3A 4KH9A 5ECJE 4KC3B 4R84A 3ZY7A 1X9GA 2JGMA 1QTQA 3G0CA 3N0XA 3UXEA 1U1IA 3JQ7B 3W0WE 4ZD3H 4L02A 1VCIA 1QZXA 4QRRD 8CGTA 2B3DA 1J9GA 3PKZA 4LLAA 1SCUA 4YIHA 4WFHD 2F6AA 1CEXA 3WO1A 3R7WB 1Q1PA 5EPOA 2OPHA 4XUDA 1DO0A 3VGAC 5F1OA 3UROR 4N1EA 3D6MA 2ZF8A 1AMXA 2YW2A 2TMGA 1KTIA 1YACA 2VYND 1URLA 3GMLB 3GT4A 4WFHE 1E8NA 1FNGA 1BBJB 4CU7A 3FTGB 4QJ4A 5GS2H 3MUGB 3AFOA 5KYUA 1U8MB 3S37H 1EAOA 5CLHA 3TZLA 4D9MA 2JD2A 1OT2A 1D0VA 5ERGB 1BPLB 1SGWA 3H6GA 4ZIRA 2MWCA 1P19A 4EYQA 3CHRA 1L5KA 5H4ZA 2XTMA 4N8SA 4YBRA 2QDXA 2XB8A 1NQUA 2C34A 4HGWA 2LCIA 1LSOA 4HUQA 1X2EA 3AWDA 4JM2F 1U8PA 3IILA 2Z93B 4BLSA 4JQXA 4QGAA 4BQ6A 1XMPA 1JYVA 5DO2C 1ZI8A 1FNDA 3A1FA 1X7WB 1YQEA 1A7QL 2Y7NA 2D00A 5IWAB 2ZP0T 1G4UR 4OM8A 5I6KA 3SE3C 4RABA 5DKFA 4LNHA 5F2EA 3PDOA 5BXQC 1CQIB 3APFA 4Y67A 2DMRA 3RWDA 1HL8A 1M7XA 1F20A 4P4KB 5HDRA 2VOEA 2EJWA 3H9YA 3HI1B 3WBJA 3NHSA 1SBSL 3KDPA 2XN1A 1FMTA 2D5LA 3OG9A 2X6RA 2AJTA 3SYCA 1ESCA 3Q3CA 2ON6A 4DESA 4BFOA 2VSXA 2VZ1A 1U3GA 3IETA 2WSYB 1SLVA 5KVDL 1UJ5A 3IUJA 1H0RA 2Y69B 4UUAA 2AJ3B 5CBPA 2CHVA 3O3OB 2CHNA 5JAHA 4PYKA 5E2UL 3KEQA 4BHUI 3DB1A 4L50A 1G8JA 3LVTA 1LPPA 2LQRA 3OZEA 5D5PA 2IQAA 1TF4A 4L05A 5AKZA 3WHPA 4XP1L 2ZSDA 4AWXA 3ZDRA 4ZT1A 4G6MH 3N2JA 3QUAA 5KSBA 4DO5A 5L4MA 2FT6A 3L3IA 2NNFA 4ZTPL 5F7LB 2HBRA 2O0HA 2YHAA 4HS6B 1JF8A 2DKMA 2X8BA 4B45A 2JJ2D 5C34B 1GAWA 4BUGA 3W5BA 3JQEA 3RYCB 2WIJA 5JNUA 2XDQB 2R0ZH 3EXG1 2ZCZA 1BNCA 1LQTA 1AUPA 1RP9A 3D8TA 5CK4A 2WXIA 1KI1A 3DJ9A 4Q3LA 1G17A 3M82A 5BYBA 4A6DA 1L1QA 1X0VA 2HRGA 3H2YA 3CXFA 4O4IA 3WBDA 1E61A 1A1NA 3AFIA 1EINA 3O8LA 3MBOA 2X05A 4KXFB 1LX6A 1CY4A 3P32A 4G8FA 4J4PD 5CHNA 1WQ3A 3IF1B 2HA2A 4N2HA 2R15A 4CVZB 4BA8A 2YHSA 2IRWA 1R15A 3W9EA 3G8AA 3LV8A 2HJLB 1WEJL 2WSLA 4DA9A 1WAPA 1C5KA 3G5VB 1A9XA 1NC2D 1AHWA 1P4RA 1Q74A 4BCXA 3SICE 4Q9AA 2NTNA 5DSZA 2PBRA 2ZCLL 5H16A 3QEMB 1QOKA 3FBTA 2NW6A 3AP2A 4GRIA 2P5PA 3AXLA 5JSHA 3DG9A 2W6CX 4PGMA 1UFUA 4KRYA 4HUXA 1FDRA 3RS9A 1KF0A 1I3OA 1Q1JL 3GUTA 1P6WA 1EP3B 1AKRA 3AAZA 4LFBB 5DD6B 4BQEA 5AW8A 1NANH 1H9AA 5A7FA 3T5PA 4M98A 2CIIA 2X2HA 1T0IA 4W70A 2IHVA 4R1QA 1GSAA 4LKOA 2HOQA 4QHKI 3WLPA 1GNLA 1J8HB 2ATKA 4MJHA 4X6FA 2NQTA 4LOUC 2FP3A 1GZ4A 2BY0A 1WMDA 1LSSA 4CC4A 1YRYE 1RZPA 1B43A 2RHWA 2ZKHL 5JAQA 2AUTA 1KYIA 3PGJA 4OKSA 4P4KC 4UHEA 1HXYA 3H85A 4ZI5A 3QVGB 3OHMA 4IF4A 4LBEA 4KQIA 2E0IA 1PS3A 4I5DA 4JMLA 4LZLA 1TKRA 4L2IB 4DJJA 3BGFB 1QO0A 3Q2LA 4IIJB 3FVWA 2AQ2A 1BDJA 4XSHA 1ZLSH 4L0YA 4Q14A 1MLBA 3HCVA 2AJSL 4C4KO 1C9DB 5KOYA 5K3OA 2D8AA 3A31A 4ZI3A 1Y37A 3UJ8A 4XWGA 4FEGA 5AXCA 3UUEA 3QKRA 2Q7YB 3UV7A 3VKFA 2ZJ6A 5F7AA 3RC9A 1Z5PA 2H4FA 2UVDA 3OQJA 2JRLA 1P3DA 3L2MA 2MR5A 4PRYA 4PQFA 1P7YA 4X45A 2WWRA 5HE8A 3IGFA 3G08B 2CXKA 3EC2A 2ECPA 2HLEB 4YBHA 1VCMA 4LLMB 2C9QA 2V3FA 3THYB 2DR2A 1F60A 3CN0A 1PBYA 4F9LC 2ID8A 3QU7A 4LSVH 4WL0A 4DNFA 1PNOA 3W3ZB 2LLGA 1BXUA 1MD9A 5JOPD 1C30B 5COQA 5DT2A 5D85A 2CKBA 3VX4A 4HF5H 4ZSOA 5CJQH 4KVFA 3ILPB 4UAVA 3D12B 2EFGA 5FOTA 5CIPH 1X1QA 5GS2D 1FAIH 1PZ5B 3DTYA 1MAMH 5GZOD 4B3BA 2C2HA 5FORA 4PHXA 2BNQE 1TQ8A 1UM5H 2ZT6A 2RGSA 4WHYH 5AG8A 1DWQA 2P8JA 5KYWB 5TDHA 4TV8F 3UERA 1GFZA 2A1IA 4RD1A 2HK8A 1PLCA 5J11B 4ZMPA 3WN5A 2HRZA 4V1CI 4DSYA 1M1NB 3WRYA 1AT1A 4KWIA 1ZLDA 4CMEA 3BIKB 4OJEH 3SHVA 4OEHA 3PUXA 1FE8A 2Z8ZA 1XDUA 1YULA 1BMQA 4YGVB 1OT4A 4YRLA 4FG6D 1T7XA 3OZFA 5CT4A 3HWSA 4URFA 3MHTA 4M62L 4AG4H 3O2DL 4XC1H 2PXYA 2B34A 3HI6H 4XAKD 4PGBB 4W1RA 3KLAA 3KH4A 3RVPA 5B39A 1NMCC 2J3KA 5JS2A 3T7TA 5ICGA 2CNLA 5DP2A 2NZWA 4B4KA 4U1SA 2WWTA 2BNRB 1R3JA 5ER6A 2X1PA 5IMLA 4G8BA 4OVUA 5GZOC 1VG1A 2Q21A 3ZD6A 2WVSA 3TIFA 4AZ0A 3JWDH 1K68A 2G9KA 3VU3A 3ARYA 3GVPA 2C2YA 1TJGL 3A6LA 5MI0B 4LCIL 3IVMA 2L69A 4ACAA 3DS8A 4J4HA 5DGTA 1Z7JA 2HT3D 2W6OA 4P4TA 4Z99A 2QQFA 1RUQL 1YNTA 4NJMB 1VEPA 2DLFL 1U8CB 2ET6A 5IB1B 4JBXA 3MJRA 1BVNT 4L8CB 3DBLA 1YYML 3NXKA 5E99L 4PR3A 1H3NA 3F3KA 5HQ3B 1FMFA 4EEZA 1YR7A 4WI7A 1H19A 1ZM3A 4R0MA 3UC0L 1P8JA 4BNTA 3HJBA 4OUUA 1BE1A 1RZRD 2PYIA 5IFLA 5C0GB 3RPBA 4BZ1L 3GGWB 1N2CA 3OJ2C 3F8WA 2AJLI 5FQNA 3BE1L 1MV5A 4QO7A 3MU3A 4AY3A 4R5XA 1GGJA 5C8XA 3WADA 2HJHA 4LF4B 5IKCA 3EUDA 1E3MA 4JW3A 3IKJA 1RZQA 4NPKA 2PTGA 1MUJB 4OB5L 5H94B 4NNJA 3R44A 4AY5A 1E9BA 1NUNB 2P11A 3ZOKA 1B3BA 4LC9A 2L17A 3WJ1A 5EOTB 4FOMA 2CLMB 4YMGA 3NTOA 1QAWA 1W49A 1C30A 4NM8L 1P1BA 3VNRA 4J3UA 2XIIA 4GWGA 2RB8A 1GUBA 2IPTL 3KM2A 1UEIA 3MWEB 6REQB 4IL5A 3MJVA 4DLYA 5AKIA 2Z1MA 1TTHA 1P61B 2IQAB 4INPA 1XF5B 2P43B 1RQGA 2NSMA 3H1PA 4TMPA 1U11A 5TFSL 3GTVA 4OH1A 1MVUA 1W52X 3A9UA 3HNTH 3K4AA 1BDYA 2G06A 1NTDA 3HYNA 2JLQA 3O6ML 4DC9A 3Q5TA 1XWWA 2HF8A 4ZAFA 1MA3A 4AM8A 4KVCL 3VKUA 3CC5A 4TQAA 4WBSA 4O02H 2PUFA 2WBLC 5EUOE 3QYJA 3ZK7A 5IXSA 1ZT7B 1ZWIA 4BE9A 3GUCA 4JL6A 1QSED 1RMYA 4CIBA 2QN2A 1I8LA 2YMMA 5BXFB 1XSIA 3ZXIA 2X0JA 5K9OB 3IGUA 1YZNA 3QDHA 2P4QA 1IXZA 1H42A 4RVHA 3D3VD 8AT1A 4GKKB 2IKSA 2OVBA 4BK5A 3DIVA 2B6NA 3HUJB 2W91A 3TBTB 4RSYA 2R29L 3PWPE 1OH7A 5AK3A 3Q8BA 3B52X 2FMXA 4CVZA 3CUPB 2ECFA 1Q1AA 4D0BB 2PBFA 3QG7L 3UTPE 1V1MB 2Y66A 1I1AA 4BCZA 1SXGA 2HP4A 2CVHA 1YVLA 1ADGA 5K6AA 2CC2A 2XZLA 3SQRA 2PWGA 5B1DA 1ZD2P 2OR9H 1HDEA 4LV5B 1SXQA 3RRYA 4UHBA 4KZKA 3SMQA 2YHUA 3RURA 3IDIB 3KXIA 1YJ5A 4GRWH 5HIMA 1LVHA 4PCLA 2QTWB 1OCRB 1WTLA 5BMVB 5I8ZA 3HE6A 1KFJB 4D5EA 4YSSA 1A2YA 5BUAA 3RGVD 5JJBA 1NU8A 3MJFA 2Y76A 2IO5A 2VZOA 1B4LA 1EFRA 5HYQB 1RUQH 3QDJA 1V7NL 3T7KA 5DZ9A 3OJFA 1ITBB 4YK7A 1U5AA 3B9VA 4JCCA 1PZFA 5HGAA 3B9AA 1TJGH 3UW1A 1X7TA 4JQYA 3TQCA 1ZK9A 4V33A 1M73E 3TF7C 2C92A 2DR0A 4F6CA 1FW6A 3A1CA 3STTA 1ZRUA 5H81A 4AWBA 3DHVA 2PUJA 1BX2A 3SJZA 1WPQA 4XPGH 3JWPA 3F58H 1NDGB 2G9RA 4P34A 3LHAA 4CTNA 2Y99A 4URTB 3HUTA 2QEQA 1YUHB 2CO7B 2DD8L 1N5YH 5BT9A 4ZFZB 2FN4A 3P9KA 3T4YA 4HDRA 4QHYA 5KVCA 5JIMA 4EFKA 1GRCA 4ZMYA 4ODUA 2C2WA 1ONNA 4NKOA 2X6UA 3BOSA 4R1UA 4P23B 2ZJ5A 2A0UA 4N01A 2HWZL 1E27B 5CDSA 3MRDB 2FV8A 2BOBB 3W8NA 3X1BA 4BK4A 2DMCA 2IE0A 1TDJA 3TLBA 2WWMC 1VBFA 1W6RA 4K3UA 2O3QA 3TO4D 1YQGA 1CXLA 4OQNA 4LLVA 3T3NA 4N3BA 2ZBVA 4ZZ3A 4HLQB 3ZE1F 4BO5A 4PAOA 3FA2A 1UM9A 1HT0A 1RXSA 4JQIH 3U6XA 1QU2A 4QIRA 2IIJA 3K9QO 2VKWA 4Q7QA 4TWBA 3G5UA 3CLSD 3SZ6A 5JO5B 2ZUUA 5C9ZA 1IEHA 1CPUA 2IH3B 1Z0DA 4OB7A 3CA8A 8LDHA 2YWFA 4D0LB 2Z1DA 2VBCA 2QW8A 2YD6A 3C6YA 4I6GA 3B1TA 1U04A 2CVZA 1PEAA 4KRGA 4LCUB 4LP4A 4UCXA 4OZ4B 5FM5O 5DHVB 3MRJA 3NRJA 1ATZA 4JXJA 1WWBX 1XLTC 4F37K 5DISB 2OFOA 2AXGA 3CZJA 1FSSA 2M83A 1KTRL 3ZZUA 4ZW5A 1O5OA 2QQEA 3RVRA 1J06A 1I7UA 4P46C 2W2KA 3WK4A 1NC4B 4JCOA 2X4SB 4NUMA 2IWKA 1VIYA 1PL0A 2R23A 5K39B 4ZUSB 1N8NA 2OTWA 3KXPA 3AI7A 1Z06A 4KN5A 1OZAA 2YWCA 4PYIA 4YAUA 3NGBC 1ADJA 5CLQA 3SC2B 1Q21A 3BIJA 3PE4A 3I8SA 3FRJA 1E62A 3FT4B 4MKRA 1M2VA 2EEZA 4CM9D 2YMOA 4J3JA 4RIGA 2PWZA 3O73A 1SK9A 4G0UA 3P9QA 1RJDA 4NU5A 4XPIB 3HZVA 3OC8A 1FHNA 4EIBA 3KT8A 1Z35A 2W2OA 2Z9CA 5E2IA 4JB9L 1TM2A 1IM3A 4BH8A 5I1HL 4NSKB 2NZ8A 1EP9A 1KEPA 3FPFA 3QG6A 4PRIB 1T04B 1CS4C 2V3CC 4R0VA 2H6PA 1E9DA 3ZNOA 2HKHL 3K2UL 4HXBL 2B0JA 1JZ8A 5SWQA 1E9EA 1ZC3A 3QUCA 1Q1JH 4YS6A 3GCGA 4NBNA 5EP4A 3V5KB 4UVEA 3BB3A 3OSUA 2IXFA 1AANA 1MTZA 1FGNL 4KYTA 7TAAA 3JSSA 3W2HA 1KIAA 1R1CA 4PMEA 1LNUA 3FO1B 3DCYA 2ZCLH 3UBTA 2AQQA 4PAZA 4MZRA 1T35A 2RR3A 3CX5J 4PRBB 2KMLA 3PZBA 2BNUB 1Z3RA 5HWSA 1XEAA 1NW6A 2ZT7A 1BAFH 3V8VA 2JD0A 2DICA 2Y1KA 2V6JA 4KMMA 2XOTA 1FNMA 3BUBA 1NN1A 4GBGA 5A3SA 5DGIA 3RVBA 4NBXB 4YTEA 2DAVA 2DQHL 2HJFA 4TN9A 2UZ1A 3IUNA 3GEWB 1CJCA 3UJIL 3PDHA 4R4JA 2QY9A 1YBVA 1ZWLA 1C3OB 1IEVA 1EFQA 4HBGA 3N8NA 4L5FE 4K7FA 2E4ZA 4JANB 4NFSA 3P27A 3L08A 2VUOA 3EQZA 4LC1A 1YRKA 1ZXLA 3AONB 4G9DA 1PZHA 32C2A 3HG3A 3FT1A 3MRRB 1XLVA 3VO9A 4G7VH 4NUGH 3GCWA 4DCNA 2Z1NA 3RWFA 3JQBA 3HZRA 2JGDA 1TCCA 4H44C 3R77A 2H48A 4BX9A 4G6ML 5KJ1A 1SMDA 4OIBA 5DHVA 4KJPC 1URIA 1W2HA 3ULAB 2PMDA 4NJAH 4MNQB 1YQVH 2QLNA 4F8OA 3FNQA 5GONB 5SZHB 3G8CA 4PHGA 4LBWA 1DCFA 2Y8EA 4BKLA 4JJ5B 3IV9A 4IDQA 1T25A 1I7TB 3IT8D 4F6RA 4MAZA 3I5AA 1DN0A 4LY6A 2IVFA 1D5ZA 4AUUA 5ANHA 3EFDL 1H6FA 2YV3A 1F17A 2ZYTX 4A38A 3SBDA 1ZH6A 2P24B 3SDDA 1L5HA 3TPFA 4MDIA 3SYTA 5BZZA 3GGJA 3KYMA 3WAGA 3E2HB 3HKFA 3RRQA 5EE0A 1HDZA 3ZC3A 1INQB 3DF7A 2MCPH 1AQYA 4Z9KB 3OJDB 3C3KA 3BGVA 3IKCB 4U1LB 2OQIA 3MIZA 1N3IA 3BYYA 4YAKA 1U90A 1JPTL 3S2YA 1HLDA 1B2LA 4OZFH 1O8BA 3GS0A 2APXA 1IN6A 4KODA 2XTJB 4D41A 1LO0L 4DJMA 5GGRA 3Q1LA 2GPAA 1PZSA 2W94A 1MG0A 4FHEA 1PY4A 2Y05A 5JXEA 3FFCB 1ET8A 3O2DH 1UWKA 3RYHB 4RJKA 5ALCH 4PP1D 1NAIA 2YFQA 2BM8A 4RAVB 1FUEA 1NCCL 3PWTA 2O4CA 1BHO1 1W8NA 3RO7A 2JLRA 4BPRA 4S2SA 2FUEA 2DXIA 4GEJA 1PGJA 1EBAA 3TVMC 3E18A 3G49A 2YUWA 2MU1A 5EMNA 2F3TA 4BWUA 2GZDA 3WD5H 1GJWA 3RJZA 4IRJC 4LEEA 1ZANH 2EDHA 4DEVA 4JBYA 5GIPE 4MNGE 2VLRA 3LDFA 1RUKL 1JHUA 4HH1A 3PLAE 4D94A 2CM6A 3TC9A 5AVVB 2QRUA 1IBZA 4F8EA 1PR6A 3O1LA 5FLEX 1Y0LB 5EZJB 3B78A 1QDEA 2NACA 1M7UA 5DA4A 4A5SA 1D2HA 5BSEA 4TUKH 1MEJA 4EGFA 1Z9SA 3PFKA 4MQSB 2CO7A 2CYCA 2MIIA 3NEYA 1MAAA 2HL6A 4O4LF 5SX4H 2YHGA 3R6WA 2W9DL 1YMMA 3L4BC 2QGCA 4BWTA 1XSJA 1DWPA 3AUKA 2KDGA 4TVPL 4AEHH 2OX5A 2GI4A 2OZEA 4LAJH 3HA2A 2GVDC 4F8PA 5AKGA 2FNBA 1M2JA 2QIOA 4U6VH 3G5AA 1NM5C 4XR4A 5F1YA 1AZZC 2RGAA 2CJWB 1YS1X 5IT2L 3T0EA 5T67A 2WLKA 1UQUA 2VLJD 1OPGH 4CL7A 4PBXA 1KCRH 1H5BA 4P2RA 2DECA 3C6QA 4XMVA 6NULA 3W3BA 3QWRD 1UOPA 3U44A 3QFHA 4ES6A 1G98A 1Q3TA 1W2GA 4XMUA 4LX0A 3GZPA 3AVOA 3GHEL 3H05A 4AU1A 2P8SA 3GYBA 4J0JA 1V7CA 1OE3A 1FL5B 2QZQA 4JJ5A 3HFJA 3P3TA 2HNKA 3QS2A 4GSUA 5C37A 3I5YA 3VNSA 5ESQB 3MRSA 1RXLA 5I7FA 1ZVNA 3UAEA 2X76A 5A71A 1W4RA 4JOSA 5FWDA 3TRIA 3E4DA 2XA1A 4MA3B 3JYBA 2W48A 2QADC 5IHUL 2VLJB 4F58H 2ERJC 4ZK2A 3LKVA 3MELA 4MNHA 4Z3GA 6AT1A 4H5SB 4LGRB 1JN6A 1AD0B 4HGPA 5HJ7A 4QHNB 3ULUF 5IF0B 3DO7A 1GY8A 5K8CA 1RMQA 2V7UA 4AZ8B 1RHFA 4YUAA 4XEUA 4MD4B 3DI3B 3UGJA 4Z7AA 1FZMA 4E51A 4JYCA 4DJAA 3L9WA 3WGMA 1JAEA 4CMIB 1KCUH 5B37A 3ID6C 1WTGT 1CNEA 3LY7A 3OZBA 5TGTA 3U3MA 1M5TA 4WOPA 3VAZA 3LNEA 4LIPD 1TW2A 2AAVA 3ZWWA 5BOSB 3K8YA 1JFLA 3QVKA 2PQ0A 3C7AA 4HDCA 3DX6B 1EAPB 3L1IA 3ARED 4M5ZL 1FNBA 4Z7QB 4QDKA 5IQ9A 3PDJA 1D9KD 3MOBL 1OVMA 3CIAA 4QZVA 5IJZA 1NUGA 2R8BA 4XRCA 2E27H 4G11A 4N8CL 4OHMA 4MQ6A 3EVAA 4UBOA 5C7XH 1JFQL 4Y4FA 4UFOA 1PR5A 4EO9A 5CNHA 1TQHA 3MM4A 3IDGA 3B1JA 1KGDA 5JR1L 5C8ZA 1QHHB 3RSFA 5ILOA 1LNSA 4E5XA 1U2SA 3D51A 4ADJA 3VCLA 1XAUA 2BWDA 2KYIA 3BKYH 4FTVE 1LLAA 4BXOB 1L8AA 3H19A 4K9LA 1SIUA 2XTNA 2VJ8A 3RFCA 3UV6A 2RG1A 4BINA 2VLBA 4MB1A 3ZVLA 2D2CC 4RTPA 3NIGE 3CH5A 4YALA 4AS2A 3CNKA 5DO8A 5DUMH 2JFUA 2DDQL 4X1OA 5K5YA 1R18A 5LA6B 2WO2B 1I9JH 3KR3H 5KTYA 1S02A 1KVUA 1VL8A 1KY4A 5F52A 4PVMA 3TW4A 3U3ZA 5LDHA 2Z08A 1WUNT 5JH7A 3X12B 1R8XA 4DOHE 5BZDB 1Y6GA 4Y7DA 1IAIH 2FZ3A 3TV3H 4QRBA 1T6BY 2K6YA 3CH7A 4LDOB 4U1NB 4H6VA 2C3YA 1KKLA 5FPYA 2IZ7A 1UDRA 2VJLA 2YEQA 3IESA 1J33A 4LV8B 5F9HA 1DC6A 1E5DA 2O7RA 4MEAA 4DUGD 3T7CA 3FU7B 1KL7A 4DVGA 5D1QE 3ED5A 1FZOB 4DLVA 4FHBD 1Y1QA 3KW8A 4DJEC 4WCYH 3FH5A 2OBMA 3GUHA 3MFGB 1WGVA 1KMQA 4KFUA 1XZNA 5IM7A 5GRVK 5IVXA 1H5UA 4FB4A 4OZHE 1Y6QA 2X44D 4BNUA 1Y3AA 2BW0A 3BFVA 4C59B 3E7WA 1IARB 3K72A 4OBBA 1TZHA 2WJAA 4UXJA 3Q15C 2CDEA 3LNFA 4HJGA 4D9QE 5I7UA 4OLYL 5K51A 1KAGA 1M0TA 2ACEA 3GRWA 5F7UA 5AW7B 4DERA 1HH4A 3E5HA 2DWYA 3ZTJH 1JECA 3TCLB 1P31A 2WQZA 1RW4A 2I24N 2P2CA 4WIAA 2B59A 2GY5A 4BLWA 3BAKA 3F65A 3EXEA 1U0BB 4KHPB 2VK1A 4J6FA 3DGDA 1BWSA 1FFPA 3D9AL 4EDXB 4HZAA 3BH9A 3OCXA 4CPDA 3RTAA 1TQVA 4WKGA 1F3JA 1U8KA 4ZAKA 5ALHA 2OWDA 3QPUA 1GZUA 3FBWA 5B1HA 1R5IA 4H3VA 2NY1C 3QFCA 1CCZA 3OAUL 2AVGA 4RFNB 3QE3A 2NSHA 5B7EA 4PJ7A 4NQTA 3BP7B 5TC4A 2XUDA 5SX4I 4FADA 4IRZH 3DXAD 1QPPA 3FRIA 3MB8A 3V4VB 2AJ8A 3D33A 2C54A 5L0QC 3Q13A 3WWYA 5EJ4A 3NLLA 3PIQB 1CIPA 3VGPA 4FVTA 1S4IA 2YCBA 3FCCA 1RWQA 3STVA 3SYKA 4XPBL 1OXVA 1V3TA 1JKFA 3ZW8A 2WXJA 5AHKA 2R7EA 2VR5A 1K8YB 4MXQC 3ZY5A 4CBZA 4XNMA 4P4KA 2IYTA 4K7JA 1KI9A 1BVYF 1KDRA 1N2OA 3AM8C 1FUYB 3LPGA 5JRDS 3Q7EA 5ED0A 4HWTA 3UP1A 3P1JA 4X62B 1EEZA 4ZFNA 4X4YB 4M7ZC 4JDPA 5JXEC 2XRAL 1EANA 5DMKA 4B46A 5EFIA 3RASA 3GB9A 2QVKA 4GMSL 3STWA 4GX1A 2OMYA 1P1HA 2B21A 1J9EA 1HH9A 1X2BA 2JVJA 3DZGA 2HM7A 5DYTA 3ARTA 3GSUB 4HQNA 4WW1B 3TFKD 1K5DA 1S8FA 2V6IA 5GHWH 3OQMA 1GPDG 3OJDA 3R9IA 2V5UA 3KQTA 5IMLB 4KQJA 1MIOB 3FCTA 3TFWA 3QE0A 3DJZA 2OCKA 1SC9A 4CSTA 4OXYA 4HQLA 1WU8A 1RKBA 2ITCA 2VJQA 3IB6A 4AN4A 1AE6L 5D96C 4BNHA 5T1LD 1ONQA 5GONF 3OT5A 1PBNA 1TYBE 5C0JA 4EQ6B 4PGDA 3T0XA 2H92A 3QNUA 4DLSA 4X6BA 5E8PB 3KMDA 1N75A 1TVHB 9CGTA 2AFHE 5IVZB 3DEZA 1J1ZA 3EPPA 1E9OA 2PSEA 3ABOB 1AOHA 3DTDA 5C70A 1T3SA 4A1FA 4CMMA 3VDAA 1YH3A 4DKAA 3G2HA 4I3SH 5B53A 1WFOA 1TG8A 4B5LA 2AN4A 2FSEB 1AXTL 4HCRA 1C16A 3G5VA 3PTAA 4UAJA 2B59B 1OI4A 3I5MA 1CQZA 4ZJPA 3UL4A 5J9PB 5LWYL 5EIVA 3G0OA 4Z9YA 4CV2A 1EG2A 4YMWA 3WL3A 1SHSA 3JQBC 3JY6A 2NVOA 4OJDH 4NOJA 4JYMA 3K0AA 4ZUVB 1NWOA 4G86A 4NYMQ 1NBME 4TSRA 3F6SA 2V6BA 3A23A 4K88A 4LVHB 4BCCA 2YGQA 3A1NA 3FDWA 4QA9A 4DLKA 2XCRB 3IMGA 3M5DA 3ORFA 1QYRA 2CJUL 4NYJR 1AQDA 1SUIA 1P2GA 4RCZA 5JQ6L 4YQEA 5KTTA 1SRDA 4MV1A 2O4EA 3BKML 1SOUA 1YI0A 1RZ8B 2XQJA 4H26A 3OPQA 2Z8WC 4X9IA 2G4VA 2ID9A 3OKEB 4WKBA 1EMTH 2OSBA 5IIEA 3NFRA 1GUFA 4YPGB 2EEDA 4FNLL 4K23H 1T10A 3MOQA 3G2MA 4AQDA 3P02A 1D3CA 3T15A 1HT1E 3EYVB 3P69A 4URKA 5IVKA 3O0TA 3CFJB 3LIZA 4ZMBA 4EOWH 5F9OL 5C09A 1P5JA 2XN9D 1SEQL 2C2MA 2EO9A 1LWNA 1G6RH 4I9UA 1C3LA 1NMBH 1T21B 4QYSA 4GG6F 4Y9TA 2VDNH 2BINA 2PL9A 2IEDA 4HPHA 3MLUL 4DA8A 3MV8D 2EERA 3W2GA 4GB9A 2ZXGA 5HMLA 1QGUB 2B1HL 4PJEF 1P4LB 4UAHA 2AH5A 2PX3A 3PRHA 3TRJA 2VQEB 3OECA 4XDGA 4QXMA 1DZIA 3NCCB 5KJRH 2VXTH 1UACL 1JALA 1SA0A 3U6RA 4YVNA 2C2OA 4EEXA 5ALOA 5ABAA 4AL8L 3TNLA 5F7FA 4GP7A 3WFBL 4IRSA 3PT5A 3HUDA 1E9CA 4DXDA 5SWZA 1JB9A 1NDMB 4IXNA 3ES9A 1EM8A 3B53X 4Y1EA 4NHUA 3H9SB 2WUBL 1L6RA 4I9GA 4YMSA 4JAVC 4FBLA 2PMFA 4H7PA 2I60H 1LBHA 2JZOA 4FYTA 4EATA 4R1TA 5CLYA 3IERA 3GMSA 1U99A 4OTZA 3RVJA 4R26H 4EWLA 2DY2A 2I4TA 3I74A 2H1VA 1C1DB 3S8FB 3FF7A 1Y4AE 2Y25A 4KK6D 1NGPL 1HETA 3V7NA 2FF7A 3MV8A 1JJIA 5EIWA 4F8JA 1NEPA 3AHHA 1NTRA 2FR4B 4Q15A 1IU9A 1IUOA 4P7BA 1N8ZB 4I8DA 4GNKB 4U2DA 3GRWH 4PWEA 3DDUA 5C5IA 2P48B 3KU1A 2OAGA 3VSEA 4Z1OA 4WFQA 1VLZA 1ORIA 1ADQH 1T5WB 3VZQA 3WQQA 2ZSEA 3MJDA 1OR8A 4DFDA 3DEKA 4U6HA 1HE7A 4X63A 2CWWA 3BWUC 3FHAA 4JVSB 5D3MB 2BVPB 4EW6A 3RZCD 3SNKA 4NNPH 2OCJA 1H0DB 2DQDH 4ZG1A 4BPBA 1L3WA 4XMKH 4PZZA 6YASA 3APNA 4KXLA 1C50A 4PPQA 3BDIA 4D9KA 4QG3A 1RU3A 3EZNA 2JJYA 4JT4A 5B38B 1FFWA 4CM7A 1NKOA 5AW1B 1BSVA 2ZE6A 4HJGB 4N7JA 3UFXB 3GIWA 4WMLA 3F7KA 2J6IA 4U5QA 1UM8A 4X91A 4YRAA 3I9AA 5FWYA 1WBYB 4FNPA 4P99A 2G71A 4Q4IA 1F8UA 4FFVA 3R76A 4N4AA 4QGSA 4KQXA 4ICIA 3IJSB 1HG0A 3DFFA 1NBQA 4HL6A 2YWZA 3GVXA 4GKZA 3H54A 4KROB 3QA3E 5AW3B 4NQUA 3NJRA 1B6RA 2X4OA 1L6IA 3BJLA 4PV8B 1M33A 3KSUA 1JBKA 3AEUB 2J48A 3I2KA 4BASA 2BDNL 3E8VA 2R6FA 2CZQA 4IDFA 4A8TA 1TVBB 4EI5A 1SKQA 4PTTB 1TFPA 3RSSA 1CS0A 5I0YA 3WGVB 4POAA 3KQUA 3SC2A 3C2AH 4Z7UA 5KNCA 1UBCA 1UD2A 5TMPA 1M7IB 2C2GA 4KE7A 1DVUA 4JFSA 1SEBB 4LCCB 4WKPA 1HM5A 3V4VA 1VERA 3BO8A 1SY6A 4NDNE 2QAGB 3ND5A 2I2XB 2MSNA 2YPLD 2GD1O 2HU2A 1RIHH 1S7SB 2NTFA 1J97A 1SZNA 4AZSA 3EIWA 1Y6ZA 1UXOA 4YV2A 5L3RA 1U8UA 1DAPA 4Q4AB 1M9WA 3OUTA 3NJJA 2K0RA 3VGJA 1T7WA 4EHJA 2OT3B 5DCUA 4G1FA 4O08A 2RJNA 2Z8RA 4AJNA