3ZDZB

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
464
structure length
464
Chain Sequence
b'NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
molecule tags Cell adhesion/immune system/peptide
source organism Homo sapiens
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
total genus 111
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3zdzB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3zdzB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3zdzB03
1PD0A 1NA5A 3N2NA 2VDPB 1SHUX 1L5GB 2VDRB 4G1MB 3EGXB 1SSLA 4M76B 2O7NA 4GZ8A 5E6UB 1M10A 1XUOA 1PCXA 1BHO1 3PPVA 3M6FA 1UEXC 3TW0A 1U0NA 3F78A 4HQNA 4A0QA 2VDLB 1L5GA 1MF7A 5HGJA 3VI4B 4BJ3A 3ZE2B 3QA3E 4WK2B 3NIFB 3ZDXB 3NIGB 2VDMB 3FCSB 4G1EA 1CK4A 3F74A 4HQOA 1ZONA 1RTKA 5ES4B 3K6SA 3EG9A 1CQPA 3AL8B 3NIDB 1JEQB 3TCXB 1T6BY 5KYUB 1YUKA 1MQ9A 2VDOB 3TVYA 4WK4B 2UZYB 5KYXA 5E6RA 4WFQA 2VC2B 4CNBA 1MQAA 1M2OA 2M32A 2ODPA 4MMXB 4Z7QB 3EGDA 1OAKA 4CN9A 3OKWA 3OKYB 3AFCA 2QTVA 5HDBB 3EFOB 3NVQA 3IJEB 3ZDYB 3EOAI 1SHTX 2I91A 5KYWA 1MHPA 1RS0A 4PN7A 5E6RB 4G1EB 1AUQA 1PT6A 3TXAA 4C2AA 4C29A 4F1KA 5E6SA 2WINI 4O02B 4HQLA 4Z7OB 3AL8A 4IGIA 1JV2A 3ZE0B 1QC5A 4XW2A 1PD1A 3IJEA 3PPWA 2NUPA 1T0PA 1M1XA 4WK0B 3V4PB 3FCSA 3ZE1B 1V7PC 1BHQ1 4MMXA 5HJ2A 3EGDB 1JV2B 1QC5B 3PPXA 2ADFA 3RAGA 3FCUB 1OLZA 4F1JA 4O02A 3K72A 4UM8B 1M1XB 2ODQA 1N9ZA 1ZOPA 2I6SA 1U0OC 4NENB 2WW8A 3E2MA 4G1MA 1ZOOA 2NVOA 1RRKA 4UM9D 3BQMB 2VDKB 4Z7NB 5KYNA 4WJKB 3OL2B 4UM9B 2P26A 3K6SB 3EH2A 5E6SB 2XWJI 1U8CA 1IJBA 1AO3A 5LN1A 3K71B 5KYYB 1U8CB 5KYUA 3IBSA 4HQFA 3K71A 2P28A 4O3TB 1SQ0A 3V4VB 4FX5A 5KYYA 1YVPA 4MMZB 1RD4A 3OL2A 2X5NA 4NENA 3EH1A 1SHYB 4C2BA 2NUTB 1ATZA 1YVRA 2VDQB 1IJKA 2NUTA 3ZDZB 1JEQA 1JEYA 1JLMA 4IHKA 4O3UB 4HQKA 3ZQKA 3T3MB 4IXDA 3BQNB 4MMZA 4CN8A 5KYXB 2IUEA 3Q3GE 3BN3A 2XGGA 4FWWA 1MJNA 1DZIA 3EG9B 1IDOA 2VDNB 3PPYA 1XDDA 1IDN1 3EOBI 3EFOA 1TYEB 4NEHB 3HXQA 1JEYB 1LFAA 1DGQA 2I6QA 3T3PB 1N3YA 5BV8A 4JX0A 4DMUB 5E6UA 5KYWB 1QCYA 1M2VB 4MMYB 1AOXA 3HXOA 3AL9A 1M1UA 1FNSA 4K3JB 3GXBA 1MQ8B 3HI6A 3K72B 2ICAA 1XDGA 1FE8A 1Q0PA 2NUPB 4MMYA 3EGXA 4JDUA 2B2XA 1M2VA 3VI3B 2XWBF
chains in the Genus database with same CATH superfamily
3K2IA 4LHUB 4WHCA 3VXSA 5H94B 1U8KB 5FR3A 1YCFA 1EXUA 2PVSA 2H3NB 5EEZA 3L46A 3FB5A 5KTEH 4MUFA 1RUMH 4NKQB 3IBCA 1LLAA 2WYVA 1UWXH 2X86A 3GIZL 3H9YA 4PNPA 3U1SH 4D9MA 2B83A 3BWXA 3VYOA 3QVKA 1IZYA 4MCYA 3GMQA 1SU4A 4I08A 2NOAA 4GXVL 1V6AA 4DA9A 4FL4B 3UHJA 5JNRA 2YHSA 4BO4A 1PD1A 4BE7B 4I66A 3GJ8A 4R51A 5A5EA 4AY3A 1ZX1A 3EIWA 1ZEAL 3H5VA 3GSRB 2HEGA 3QJOA 1A4XA 5FUBA 4N87A 5BY2A 1JXDA 2WZ5A 4XVTL 1BKSB 3JT2A 1IC5H 3RVUC 1NVKA 1W88B 4K94L 2ZXFA 1RFGE 3FETA 4YCMA 4F4CA 1Y5NA 2WVAA 3MR9B 3TQCA 2AQNA 2Z6QA 1K5NB 3O2DL 3RTAA 3GOQA 2V55B 4PJ8D 1GR1A 3P9LB 1WH0A 4PJGB 1CLVA 4N2CA 2BZGA 3BWZA 3WN5C 4XZUA 2P2ZA 2YUIA 4D4JA 1SDDA 4M83A 3V7AE 1IXSB 4YR7A 3V6OA 3D85D 1ZT4B 4KQ9A 3MV8D 3TRJA 2OTWB 1G4MA 1CY1A 2ID7A 2XZPA 1FO0A 1PU0A 4KBPA 3FNQA 3ODGA 1NCDH 4CVNA 3FQYA 4S1PA 4PG2C 3QVGB 4DMGA 1U8IB 1WE2A 3RUGA 3K0CA 3BULA 5ICFA 4DC0A 1IVLA 1MNUL 4LT7A 4Y5YB 1SHJA 2NCMA 2QL7A 2XQKA 4FYWA 4X7DC 4KU4A 1ACZA 1CRPA 4Y5XA 4IHJA 1KPVA 1KU6A 5IJ9B 2E9IA 1N8KA 5K3FA 3TEWA 1ZI6A 4QCIB 5IOPB 2V5YA 4LHEA 2EJUA 4HDRA 3OH8A 4ZYVA 3RYIA 1NTDA 1ANKA 4QOJA 2ZUBA 4YBHA 3BSHA 1C9YA 4A8TA 3FZEA 4WA8A 1BX0A 5SZJA 1TTGA 4EZBA 5AI6A 1MT0A 5D7LA 3TT1H 5HW0A 4IEIA 2AZ4A 2VL7A 1U0RA 4K8RH 3IJHB 1IJBA 1B2RA 4ZMWA 4RJIA 2QMUA 5DLQC 4KWEA 3BILA 4L4SA 1LE5A 3GFOA 4EFKA 4M53A 1VFUA 1AR1D 4QYOA 3D2LA 3TUJC 3BJIC 3GMDA 2XX0A 3X13B 2QR0B 3BL5A 1DQML 3M6XA 2GSWA 2FQGA 1T7ZA 2OBXA 3QZWA 3RDJA 1DTWA 1O89A 2Z34A 1HI9A 4FP8H 2DQMA 1WAEA 2R27A 3KDPB 2OC4A 3TFOA 5IW8A 4OHFA 4F2MB 3GXUB 3WP1B 4XNAA 4YAKA 5H70A 5BMFH 3ESBA 3ST7A 3F5DA 4GL4A 3OMXA 1E65A 4BMOB 2F7RA 5JPNB 1CR9H 2FEEL 3US0A 3JV7A 2OLJA 3MGTB 1SM4A 1YR3A 3U3OA 1RYYA 1HSAB 5SY9A 1TECE 4F3YA 3ZCQA 3PQFA 3AT1A 3ZV3A 4HWPA 4WIAA 4X4MA 5D7HA 2VKXA 3S4YA 4F96A 4AENA 1XF4B 4FHDA 3GM8A 2BRUA 3IAM1 4ML3A 3AQDA 3QCVH 2K3HA 2ZTUA 1IM2A 1JG4A 1I4TD 4Y2RA 1ZRUA 5EOCH 3HEBA 5KW9H 2J6IA 3IFLH 3LY5A 2LIPA 2QJFA 1WD8A 3QEKA 3GUUA 4U8GA 4FP8L 2FMFA 1FRNA 1EX6A 2R7AA 2XV2A 5EIHA 1CI3M 3I6GA 3LDUA 4XOUA 4E9WA 3QPUA 3IUYA 3PWJA 1RVDA 2NZXA 3WKMH 4YXLL 3MT9A 2XLLA 2I4LA 3JALB 2D1YA 4XWGL 4BEJA 1QP8A 4DIDA 3HU2A 3PF8A 2M6KA 3DE5X 1JPFA 2LHAA 3P11H 2X89D 2LT9A 3FFCB 4NUGL 2J3HA 2EDNA 1P7KA 5JADA 3P02A 1XN1A 5DFVD 4D43A 3ARDC 3SWWA 3E9ZA 4J39A 5EEWA 3OPNA 3WGGA 2I25N 4RVSA 4NQRA 5E03A 3GHHA 3LCMA 5I0ZA 5GSRA 1SXIA 1UUSA 1M10A 4MRMB 5GZND 2HJGA 4HQNA 1DSFH 3CZQA 1SMKA 1U3JA 5INDA 1YNOA 5TQ0B 2F58L 2H7XA 2YMTA 5BVGB 1JHVA 1HE7A 4OB8A 1E92A 4LOHA 2XPYA 5EIBC 4XSVA 2H7WA 4XR8C 4HV8B 3WGVB 2PWDA 4RBPK 3OM1A 2NZ2A 3Q3GA 1SN2A 3B9AA 3SP1A 1TPZA 3B9PA 4AFNA 3VJRA 2ICWA 1NGQL 2A9KA 3VVMA 5DHSA 3CVXA 2EEPA 5GGVY 3VYSB 2XXCB 5D7EA 1LVEA 1KSJA 4GSLA 3PPIA 1HNNA 1YO4A 1M7IB 5CIPB 1ZGGA 1U58B 5EPMA 4DA0A 3T4AA 4BFNA 2G5BA 2AJXL 1Q15A 2Z8YA 1RZIA 4AEIH 5ENDA 4NYIQ 2OXEA 3ZRCC 1MHPH 3C6EA 3EF7A 4WTZA 4IHKA 5HQ3A 3FFCA 1LK7A 2MSDB 3HRHA 1BMQA 1XXLA 1RLUA 3VU9B 5K8CA 3AMKA 1JYVA 4F9PC 2YHAA 1U8FO 5JRDS 1W44A 3UPTA 2FPLA 4YAGA 1MD9A 2X1XR 5HHOA 2D7NA 4IHOA 4ODVL 3W9DB 1LLUA 1ZLDA 5TQ0L 3ATEA 4YDSA 3LNFA 3SHFA 2Y76A 1GGNA 4NR0A 3IE1A 3GNTA 4JQXA 3IQGX 3PTAA 3U6RA 2JBAA 1Y7VA 3WB2A 2UYCA 2ZIEA 1UFUA 5M5BA 3PLAE 1M8KA 2PX8A 3DE6X 4B6ZA 4AQZA 1RPZA 3KZ1E 2J9XB 4QPNA 3IEXA 3RC8A 1UASA 5EIQA 2RGYA 1JSYA 5TPWL 3NB0A 3FCAA 4KPFC 1EDBA 4WHYG 1SQ5A 2YMXH 4AKHA 2AWOA 1CCWA 4UQCA 2B1GA 1QFWM 1VIYA 1HMPA 1O9WA 5JHAA 1FSGA 4Z9AA 2GD0A 3X1KA 1ZL0A 3CNLA 3RC7A 1JQJC 3S29A 1EVZA 4HPXB 1AA6A 5HDQH 5ABDE 4HV4A 1AE6H 3B3IA 5HR5A 5BVHB 1OXBB 3EXAA 1H8LA 3I6KB 3WYGA 1H2WA 3A26A 1SXJD 1YIAA 3VD7A 3MRXA 4CMMA 4LUCA 4DMFA 5KVGH 2Z4QA 4C4PA 4LV8B 4QPEA 3NIFF 2WWNA 2QZ5A 4DIFA 3KDPA 2VNHA 1FVDA 4RKRA 1GZ5A 2FUEA 4B9EA 2D73A 4PCUA 2R85A 4U3HA 4IDHA 4OFYD 3O8DA 1NCIA 4CFYA 2ZWKA 1IAIM 1B4TA 3KYIB 4XJVA 1OAUH 5H9WA 1YAJA 4AL4A 4E68A 1OP4A 3D4BA 5HNKA 3BZDA 3ZY3A 1NVDA 2XXAB 1MHEB 4MEAA 1MY5A 1GCUA 3PUCA 4XPIB 1G42A 1NC4D 4EO9A 4CCAA 4GS7B 3FONB 1J8YF 4GAGH 1UWKA 4QWWA 4UMVA 4LLVA 2VDPB 4JLNA 2EOAA 3FGOA 5AIAA 3H55A 4KRPD 1KULA 3CKLA 1T6NA 3R0ZA 2YD2A 4G0PA 3QKUA 1G4RA 3DTUB 3DJ9A 1EZUA 1GYWA 2CJWA 3FXIC 4KXDA 4FNSA 1IB0A 4PJ7B 4AJ0A 2REQB 1I31A 1RVFH 4FQ1H 4P84A 1G8SA 4AD8A 4OGGA 3ETJA 3NETA 1CR1A 3WTXA 4BGIA 2O5XH 3TN7A 3TBWA 1G7MB 2W2QA 2NPLX 5H68A 3NVQA 2O30A 2PXYD 3C48A 4EBBA 2JGLA 1B1CA 4UEJA 3U09A 3PWLA 3LS4L 1RZ7H 2G5GX 3ACCA 4K05A 2EQAA 4JZYA 4M93C 1N2CA 5JCJD 3C8KB 1A77A 4TLMB 4JI3B 4KXFB 1W16A 3KYDB 3UT5A 7ABPA 1UPCA 4XN7A 1KJ2B 1RZQA 2R29A 2AW3A 2R1WA 3RVXD 3MV7B 5SYAA 2CXRA 1C8LA 2V7TA 4XD7D 3A32A 3QK7A 1ZD9A 1W1WA 3UTPE 1YECL 1EK2A 1ADGA 3C08L 2KI6A 4Y4KB 1XCPA 2WLZA 3IJPA 4P9NA 2YJQA 1RM4A 1K2DB 1VKRA 1BROA 3C2AH 3DOHA 1MLCB 1U28A 1K3TA 3DBXB 5D1ZA 2I1VB 2IFTA 3C6KA 4JC4A 1A4KA 1WKBA 1RIVH 3MRLB 1WK0A 4C7JA 5AVKA 1NLFA 1IKFH 3T3PB 4E41D 3VXRA 5KJ6A 2ZJ1A 3LFUA 1M42A 4MGYR 2HMTA 1MH9A 1V3UA 5A4AA 5FT9A 4KUCF 3FPBA 4DOMA 3GZNB 3R19A 1TJGH 1J0JA 3HCBA 1DQLL 4RXTA 3AUUA 4Q37A 2HJVA 3PFIA 1ZUD1 3JR7A 3HCCA 5CEZE 1B3RA 1T8SA 3SDAC 2YN0A 1MW8X 3GAZA 1Z6AA 1U7PA 4W9EC 1ZONA 1UATA 4Q93A 4WXRA 3BYYA 4A0GA 2GN2A 2DLEA 3CWZA 4LQLA 5J2TA 4B33A 1T4KA 2B0JA 1G5IA 1YZLA 4HDRB 1CVSC 4GQBA 2H6PA 1C41A 3UJPA 1MCSA 1IWPB 1PR5A 1HEHC 8GPBA 3HXKA 1FE8H 2DFNA 3W6OA 3SBEA 4L9LC 2CC2A 1NJ8A 4RK7A 5I7OA 1E0DA 2UZ0A 3O82A 4UBDD 5BMVA 4JEGB 4ORZC 1TAQA 4ALKA 5CT6A 3UM9A 2WIIA 4R9HA 3FPYA 3GLGE 3K1DA 3RJTA 3VD3A 1ZGCA 1KTIA 1E5BA 3S7ZA 1SG9A 4WINA 1ADQH 3JZFA 3T8XB 2A0LD 5CX1A 2WW8A 1JRHL 3RWIB 5IHXA 1R3DA 4O2BA 1IPHA 2Y7SA 5BXYA 2H5JA 1PEYA 1RD4A 2DPGA 3RIYA 3ZK9A 2L82A 8PAZA 3WVNA 3L7FA 4BZ1H 1AQJA 1VXRA 4OUDA 3E58A 4QY8B 2VXTL 4Y1SA 3PF2A 2NYKA 1Y3DE 2WTBA 1H0DA 2VH2A 3N85L 5I6NA 4R8RA 3RU7A 2W4IA 1W88A 4OGAC 3AT8A 3DMDA 4G42A 5CB4B 1M6YA 2YV4A 4I4LA 3SQWA 1QWUA 1PCSA 2F00A 5K8JB 2GUWA 4N90E 3QZMA 1NW3A 1UOVA 1VI5A 3DARA 4Q4HB 2A1TS 3DTTA 3HSSA 3OBIA 1N4DA 3WX0A 1A4IA 3E3MA 2FPRA 2J4WL 4F8NA 1UMBB 3HR5A 3U2SB 3U7RA 3GIVB 1YJ5A 5AXAA 2EEBA 3T5BA 1X7QB 3Q6FB 4UT7H 1BPLB 3G8AA 2VPWA 1EFDN 4WXMA 2JHGA 4LCUA 3JV0A 3EJCA 1ML3A 3S5LB 4TNVK 3AI7A 2XN9E 3RL2A 3C3JA 4HIJA 3IOEA 4GAJL 4JB2A 3G08A 2N3JA 3GW8A 5HVHC 2OJZL 2FTKE 1VSCA 3NCCB 2FSGA 2X9YA 1T8UA 2VK2A 3PQEA 1HQDA 3KPNA 5JW4M 3GLKA 4FOTA 3USZA 3MFYA 3FPAA 4IGBA 5MEQB 3L5KA 2VZ0A 1V2HE 1AKVA 3IJSB 1CUCA 3BP6A 4IR7A 4IOFC 1GFZA 2HA1A 4DPCX 4MUXA 5CYFA 1S3KH 1O8BA 3VMFA 1WCBB 1Y07A 2NDGA 4MJID 1DTSA 1Z2CA 3BSZH 4EZEA 1WDLA 2X5KO 4X1YA 1ULAA 4UDYX 1QIHA 1YRYE 1WZNA 4XAKD 3PC7A 2NUBA 3ASYA 4UMFA 3DOUA 4KQFA 4WADA 3Q6GL 5HI3C 4NFLA 5BRPA 4D80A 4NZUL 4K7PX 5JIMA 2ED9A 4JJKA 4QGAA 1O5PA 1R5VB 2GHZA 1E5UI 2WUBL 4MRRA 3HR6A 3IXAA 4ODWB 2CCJA 3L3HB 4PBVC 3KFVA 3DE3X 1ZCRA 1I1OA 3V6ZA 5CLIA 1YBMA 3BISA 3QDGB 2XY1A 4CA4A 4PX3A 2UZ1A 4E3ZA 4HHGA 3GK8L 3DXFA 4K6OA 4GM4A 2WXQA 2G5UA 4XN8A 3MV8B 3JQ7A 5E3HA 1B8UA 2UZXA 2PD6A 4R1SA 2WXNA 2B37A 3NGXA 1LO4L 3KEDA 2JEYA 3EDCA 3I50L 1U91B 1BXGA 1MFAH 4HS8L 3LH2L 3EWSA 4L85A 2NT4A 4PJ8B 5F1KC 3Q0TA 3CLEL 1ZNXA 3IBSA 4QODA 4HGYA 4JMPA 4ZXBA 4DLNA 1E5LA 4RSVA 3QOWA 2D7JA 1BQRA 3Q6MA 4MKGA 3ZV6A 1Z4PX 4UM9A 4JBYA 3JAWB 4S05A 4GW4A 1ZGLB 1ZZGA 5C80A 3HG5A 4WLEA 1J8KA 1SUIA 2ICAA 4UZFA 4N47A 2YPLA 1PV4A 3PS6A 4BN4A 4MDIA 2M6SA 4RUKA 3T7CA 5KAQG 4K9DA 1GU0A 5GM2A 3QMPA 3JWNH 5E0OA 2JIMA 2A9MH 3T2PA 4B3DA 4FEMA 4TF4A 4BFRA 5SWZB 2CL0X 1GYVA 1HNGA 3BZ5A 1N2JA 2IEAA 1RLOA 4WGKA 2IT1A 3I6QA 1E6UA 1L7MA 4FQPA 1YF3A 1U3DA 4TX1A 2BVPB 2OCDA 4S0XA 5DM1A 1NGZA 1G3RA 2VDOB 4Z7VA 4Y1RB 2X3AA 2Q3CA 1EO8L 2B59A 1W5BA 4HHWA 5L2JA 2HB6A 3QDMB 1RWOA 3NC4A 2C8VA 4LARL 2QZZA 5JZSA 1YCGA 1HT1E 2PX3A 1Z5ZA 4HFWA 4B7UA 1A5AB 4G07A 3WXVL 1KXHA 5AOIA 1A0QL 2VZ8A 1YVEI 2FWIA 4YONB 3ZKXB 1FDLH 2YOHA 2OK8A 5IZ4A 4MQFB 3BSSA 1NLDL 1D5MB 1C2YA 3GPBA 3KPWA 3E2MA 3ZCTA 3PXJA 3UG3A 5BJTA 2P4QA 5KBLA 3K1JA 3PCXA 4PJGE 4GMFA 2DRUA 1VGEL 2R6R1 1FJXA 2W6JA 2H6EA 1RNLA 4KH2A 2EGHA 4L8CA 4PYRA 2IU3A 2F43A 4IBLT 2IYVA 1A96A 1G1AA 1JHTB 2YVLA 4FDLA 2H4JA 5ALZA 1MO4A 4Z51A 1UZNA 5HHNA 4HJXA 2Z5VA 2ZSUA 4J0DA 4LBVA 3TLGB 1FMLA 2DQTH 1J7JA 4HDKB 5EE0A 5EZLA 1DQJA 2VLKD 4M7KH 2OMBA 2O61A 4NE2A 4GRLA 2G3XA 1DJIA 4HUMB 7GPBA 3JVEA 3CFQA 2EKPA 3T5CA 3MYJA 3W2TA 4ER7A 4HS4A 4N8CL 4JVPA 1KPRA 3RWMB 3EPPA 2VLRE 1M2GA 1E98A 1YGYA 3ESCA 3ZOAA 1NCOA 2QORA 2JK0A 1BC5A 1QYCA 4NG5A 5DHTA 1K4MA 3F7YA 4C56B 2JJUA 3SCMB 4OL9A 4H18A 4PWFA 3TSOA 2XZCL 1WABA 2Q20A 3ZYCA 3AROA 4IRUB 4M9RA 3TGPA 4JG1H 1YPZE 5EUOE 3EF1A 4AKOA 2XKNA 3CF2A 2XE6A 4FFOA 1YQGA 4AQ1B 3ZGLA 1UD4A 4C0KA 4EHDA 1OLZA 3IDIA 4MKZA 1UXMA 4A15A 2HD4A 3LX9A 1E5ZA 3WKNA 3ABKB 2DMCA 4M9OA 1K7YA 4HMOA 4IO0A 3VMMA 3L0CA 5I5GA 4M5SA 2Y2VA 2AZAA 5TMBA 3PAZA 1BXRB 4M5YL 4K9LA 4NATA 2F9FA 4RQBA 1TX4B 3WKYA 3DNMA 5I15H 4N12A 2ZREA 3CLSD 1EUUA 2X14A 1AC0A 1ZM3A 3R3HA 1DAFA 4U6HA 3FRPB 3RSHA 3FMGL 1XU7A 4B75A 4D56A 3O6KL 4CR7A 3EG9B 4KJPC 3IGFA 1G2OA 3HP1A 3UXYA 2AW5A 3IN2A 1J49A 2SKDA 5FL7D 4QCIA 4J1TA 5I6DA 3IWVA 4WNCA 5JTUA 1XQVA 3QG6A 4URFA 4ZVPA 1TU4A 5H4YA 5ALRA 3IGAA 2R2HA 3AU1B 4AYMC 1NVEA 4TXHA 1IE3A 4OR1A 2W2LD 2QDVA 5I75B 1KVUA 3RA7L 1TZHB 1O4WA 4DIXA 4CDGC 2GPBA 3WHIA 3G5YB 3WFDH 5ITZA 3DBRB 4ON9A 1UBKS 5E6IA 3IMBA 3RI5F 5FYLE 3ZWCA 2AAAA 3ONEA 1E61A 1A02N 1YS1X 1CU1A 2P8PB 1PZGA 2AYXA 1EWTA 3FDZB 3VFUA 3LBHA 1P6XA 1OP5K 1Z9LA 1GUFA 5CMLA 5HUHA 3UGQA 3KWWB 3TO4D 1NVBA 2ZONA 4IMKA 1EFXA 1MWAL 2UXBB 4F9TA 4P59L 4AJKA 5JT1A 2JGIA 1KO8A 4TRRA 3VKGA 3ZXUB 4N0PA 4CKQA 1E0OB 2JKSA 2UZ3A 2F9LA 1BAWA 2XQYA 3LF2A 4PNHA 3BGFC 3J8F7 3FLAA 6PCYA 5BYKA 4OZGB 2VBIA 2EDRA 1AO7E 4XWGH 4Z4IA 5T67A 4MMXC 4D7PA 1Y8QB 2CDEB 4EKNB 4IGFA 3D7MA 3AU0A 1OTSC 1QIMA 1WX1A 3PNBA 1PZAA 4B79A 3S2CA 2DWUA 3KKPA 5ITFA 5T33L 1CDHA 3D18A 4Y4HB 4N8PA 1SJXA 1MABA 1QO0D 1G20E 3GRWA 2J59A 4M8QA 2QBYA 2BVTA 3MWDB 4MXWH 2FHCA 4C4UA 4AICA 4FONA 1I1QB 1MB3A 1EHCA 1YJXA 1T22B 5CGZA 3NZHH 1ZGBA 4KNSA 5DMYA 1HYEA 2V9PA 3VTFA 2F15A 3BDAA 1D5ZB 3RY6C 2CLKB 2RIRA 1BX1A 5CD5C 4PF1A 3SB3A 2LFEA 2VJBA 2JANA 3DK0A 4BLWA 4URUR 4G80A 3O83A 3N53A 3UTOA 4YQXL 3TCXB 4BLTA 3GX1A 2MR6A 2QD4A 4RISL 4Y2DC 2R5NA 2YN3A 4ZREA 4C0SA 1PEDA 5CM2Z 4CKWA 4KV5E 4RYDA 4EDXB 3RBXA 3BRFA 4OFZA 3DPIA 3EJZC 4B43A 4MQBA 3A4NA 4NJAH 5AK4A 3JQGA 4N5ED 1X87A 1HFKA 4BNKA 5FOJA 2MR5A 1JECA 4Z4FA 4Y9RA 1WS7A 2Y1WA 3DP9A 1IBZA 4XMKH 1S5PA 4HALA 2FZ3B 5DNAA 4XR4A 2JNWA 2PO6B 5CJOH 1XLVA 1X7XA 4YMLA 4UM9B 5K3CA 2VMJA 2G82A 2WAQA 5FYJD 4PJ8C 5C08D 1J23A 2B8TA 4BP8A 5I7VA 2QE6A 3W5MA 2PT6A 4KXMA 5EZQA 3CSFA 4X9IA 3MYJB 3KU4A 2W4MA 2EBFX 4OVKA 1K8QA 1TKAA 3ABQB 4IRJB 5KKNB 4X64B 4FB5A 1IAKA 1DFXA 2I0FA 4P5TA 4KPHL 1J2YA 2YJ6A 4C83A 4X9GA 3ZBUA 2N1TE 2HJKA 4PY8I 4EN3B 2P46B 1FVHA 4IDJL 3HI6A 1SU6A 3I4LA 5A62A 2AD5A 3NEJA 2I07B 4WUKH 3TM5A 3ROGA 1JE1A 5HHTA 5JW5B 4MSUA 3HCEA 2AUNA 3ENZA 4LDQA 1IK4A 1DO0A 3TW0A 5EIIA 3ED1A 3CVIL 3EO0B 1YU6A 2OXGB 3UV7A 3F84A 4MHTA 1ZGHA 1EIBA 1EANA 1YB4A 1RAAA 4JQCA 4AE1A 1FX0B 3LU1A 3PNVA 1O0BA 2O9JA 4UXHA 4JQYA 4NQVA 3N6VA 4WBNF 4UV7L 5F78A 1FYTB 1J20A 2V4UA 5DC9B 4IOLA 2PWFA 4PRHE 3H3FA 5D5MA 1U2GA 4MAYB 3KM2A 3L3KA 1GYUA 4H7EA 5IKCA 4HAWA 1KMCA 1U0HC 4DPAX 3HP7A 3RFTA 5FGCB 5KANG 3KLOA 1I4FA 2JRCA 3RRQA 5LLIC 1K6MA 3IKVA 4GH5A 1RI2A 3JAKB 4JQOA 2GFHA 2ZBQA 3WYAA 5IM5A 4QPCA 4N40A 2A9CA 2H31A 5EP1A 2IRWA 4Q7KA 2HI0A 4QRSB 3CH4B 5BZZA 3ZZQA 4H2DA 2HIGA 5I9NA 5AVYA 5K99A 3UH1A 3ZD6A 2J3SA 3WK6A 3BWCA 4P80A 1QLFB 3B9KC 3AR3A 3L8DA 3S36X 2QTGA 3VUAA 4AXWA 4UUPA 1NU6A 2DWDB 1OTHA 5JW6A 4LXIA 4GZ6A 4YQYA 1RLMA 3BWUC 5PCYA 1KQPA 5L88L 4IGBC 3R5KA 3COVA 5LA6F 1HOCA 1FP1D 2OCXA 2O7VA 2OR8A 3T7KA 1JHMA 5EBMA 5F1NB 2CUNA 1NQUA 5JBIA 2J2ZA 3QP3A 2PWZA 2J5LB 2HT4C 1A2OA 3HI5H 3U4DA 3RYHB 3E53A 3FQXB 5DJ5A 3FQNA 4UOQA 5FHAH 3TA4D 5IARA 3ZY2A 2BGTA 4JELA 3HR4A 1MF2H 4IXWA 4EZJA 4URTB 2VLRA 1P2UA 2NNAB 3RDTC 1FTYA 3NPSC 2JJQA 3GMLA 4MV3A 5E2JA 1SXBA 5I4IA 3QIUD 4L4TE 4KYUA 2PUQT 2QLTA 4X80L 1BOOA 3PWPE 2AJ3A 1GVHA 1KYQA 5IFJA 4Z1MD 4JLUA 2D3LA 1EH5A 3IN0A 2OD7A 4G4GA 3P0YH 1C12B 5FAAA 1PBTA 3Q1SL 4NARA 2HXSA 2GGSA 4EAAA 2PRZA 4ADSG 3LNDA 4G6JH 4ILEA 1KI4A 3TBTB 3WYBA 3IKCB 3R76A 1W6RA 4DKTA 3SQXA 4BRWA 1KCLA 2C4FT 3L5WA 1WLYA 5F9JB 5C7IO 3NJHA 2Y0PA 3MGKA 1T0BA 2E6QA 2X8AA 3PNKA 4OUDB 4JQIA 1OWMA 5B12A 3SZ3A 2H32B 3TVMC 1NTRA 1RIVL 1HDOA 1Q72H 3BAIA 1AKUA 3L13A 1WDWB 1O97C 2IIBA 3C5VA 3HG7A 1OZ0A 4Y18A 1ZI8A 2ZCLL 1L5FA 4NH0A 3ZI4A 3D1VA 4ISVA 3BP4B 1E79A 4O2AA 5EXEA 4G5ZH 3ECQA 2ZUWA 2YGOA 2AVDA 4O4HA 5AW3B 5ICXB 3QRGL 1WUKS 4QMEA 2C1XA 4KX7A 3K72B 1UWFA 5H2BB 1WRBA 1XRPA 2PZLA 1G8MA 4EKJA 2V9UA 2IDCA 4PGHA 4JODA 2WXPA 4RWHA 3DBOB 3BGVA 2VJXA 4IG4A 5DRZA 4YRFA 2ZUCA 2ZCKH 4HCJA 3ISTA 4PO8A 4M5ZH 5E2TH 1GGCH 1RV6X 1ZOSA 1PTJC 5F0JB 5L8VA 4TV8B 5CR9A 1M2OA 2DFDA 2ERXA 3ZWWA 2DOKA 3NMUF 2XR1A 4D6YA 3B13B 2I60H 3D1MC 1ZMRA 1RBQA 1SN0A 3PWSA 5IFLA 3GDCA 4WO4D 1NKRA 3FCBA 4HMDA 1GV0A 1W6LA 3MSPA 2VDWB 4KQ4L 3H0CA 5JOQA 5LGJB 3JD3A 1ANUA 4US0R 4CTKA 1A14H 1M05B 2X1LA 4M1CD 5GGVH 3HADA 2OHIA 2OCYC 2V9TA 2ZU0C 4MA7H 2CHFA 3I05A 3RSOA 1YLBB 3BGMB 3OEWA 1Y5MA 2E75C 5L2KA 1TTFA 3PWNA 2R29L 4NRYA 2WYZA 1R24A 3FNRA 5EZJA 4YQEA 2WVSA 3VYPA 3L1UA 2YOAA 5JZ7D 3SDCD 2BFEB 4ISVB 1VGEH 2BEWB 3IAPA 5DT1H 1E6LA 3QLVA 1MFCH 3GHBL 5EZ5A 1DQLH 2Y2TA 1XK6A 3O92A 2C4HA 5EUQB 1KYIA 4GKAA 3MSCA 3IJ8A 2QQLH 1I1FB 1U92A 4RHFA 4CKYA 4ZQKB 1RE0A 3HN2A 1VFAA 5AVUA 4S2SA 2B15A 1L5NA 4MAYD 4Q9LA 1E3LA 3T3NA 1WU7A 1CFVH 2H41A 3IOYA 1JR3E 3WKDA 1D5BB 1ZWIB 1IAOB 2C9YA 3GEHA 4MNQB 3TPZA 3MDJA 4CC4A 3PIQB 4O8CA 3L77A 5G0VA 4N8CH 4D3DA 5IUJC 4QUIA 4OF5A 3HFGA 1C16B 3CXHK 3UJDA 3WDJA 5CN2A 3FB6A 2WR8A 3YASA 1P2DA 2ONJA 3NRCA 2W22A 2NW2B 5GINE 3I01A 2DPYA 3HCPA 2FGZA 1BOFA 1ZR2A 3QXAA 4MS1B 5DRXB 2PUWA 3ZQ6A 4NC2B 4WU7B 4AJWA 1NYRA 3CPHA 5BQXA 1YS6A 4XH9B 3BEOA 5L4IA 3QVXA 5ALCL 4FSDA 4I6GA 1XH3B 1GCYA 4BFJA 2QNRA 1CIDA 5LOVA 5AVTB 1OTUD 1QFJA 4N3BA 2ZIXA 1UK9A 3B20A 4M7LT 4NJ9H 5HYIA 3IEUA 3GLQA 1ZVJA 2OQRA 1ZXBA 2WQSA 1P4BH 3PL5A 4RF3A 2V3CC 3KPSE 4PUBH 2Z35B 4IH4A 4YSPA 3NH9A 2R3SA 2CNOA 4O2EA 1TYCA 3OEYA 4V2UA 2Q2QA 2PUAA 3CVBA 5HFNA 3Q2NA 2H1PH 1GA1A 1UJ5A 2CBZA 1Y3BE 4IGEA 2HWXA 1NMBH 1QSEE 3JZYA 1R8XA 4G2NA 3STZB 5LO7A 1ES0B 2NY4C 2NAPA 3SIWA 2WK1A 3FTEA 5ID0A 4M7JH 2G9NA 3EIFA 1GPAA 5FWXB 4P3DA 3M1LA 3VDMA 4KDTA 5I0VA 2PR4L 3LKVA 1QZ3A 4FLEA 2BCKA 4KKNA 2W98A 5JPDA 3MHPA 3QHAA 1F42A 7FABH 3OD3A 4R41A 3PUUA 5KTOA 3NEYA 4LRTB 4LJAA 3PHQA 3AWGA 4HZAA 4PUBL 2A14A 2GZMA 3VHLB 4HVCA 3IPLA 4EHAA 4PAMA 4D8UA 3S35L 1KYDA 2QG6A 1F5WA 2YHUA 1KCRH 1CJKC 3O2WH 3DHEA 2Q0ZX 4XYLA 3FTPA 3Q1KA 1XSIA 2LBPA 2YINC 4MUIA 4D9GA 4GM0A 3RPIA 5GJBA 2GJ6B 3U9PL 4TUKH 5K33A 4K8RB 2VDQB 5G0TA 1CYEA 1E4XI 1QO9A 3B5IA 3FBWA 4QHNA 5HHPB 3Q6IA 2QP3A 2Q7NA 1JGLL 2EUVA 2CNWD 1P69B 3A6GA 4TTTS 4GGMX 4ARZA 3WQHA 4YP6A 2GZ1A 1Q0TA 4ARVA 4OSUH 4CR6A 5JPMC 3ULUH 5JA9A 4HJSA 4C0AC 2O2HA 1JZGA 3EQ2A 1UM5L 1XR3A 2IXAA 1D0VA 1ZL2A 5DO8A 5HJ5A 4BB0A 1TK9A 1V11B 2ESVD 5F2EA 3SIPA 3S5ZA 1DQMH 4EGAA 3GNML 3MHTA 1N8ZA 4Z3EA 3P0GB 4MEBA 1L5LA 3ZGXA 2JAUA 1PVHA 5JIDA 2DM3A 2OC9A 5LL6P 4NQZA 3I0ZA 4EOGA 2DKMA 5KWYC 1TYRA 4KBYA 4BFIA 4YPGA 1PNVA 1FFYA 4K8RC 4WI3A 3AUWB 2VYNA 4B3TB 3GLIE 4PWIA 4OK3A 1QQTA 3A2KA 5B39G 4XVOA 3DZCA 2N0MA 1LGVA 2XRAH 1RJDA 4QRIA 4OBXA 3U9UA 1QONA 4ZFNA 1QC5B 3HY4A 1DAKA 3AG2B 3FHCB 4NY1A 4PX2A 4UFOA 1RZJH 3NJVA 1QGAA 4LSSL 3VXNA 3BDIA 1UKQA 3PNWA 1VLXA 5B3JF 2SEBA 3AFNA 1L3CA 2X2EA 4DPLA 3FOFC 1LNUA 2VP5A 3QDJE 2XGMA 3OB8A 4NZFA 2IIJA 3AMVA 4X20A 4KNVA 1COZA 5SZKB 2R29H 2NU9A 1LK2B 5AB1A 1TUEA 1M1YE 3NCFB 3P4OA 2W0PA 3UTDA 4PJ8A 4GB9A 5C3IA 3ZTYA 3EFOA 4C04A 1N0VC 1NCAL 3BSGA 1E1YA 2FRXA 5E4EB 3IV6A 3ND7A 2ZROA 3O84A 4L8SA 2CKDA 2A9ML 2OWEA 2PRYA 3TONA 1KEZA 1I6KA 4G63A 5JWRA 4S1QL 1V16A 3V79C 5A7BA 3A1UA 4UFPA 5CFPA 4L4VB 1F2TA 2PUDA 2A4CA 2GM5A 5DYGA 4ETNA 1XF9A 2BT4A 4A16A 3MFFA 1NNEA 2D2CC 4B9YA 2HLHA 3KW7A 1VJSA 3EYUH 5BR4A 1JG1A 2C94A 3CR3C 1L1RA 3ZIAA 1EHNA 1SC6A 4HDNB 2HHAA 4I3RH 3H6KA 1J22A 3OSVA 2LKCA 2JIPA 4KIGA 4LSQL 2HG0A 2H4XA 1G7LA 5EV7A 5IJCC 3SHQA 3E7WA 3A47A 5BQDA 3TDMA 1EJFA 3MJ6A 1EZ1A 1CZHA 2E1PA 3VXSD 4U1NA 2CHVA 5E2IA 3JPYA 4WKOA 1D6MA 2YVUA 3FOMA 4HUWB 3CPLA 5EVCA 4A38A 4WTOA 3ABGA 1RJWA 2ZSWA 4JGUA 5T5FH 4YWGL 2CL7X 1SYSA 1OSZA 3ZTDC 4DB2A 2IA5A 1G6RH 2OMUB 3T6QC 2Q4RA 1GU7A 4JLWA 2P1ZA 2XZTA 1M7DB 2XTJE 1MJNA 4GQRA 4LJ9A 5TRTA 5FUVA 2EEAA 1U3HA 1DN0A 4IIFA 4MIEA 5GM1A 5DMKB 2QMJA 3TBVA 1MQ8B 5FV2A 3QP9A 2VB5A 5KOHA 5HYJE 5JCXA 4JVWA 4IDAA 4JCCA 4IGAA 1WZCA 3U7QB 3G68A 3X1MA 3QULA 1H69A 1FJ1B 1LPSA 3MT8A 4OQNA 5FI1B 1R0CA 1O95D 5F7OA 1YDWA 3V4UH 4Z6AT 2W8CA 1AHHA 1TZKA 1R18A 1AQHA 1T2NA 9LDBA 4YJ2A 5ILOA 3ELYA 4PW4A 4WKZA 2YYYA 1FV1B 4OCZA 1NW7A 5D1ZI 1TM4E 3VHXA 3A28A 4MZDA 5J57B 3HJEA 1VDGA 1FU7A 2QXTA 4WBSA 3A10A 4E46A 1V96A 5CBAB 1AKJD 4HUQA 3DMRA 1IAII 3KWJA 4YMHA 2PSEA 3MGOA 3X1EA 4M1DH 1HKUA 3Q9NA 2UVQA 4RZKA 5KHLB 4N5MA 1LLQA 5ALSA 3HE6D 5C0NC 1MX3A 1G9MC 2V7NB 1ZEMA 2PJUA 1S2GA 4MV9A 1BAGA 2Q6VA 3NZ8A 2BRUC 1NPUA 1MFVA 3D4CA 4XFDA 2DEXX 3CLUD 3TAUA 4QKQA 5DU7A 3LIPA 5C7XH 1ROWA 3WO3B 5IJZA 3PNSA 1MCFA 4R3NA 3OLQA 3AREA 2ZANA 2CDFB 1VL1A 1MR3F 2ERJB 1OFTA 4NQSA 1YJBA 4X6CE 3U1BA 3ZIAD 3WFIA 4RLHA 5IIEB 1LK5A 4BIIA 3KSDO 4HDAA 3KWFA 4BL5A 1G21B 4CU7A 3ICEA 4KLNA 5I30L 1MAHA 4FCTA 4KK9C 4TKVA 1KVRA 3VFMA 5CFLA 4Z1OA 2JK5B 3CG8A 1KFAH 4KROB 2VDLB 1WT5A 1QK5A 2PYZA 3N85H 3EFFA 1V7MH 2H6PB 4RJLA 4FDAA 5TGDA 5AVRB 2QUZA 1OLOA 3BL6A 4MCIA 5KREA 2WJPA 4K3GA 5EBMB 3WSVA 5DUPH 3CH6A 1D7DA 1EZVY 4DHLA 4C55A 3BE5A 2C57A 2UKDA 2L42A 4RADA 3ZE6A 4B4UA 3H99A 1ZHNB 2YWBA 5FYJL 5FNZA 2FX9L 1XTMA 4OIIH 3D6MA 3D9AL 1VRSA 4WFGD 4TMZA 4J16C 3TP4A 2J0SA 3BWAB 1PS0A 3JQFA 3FWKA 1CD0A 2KDYA 3PENA 1P1CA 2IFFH 5LQCA 5EJ7A 2ITDB 4HKXA 2XTJC 3LPNA 5K5EA 4C4ZA 1SEQL 2ECFA 3PDHA 1NASA 2QGCA 3DEZA 5C0AE 4YRJA 4DCJA 3VWJA 4OP3A 3QPQC 2OLKA 1BRTA 4HFMA 4IHJF 5JYEA 2JKXA 1VE1A 3SFZA 2NYRA 3HDVA 4RGNE 5D6DC 4UDUB 2FL5A 4N9GA 5AJYA 4FGWA 1CY8A 4MAYA 3LHKA 4HL6A 3EJYC 3MWFA 1H4VB 4TQEH 2JLUA 3II1A 2G9KA 4XI5C 2WHPB 4L3OA 3N2ZB 1T1JA 3U3XA 4KGDA 4BVKA 1TTRA 1SD1A 3PFWO 3UC0H 2WBJB 1CG9B 4EPSA 2D1QA 3GP5A 5F21B 2FK8A 3BSWA 5DJ6B 1NG1A 3D81A 3TYFA 3QVJA 2KW5A 5ILTH 4EIUA 1RY7B 2EFEB 5TX7A 4RU1A 1D0IA 5WRFA 4JQXC 3PE9A 4QM6A 5BN5B 3ZQJA 3NRJA 1DL7L 5EU5B 1ZJZA 1D4FA 3OC0A 1T2QL 1DZ3A 1DUYB 4DSTA 2HXGA 1FNFA 4UTVA 2JJ1A 1DDHA 3HVJA 5BW5A 3NTRA 3U4AA 1M6OA 4Y88A 1QF6A 4MQLA 2JKWA 3S5UA 2JJTC 2NVBA 3WO1A 2DS4A 5ILTL 1SVCP 5CA0B 3FHOA 2UUCB 2ZB3A 2JLQA 3LD8C 2D0DA 1L4EA 1XVSA 5CSZB 1L5HB 3HJTA 4UM8B 3VFVA 1EH9A 4FYVA 4TUOA 1UEMA 1ORDA 1YR7A 2Q29A 4G1MA 2MTAA 4C06A 4PJCB 3NBYC 4TMTA 1M7UA 4MLSA 3M2TA 5JSQA 1QDEA 3F5QA 5ICCA 5FUQA 4X71A 1U2EA 5TQ2A 3NUZA 1U3UA 3GZKA 3PGJA 4JENA 5HPMA 1LO4H 5C53B 4JG9A 2O2CA 5BSUA 3AYZB 1V55B 4BCDA 4TLLB 5HF5A 2FY8A 4FA6A 3L6OO 2R39A 2P5UA 4DLAA 5FLUA 1C5DA 4KO2S 4UAVA 4DZ8B 1W0JA 4MDRA 3L2MA 4H13C 1IQ0A 5JXED 4CCYB 1DLIA 2ENYA 4IRJD 4G36A 2RGWA 2ZRPA 1E5XA 3GD5A 3BCHA 4NQDB 4E2FA 4DVRH 2FSVC 4PJIE 3TLXA 2GBLA 3E1KA 4EX6A 4FOSA 1KL7A 3G0GA 5FO8A 2QPAA 4AK2A 4LEOA 5C08E 1EA5A 3VU8A 3IBOA 4KXLA 1FXUA 2PF6A 4GW4B 1SXNA 1ONQA 3DEIA 4OSEA 1NWHA 5DM4A 4UQ2B 1EP9A 1PJLA 4P23B 2M6RA 3B36A 5L7WA 3RQSA 4EUHA 5G4LA 4H0HB 4RD1A 4QXUH 4U1NB 2A9FA 1T2EA 1E3IA 3W38A 5ALKA 4WHTB 3DBHB 2FECL 3FLEA 5AI5A 3T35A 2JGDA 3CZMA 2C3VA 5EVJA 3EA4A 1VIMA 5LA6B 2HQSA 3LVRE 1VMEA 2BOVA 3O3UN 3HB1A 2W8ZA 3KQQA 2WAOA 4KDTC 1WBXA 3AV3A 2VJLA 4Y0NA 4CM8A 1U8NB 4BU0A 3CG4A 2BIHA 4C0XA 1K66A 4QDXA 3D50A 3CSUA 1OZTG 1VJCA 5AAPA 6LDHA 3PS9A 1EK5A 3BZFB 5JMWA 3F7MA 2AG1A 4KACA 2DQFB 2HJKB 4IZHA 1UXWB 4QNMA 4IDQA 2GEJA 3LRPA 2AXWA 4NABA 3SZLA 4IFIA 2WKLA 3EOBB 5LUMA 4J2HA 1LF5A 3VSEA 1MAAA 1SCUB 1ZN9A 3K09A 2P9RA 1J7VR 1ICIA 4R1TA 1T7YA 3LZOA 3JTTB 5GRVL 4AMBA 1EJOH 5D6CB 5FW8A 3ROQA 5ETJA 2VPIA 1BQLH 2HT6A 3DURB 3F2VA 1PDOA 4S1QH 1XUOA 2XOEA 2VMCA 5F44A 3EYAA 3KPMB 3RJDA 3DV6B 1KFJB 4P23C 1E6JH 4PFQA 4J3VA 4BYHA 4NO2A 1N5DA 2PAFA 1J5HA 1XR8B 5TE4H 3ZZLA 5BMVB 4ZP1A 3KYOA 4UQ9A 2BHZA 2RK4A 4W5QA 4H8QA 1T1YB 3AXLA 2ZBUA 3D02A 4JIMA 2OAAA 3SSOA 2C9CA 4V38A 4M1YA 1SXCA 4KK9D 4JFDA 4GZLA 3DXAD 3HPLB 3HMXA 1BMDA 4OAQA 3AWEA 3VTTA 3FPEA 2C82A 2VIRA 3CEMA 4IIJA 2IG2L 5FCDA 3B7GA 4C7VA 3OVUB 3UYOD 2QX8A 3LN9A 3V0FA 4X6EA 7PCYA 4NRDA 5CCKL 1D2GA 5CZXC 4E2ZA 5F3BA 1UB5B 1UZ8A 2WV9A 2X9ZA 4UEOA 1DJSA 4MLIA 4O29A 1VEOA 5CS7A 3VQ1C 4QRHA 2AJYL 1DQDH 3HHRB 4ZVNA 4URYR 3RS9A 4AQ1A 3ANXA 4YRQA 3ZT5A 1GD1O 2JCYA 3SZRA 5FYJU 3G7UA 3HYCA 3AGQA 4TULH 1Y1QA 4Y8VA 3HLYA 1XAKA 5PGMA 1PEZA 2QQLL 1KO7A 2C0PA 3RYFB 2AR0A 5KWIA 1DVQA 4TNWF 4DE5A 1H15B 1OK8A 3RWDA 4RFOH 1KI2A 2JKRM 4IU2A 2X4LA 2J6HA 1YFKA 4IVNA 4QTTB 5HD8C 4KGLA 1D2MA 5JDCA 5BPPA 1JYXA 5E0KB 5EFIA 1UZGA 3WMRA 2YMOA 3OIUA 5U4XA 4X6FB 4Q9BA 4TTIA 5B1JC 3IEMA 5DGTA 1FMJA 4LEEA 1C50A 2V58A 2G2NA 1MEOA 1TU0A 4CVXA 4YSTA 4JY5L 3D69A 3UANA 4CDHA 4KPUA 4J8PA 4YDNA 2KZKA 1E2PA 2DKOA 2OI9C 3S97C 1NLBL 3HRIA 3OLIA 1I4WA 1Z4IA 1Y1SA 1DJOA 1KC3A 3AW8A 1EWQA 3HC4H 2EFDB 4BQPA 2NY1D 3GINA 3EH4B 5ICYB 4TMPA 1AT1A 2YAHA 1UBGA 4UD2A 2N56A 4N86A 4LXFA 3VGBA 4Q3BA 3ASWA 2BNRA 2CWRA 1G9NC 1OM3L 4UKDA 2XLCA 1OANA 2A6KA 3F65A 4TQ9A 3KE9A 1AQMA 1ABEA 3MMEA 2PH5A 2XWQA 5IT2H 4K26A 3CW8X 1FLAA 2GD6A 1KRWA 5FUCC 3ARED 4FGJA 1MQKL 4HETA 5DC2A 1E2JA 3ICOA 4QG7A 4AN4A 4HDQB 1T04B 1RH8A 5FUYA 1G3IA 4P2YA 3RWGA 3CBRA 2XSZA 3EUDA 2O3UA 1R66A 1QSZA 2B4AA 1SG0A 2W48A 3B8EA 5CVDA 1OZFA 3RUIA 1OF1A 1MF7A 3I2FA 5A06A 2P9TA 3D69B 2Y1LA 4WI9A 4JC5A 5FAKA 3AT9A 4XMVA 3R5XA 1GUBA 3CXFA 2WBWB 1MFAL 4JKYA 3HMXH 4C5BA 2CO2A 3CFBA 3HCNA 5CINH 4GO9A 4ER5A 1AGCB 1R3LB 4C03A 5LAXB 1DJHA 4XMWA 4LWPA 4O2AB 3ZWAA 4UPVA 2WUWE 3S34L 3UZVB 3EXHC 1XO1A 5E00B 3V1LA 3SQOL 1NJSA 5D1QE 4Y2OA 5C0EA 5KJCA 1KGCD 1OIXA 1ZCFA 5HYSA 3CAFA 1HWHB 2C4KA 2QUKA 5TE4L 2A6PA 2AC7A 3VD2A 3LRGA 4ZXBB 5BVJB 3R23A 3R5HA 2PABA 3F1LA 3H2ZA 5GJVC 5K69A 4IV8A 1OAZL 2Y72A 2CK3D 3SYAA 3QJFA 5ALWA 4XBGB 1FUYB 4G8GA 1BWWA 4LGRB 1BIIB 1H1LB 3TJEH 2O0KA 3QELB 5T3XE 4QHMA 4JZNA 4FG6D 1JEYB 4Y6OA 3OMNB 2A0WA 4AH2B 1J9GA 1XLUA 4K9NA 5SWZD 3TRDA 3RJMA 4B47A 1B74A 2WJZB 1AE1A 3TESA 2AJ3B 3PCTA 1EX9A 4KMTH 3SYCA 1R3UA 4E30A 1XCOA 4PB0L 1XH2A 1X7WA 3O4LE 3FJTA 2K2QB 4KWCA 4PJHA 5BXFA 5AW5B 4LASL 1PU2A 4PVCA 5SZIA 5IZCC 1Y0BA 4TULL 1Y1RA 3FCSB 4UIKH 3DVIA 4OSOA 3K6SA 3PABA 3VXMB 4I50A 3L4XA 2MSEB 2JXMB 3M1BB 5K8VA 1Q0YH 4OKDA 3QG5A 2HVJB 5GISL 2HFFB 3A58B 2KKQA 3PZRA 3STBA 3EXHB 1ASOA 5MI0C 2HJLB 1OAJA 5F7EL 2W42A 2SECE 4P2QD 2OXHA 1ZN8A 2ESVA 5C0JB 3G0OA 4R2LA 2ZTMA 3EAGA 2OXIA 3OJVC 3WQSB 1CHDA 4AJEA 3MWYW 4LSDA 1USWA 2CF6A 2GR9A 5INDB 2C0QA 4M1MA 3EGDB 4GM1A 2WWGA 3E38A 3R18A 4F2GA 5BVHA 4DUGD 3L5XL 1Q1JH 4NKMB 2J7PA 2WNSA 4EW6A 1FYEA 5T4HA 2IAND 3WCYA 3X17A 4HEA1 4L2IB 4MVJA 1AQ6A 1KKMA 4FDWA 4XNMB 3OMZA 2IYUA 3JRNA 3VNVA 5TFSH 4KVZA 4WOBA 1ZVMA 1PSKH 2NTFB 2OV1A 1JGEA 4ZFOL 3HZ3A 2XE7A 1REQA 3L0SA 1AI1L 1R64A 1KGXA 3OLDA 3MQIA 2ZZNA 1CB0A 2R6FA 4Z7JA 3G02A 2CKBH 3TL5A 2VUIB 3M8KA 3S4SG 3QPVA 3L5XH 2NSXA 5D7NA 4XNDA 5DGDA 1WZLA 4OO3A 3ARFD 2IV9A 3OQVA 1UQTA 3MRSA 4PZEA 2HGZA 4UIMA 3KTDA 3NBQA 4NQQA 2QPTA 3I28A 3BP4A 1U94A 3EDQA 1P81A 5CCJA 4RH1A 4Z3HA 4RVCA 2BFFB 3ZKQD 2RGNC 1FFWA 4A36A 5A9SA 2M2IA 2PLFA 5DX1A 3MHZA 1VTKA 2NNCA 3HV2A 3ZQ4A 2BP8B 4I18B 3TLMA 1OVGA 1U0EA 1EK1A 4GRLC 4WUUB 2I8LA 3OG9A 1JMXA 5CUSL 4XTRC 3IRZA 4MMXB 5DYFA 4BKUA 5F9JA 3OSZA 4TL9A 3DO5A 4OK5A 5FYKD 5L2KE 3A1CA 2JI6A 2O3SA 4BTLA 3KXLA 5FO9B 1Q2XA 3SE9H 3OAYK 5AM0A 3AC0A 2ZSAA 3DB1A 3GFVA 4I1PA 1FL9A 5CB6A 2ZIWB 1KETA 3O94A 3UZQB 5HS6A 3VKHA 1RMFL 3WIIH 3PUXA 3LHAA 4QT5A 3I2YX 1T7XA 1MCHA 2A2QT 2ENUA 1DQYA 2ZDGA 2Q6WB 3AXSA 4NENA 2OW7A 2GI0A 3ID6C 4R1OA 2OR9H 5HE9A 3ZE1E 4ZFZA 1OTUC 4OY9A 3ZTNH 4DP8X 4X84A 3T9DA 2DPXA 3IIKA 6GPBA 2JXMA 4HAXA 3JATA 2FN9A 1P1BA 4P2RB 5JAOA 1DZIA 3VYRB 2BWIA 1GJUA 2EBHX 4L5CA 2VLLB 1R0AH 3S35X 2ITDA 4HKXB 5AVQB 2MCPH 3LZLA 4DCCA 4IMIB 3NOIA 1O96A 1UJ3C 2OYRA 3ZI7A 5F1NA 4G8EB 5LD2B 4LLYA 3W5NA 4TYUA 4YO8A 2DXIA 1ZHKA 4FFNA 4DGVL 4JPSA 4KXCA 1HM5A 1YU9A 1C3VA 4PZAA 3WWCA 4KO7A 2DTSA 4QC2A 1LI5A 1Y5RA 3WKQA 5JMOC 1Z0DA 5I17A 2OCIA 1GGIH 1I9RH 1IRIA 2C3HA 2P1YA 5D3MA 4ZMQA 4KJWD 3K9FC 1B4LA 3RIFK 5T5FL 1ONSA 1CF8H 4EDWH 1ZU4A 4EMZA 4XC1L 3FVQA 1RZKL 1E4OA 1RUQH 3M3DA 3BQUB 1CNFA 4JP2A 1VCOA 1D9XA 4DGVH 4CNIA 1JPJA 2VSYA 3RS4A 1Y4DE 1Z6JT 2BCKB 1XP8A 2X4RA 4YAUA 4QRUA 2NQTA 1FN4B 4P5RA 5FV7A 5KYGA 1XIWD 2DZDA 2EZ0C 3QVGA 1JEJA 4X45A 3QI7A 5H3CA 4F57H 5EJ9A 4EXKA 1Z47A 1CF8L 3MJEA 2HIMA 4JQZA 4ZALA 4WXYB 3BHNA 2A84A 3FSWA 4NHCL 3QFRA 4YUZA 3ZDZB 4FC7A 4H0IA 5CA0A 4KXXA 4GLRI 2JI4A 2E55A 2D03L 1C9MA 3U9LA 1OGYA 2WANA 4HFJA 2QY9A 1CLCA 4BLPA 4PV1C 2R7EB 1D2PA 4TSAH 4O0MA 3HNVL 3OA2A 3WGMA 4MNQE 3ZO0A 4EFLA 3L17A 3NW9A 1PT9A 2CUKA 1UD5A 1D7AA 1SY7A 2R8XA 4FQQB 4YJGA 4Q56A 1H3PH 2BP0A 1P44A 3U44B 1M2HA 4JLAA 1SOSA 4H08A 3OKOA 4UZGA 1F8GA 2VAAB 4QHKI 2I7VA 1OAYL 5I1IH 5B38A 1V71A 3P9PA 5EWLA 1MI5B 2XXAA 2E3JA 4EBQL 5LB2A 1XGYL 4BQNA 4X41A 2PCJA 2YWYA 1K8XB 2GJ9A 4RK0A 5AW9A 4GR5A 2GILA 3GRBA 3PJDA 4B31A 4ZUUB 3ZI0A 3FH0A 2O2SA 3LY7A 4C14A 3IDMA 4ZZ0A 1NVGA 2VTFA 1AC6A 1YEFL 2GJAA 2WE7A 3CKMA 1VLZA 4AGOA 1XBTA 3RH0A 1NY6A 5LIRA 1CWVA 4IKKA 2OK0L 3CZPA 3D6NB 5E6SB 4IFEA 4UVGA 5DR5H 4AV4A 2FJGA 2EVHA 4MQUA 5REQB 4WCYL 1FI8C 3AF1A 3GNLA 5A2JH 3SJBA 5H4HA 3LPGA 4W9IC 4GE0A 3RAJH 1PFKA 2R62A 3OTWA 2AJ8A 3BFXA 5J3HC 1J2EA 4N7JA 3L3JB 2XWSA 2R23A 1WCIB 4F5ZA 1FGNH 1PSKL 1RZJL 3CMCO 4LRSB 4F4UA 5IYZF 2EXSA 5I9QB 2RHEA 4JKPL 1C0LA 3WE6A 4UV7H 3F97A 4PLGA 4NESA 5HJGA 3UG6A 2EDLA 2WCSA 4HGMA 3WK4A 3SD7A 3ECSA 3QJRB 3NBNA 1YQWA 4HQ0A 2AN1A 2A94A 1QACA 3DDCA 5DSTA 3UW1A 5L8KB 1DFGA 3QIUC 5HPOA 1SLVA 1E1CB 4BTVA 5K3AA 2ZE0A 2P11A 3TOSA 4U1JB 3QOXA 2ZCVA 3PHCA 3HWSA 2CJFA 3L0OA 3TVMB 1PTKA 3IDFA 5T64A 4IM8A 1SBSL 4L5FL 3MBWA 1RXUA 2YD5A 4C2AA 3TTVA 2EYSA 2VJ0A 4GKNA 1ZS8A 3ZTEA 2V2WB 5B7PA 4R1UA 4J8RA 4TS9A 2XYVA 1MG0A 4IXMA 2O52A 1WISA 5LQAA 2NX5B 4HUNB 4Z4EA 3IHLA 1N5AA 2PR2A 4PJDB 2X4TB 4XYEA 1HE4A 4M7JL 5JD5A 5ECGC 5AW8A 1ZHKB 1GAFL 3EOTL 1JHXA 4IKIA 3FFTA 5F7BA 2EDFA 1JF1A 4PIRF 4AL8C 3BQNB 5CFMA 4XOIA 4X9FA 1JF8A 1RWVA 3DIFA 3GMRA 3LQZA 2HSIA 3Q8LA 2Q41A 2E9GA 2BDTA 4ARBA 3K2QA 4J76A 3PQYE 4QOFA 5HGBB 3U13A 2J2ZB 1SUAA 1KMGA 5KDOA 3SXPA 2K45A 1XEWX 4CG0A 3FTUA 3RG1C 2ZKLA 3BCUA 4PO9A 3MJRA 3A4DA 4H40A 4W9NA 1W29A 2V6JA 1PX8A 2WAYA 1G9EA 5LQRA 5EIVA 1DBKH 2YTZA 4YDHB 3L4KA 2Q6LA 5DT9A 4FYTA 3WDLA 1I9CA 4ADGA 5BO5A 1N0UA 3COWA 5AVXB 3ITKA 3IP8A 3WHKA 1TQBC 2HWKA 4E7PA 4H1WA 2G17A 2JI8A 2F3TA 5KOJA 5L9AA 3R7BA 4R4BA 4Z99A 3PK0A 3FKUS 3NDJA 4A7VA 1OIVA 2QMZA 2DQFA 1KYOK 2V7QA 3RU8H 3CF4A 5TJ9A 3P9WB 1UJCA 5I45A 4MQ5A 1IGJA 3HPLA 3KHTA 3GNMH 1EDDA 1JTEA 2QR3A 3PQYA 2V5RA 1BQHG 4YCLA 2NO4A 1CN4A 2WXJA 2I2FA 1P7WA 1Z6PA 1DKMA 3KE0A 3VNBA 1ZV5A 3QEAZ 2YFHA 3G85A 3LEYL 4B4OA 4JANA 2BFCA 3BVNA 4RKWA 1YBAA 2Z7ZA 4AO6A 2XCUA 1I6MA 4BLQA 4TTPA 4Y19B 1LSUA 2VXCA 2V7WA 5AIBA 1T2AA 1W6UA 3RNKA 5JHBA 3TFWA 4CODB 1XV5A 5ISZA 2XCOA 2OXGA 3L95A 3M17A 3FTNA 2FX2A 3AERB 4QXGL 1R6BX 3R6TA 1GAQA 5TTRA 5FLXA 4RSMA 4K55A 2YNMD 2YS4A 1XGTA 3V4SA 5F0MB 4BQRA 1NJ9B 1G5AA 5GHWH 2HFTA 3AITA 2ZR8A 4DBVO 1G7PB 2XBZA 1F4WL 1TLFA 3TBTA 1VL5A 1BF8A 4TVOA 2DQTL 1PDKB 4Q6WA 4U05A 1J39A 1XDBA 2D1TA 4M37A 1KFBB 3NMEA 1XKXA 3MVEA 4HKBB 2DFLA 2WO3B 5K6RA 4BFIB 3CRVA 2QSCL 1H6BA 3GRVA 4IRZH 3DETD 3F96A 1FNLA 4P82A 2DH2A 2AQIA 821PA 3VWJD 3IXTB 1OAUL 3GA7A 4N8VB 3I5MA 1C1DB 3KRTA 5I1KL 1E5QA 1U8OB 1J5IA 1V8ZA 3B82A 4OAPA 5IJXA 3I3BA 5F7XA 1KVTA 3ZGYA 1FTNA 4KRFA 3KCPA 4OJEH 1T0MA 2FEDD 5J63A 4H15A 4L5AA 4EOWL 3D8BA 4KQ4H 1FOEB 1F48A 4O02A 4Z78A 3IF1A 2ODQA 4TMXA 3BQMB 3VGJA 2GFBA 3NIGF 3GLFE 4S0ZA 5H83A 3ZKWB 1M5TA 3N43F 5D87A 3IVMA 3VR3A 4K7FB 4IS6A 4RX4D 2JFPA 1BE1A 2A77H 5A5GA 1HT3A 3I1JA 4N25A 1MNUH 2NT1A 5GIRA 1LEGA 4N5LA 4LDAA 5IBLC 3IO3A 1MTZA 5GRJL 4EDHA 1MO6A 2WWTA 3RL1A 5HMLA 1FUIA 3U9WA 2RGRA 5J1AA 1E4XH 2CSPA 1I9JH 2Q4TA 3QVSA 2PMKA 4GNRA 1I24A 5LBUA 5IF3A 5E6IC 1IY8A 3LCVB 1J10A 2A59A 3N43B 3NVAA 4OIAA 1EX7A 4ZRMA 2FT7A 5EB9A 3F7TA 4R7LA 5B7EA 2AGVA 4A2LA 5B1CA 2J56A 3FOEC 2FX8H 2HFFA 1PV2A 1NMCC 3BJEA 2EW2A 2IPNA 2BL4A 1Z16A 2OJEB 5EIBD 1EU1A 3ESVF 2BTOA 4WSJA 5E2TL 3DOFA 3UCEA 1SEQH 4RIGA 5ESQA 5HBGA 1TVCA 2P8LB 2XFXB 4LF3B 4AMKH 1GZUA 4M61B 1X1AA 1NYQA 2C54A 5IH7A 1XF4A 4IIUA 3FKSA 4U7PB 1S7RA 4NNXB 4Q9AA 2VN5A 4HXAL 1QYDA 3DLQR 1S3GA 4TZ6A 2I3AA 1LQSR 3JWOH 1F0NA 1IC4L 3PQDA 4PJ9D 1XJQA 3ZYOA 4KU1A 3JQ7B 1E3EA 1Q1JL 1UKVY 2ODTX 4R7GA 4U3XA 2ATCA 4WHMA 1YAIA 4ZFOB 1Z15A 4W68A 2XVKA 3HN7A 2P2CA 4YFLF 1L0XA 3BQUC 3ELBA 2J4DA 4GOSA 4ZC8A 3VI3E 2YAOA 2ECKA 3K09C 3VMNA 3DTXB 3OKNB 1RI3A 1DBAL 4ALAL 5JTTA 1OM9A 4D4MA 3MOBH 5C3LD 1UCBH 3NLLA 4A0HA 3KZVA 4Q19A 2ZSVA 1S9HA 1TQSA 1KDZA 5A4FS 2HJHA 4TV3A 1SOUA 4I4TB 1ISJA 2XVBA 4BHUA 2VJAA 5IDWA 4LGVA 4LNUB 2DDQL 4ZAVA 3B3BA 4MS1A 6CGTA 1P80A 3HSYA 3N39C 1SBCA 4Y2OB 3RVJA 2QF7A 5HRCA 5B6IA 5IXJA 3LUAA 4NX0A 2K78A 2E7MA 3SDYH 3TFQA 1QHXA 5JXGA 1I5OA 3U4BL 4DNXA 1LWJA 3LP5A 5EZSA 5IJ0B 4AXXA 4V1DA 5TT1A 4C57C 1D9KB 3BEDA 4OQXA 3WTVA 5C7YA 1ISPA 1OP5H 3VXQA 2Z7UA 3I39X 3MNZA 4CN6A 1CXHA 1KIFA 4IH1A 1WE5A 1KS9A 2QRZA 4G1BA 4WNAA 2FOLA 2K7PA 4TTVA 3TZ6A 2ZKWA 3MRIB 1DBVO 1PK9A 4G80B 2R7EA 2YSSB 1P9RA 1G87A 4REOA 4CIVA 2GITA 4YROA 4UQIM 1XF5B 3BJLA 1I1NA 5KBDA 2ZS7A 4Z0PA 3D87B 3SGDI 1QAQA 3RVMA 2H2GA 1FMFA 3IDSA 3U3DA 3RJOA 1NCGA 4RAVB 2JFZA 3B2UC 4WU7A 4OZFG 3IB6A 5C32A 1A47A 3HE7D 3ZGZA 5A0VA 5DU2A 2QN9A 4B7CA 1U2CA 2A38A 2X7HA 3OQHA 3EJRA 4LSTL 1KVSA 2MH4A 3W4KA 2FP4B 2ENPA 4FFYH 4NKRA 1CRQA 2V2XB 4U3SA 2QELA 2DR3A 3CC1A 3P2BA 2E37A 5K9KB 1BXAA 3ROOB 3SJVA 3SODB 2PWBA 4FJ0A 5DNYB 5IIEA 5EH1A 4ZMYA 3OOWA 3D4LA 4PEVA 1I7PA 4NMMA 3MRBA 2Y6SD 2E0PA 1KDJA 2ZG6A 1N2CE 4G8BA 1E7QA 2B35A 2WXHA 3GSRA 3JARB 5JUWA 1JERA 3UYLA 3FQUB 5AOJA 5I1JH 2R8SH 4AWBA 4YSDA 3O3CA 2R0WH 2QMOA 2IDMA 2LR4A 5BO0D 3N06B 5D2LA 4QBTA 2XY2A 4GUAA 4QRRD 3JD1A 3ROZA 3LS2A 3G6JA 3Q8FA 3KGSA 1MV5A 1OXSC 1YMMA 3ZR4B 4E9QA 2Z1MA 2A73A 3O3DA 1GZ3A 2IWRA 3A4MA 10MHA 1FFPA 3GTTA 3R1GH 5A4IS 4WY8A 2HLDA 3WL8A 1FYWA 3H65A 5KBPA 1QV6A 3OAUH 3GBNL 1IKNC 4M43H 3QQDB 3DURA 2APSA 1KPHA 5A1AA 4ISCA 4L7QA 4RHUA 5P8WA 4H1LA 4JQVA 3EH1A 1XTUA 1XD9A 3L92A 3WFEH 5ERXA 2YQ5A 2HH0L 4PLZA 4B0MM 4BP3A 3GMNA 1YIDA 2PMDA 1SH7A 4N0CC 1H2BA 3RTDA 3AKZA 5IW6A 3KR9A 2IH9A 5DGXA 3DMFA 4GMSL 3WWOA 3W11C 1C12A 2IYTA 3GRYA 2PCPB 4Q3KA 5G40A 1HDGO 3VSVA 3OD5A 2EO1A 3HUJE 2V7GA 3GLAA 5FM5O 2J9FA 5D7SH 5E8DH 5C0BD 1F6LL 5CUSH 1TCCA 1CK4A 5D93C 5T1MB 1VFMA 1ZKAA 2O59A 5CLZA 1QHPA 1ZLSL 4L29B 3ZU8A 4Y16A 4MRNA 2Q3XA 1JPGB 3D3VA 2HRPH 2FSPA 3P0VH 3QLUC 3N44B 1U1FA 3LUCA 5J43A 3SVZA 3BL8A 2BC4B 1VG8A 4BKMA 3REWA 2CJSA 2V7UA 3MV8A 2YJ3A 5TC4A 2ATEA 2D0IA 3VUEA 4UOEA 2DVMA 2F54E 1L4YA 4P2OD 3AVOA 5FTKA 1G9NL 1OE0A 5I2IA 3FUKA 3HC0A 4CN1A 3PDCA 2NLJA 4RFVA 3RF7A 4XUEA 4GAGL 2MPVA 3T94A 3N40F 4X24A 4L4YA 3TQOA 3SR3A 4HBCH 3NA4A 2IMMA 2JF1A 2QU8A 5FI3A 1PNRA 3N86A 3CRNA 2EP5A 3GLRA 1TYEB 4U6XB 5BUSA 3O8QA 3VOTA 3C7CB 1J33A 4Y2HA 3KPUA 1XCLA 1U6JA 2R4QA 2LU3A 3POCA 2QV7A 2N7BA 3OTQA 5GRXG 2FZ3A 5KVMC 2ZM5A 2GEFA 1FNCA 5KKAA 2J5BA 1OAAA 1VGKA 4TYPA 2Z1KA 2WNHA 5CITA 2XV3A 4ERSH 1MAMH 3T0IA 1TGVA 2DF8A 5A2BA 2KBGA 3HNRA 3SVTA 4R7XA 2G3MA 4UM8A 3VFVB 4QLOA 2DLFH 1H2RS 3D8RA 1WHTA 3CHSA 5ALTA 3IYLW 1LZKA 3LK7A 1DSWA 2G2RA 4F5EA 1LI4A 1QR2A 2P4AB 2QPEB 2EJBA 4U7MA 5EHFA 1OX4B 1Y8AA 4MOWA 3P9KA 3P0EA 2AJZA 1B0RA 3MCLH 3DFKA 2GXAA 1FVDB 2Y3AA 1IUNA 4TWIA 3L6CA 4LFHG 3LQ4A 3ZHBA 2DIJA 4X1KB 3CBGA 5E24E 5EESA 4C6TA 1QFSA 2B1RA 1WZIA 4F84A 4L15A 3WLRA 1NC3A 2AZUA 4DN3L 4IIYA 4K94C 4ODXA 3V4PA 2H00A 4EUEA 3QJUB 2K6ZA 4WI2A 1M2EA 2EDQA 3L7JA 4J4PC 3HR5B 3NIDF 1C5BL 2GN9A 1PY0A 1PNOA 4MR7B 3R8BB 3WS3A 3Q2VA 3KD2A 4N2KA 5AKEA 2PVCA 5DVLA 1ILEA 3EYOA 4RD0A 2GA9A 4G11A 2YFOA 1TJIL 2QAJA 3E8UH 3IGLA 2CAKA 4F80A 3BPLB 3Q5GA 4FCVA 3ULAB 4HR7A 3EW3B 2PPDA 4UIMB 2ZU6A 1LRJA 2YRFA 2Z98A 4W4OC 1NKTA 1XKTA 2XVAA 3RX5A 1OLXB 2DSTA 4U2KA 1MCKA 2IAMB 4CIDA 3GMOA 4B41A 1QG4A 2QN1A 2WWOA 4JHUA 1JNHB 1TVKB 4MVJP 4ZDWA 2ZPTX 1INQA 5K6TA 2FJGB 3CZCA 4KTGA 1YTUA 4FHKA 1S5IL 4HDCA 4UPEA 3MBWB 4DUZB 2FZ5A 3QBTA 5I9BA 3BVPA 4ARIA 2J0UB 3HA3A 1N5LA 5LOVB 3GI1A 4LOAA 2AV6A 4O02H 3G6WA 1YS4A 1Q7RA 4QYWA 4H2CA 3DXYA 2A6DB 1BD2A 1QFUH 1QHNA 5IUSA 4QATA 3SE8L 5L3RA 4LE1A 5CXQA 4X98A 2ZAHA 1FFHA 2OT3B 3HA5A 2OMKA 1Q7CA 1G0DA 1IGML 3HDQA 5BQFA 3R7QA 1VYHA 2B34A 1WETA 4B3EA 3QW9A 1NVFA 1A4UA 1JKJB 2G77B 4Q18A 4QTYA 1XNRB 1CFTA 1RQNA 1U98A 4K7PH 3E84A 1M1YB 1NWOA 4GOKA 2DP4E 3RY5A 3LQZB 1Q9WA 3WICA 1QKIA 4PLNC 3QDJB 3HXQA 3VSUA 3HB3D 4FYYA 3SBWC 2W92A 1X39A 1M2VB 2CEKA 5DN6A 3RREA 3D0AA 2FVNA 3T5WA 5ERYA 3FTSA 2H9YA 5EYPA 3CXHJ 3LAFA 3PWZA 4K6HA 1EGMB 3L4EA 1YNTA 3KETA 3M6AA 4EA8A 1A4KB 3DT6A 1WTGT 2BSTA 5LDSA 3I6YA 3L2OB 3L7IA 2PD3A 3SJVE 4JVSB 5F70A 3L4YA 1KBWA 3AB7A 4I3FA 3PHOB 3C41J 4LMRA 3ETGA 1M1NB 3P0RA 1DIOB 2VSDA 4X6CA 2P9QA 2OPBA 1QZXA 3MWDA 1DVFB 4FTVA 4M8QB 1ODCA 3UG7A 3F04A 4KTDL 4IJ3C 3P3RA 1N8NA 3DKHA 1GG9A 2QJRA 1TITA 2DECA 2Q9BA 3B8YA 4GWLA 1FH5L 1ZEAH 3TOCA 1DBPA 1E2WA 4R84A 3WXWL 4B0PA 4MS3B 5G02A 5CKAA 2BP7B 3CDGB 3HIZA 4H8WL 2F3SA 3SFTA 3OAZK 4YHIA 3SDDA 2NZ8A 4XCNB 4DLWA 2XWBA 5HGDB 4BFKA 1KZYA 3JWOL 1P6UA 2C5DC 4A10A 4EO4A 1FGVL 3L1KA 4W4NA 5JIIA 2HG5A 3AKEA 4DV3B 1OV4A 1A7KA 4GO8A 1IVNA 5D3MB 2RBKA 3SJAA 1INEL 3SCMD 2JFQA 1CICB 1AZRA 4LOIA 3ULVC 1OASA 4WOJA 1XDDA 4FXKC 4OA5A 1D2HA 4MO9A 4PI2A 1LBTA 3RROA 1AXRA 4RTLA 1F2UB 4FZ3A 3NBFA 4HZLB 3HZKA 5DQ9A 1A7NH 1FLDA 4UVIA 4AI7A 2X58A 4OGZA 3D08A 5EZJB 3UJJL 1I94B 4EY7A 2B5VA 2JRLA 4KVNL 4X8XA 4NEQA 1ETJA 2HX8A 4QUOA 5NLLA 3SYTA 4L8LA 4MRBA 4Z7VB 1TQCB 3H11B 4Y1RA 3EXG1 2C8JA 4RMHA 1RQLA 4CLRA 4AM8A 4IDNA 5IF0B 3M1CA 5T41A 2IX9A 4EYGA 1DKQA 4PRHB 3Q7RA 3DE2X 2BY2A 5COAA 3PE3A 3UWOA 2YQZA 4NQCB 1J0KA 3OKEA 1DOZA 2VDWA 3TFKC 4KK3A 3K1AA 4U6HB 4D82A 4OYHA 1B2YA 1YQQA 2XKSA 4A7GA 2DH6A 2E7LC 4JHZA 4QI3A 1NZRA 4QWMA 1CE8A 4WTXA 1JJIA 3P9XA 5AP9A 5CP7A 2OA0A 3GS0A 3C5HA 1GKEA 1MJFA 3IUSA 2QXYA 4WVFA 4GKBA 1PFWA 1SYSB 4G5HA 1WXDA 1Y6FA 1ZJAA 4QO1B 5KVEE 1DINA 1GRCA 3NKVA 4YPVA 2WLKA 3DWFA 3TLCA 3IAFA 3P0IA 4K0RA 1RJFA 1U8OA 4CF3A 2BP5M 3CHXA 5HJEA 2VR8A 1MFZA 3I83A 4XOEA 4D0DA 4PJAB 4FQLH 1RUQL 1AKYA 3S3SA 2ASEA 3DC2A 4BK8A 5HYJB 1G55A 5UKDA 4JCOA 5DOVA 2CSUA 4AY6A 3UGJA 4XH2B 3C1OA 3ICWA 3MRKB 2A92A 3C3KA 3ABZA 2FX7L 1ND6A 2YIMA 4MLCA 3ILQD 4MWTA 1MW9X 2ZP0T 3VFWA 2DPHA 5BW7A 1R15A 5G4OA 1WUHS 4JT8A 2I2DA 2YAPA 4MXVF 3S3BB 2QA5A 5KBMA 1SOQA 1Q50A 5L9DH 4MJIE 4UEQA 3MA9H 3RKRA 2ZJ8A 1RUKL 3LQAL 2ZXAA 3R4CA 1TA4A 1G19A 2DL9A 3QNXB 4F3RA 1MCNA 3DGEC 4NP4L 2I6GA 3QHQA 5FL3A 1NUFA 4PJIA 4BO7A 2P80D 4BZWA 3LPFA 1OKKA 1OJLA 2CUAA 4XRCA 3DT9A 2QLFA 3GL9A 4KMOA 4EPYA 4JBIA 2E86A 1D5MA 3O2DA 1KIAA 2B36A 4AT6B 4IUBS 5L4SA 4D4KA 5JI3E 4HIIB 1N6NA 4KAQL 1XR8A 2FWLB 2WTUA 4POYA 5EP4A 3LKRA 5IREA 4JJ5A 4QQNA 2X41A 2NVUB 1XCQA 4LSPH 4NZOA 4Q15A 3QAQA 2QLYA 3GLIA 3BE8A 2NXZD 3U7YH 3LW8A 2MYNA 3DROB 3X0DA 3CDCA 2CHXA 4X2UA 3GI8L 4HEME 3TBCA 3VPAA 1BFVH 2AK1H 2CDCA 1N70A 4TQHA 4ZO9A 2X12A 3V9AA 3P2YA 3REQB 3MG9A 2OSYA 3QUYC 4HS6A 5H5JA 2ENJA 5EP3A 2EDOA 3GFQA 3TKYA 4D0CB 5AKYA 3L7EB 2BKVA 1XVAA 3UCQA 3IP5A 4D79A 4BE5A 1U95A 4JM2A 3I9MA 2LLLA 1DC4A 1JZTA 4UVEA 4JOQA 5KG9B 3R0XA 1LO0L 3ISRA 2X6AA 2D0GA 4N68A 5HGBA 1O75A 2HJFA 4N1EA 5AFAA 1MC8A 2Y07H 1ZD5A 4MJ7A 3DZKA 5EO9A 3RV3A 3DX6A 4MHOA 4D0DB 1ZI9A 3CCHB 4M5ZL 1OXYA 4Z0BH 1P7CA 2O1EA 1ACYH 2X5OA 5J6GB 5EC2A 2XRYA 1NBVH 3CC8A 4JC0A 1PP4A 3HRPA 3OZAA 3PHJA 4FN5A 1Q1ZA 4BUZA 3RTQD 1A7JA 2QYOA 2CB9A 1XEWY 2VUOA 4ALAC 5JW5A 3VBCA 3B7YA 1IPEA 3S7TA 2FCAA 2QRLA 1G8KA 2D0FA 2QOEA 4FWTA 3E0GA 1BE0A 4H7HA 4NQED 1Y8ZA 3R4DA 3KWLA 5E1GA 2XX3A 2C9QA 3W39B 4O00A 3TYGL 1P75A 3RFCA 1X7HA 2EZUA 5JW4R 5G4KA 1DHTA 3I72A 2QEJA 2UY7B 4TV9B 4MYPA 2WBJA 4WW2A 5IT0A 1HG1A 3G2IA 1JLHA 2SKCA 5FWXA 5IEKA 4LZJA 5A9RA 3RBSA 5B39A 1RKRA 3QIBD 5EPOA 2A6KB 4C20A 4C01A 1Y8RA 1IHDA 2FAXA 9GPBA 4H8HA 3FOAA 4LIQL 2E7CA 1ESZA 2ZX8A 4Y2QA 5LAXA 5FYLL 5I9LA 2E47A 1V3QE 5F9WB 1M75A 3S36L 1D2EA 3T3PF 4LGYA 4X1IA 1VYUA 1YEKH 2CMRH 3OWXA 2Q7AA 4QTXA 5HD8D 2VISB 4Q4JB 1RWNA 1UMCA 3OWOA 3L5IA 4HUKB 4L4JA 2J7PD 2EH8H 5JIQA 4S2EA 1GVIA 3BFKA 3A6BH 2W2TA 4MQXC 4HK3J 3MXVH 3V5KA 5DMJB 3KT0A 5FW7A 4BIMA 2H45A 2WXKA 4WEBH 5KEIA 1NUGA 4UXJA 3QFCA 3IURA 1Z5OA 5IHLB 1SOXA 5CN1A 4F20A 1CKEA 1PY4A 2P9EA 4UU7A 1E7SA 3HYNA 2OR7A 4XH2A 4EUPG 4YFVA 2E87A 3KXFD 1A8IA 2PKXA 1JEYA 1RJZB 5ALHA 2Z92A 2YASA 3VXME 4KFRA 3UHAA 5K01A 4D0LB 4XX0B 1RMYA 1OWLA 4GGPA 4NRZB 3G6DH 2GJJA 3D1JA 1FL3B 3AADB 2APFA 4AXBA 2AK3A 4J1SA 1O7DC 1ZSHA 5KVGL 4WEBL 1NGXA 1JAXA 1WRFA 1BU5A 4FT2A 1HVXA 1P0SE 2Q4BA 5HYEA 1N0LA 1JK9A 1O4VA 3KYDA 1PVOA 3OIFA 1U8QB 1KIUA 5JHLA 4LVUA 4BNYA 5LJIA 1CK0L 5GSVB 2EC9T 3PL6A 3GRCA 1RULH 2XMDA 3MGGA 4UQDA 4WACA 3WLLA 2GJ8A 1Q0EA 3C09B 2COKA 2RQ8A 1ZESA 3P9IA 2REQA 3ARWA 2DMKA 3BIWA 1Q17A 5IMOA 2XNKA 4LOUC 1U3ZA 1THMA 2XWPA 4JASB 3EEIA 1E9EA 2ED8A 4E5SA 1KGSA 4HEHA 3CN4A 1WVZA 3O4RA 4GVXA 4A73A 1XMIA 1VE9A 1TTPB 1LLFA 2CLLB 4P3NA 2Q1TA 2QT1A 3O74A 2C7QA 3EZXA 4ANWA 1YEWA 3LTEA 5MP6H 5DTIA 3CPLB 4XN5A 4F8PA 2Z5FA 1URPA 4N9WA 1IOVA 3REOA 4MKMA 1AZBA 2I7XA 4G0NA 2OG2A 2FW7A 3QPCA 3LKQB 3WBFA 2ETVA 4RS3A 3FTGB 1DKOA 3IGAB 1ZW6A 2WUDA 2DWPA 1HAUA 4YS6A 2OBGA 4KOBA 3AACA 3MCYA 4PRIE 1WXIA 2O23A 3LZ6A 3PVSA 1LL1A 4ZAWA 1MDFA 3RFXA 3U0TB 4C4OA 4FQXD 3WP0A 3BFQG 3VGDA 4H2AA 4FG0A 1U90A 3OQRA 2X70B 3R7NA 5C7XL 1Z12A 3N28A 5L51A 4PWKA 2D4DA 1X7YB 1P1JA 3I9GL 1W59A 1WA2X 2MHAB 3DQZA 5LQKA 1Z5GA 5DK2B 2HG5B 1I8UA 2HFJA 4KKVA 1Y6ZA 3CHRA 2LAGB 4OKVB 4J4HA 2A6IB 4P3PA 2P0YA 1VC2A 4BHUI 1H5UA 3AR4A 3IAS6 1XBRA 4DUPA 2WLMA 2OULB 4ABWA 1T25A 5ACZA 1HHGB 4I1SA 4JUCA 4TUYF 5EU6E 4LBZA 2PO6C 4FA8A 3N5CA 4OCWL 1QR6A 2BMWA 4OF6A 4FFVD 4KJQC 2PGNA 1OCEA 2P3QA 4Q34A 4A0RA 2DQJH 2PNDA 2QGFA 3I2KA 1G60A 4G3XA 5FCSH 4PYGA 4NENB 1FFTB 1HE3A 3TW6A 3FU7B 3AL0C 1S7SB 1JE6A 4CVUA 3O6LH 3P2MA 4O2LA 4YSSA 3QH4A 5JSYA 2GY7B 4BB6A 4J3WA 4Q1FA 1RLWA 2JTDA 2KDGA 3FB5B 4F15B 3LS5H 4EGQA 3DV0A 1LTKA 2A5LA 3H1BA 1CVIA 2JFBA 3OCYA 4TMVA 2WNIA 1QIFA 4FI8A 1GYAA 1CL7H 4LY6A 2I9TA 1GQRA 1RSYA 3V6FA 2IWFA 4TM9A 5ARCA 1IGCH 4LYEA 5FGRA 1DFBL 3KK0A 3OMWA 4WGGA 2AN3A 2YH2A 1I5RA 3FHLA 4H8WC 3L4TA 1LYQA 3AABA 2RD2A 5IR1B 2E6KA 5EJ8A 4ONOA 3RY4A 2GXQA 1SD5A 5I8EA 3LDHA 5J6SA 3K0FB 4ZVKA 4Z9KB 3RC9A 4TNVF 1X0XA