3ZDZB

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 111
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3zdzB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3zdzB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3zdzB03
3OKWA 1LFAA 2ICAA 1U0OC 4WK4B 2VDKB 5HJ2A 1M2OA 2IUEA 4MMYB 1M1XB 3NIFB 5E6SB 3T3MB 2VDQB 1M2VB 1SQ0A 3FCSA 1QC5A 3PPXA 4PN7A 1RS0A 3EGDB 3VI4B 3OL2B 2VDOB 5E6UB 1U8CB 4HQFA 1ZOOA 3NIDB 2XWBF 1OLZA 4NENA 4GZ8A 4O3TB 1AOXA 1BHQ1 4HQLA 5HGJA 3K72A 5KYUA 4C2BA 2VDPB 4O02A 3OKYB 4HQKA 3FCSB 2VDLB 2NUTA 1MJNA 4IHKA 2WINI 3EG9B 4NENB 1XDDA 2ADFA 4WFQA 4IGIA 2P28A 4BJ3A 3K72B 5KYUB 3AFCA 3NIGB 1U0NA 5KYYA 1RD4A 2XWJI 3ZDZB 5E6UA 4M76B 1U8CA 2NUTB 1XDGA 1CK4A 1RTKA 5E6RA 1SHUX 5BV8A 4UM9D 1RRKA 3HXQA 4G1MA 1SHTX 3N2NA 3AL9A 4F1JA 4HQOA 3F78A 1YUKA 2UZYB 4FX5A 5KYYB 4WK2B 1ZONA 3EG9A 1SHYB 3F74A 3BQMB 1QCYA 2O7NA 4C29A 5E6RB 4DMUB 1M1UA 4UM9B 4G1MB 4CN9A 2VDMB 1N9ZA 2WW8A 3RAGA 2ODQA 3EOBI 1IJKA 5KYWB 3V4VB 4FWWA 1YVRA 3EOAI 3K6SA 3TCXB 3GXBA 4WK0B 1DZIA 1OAKA 1V7PC 5ES4B 4Z7QB 1Q0PA 4JDUA 1N3YA 4Z7NB 3IJEA 4WJKB 3K71A 1FE8A 1AO3A 1MF7A 4IXDA 3K6SB 5HDBB 1MQ8B 4Z7OB 2I6SA 3BQNB 2X5NA 3TW0A 1TYEB 4NEHB 2VDNB 3ZDXB 3ZDYB 2ODPA 3M6FA 2I91A 1T6BY 3QA3E 5KYWA 1PCXA 3Q3GE 3ZE2B 1BHO1 1ZOPA 3IJEB 3K71B 1XUOA 1SSLA 1MQ9A 1UEXC 5KYXA 3TVYA 1YVPA 5LN1A 3E2MA 3ZE0B 3VI3B 1NA5A 2QTVA 1ATZA 4O3UB 1FNSA 1IDOA 1PT6A 3EGXA 2VC2B 4G1EA 4UM8B 3PPWA 3ZE1B 1T0PA 1IJBA 1M10A 1CQPA 1AUQA 3ZQKA 1MQAA 5KYXB 3TXAA 1JEQA 3AL8A 3IBSA 4JX0A 4K3JB 1JV2A 1MHPA 2VDRB 1JEYA 1DGQA 3HXOA 1IDN1 4CN8A 1L5GA 3EGXB 3EH1A 4G1EB 3PPVA 3V4PB 4MMXA 4HQNA 3HI6A 1PD0A 4MMZA 1PD1A 2M32A 1JEQB 2NUPA 3AL8B 2XGGA 3EFOA 3BN3A 3EH2A 1QC5B 2B2XA 4CNBA 1JV2B 1JEYB 4A0QA 4C2AA 4XW2A 1L5GB 2NVOA 1JLMA 3PPYA 3NVQA 4MMYA 5KYNA 1M1XA 5E6SA 4MMXB 3T3PB 2I6QA 3FCUB 4MMZB 1M2VA 2NUPB 4O02B 3EGDA 3EFOB 2P26A 3OL2A 4F1KA
chains in the Genus database with same CATH superfamily
5GZNC 5AOBA 3TH5A 1ZJ5A 3J7TA 3RI5K 1PFYA 1QHIA 1PNVA 1DC3A 1K5HA 1A5AB 3ZR6A 3CNNA 3CIOA 2H63A 1PUJA 1T24A 1U2GA 4YXWA 4WFQA 4HWBL 2HC9A 2CO3A 3PE4A 5F5XA 2BPOA 5EU6D 4PLVA 3D6UA 1NF3A 2FWUA 1E94E 2C1EA 4Z78B 1IL1B 3HKDB 4KVCL 5DCLA 6ADHA 2FJHB 3NIDE 4V1DE 3CSYA 3L1VA 1RQNA 4AG5A 1URIA 3LUJA 2ACEA 2H2IA 1R64A 3T3OA 3LEXB 2F53E 3K0YA 5DLEA 3K6SA 3T4EA 5HDLA 2F3PA 3C97A 1E99A 3PX2A 3A04A 4WRLA 5DD3H 1F3JB 3WLWC 1UBUS 1ADBA 2PT7A 4N76A 1YDPB 4PVBA 1GAQA 5ISMA 3V4UH 5EOCJ 2E4YA 1DQRA 4IS3A 4X0KB 2RB4A 2JAXA 1TQBB 3TF4A 5DTIA 5FM8A 1Y07A 3NA9L 5E4TA 3VDNB 4Q9JA 3E9CA 1GS7A 1CBVL 4DETA 5KSYA 3QW4B 3NDBB 1UGNA 1KY4A 1XD2B 5ILTH 3B53X 1QQAA 1A9BA 4BNXA 3PKIA 1ZKMA 2H1PH 3VFNA 4X8JA 2JRCA 4PY7B 5FA5A 3F3HA 2HLHA 3LL7A 1RC8A 3U3JA 1IUZA 4L1TA 2UUBB 3ULUH 3L7LA 1ORHA 4A67A 3CPEA 1HYGA 3W1VA 1YE5A 1MIHA 1IY2A 4JMPA 4XVRA 5J8OA 2X4SB 3EA5A 2PYFB 4AMWA 2GD1O 1ZESA 3COJA 1XAIA 5SWSE 5AM3A 3X1JA 1KTDA 4WLOA 5AVTB 3TN0A 5D70L 4YYEA 4BRUA 3ZYOA 1YDEA 4XRCB 3G3LA 2B59B 2BAGA 1N34B 1J0YA 3SYNA 4EUHA 1DZIA 3GI8H 3MRHB 1H42A 1QOZA 1CJYA 3I5MA 3FF7A 1GY8A 2BCGY 1XMIA 1PX4A 2AG6A 4ETIA 5CGYD 3VWKC 3CVXA 2YPLB 1NWOA 1XGYH 1FIEA 1P7QB 5G5DA 3WLPA 4GWLA 5DM1A 2PGLA 4M03A 1YJDL 4R3SA 2B77A 1T8SA 1L3IA 5J4MA 2Q0XA 3L5IA 4B3MB 4Y4KC 5AVJA 4IYJA 4K3JB 2GSGB 5HGGS 1UASA 5JHMA 1ZEAL 1GADO 1Z2OX 3CIFA 2AEMA 4URHA 4LWPA 4GR5A 4PWZA 3D48R 4GRMB 2CBGA 3QG1A 1VPEA 4C14A 3SZRA 2IDQA 1DKNA 2X9LA 3QLVC 2BNQA 3UUEA 2EDBA 2X4DA 2I8CA 2FB4L 5DD5L 1PJQA 5IESL 1BFUA 1PT9A 4P4SB 4F2MB 2OP4L 2FZGA 2VZ0A 1SVSA 3WYEA 1VCMA 5G0VA 3MTGA 4GAJH 3EF0A 3L1KA 4BCDA 4N8VB 1NONA 4K9PA 3JZDA 1WCV1 3Q5EA 1Z0AA 3TBVB 4I4TF 4MLDA 5DGXA 2HXAA 4G0UA 2JFGA 1SMDA 2SEBB 2E4WA 3BAKA 2JK5B 2VPYA 1V3KA 3RPIA 4KROD 2PPEA 4Y6SA 3L2MA 2I62A 1DKLA 4FT2A 1JHLL 4B9AA 4B44A 4O5AA 4IPTA 2G60L 3MTXA 4MQFB 1DBMH 1JIJA 1KAEA 1Z4QA 2WF7A 4P2QD 1YC8A 1MHHB 1YN6B 2VWEE 3LKOA 1U2DA 3QQ4B 3MRNA 1QX1A 2H0JA 3MROA 1BA2A 3THXB 3G1WA 1CK0H 1A6WH 5J59A 3QEHA 2JCYA 1I3VA 3MLRH 4OBWA 4KNUA 4NAJA 2GS9A 3SYPA 4BGEA 2GAAA 1CQXA 3CINA 1MDBA 1P91A 3CVVA 4PQXA 4U1SA 2PLRA 4PJCB 1DN0B 5CJOL 2LW7A 2EIBA 5BNTA 4R8SA 3N7AA 5BSHA 3GDFA 4QUGA 1NYRA 3WNZA 1C2YA 1PZUB 1WO8A 5AIAA 3WP1B 2ZJOA 3FHAA 3FMIA 3T3IA 4ZCRA 3S1SA 4WZBE 3IBYA 1US8B 4JL2A 1IC7L 1Z0UA 3P2OA 1MH9A 1GC1C 2YJNA 2GHTA 5HTOA 1SJHA 3L9YA 5H3CA 1SHZA 2BO0A 3T0DA 1E42A 2YY5A 5FGSA 2GCYA 3P19A 2ZPAA 1EX1A 5BW7C 4Z7UB 1U04A 3NOXA 4BUCA 3K9GA 2C2MA 4ZFFA 3IMVA 2FFRA 4G5SA 2JAWA 5EESA 2Q8BL 3IKCA 1U99A 3ZYIA 4E5VA 2V6MA 2FOXA 2QSUA 4Z9YA 2JEZA 4PMFA 2G82A 4O8ZA 2IV3A 4B75A 1Z5UA 3CH1B 4DKEL 1F20A 4NN6B 2PP8A 4M1EA 2C98A 4YWGH 2W6MA 4IDDA 2WHQA 1Q1NA 2AA3A 4WFHD 2KS0A 2MCAA 1IKNC 2E4UA 2F9BT 1O0BA 5I1AB 3WCYA 1OBFO 1RUPL 3G9VA 2B5IB 2A74A 5AVSA 3UC5A 3VH8B 4RY8A 1LBHA 5F9WB 2DI7A 4FXOA 5PGMA 4CF7A 2AJUH 4KTEH 3GHPA 4N0MA 3X1GA 2FEOA 4D3SA 1GO2A 1PR6A 3SJVB 1D2MA 2J25A 3BN9C 4Z0BH 2X9QA 3PP8A 5CZKA 4YV0A 4FHZA 2WSSA 1A77A 2ZYGA 2DN7A 4QUBA 1I8KB 1P29A 1U0FA 3VKFA 2Y71A 2VQTA 2VWQA 4KXQA 5JT1A 2OMBA 3US9A 5I1JL 1B4LA 3PGFL 2CUHA 4R8RA 4MGHA 2JKYA 3ROQA 4L05A 3GLRA 3KPPA 2B4CC 4A6YL 3Q88A 4LJ8A 2XBUA 4ZX4A 2ASVA 4QUDA 1OO2A 4OLZH 2JVUA 2G2RA 2Q5CA 4BKLA 4EHIA 2DH6A 5G3ZA 4QT4A 2J0UA 3GRKA 2YZNA 1NMAL 1JE0A 3UG7A 2DEUA 2QY6A 4NFSA 3A14A 3DFFA 3H9YA 4PBTA 4ISVA 5TTRA 4BDVA 1N2OA 1L5WA 4W8OA 3BMXA 3JZIA 2FMUA 2QYTA 4QG7A 3SCMD 4CM9A 1VIDA 4GMHA 1ZIBA 2C94A 4H60A 4X24A 1ZANL 1NUHA 3QIUD 4G6MH 4LCWE 5AB0A 3CIQA 5E4AA 3RURA 3QF4B 1OE1A 5GGTL 1RJGA 4JC5A 2JAOA 5J3HD 1RZRD 1WETA 4YHPA 3OCXA 2KLTA 5K0JA 3VBEA 4MJLA 2QTTA 3FUIA 1SHMA 1PKQE 3NZ8B 1PT7A 3Q72A 4I5BB 1N0VC 3QC6X 2EFHB 4FADA 2WHXA 3A6GA 3FFDA 1BH2A 4V38A 4J27A 5KW9L 5TGBB 4M7LH 1A1VA 3QUCA 4GL2A 3WL9A 1G1KA 4J1NA 1FFDA 3ZO0A 4CV0A 1DFBH 1M2OB 3FNQA 3QIBC 5A2AA 3OR7B 4JPIA 1A2YB 5ALOA 1AXSA 1I8LA 2WCSA 4LRQA 5EO0B 6GPBA 2ZX7A 2AI0H 3AESB 4PPTA 4OBBA 4QYWA 4ZCLA 1AXRA 4QVKA 5TPWL 5AUOB 3CZCA 5JSHA 4FTWA 2PKCA 2EKSB 5IJ0A 2MKLC 1QHFA 4HQQH 4R51A 2B9EA 1Y5IA 3QMMA 2V2XB 5D1NA 5L8LB 3D7KA 2ITCB 1D9XA 4FQ1H 1GIAA 3SC2A 3LSTA 5IVPA 3VXSE 1U33A 5K0NA 5DQDH 4DIUA 3PGVA 4K7FB 4EL5A 5E2TH 3O4HA 2QLVB 2XCRB 1RDFA 3DKKA 3FFOA 4DLPA 3O75A 1B2WL 4K8RC 4WFFD 1DWPA 4MS8D 2R69L 4YQYA 2FF5A 4KH2A 4EFDA 1RVFH 5TQ2A 1ETJA 2MINA 3D6MA 1EJOH 2XMGA 3A2MA 1UCFA 3U0TA 1E7UA 3H4IA 4KREA 3EJYC 4BUGA 3VE0A 3GNSA 4JFQA 5HHXL 3E9UA 3MBIA 5ERXA 1RXEA 2X09A 3NK4A 1W8OA 3P45A 3DTYA 4YJDA 4OK6A 2B6NA 4NHUA 2P4SA 3O4LB 1IPHA 3PF8A 1C30B 4QF1A 3E6AA 4NCAA 1T3FA 3F5QA 1MLCA 5FPHA 3F85A 2NU7A 2JCCA 4DYDA 2HSGA 2HV9A 4X92A 1BGVA 3KSMA 3DETD 1N7MH 3EKCA 2PH3A 4IQGA 2VJXA 3OLQA 3BD5A 3GFPA 1XDGA 2GZMA 3QC5X 1GOGA 4L3EA 1BVNT 3CV3A 3UHJA 4D9JA 2GHWB 4MUKA 3BH8A 3IKKA 3ZZ1A 3COPA 4KO1S 3SQOA 4RVBA 4XI5C 4URFA 3CSYB 4ZXBA 5D85A 4ANUA 4Q47A 4EK9A 2ZSUA 3HC0B 4QELA 3DDUA 2Z7WA 7FABL 3AFIA 3K6SB 3N87A 3V7AE 4JQOA 4DPKA 3PFWO 5SX4H 1PFUA 2GDJA 3EWSA 1FC2D 4A8JA 4O5LH 2OHGA 2N7SA 2BM1A 2DUWA 3H9SA 4CU8A 3P9QA 2RALA 4EKYA 1NMBL 3O8DA 5FBHA 3L2LA 3T7DA 4Z7QE 4ALJA 2Y5TA 4N01A 1SLUA 3P4OA 2P1DA 1CDHA 2CM6A 4LWOA 1LNQA 7REQA 1CXKA 2HL6A 4B9PA 5HGBB 3QZNA 2QHRL 3RGHA 4Q3DA 2CLFB 1GPH1 2MOGA 1YI8A 2R62A 1G38A 4ZW6A 4BYMA 3TA3C 1UZUA 3HV0A 2PTTB 2JI2A 5E0FA 1L0PA 3E58A 1WWCA 1A9BB 2WPDA 3FCSA 4PLTA 3KHKA 4LKCA 3JATB 2FEDC 4J0KA 1ETA1 5HIMA 4MAUL 1JQKA 1OQAA 3VFNB 4I3RH 1OT1A 4X8JB 5D1ZI 4MR9A 3FC8A 3EG5A 1DO2A 1YEIL 3ZKMD 1A9OA 1P4JA 4Q48A 3CFKA 4MRMA 5DC9B 4E2OA 4LQFH 4X71A 3WLFA 2F3QA 3GAFA 3F6CA 5E0QA 4YASA 5EF0A 2R1VA 1CB0A 4KKZA 4YHLL 2YHSA 3RS8A 2C7PA 1OUMA 1YH3A 1P6UA 4V39A 4M0DA 1KTDB 3TO4C 5IY5B 4OHKA 4RGYA 4EA8A 3FF4A 2R0QC 4UMEA 1K7CA 3OIGA 3GMOA 5FGCE 3L17A 1EK2A 4EKEA 3JQFA 2NNCA 3ISRA 5IDYA 1H2HA 1G43A 1B2RA 4F33A 4B96A 2HDOA 4FNTA 1NIBA 2OHVA 1V4NA 1C8PA 3RFXA 2QV4A 1SCBA 2A1WH 1XPRA 3DVSX 5G5DB 3QDGD 4ERXA 4UNSA 1RWNA 3CKMA 4R3SB 4PRYA 3H75A 5FWNA 1RQLA 1YDHA 3EX7C 4OHYA 2HHCA 3C3PA 4MYTA 1W72H 1P9MA 2ACWA 4FHDA 4LAQL 2VABA 3WTSA 3F7TA 3P0JA 4WERA 3B9KD 2OCKA 3B7WA 2B14A 1VGEH 1N2JA 4NNPA 2BNQB 1ASPA 1P7ZA 1AQLA 3I2FA 2ESRA 4RV5A 1MIOA 3DCNA 3H0KA 3FIUA 3D0KA 5HHQA 4CADA 1XTTA 5DO8A 1P72A 2BGIA 1U90A 1Q72L 3I09A 4B3SB 3K46A 4KXVA 3AREC 4E09A 1JLLA 1PJWA 4QOKE 3UG4A 1Y7HA 3WEXA 1UACH 3MCWA 2WLYA 2F2TA 4H3KB 1WCXA 3QFTA 2E6PA 4EHFA 1Z2AA 3PXEA 5CH3A 4AVIA 2DKFA 4N2AA 4ON9A 2UVPA 5L3ZA 1CFJA 5FPQA 3SYKA 3CNEA 4CBZA 3II3A 3LLCA 1G0YR 4FJ2A 2EDNA 3TAXA 3O83A 2QVMA 5M04A 1PIWA 1DSWA 4XMKL 3H5WA 4FXGA 1DBBL 4EBBA 4XJSA 4LA4A 2ZRPA 4XARA 2FZ5A 5E2AA 1FS5A 3MRNB 1CL7H 1K92A 5KQSA 3M4JA 3MROB 3TQCA 3G79A 1ZGZA 1XVSA 1RCYA 4IDJH 3H9CA 1HKFA 1ZH8A 1Q1ZA 1PL6A 4ZV7A 3G9TA 2NTFA 1P60A 5E1QA 3D4PA 4JA2A 1NVDA 4U1SB 1O7DC 3SIWA 2C1ZA 1FRGL 2XLBA 1SEQL 7AT1A 3TX2A 2C9PA 2RHWA 4NCC2 4X20A 6CGTA 4X0NA 2VDPL 1RXIA 3FSAA 1H4SA 1IY9A 3KDPA 3VD2A 2D8MA 1FHNA 5FO8B 3NP7A 1X14A 3OG4B 1ZI6A 3B60A 3U09A 2DYPA 5ELXA 3VWJD 2A9FA 3KCNA 3HJUA 1KJJA 5KAQF 4BZZA 1NCCL 3LW7A 2H9YA 1SJHB 2JFVA 2CEKA 1MFBH 1YEHH 4FQLL 2GCYB 5TDOA 1AZSC 4ZUWA 1DAPA 1TJYA 5EZ6B 1OHZA 1IXKA 3SLRA 4ZFFB 3P2TA 4LJ6A 2WO2B 3CLEL 4WO4C 2AZ4A 3A2LA 5K1VA 5CITA 2FQYA 1QK4A 1S3KL 3H3PL 4F15B 2G70A 2Q28A 3B9BA 2UZIL 4ALAH 2JEOA 1K3ZA 4N5EC 2ZUDA 1U3UA 1SCAA 4QFDA 4BHUI 1QDEA 3TESA 2C03A 3ZZMA 2HF2A 4JZNA 1B74A 4IDPA 1Q3TA 1H2YA 3RL1A 4PJEA 4JM4L 2DJ4A 1BVUA 2I8LA 2NYYD 1CY4A 4C30A 1M73E 4C20A 3GJFA 1UF9A 4LXUA 3KQNA 3ARSA 3VO8A 1MI5A 2A74B 5AVSB 1P6FA 3GEDA 4X6XA 5J1TC 3WTYA 4X7TA 3AY0A 5ILQA 2HRGA 3RC3A 5ANMA 2QM7A 4DA8A 1SU6A 1C2TA 4CKWA 4ZOQI 5AIBA 4MXQC 3GI9H 4RUKA 1QR4A 5J6HA 4F04A 3B9DA 3ARFA 1B0GA 3PJNA 1OAJA 5C1MB 1M34A 1F7VA 5FI0B 4W68A 3OQMA 6ABPA 4OF5A 4B6SA 2H48A 3JCZA 3S4YA 3WRWA 4M7KL 2J9ZB 3AY2A 4K55A 4RYDA 4FYJA 1SXCA 1FFEA 1AQ8A 3GN2A 1E7MA 5T1LA 4C06A 1T2DA 3G5WA 4ODVH 4TQEL 4CKBA 4YNBA 3KPPB 3N3BC 3COVA 2FSHA 1P45A 1XZJA 2Q3DA 3Q8XB 3SKXA 5FPKA 3FTWA 4LIQH 2FFQA 5AYVA 3DV6A 1G16A 4BKLB 4K9JA 4LESA 4P9HH 1U4OA 2J0UB 4A3SA 1T21B 2V1XA 4CMBA 3R5JA 1DEDA 2RFLA 3L0BA 4QODA 3THMH 3NJVA 4G5ZH 2JKVA 2WOJA 3RU3A 4ISVB 1K8XB 4NTZA 1JOIA 3JVGC 2LPMA 3DR5A 4TMKA 5LB1A 4PRPD 5FI3A 2XNAA 1SG6A 4ER6A 2GZ2A 4FN4A 1UEMA 2OJEA 4I3SL 2QYHA 3V8NA 4BSVA 4AVKA 4YMTA 1R3JA 2XOKD 8MHTA 1Z2EA 4M6MH 5HDQH 3V0VA 3D0AA 4YHPB 3REOA 1HYSC 2R11A 1PZCA 2D3JA 3PL6A 4MVBD 5C7OO 4GSDL 4PRHD 5AM1A 1VFNA 3PDGA 3RWIA 5HTSA 3RGVD 1SQ6A 3FFDB 4X97A 4BO5A 4HSEA 4PV1C 2VJLA 1GMEA 3Q4GA 4MVJF 3WC4A 4R9VA 1TJHH 3WL9B 4N2BA 3O0RL 1S8NA 4KZPA 3HR6A 3RVDA 3VJ6A 3DGCR 4L4VE 1ORIA 3MIIA 3NIGB 4N7BA 4BEVA 4JPIB 4JFZH 2EV9A 3IBCA 3L4UA 1AXSB 1EZZA 1VB5A 2QTEA 4LHUA 3IVCA 5JISA 4OD2A 1WW2A 5DT1H 1EFPA 1QFSA 2KMLA 5EEVA 4WAUA 1PS8A 1KI4A 5TF4A 1X9IA 2NXYB 5IJ0B 3TEZA 2LD4A 1PNTA 1OROA 3BRFA 5L8JB 3QB7C 5ID0A 4LVHC 2E4AA 3VZBA 4EFKA 5F72S 4UT9H 3NAQA 1IAII 4E9QA 1CV2A 2OD7A 2QTVB 1RYNA 3SC2B 3QORC 3EJPA 3LS4H 1E3DA 1H0HA 2W2MA 1ZU5A 3C3DA 4GE0A 3KYIB 4LPXA 1G7RA 4OQQA 4HU8A 2EE2A 2WT8A 5CYGA 1SBSL 2WVHA 1WVGA 2E3JA 4LOKA 4MVJD 1JN0A 4B0MB 2A14A 2R6AA 4DXDA 5KOJB 2Z1PA 4X6CE 2PMKA 3IQWA 2FGWH 3UWKA 1GTJ1 5TQ2B 2MINB 2YD1A 1R8QA 1XYVA 2P5UA 2R1UA 1DO5A 4R0NA 2H2HA 2E87A 3BSYA 1JHAA 3N6XA 3U0TB 2VN8A 2P65A 3NPZB 4RISL 4PX9A 3W8DA 1M1YA 2ZDQA 2I7DA 4G8CA 4OSPA 3VE0B 4JFQB 1CUWA 1XLUA 4G8JA 4CZ2A 3ANTA 4RFOL 3E61A 2EO1A 3ORSA 1OXSC 5T4BA 3T5BA 4D26A 5KJRL 2JZOA 2ZU0C 5JG7A 4Q02A 5EEGA 2QKIC 1ZJWA 1T3FB 1MLCB 1M0EA 1ODUA 2ONZA 5AI5A 3H5LA 3SI7A 1V41E 3FWZA 2JCCB 2V9ZA 2PBRA 3IMKA 3K0HA 1YS7A 1PKXA 3LX4A 2XX3A 4JR0A 4MO9A 1QMGA 3EQ8A 1YCHA 3HDQA 2BIHA 1QSEE 5DYNA 1JZ6A 5GS1C 4L3EB 5KANI 3U49A 3I58A 1D5BA 5MEQA 3TX4A 1FS4A 2IHJA 2WYTA 4F21A 4AEHL 4PCTA 1QF7A 3H42B 4JD5A 2ZAYA 1HORA 4D25A 4OH2A 1VA5A 1NDHA 4PPYA 4PIRF 3A9CA 4NDZA 4ZXBB 3Q9NA 4FNGA 4RO0A 4OZFH 2J67A 3UMMA 3SGJA 1J70A 5TC4A 5CDFE 4PD4J 5HJ3A 1CLZH 2OFFA 2D7DA 4YCJA 4Z1MD 4K94C 3D08A 1SA0B 2ZKLA 4PAWA 3ZE1B 3JQQA 4A8JB 4LSUH 3PEVA 3PYCA 3HS3A 5EIFA 3H9SB 3LBIA 1OX6A 3OE5A 2XVMA 4HK3J 2YN0A 1WCIA 1KB5L 3EJTA 4QUIA 4RGNC 2YV1A 5HOEA 2Y5TB 2WTUA 3P4OB 3T6QC 3HABA 4YY3B 3DPIA 4PU0A 3D69A 1AB6A 1SBQA 1E6OH 1G8HA 1ZINA 2P2YA 4MCZA 3BFPA 4HG4K 3FE2A 3PIDA 4PZDA 2AAAA 4F1ZA 2XCQA 7REQB 4QGYA 4HGMA 4KTGA 2FEKA 2JNWA 3I0MA 4JQIH 4LNUA 1UWEL 3EUDA 2YIVX 4YMUA 4NKIL 2EFEB 5IC5A 1KAQA 4JFFE 2HF7A 3I04A 4XB2A 3FCSB 4N2KA 5LQBL 4XDYA 3ZBQA 2VQFB 4LKCB 4PLPA 3AFOA 1Z0JA 2FGJA 3KQKA 1WNTA 4MNTA 4GPD1 5EZPA 4MR9B 4DPCX 3KBEA 4CUKA 1NVKA 5GPBA 5IBPA 1MXHA 3V7FA 2O2EA 1T1IA 4HKBA 2Z04A 4S0ZA 1XKQA 3CFKB 1RAEA 4MRMB 2QFRA 4PM1A 2VZ1A 3IRZA 1FGVH 2R1VB 1TZ8A 3LZFL 5C9JA 2PXXA 1YEDA 4P3NA 3DXAE 3L5OA 1JHUA 1XHFA 1W4LA 1QAOA 1N68A 5SV4A 5EWIH 1N8TA 3L0IB 1RE1A 4AJ2A 4LFBB 3TO5A 3GMOB 5DQJA 3KQUA 1BHO1 4HXBH 3X11A 5ID1A 2QRMA 5BOVA 2GC4C 2VSYA 5EP2A 4YCLA 4F33B 3I1IA 5TFSH 3P0YH 4MKZA 2NY1D 3AJ7A 1XMEB 5EC1A 2G72A 1NVVQ 3PTZA 2AC4A 12E8H 3CQQA 3HNVH 3PPVA 1QB7A 3T3DA 4JY5H 2RAUA 5I28A 2AFHE 2XJ4A 1KLFB 4G9FD 2RIPA 2CB0A 3MLUL 5BN4A 3PQ6A 3ETGA 1NMYA 3WRYC 1G7LA 3BWBA 4M6OH 1AKEA 4BV8A 3VX3A 3FVTA 1IFHL 2AVNA 5JNTA 2J3DA 5A9SA 2VABB 4PJXE 3V6OC 1XROA 1XV5A 3VYSB 4ANFA 1KQ3A 4YC7A 2WZDA 1SM4A 4NGHH 3QNMA 1MQKL 4ICWA 2QV2A 3QIVA 1MCKA 1UG9A 1MIOB 1K1EA 2FP4B 2HB0A 1I4EB 3GZQA 5HHQB 4CADB 1PAZA 2P45B 1QLEL 3LK6A 4DANA 1GL4B 4CWAA 3AK4A 1JHYA 3C6XA 4AKSA 4RMIA 1JLLB 1EPFA 1YC2A 4IM7A 1UBTS 4AF8A 1HT6A 4KLCA 5D8DA 1GYAA 5KSAC 3P2BA 4F9LA 2CYBA 2EKLA 5AG8A 3HI6H 3HPLA 4WWOA 4F71A 2VZ8A 4B6FA 3I9OA 4H3SA 4C05A 2EX0A 2RR3A 3N8DA 4RNRA 4Y1RA 3AU0A 3DWEX 1ZXXA 4HYEA 3VI3A 4IU3A 1FE8L 5HTKA 1XHEA 2UVPB 5BZXA 4J3OH 4IDEA 1LTKA 3D8UA 2OTWA 3STUA 4M4SA 3DPSA 3AR6A 5I9BA 2HMID 4FXGB 3Q2OA 1PVDA 4YFVA 4QAJA 4N2IA 5REQA 4L0PB 1G9ML 2C07A 1ADFA 3WK5A 5EAIA 3EYAA 1VAHA 3KD4A 2VJ0A 1BWQA 1GZ4A 2EFCB 3APFA 3JQ6A 4BWFB 3ZDQA 2NX5A 4KO3S 4EI5C 2NTFB 5CFHA 3MT0A 4U05A 5JCZA 2VAJA 3CN0A 3PVZA 3DMYA 2JKTM 2XE4A 1E6JH 2CBOA 5BRZD 4H88L 4AQDA 3T65A 2HQSA 4EG8A 4E94A 1FG2B 4D0CA 1VHLA 4X20B 2NACA 4REOA 1C4XA 4LMQI 3KDPB 2EZ8A 4I19A 2GUWA 1N6HA 4OB7A 3Q2NA 4L6IA 2ESVE 3DTXA 1FNAA 3FU3A 1YR9A 5IBUB 4V0LA 1T6XA 5AHKA 4HWSA 3CVOA 3CM0A 2Z0MA 4QU5A 1IC5H 3WJAA 1IM8A 3PLAE 1XC7A 2XA9A 3QZBA 2CMGA 4ASUA 3LC2O 3NA4A 3GKZA 1IARB 5TDOB 3N39C 4ZUWB 1U5AA 1W5EA 3DO8A 4ITVA 3IULA 4JQXA 4Q1BA 2KBFA 1NCGA 2ZSKA 3MOIA 4RFNB 4Y2SA 1J5HA 4Q21A 3MLXL 3T0ED 5KS9E 4YJGA 2DQZA 1NCNA 1WHSB 4ZTPL 4YE0A 2MCPL 5JI3E 5A16A 1N5RA 1VLHA 4ZYZA 4YHOH 4W7HA 2B3DA 1U3JA 2X7LA 4JRLA 4P46D 1RSYA 5BURA 1UBEA 2ZWLT 3EHEA 4JZNB 4O2EA 4S24A 4KLAA 4RAOA 3QK7A 3RL1B 3BQ9A 1CXFA 4PJEB 1MX9A 3M5PA 1Z3RA 3GJFB 2QU8A 3OSUA 4BVLA 3OU2A 4D9EA 4XYGA 3HFSA 5TH2A 1MI5B 2QBWA 4YJ3A 3BUSA 3GGJA 2NLOA 4X7TB 1ZRMA 4OHZA 1QFUH 2PIDA 1SCIA 4MVJP 4GMGA 2WIFA 4CKWB 5CJXC 2IF0A 3K2IA 3MLSH 3DVNB 3Q13A 3PUXA 3UZEA 3NACL 1KBWA 3GPLA 1K88A 1G4RA 2V3DA 5J6HB 1NVAA 3ARFB 1B0GB 4IV0A 3ELDA 1NJ9A 3A0OA 3I2KA 1S89A 1NIDA 1M34B 1Y33E 3MXVH 4IGBD 4M62H 2GPJA 1Z38A 5KBPA 1W6WA 3VI4F 3HH8A 2JG3A 3VUEA 3GLHE 4FRWA 1Q0TA 4CKBB 1U3HC 1GR0A 3EOAI 3HYLA 2W00A 4NRXA 5IUCA 1YHNA 3MV8E 2ZYIA 2WKRA 2Z30A 4Y5YC 4D9LL 3ESUF 2XWBB 9MHTA 2C2ZA 3DV6B 3ENKA 4HL6A 4QNPE 5IVDA 3X1WA 1Q2UA 1SBYA 1PR3A 2EIZA 3HJRA 2DQGH 5FBKA 4OOEA 4FTVD 1O7DE 2WXOA 1XZPA 1KSRA 4D98A 1KPHA 5CFMA 5GS0C 2H2SD 3PPWA 3TLCA 2GITA 4X60A 1ATIA 2UYLA 3G6JF 1FP1D 3CVIL 2AXGA 1NANH 3HHEA 3B1TA 1XWWA 5BNWA 3CCCA 2VN7A 2OJEB 4KDCA 3Q6IA 1R3JB 2CRZA 4FI8A 1QV7A 2ENUA 2I26N 3ZWCA 2RI1A 5ALMA 2K7QA 4B7LA 4XVUD 3QFRA 3V0VB 2K3HA 4UBKA 1FL5B 2Z0BA 2Y1CA 1JCVA 1N5YL 4C78A 2J31A 2W94A 3PL6B 1RP1A 2XWQA 1ODLA 2YBEA 2WLSA 3PNVA 5IP5A 3LUHA 2WKOA 1SB9A 5FUBA 3T1TA 1JL3A 4OF8A 3RWIB 3P0FA 1Y3BE 3LRTA 2ZUQB 2OT3B 3QJFA 2R6ZA 3SE8H 1IONA 3HGTA 4N9WA 3QJSB 1NM5C 3ZE1F 3WN5A 3VJ6B 3CW8X 3SQDA 3NWPA 5LJYH 3KQSA 3H1AA 2IYFA 3L18A 3QUXD 2HOQA 2K4AA 4LHUB 4U02A 4OD2B 3ILYA 1XB8A 3BLBA 3LJKA 4C4AA 4R90H 1CYGA 1EFPB 1I31A 5M5BA 4B46A 1T5WA 3C98A 1V3LA 4FQPA 4F7CA 1EEYA 4NH0A 4DLZA 3TT3L 4Z7NB 3QMPA 5ID0B 3OQHA 1GGBL 5EI5A 3RFFA 1Z3GH 2IOFK 3MWLA 3AL3A 3AEYA 1CFTA 4WXHA 4OGXH 1FTGA 1DG1G 2ODHA 3ECSA 3KD3A 3GZOA 1W75A 2CUZA 1JEOA 4LW8A 4TRMA 3ZZUA 3PWPA 3MG9A 3UCXA 4DMCA 2Q3EA 3FMGH 1GSMA 2WN2A 3FRUA 2YYAA 4MZXA 2N4IA 2Y07L 1K6MA 2CR0A 2IV8A 4GXUN 3R5KA 2CVPA 1M1YB 3NNDA 3WGUA 2EE0A 4F20A 2VDKB 1WFJA 4CAGA 3HNRA 1F1GA 2OSVA 3FKSA 4RVHA 1II9A 3KEOA 1KJWA 1YEEH 2FU5C 3K5IA 1O7VA 5FCUH 4HNQA 1Y3IA 4W6ZA 2JWGA 1IK6A 2OORC 4TS6A 4YUEL 4FFZL 5GGRY 3SDAC 4EYGA 3TM6A 3W9YA 2HW8A 5IW1A 3SEPA 3IUMA 4BQSA 3ED5A 1ZSNA 2N9UA 5JZVA 1FVCA 3V8VA 3KAJA 3WY3A 1IN5A 3J80A 1CICC 3WIUA 3HUFA 1E3MA 3SBOA 1QFJA 4FBLA 5DI8A 3ATDA 4FOSA 4W8HA 3HE7A 2VP5A 4QJ4A 1D5BB 3DE3X 3AF2A 5MEQB 2Y1GA 1W36B 1ND0B 3A3NA 5FM5M 4PGBA 4W6XB 4UHCA 1EHCA 1NJ6A 4B9YA 3A3OA 1IZKA 1XH1A 1X5XA 3FZQA 3U0WL 4GHWA 4AUJA 1E96A 2QZ4A 2IFTA 3OMXA 3PR2B 3NFSL 4G42A 4XHJC 3T3GA 1UZGA 4EI7A 2YAQA 4X65B 5DVMA 3QYMA 2Z43A 4HRVA 5HJ3B 2G0TA 3RVWC 1T20A 4K6HA 4K26A 3MJVA 1WXWA 5A0FA 3SEAA 5JNVA 2VR9A 1WG3A 4E9TA 3U61B 2FRVA 1BWSA 5C6PB 1VJTA 4U8HA 3VR4H 2RMNA 4DYHA 4X3PA 4CLOA 4RMQA 4Z7IA 1SOSA 1WCIB 3ZGVA 2AJYL 5C0FA 2ZI7A 2AW3A 5IT5A 2DF3A 2AJVL 2ADMA 4IDNA 1T0JB 4A9AA 4MCZB 1MFNA 4LHVA 1OFHA 3CFCH 1P1CA 1R3IH 1XLTA 2E8ZA 4YRLA 1O58A 4GIPD 4QOIA 4OI9A 3TS8A 2QUIA 4AUEA 5I17A 4I46A 2IU4A 4XWGH 1QFPA 4JHUA 1GGKA 3KLSA 3E84A 1V7NH 4NATA 1JT2A 1FNMA 3ZHTA 1UDAA 2N1MA 2ERYA 4RK1A 3IJYA 2JCXA 1KJQA 1AIFA 4FFVC 2UYYA 2Y24A 1ZONA 2WAQA 4PS4L 4XEHA 2VTBA 1JVSA 1YR6A 5HMLA 5L53A 2CNWD 2CHGA 2DD8L 4HKBB 5HYSG 1TUBA 3S8MA 4OJQA 4ANKA 3QYNA 2NY7L 4AJVA 4GDFA 3ZHDA 3D6GA 5D2NE 4XE0A 5JLZA 3CMOH 4P07A 1PFCA 3QLTA 1ZAKA 3UJ8A 5C9JB 2GA9A 1EO8H 1T3HA 3UEOA 1YEDB 2XQYG 4XDZA 2M6LA 3IHLA 3FKUS 3PCTA 4MRSA 3VDMA 2Z92A 2EKZA 4XCFL 2EZ0C 5IM7B 5AQEA 1KT2A 5DQJB 1XJCA 3X11B 1CY7A 3DOFA 3R5TA 5ESAA 3FX2A 4JB9H 3CXHJ 2H08A 1V2HE 1NC1A 4R2GD 3ET9F 3C60C 4K3GA 4KQXA 3TBYA 3IA7A 5ADOL 3BZDA 1JT9A 4PXAA 2G09A 2WXLA 4Y7OC 5BVPL 1U11A 2AE2A 2MHCA 1Y3HA 3N6YA 5BN4B 4M43H 3KJFA 3L07A 1H6DA 1TKRA 3LQ2A 4G8IA 1HZKA 1OH5A 3CH8A 2R97A 1JTFA 1JYFA 4Q52A 1A3LL 3QXXA 5A9SB 3R9IA 1A8ZA 2GXSA 2AK1H 1EK0A 5KVSA 1KH1A 1VPLA 3AR4A 4EGSA 4NZTL 4K3EL 2EP8A 1W4AA 1YTUA 2CMHA 1KCLA 2YV4A 1L6ZA 1YY8A 3EVDA 4PJ5D 4XP6H 1E1RA 2J5BA 4PWGA 5KOYA 1AZBA 1JHKL 5AW4A 4GIOA 2IH9A 4XLTA 1UXHA 1XVUA 2GESA 1KIFA 4GYBA 4NBZB 5EO9A 3MTAA 5KCZA 3L8EA 3HVRA 3HPLB 3LBAA 5JARA 1BYPA 4LLAA 2CG9X 4H7HA 4IBYA 5E9DE 2VLME 4RGNE 3HUUA 3UMSA 4YE4H 4QULA 1NLYA 4OJAA 4HKZB 3HOGA 4XWWA 4WWKA 3VI3B 5JW5A 4WVFA 4KIGA 4IU3B 3HAEH 5IK3A 3ARDC 2YXEA 2OTWB 3UH0A 2Q8AL 3F7VA 3ZDXE 2PYEB 2EECA 2C9XA 4Y9FA 2HSJA 2VS1A 3DGEC 2MWCA 5JSZA 2WB7A 3DYPA 3WLMA 2OM2A 2HJKB 1S3GA 4DDKA 4BCYA 1MPAL 2FO4A 3IFLH 1CQYA 2PL3A 3TD9A 2DLIA 2NX5B 1KQNA 2XWBF 1X87A 1X5AA 3RZCC 4D3FA 2X4UB 1WS7A 3L5WA 3KFVA 1FSKC 2Z1MA 1E3QA 3NJRA 3F8UB 2Q76A 1IMHC 4WCYH 3T65B 2XXFA 3HB9A 3OPVA 2Q9BA 1IEBA 2IQ9L 4TPKA 2AABL 4KQ4H 4I5DA 3FO2A 4DY4A 2AEJA 2OTCA 3DMTA 1CXZA 421PA 3PC3A 1NN5A 3DTXB 2WQSA 2WWVD 5LDHA 2XTAA 4NERA 4JDTL 1M1ZA 1YJQA 3QEMA 3BVXA 5TJHA 3R7RA 1T4KA 4KQCA 2PU7A 4JN2A 1S4MA 4JXJA 3G2OA 4NI3A 4J7UA 3DW1X 2O1WA 1ZOXA 5LYJA 5I01A 1KQFA 1LW6E 3HWWA 2AXWA 35C8H 1X1TA 3M7OA 4MLCA 1S7XA 1K3TA 4S1QL 2WV9A 2DWSA 1CN4A 1NCWH 2I3GA 4Q14A 1U8KA 3NV7A 1T1ZA 2XWDA 3FCTA 4E1BA 4BC1A 2IVZA 2HH9A 1TPXB 2JKJA 3L1OL 1KIUA 2X7LB 1JZJA 4TULH 4Z86A 1R0WA 2BM8A 2JL1A 4O2EB 5ALSA 3M8KA 3VSUA 3RUDA 4KAJA 4EN2A 5DNYB 4DW2H 2VI5A 3L4WA 1JKJA 1KGWA 2EHJA 3BCFA 1EB8A 1KK0A 5TH2B 2VQSA 4YJ3B 4M9SA 3VC7A 4XMLH 1ZGHA 2E7ZA 2H7CA 4KI1A 3VW3H 1JAYA 3E6HA 3MK31 2JB6A 4XVSH 1CD9B 1WRFA 2G30A 2ATVA 5GGVL 1J9GA 1O2DA 1UDCA 2VJAA 3AGQA 3CN3A 1OM3H 2NPIA 5E8RA 1Z6GA 1E69A 1UDBA 2VQ3A 2R0KL 3R0VA 3ULVH 3L4KA 1FFCA 2ORIA 4AUMA 6PFKA 3AONB 1LLDA 3C1OA 1X5HA 3C48A 3L05A 4TSCH 2VDML 3V8RA 1H8SA 5FR1A 2HQ1A 1KIQA 5C0RL 4YP9A 5BNIA 5ALQA 4LSVL 1F5SA 3SD5A 2OZNA 3JWEA 3TAUA 5KQMA 3FPLA 4NRXB 4JSYA 1G2IA 3ESMA 5HYEA 2IPOA 5IANA 1H85A 3C5SA 5BZZA 3D4CA 4XAWL 3NHRA 3MACL 4KZ0A 3LY7A 1VB3A 1E8NA 2EIZB 1RPZA 1HQKA 2VUOA 4EITA 4YV2A 4KQMA 3KWFA 4CE6A 2XA1A 3WKNA 4F2FA 1OLXA 1ZVSA 2GITB 2REQA 3ZWQA 2MYUA 4PJHF 1QGDA 2Z98A 2AXGB 5HDRA 2DV6A 3DCIA 1WXFA 4K03A 1E1LA 5CJ8A 2FEAA 3K92A 4I5GA 3BCUA 1JVKA 4UTBH 4RAVA 1L3CA 3APDA 5C70A 2J8UE 4U6VH 2BINA 4WOPA 3A7EA 4W9KC 4ELME 2QRPA 2FH6A 4QARA 1TJ5A 4W70A 4KO8A 4E14A 4ZFQA 1DB3A 2E6JA 2CJUH 4LOAA 2WUFA 4OQ4A 2FCBA 1OY1A 3D3VD 1Q7EA 3UJDA 4N90E 1N78A 3I6SA 1XCMA 3AI3A 4DN3L 4A7PA 3A06A 3QJFB 4F1JA 1M1NA 2CRMA 2FWBA 1Y6KR 4TV8A 4MZIA 4N0UA 3SBEA 3KO8A 2P0YA 4PEEA 3ARGC 4ND1A 5M29A 3WN5B 4WEUD 5KG9A 4JHLA 4JS0A 4F84A 3ENNA 2ZVDA 1MREL 5JCJD 1MEOA 3HKBA 4WQOA 3WWCA 1T5WB 1G9NC 4F7CB 3DLBA 3A1NA 4O4IA 5LB2A 4KI5F 1GFIA 1W36D 1DWUA 8PAZA 2RH5A 3KXDA 1A6PA 2VP2A 2YDXA 3OLZA 1CZHA 4QDOA 2HT3C 2YLKA 3KPQA 1FFBA 1FVXA 3LSYA 2HKHH 3DX6A 3PCXA 5BR7A 4OAOA 3SIKA 1S2MA 4UIKH 4FN0A 1CFTB 4UYQA 3NKLA 1TKWA 4QXWA 3FKJA 1NFFA 4X6EA 2VJPA 2D1RA 4KMSA 2AYXA 1KDYA 3QUMA 3RS2A 4Q6IC 2ADYA 1I4DD 1SUDA 1UB5A 4MA7H 4IRSC 2W43A 1UPXA 2M98A 3WDLA 1DQDL 4WVRA 1NUQA 4AWAA 3IR6A 3SOTA 3ZX1A 2CDAA 3MYZA 2D0PB 3KCPA 2F3UA 5E4JA 4V33A 2IMMA 2FSGA 1JAHA 2A38A 4K5NA 1ROWA 2P6PA 4KI5D 4XPHL 5D7JD 3HJEA 3N8HA 4QDTA 2YYZA 2JLSA 4EWLA 5J1SB 1S7QA 3MV7D 5IEHA 2Y69B 5IW1B 2D1FA 3NT0A 1AU9A 1ENZA 2O72A 3OAYH 5DT9A 2J9YB 4MVCA 2V7QD 3NRBA 4RZXA 4DBVO 1BFOA 5CBAA 1BQHG 1IKOP 3E3MA 4XWOD 2XB9A 3LX6A 4EIUA 2IEAA 4HD5A 2XTZA 5JPIA 1UJMA 3OTTA 5C8VA 1E6LA 4R5VA 5BMOA 3ZD9A 4GOXA 4OHFA 1BVZA 4ZTUB 1CYDA 2I55A 1RFDL 3HE7B 4UANA 3EJRA 1NBQA 4MB1A 2NU9A 4NFCA 1SOVA 3TZBA 4YEFA 3E1GA 4PGBB 1NFDA 1T9DA 3TJZA 4E31A 3ROGA 2AL7A 2FUEA 4MP8A 4JI0B 1WTAA 3V7WA 1X15A 4WZZA 3I9PA 4LSDA 4G42B 3W39A 5KZCD 2LRHA 3BULA 1E3EA 3VXKA 4JUIA 3AR2A 2IFGA 3CWZA 3O38A 3C7TA 5AB2A 1T20B 4ERSH 1ULZA 5KSBF 2DQFB 3W2DL 2QQQA 4MMYA 2Z3VA 3I6IA 1TCVA 2FRXA 2WQUA 4GKBA 4CLOB 1QBAA 1F8YA 2YD9A 4OFDA 1T0NA 5C0FB 2I4MA 1TF4A 3CA8A 1QUFA 3AVOA 2NXJA 2G67A 1S5IL 1RWXA 1CFMA 2Q3XA 1N18A 5LCVA 5EPMA 4IHKA 4HB0A 5I48A 4DEPC 2CNBA 2NADA 1T15A 1D5MA 2P30A 2AJXL 1YZTA 3PUWA 3JQ8A 3VI3F 1CS6A 1WGOA 3QA3A 1A1MA 1FVHA 2HN9A 1LDGA 1KFGA 3FLBA 1SXHA 4LLMB 5BSUA 3IF1B 1UR5A 1B93A 3REGA 1F3DH 1U0GA 3IJYB 2Y4OA 5E7IA 5CVCA 1AIFB 5IROA 2FPRA 3MOAL 1YB6A 1GAWA 3UXFA 4X8XA 2XIIA 1KZYA 1ZS9A 1TUBB 1CT9A 3FB7A 3HAEG 4WECA 4A63A 3S3SA 3FL7A 4P3CH 4PZZA 4IVNA 3EOTL 5EBMB 3V52H 1OQOA 2V6IA 2UY6A 3UW3A 4N2NA 1MW2A 2Z92B 3IEVA 1R0KA 2ZSVA 3R40A 4TT3D 4TSKA 1KT2B 2R7EA 1A8QA 1XH0A 4P06A 2R2GA 4LASH 2I5YH 3CT4A 5ESAB 2JLZA 4XNQB 5ECJE 1RWWA 2M6SA 3ZCQA 5SWZA 5T57A 1GS8A 3HXTA 4M8NE 1H3FA 4LYHA 2HMSA 3K1JA 5C7IO 3WMPA 3R1GH 5FNVF 1G60A 4FQ2L 3TBYB 5BSGA 3B8SA 4MKGA 2C34A 1U28A 3I61A 2FPKA 1L0QA 1E2LA 2PYED 3V1LA 3P0GB 2AMYA 3H1EA 3WAGA 3TIDA 4FZEL 4QIRA 3V5KA 4OD1H 1ZZEA 3VU1A 3UYLA 1KCSL 4D5EA 4G8IB 4B40A 2XW6A 5MN4A 4C1BA 3IDZA 4TQHA 3NTRA 2DX7A 1BLNA 4LCIL 3UK1A 1DE0A 4XQ0A 4C57C 1RZ3A 3V0WH 3HC4L 3OPZL 3U40A 1UM9A 3VR0A 1MB2A 2X2FA 4OJCA 4HYQA 5T3ZL 3DCYA 3KUUA 2AKAB 3UPAA 2E18A 3H5TA 4ETWA 3ENZA 3PT5A 4O4HF 1CS0A 1M7HA 5AJZA 4X90A 4EYSA 4YSCA 3FT4B 2KE5A 1T2UA 2BY3A 3F9IA 2A5YB 1ET5A 3PHQA 4HISA 1Q44A 3PABA 2EDCA 1CEXA 5E0KB 1YY8B 3DTDA 2B30A 1LF5A 1Y9DA 5GQSA 4IRJD 2QVIA 1G7QA 1SVKA 3WTBA 5AW4B 5EF3A 1TVDA 4KHXH 4ANWA 3QPAA 3DO3A 4BMZA 4N2CA 2KSQA 2H5UA 4LC1A 1FP5A 3FF1A 3B34A 3U1VA 5T3XE 1FZJB 1XF3A 4OM1H 5EO9B 1MJGM 3TBSA 5EIVA 3RA7L 3V1TC 5ABPA 3HPRA 3K7UA 5GS3A 2ZRJA 3CT6A 4MA5A 3O95A 4PJ9A 5LZ5A 1S9WA 4RAUA 4Z2YA 4PE5B 4RIHA 4WWKB 5JW5B 2WK2A 5CW2A 5IK3B 3WL7A 5TPZD 4K2HA 3L7MA 4OFQA 2NMSA 2F1JA 5I30L 1J33A 2AW2A 4EQ6A 3O0LA 3ERCA 3UMTA 4K9QA 3V8CA 3F7VB 3GS0A 4IH9A 5H16A 1NMQA 3F00A 3LFTA 2P5EA 2I6FA 4KLZA 2JIMA 2H5JA 3KPUA 4NN5C 3FCYA 4S1SL 2PVPA 5HVHB 1DO8A 3Q41A 4C0LA 5KWIA 5HI5D 5F0LB 2I6UA 2FO4B 3I4FA 1V54B 1M2KA 4I77L 4HQKA 2EJVA 4IOIA 4CTNA 4WY2A 2G4CA 3HLKA 4HMEA 1WAAF 3VO2A 2DS4A 3L5WB 2FUCA 3D0QA 3PEYA 5D1ZA 4F57H 3B5IA 4TRNA 2N56A 1NQAO 3D43A 4FX5A 3NSDA 1Z63A 2PUFA 1DAEA 4QBTA 2YR0A 3PWJA 5TQ0H 3QFSA 1KMHA 1IEBB 3PP3H 3D6JA 4U3JA 4K0OA 3WXWL 3SDXF 5KQGA 1AZRA 2VZOA 2A59A 1NNUA 2F8SA 1JNLH 4OD3L 3FO2B 3JYQA 3S7GA 5FOSA 5F96H 4HNHA 3IJ9A 3VNSA 3ZDEA 1QYDA 3ADKA 5DHXB 2Z3WA 2Y8EA 1BE0A 4X1IB 1GIGH 4JN2B 2EYQA 4AM0B 3F2LA 4GKKB 5DIZA 3GHEH 1IVNA 5IQ7H 1Q6ZA 4MRAA 5THKA 5GXBB 2VITA 1WEHA 5CVDA 3O1LA 1Y1LA 4E7OA 1TM1E 1KENL 1FDSA 1N6NA 2YWHA 5TEVA 1S7XB 3WA6A 4BLPA 4Y9CA 2XMZA 4JY6B 1J22A 4PTTB 2FDBP 3UPTA 1U8KB 3KPVA 3VFUA 1T1ZB 5DBOA 2YD7A 4BCBA 1REIA 4AT1A 1KIUB 2FT8A 1GPAA 1L4UA 3PX7A 3UTPD 1JNNL 4JJGA 4NQSB 1R27A 2PMBA 2QS9A 1G6RL 2JJUA 1UBGA 4RTJA 3KB2A 4HIIA 2W48A 1PDOA 3QNUA 3K72A 2F17A 4JENA 1JKJB 3SZOA 3O74A 4N6QA 3PYMA 3CLKA 2NUTA 1ETUA 4PO3X 3I3OA 4FOLA 5LZ7A 1YZNA 4GZMA 5JXAH 2R7KA 2BKEA 4HH3C 3N59A 3E6HB 4QUOA 4CQJA 3MSCA 5K0FA 2PP7A 4Q05A 1UZ8A 2WAOA 3EYUL 3C7AA 4YRRA 2CLEB 2QPSA 2EBWA 4CC0A 3IFPA 2CV1A 2ACKA 2E27L 1RT9A 4JA0A 4RK6A 3G2PA 2OBMA 2XZAL 4N24A 1YYCA 2HLDD 4MINA 3QVMA 3WE7A 1CE6A 4BFGA 3P2EA 2VMCA 3PHIA 1E8XA 5L6LB 4BQOA 1KIQB 5E2VL 1ML0A 1N3YA 2ITFA 4R7TA 3KZKA 4XZ4A 4FP9A 4NZOA 4BVKA 1TDJA 3KTOA 5IHXA 5C0CA 5EMLA 5LB4A 5AM5A 4LK4A 8ADHA 1DVFA 2ZTUA 1F58H 3C5SB 5G4OA 1YOVA 3MW8A 2OO3A 5E2WL 2PVSA 3PSHA 3ZLVA 3F7LA 2KZKA 2JJ8A 2CJYA 4N9OB 2R48A 4UU0A 3L45A 4B9ZA 5T8KA 3RC1A 2A6JB 4CILA 2ZBDA 3QVAA 1ZVSB 2REQB 1B76A 2X4OA 3ZKND 3CPHA 2V9UA 4TVPL 3NBUA 3CPLA 4N82A 3H4MA 4UEQA 3LV3A 3BIOA 2VH5H 5EC2B 2FPGA 3ZE6A 1CFSA 2QQKL 5H02A 3OSKA 2PR4H 1UWKA 2W2OA 2Y0DA 2M8XA 1KGDA 4JKPL 3DI2B 4ZOLA 5BWLA 3ZO9A 2ZW9A 4QNNA 3RW9A 3AFCA 3G2LA 1WEJH 1FF9A 1KI2A 2VA9A 1ISPA 1QFHA 1SVLA 2HFGH 1RV6X 4A10A 2EZ9A 5B8CA 5K3BA 4U2FA 2DW5A 4EB0A 3JQRA 3FA2A 4WUVA 1H8NA 3X1EA 1X1AA 2M1KA 2DBZA 3S2YA 5P21A 5EU5A 3E38A 3F8TA 2Q8PA 1ID8A 3AW5A 1M1NB 5FI1B 2OI9C 4LE2A 4TV8B 3FZNA 3NNNA 4N0UB 4CDGC 3UROR 1N2CE 5F5LA 2J1LA 1R17A 3Q8MA 1EZVX 2JARA 5KG9B 1SCUA 4R5XA 4ABUA 1MAAA 2KKQA 2X3CA 4RSVA 1WPCA 4J8QA 4GBMA 1E43A 2WQRA 3RDTC 1JMVA 4FDVA 1QTRA 3HKBB 4I3FA 4DCOA 4X6DF 2AZMA 4QJIA 2CCLA 4J3XA 1P62B 1KGXA 1XXLA 4O4IB 3WIAA 4FQXB 3BHBA 2A33A 4KGDA 3EGSA 1AYRA 3W5VA 1O6GA 4BHUA 1N6UA 4Q56A 1X7SA 3RSSA 5B7MA 2O6FA 1YQUA 5LBSL 3BWVA 1TKWB 3H2WA 3P0VH 1H9DA 4NFYA 2PRIA 5AVQA 3IMWA 3IMUA 4X6EB 2IDTA 2FWOB 4IWNA 2MSPA 2JGEA 1KYOJ 1ZMRA 1AV7A 5FHBL 3E3AA 5CP7A 1WXEA 4WY5A 3CMGA 3RV3A 3B3QA 3L41A 3PPXA 1RBQA 1UB5B 1AGDA 4HSCX 5GISH 5BWMA 4DIFA 4GEIA 1Z35A 1BAPA 1ZAGA 5T7BA 3WIDA 1RACA 1LLQA 2XMQA 4ZA2A 3BVTA 4J3WA 3Q0EA 4IDHA 5HGAB 3SKVA 1I8UA 1QZTA 1ODTC 1THMA 4Y6QA 3ZOZA 2O8BA 4TZTA 3NTXA 4LEOA 2RONA 3M7FB 1S7QB 1PQWA 4GIBA 3TQHA 4KX8A 5GV7A 1TQCC 4LRNH 3M5WA 2HCRA 4EDHA 2BD0A 1BFOB 5CBAB 4E4YA 4ZGWA 1Y6FA 1CUVA 5F9JA 2JKNA 1I3MA 2BMEA 4CM6A 4GQ9L 1JPSH 4ECNA 4J9UE 1XTSA 5GZNA 3IDGA 4QSHA 2YOHA 3L81A 2PRSA 4EJSC 4A39A 4ARBA 3EIOA 4W9EC 3CX6A 4GXRA 1XELA 2QJTA 1EJ6A 5DHSA 5TB5A 3HBPA 2NU9B 4QM6A 3LQKA 1T4WA 2MYNA 1NFDB 2FPMA 4H1LG 2QVXX 1C16A 4ABYA 1NFQA 2DPHA 5CB8A 3PNRB 4ZTBA 3DEJA 3W39B 4C6SA 3F2VA 4J3SA 3MJDA 2AMJA 2VNIA 4W81A 3D8TA 1M71A 3BKML 1VI2A 4KKBD 1QVVA 2VYRE 4UDUB 4MMYB 5AQ1A 3R0NA 5I7UA 1JNHA 3O4OB 3NOQA 2YWFA 3B8EA 2RACA 2L4OA 4L6CA 4Z0XA 5F1YA 3HBMA 3KPWA 5H9VA 1IEVA 4KR0A 1T0NB 4FSDA 3F04A 1JFRA 1QE5A 5D9SA 5AZUA 1ONSA 3S7ZA 2Y2YA 5EPMB 1DWOA 4P23D 1I94B 1KGCD 4E5SA 3FT0A 1Q17A 1HTYA 3JQ8B 4EHLA 1B7GO 3TX6A 1A1MB 3UMCA 1DLJA 4RXTA 1W0VA 3AHCA 5IBQA 5JOPE 3LH9A 1R8YA 1AQDA 1R16A 3F71A 2E5EA 1TQSA 2ED8A 1WFNA 3UC9A 2GWHA 1LHZA 2PA0A 2HPOA 1QHOA 2UUDK 4NAVA 3G8AA 5L95A 2DQ6A 1UMBA 3ZTNL 4BVFA 3GGGA 1HQRA 1FSZA 2VSMB 4XYLA 3PLNA 1D5ZA 2G1PA 5I73B 3GNQA 1Z5LB 4A2LA 4L16A 3N3AC 5B7GA 1PK9A 5ALPA 2X19A 2K45A 4ZVOA 2UY6B 1MFVA 4P3OA 4ID3A 4K28A 4EHKA 1MC1A 4PG7A 2M32A 3KLKA 2ZSVB 1PHPA 2QI9F 2IKQA 1L7TL 5C7YA 2HTLC 5IWAB 1VL5A 1O6CA 3V0DA 1BYUA 1P5JA 2Y2VA 4EMBA 2NY0C 1FMCA 2C61A 4EDXA 5SWZB 1HHIA 3DIVA 4GKAA 3MYJA 3GTVA 3QGVA 1PSZA 1I7UA 3FQ2A 3VDAA 5GGUA 3W8FA 4G26A 5ADPH 3PDIB 4MLPA 5I6KA 3UDWA 2Q7YB 3VFMA 3V5KB 3RDPA 4UUAA 1F13A 1NOLA 4PSDA 5EDSA 3C5HA 4BFKA 3SGDI 1BLNB 2APBA 3WNPA 1D0VA 2F18A 4AN4A 3WIFA 2FVXA 1UM9B 3O94A 2OMNA 1QHPA 5AD0A 4Q9RH 5KYWB 1CS0B 4H6PA 1MIEL 4LJ5A 3OKMA 1KOAA 3PHQB 2CLZA 3PABB 4K3DH 2QVBA 3FCOA 2BSCA 1WJGA 4L1KA 4FYSA 1G7QB 4X8CA 1H1TA 1J9CT 5CCKH 5CM2Z 1WUJS 4ZQKA 2AS0A 1UWFA 5BV7H 4LXQA 1E63A 3AB3A 1RQPA 4RDXA 3V5DB 1VSVA 3TBSB 2BFPA 1L9SA 2AI2A 2O23A 3CVDA 4G83A 5DZPA 3EVBA 1JDBC 2MSKA 4V02A 3C1AA 4PJ9B 1PZSA 5E1AA 1S9WB 4RAUB 4ND8A 3GVCA 2AZTA 1RHUA 3BPCA 5DO2C 4EQ6B 5C35A 4WLNA 4HWBH 5EPOA 4BZ2A 3DSFL 1E5YA 1V96A 3CZRA 1RURL 2JKXA 1ECYA 4KVCH 1H6UA 3VNYA 2F1IA 1GCOA 5LKRA 3CK0H 2QG6A 2WJ3A 5CEZL 4MI1A 3U13A 5E3HA 2I7VA 4KH1A 4RMNA 4MTLA 3F9RA 3OHXA 3CLFH 3U2IA 4IOIB 2WIIA 1YQ2A 2RHCA 2ZWKA 4EG3A 2SECE 4NE2A 4AZTA 5D1ZB 1E9PA 3UT6A 2LCQA 3KZMA 3RRXA 1TQDA 1H9BA 3MV11 2VZ9A 5B55A 5F1KC 3PWJB 1M2GA 1KMHB 4R3NA 4U3JB 5JRDS 2YPLD 1FAKT 4CL8A 4I3GA 2FIRT 1P7QD 4UE3S 1Z9SA 3OKKA 1UFGA 1OFUX 4OFVA 1CR6A 3IVRA 4S0HA 5GGQL 2FHFA 1CUZA 3NA9H 4KZDL 1CBVH 3T4PA 5I5MA 5CJQH 1A8PA 1YB2A 2BVPA 3DB2A 2VC2B 4Z77A 1BOFA 3OETA 1MV5A 4HFUL 3VD0A 3MJCA 2VITB 2W1NA 4M0UA 4JPKL 5EOTA 1JYVA 2GZDA 4OQYA 4C4YA 5C09A 5HEKA 1P3JA 2Z83A 3K8MA 4JWTA 2C4UA 2WWHA 4LXYA 3CU7A 3HYRA 3N1FC 4IQHA 3UYRL 3AWFA 2CSUA 5TDHA 1QR2A 3FY4A 3VFUB 2XQJA 3ONFA 1E2HA 2N46A 2XH8A 1JJUA 2AC7A 4HVAA 3OUTA 1QO9A 2EKQA 1YU9A 3SX4A 1WXQA 4ENED 2PBZA 3H9ZA 2FLRT 2IWEA 1M9SA 4Y9UA 4LNRA 3JD0A 5H68A 4PJCF 4UZFA 2H85A 1MW0A 3RABA 4J3NA 2CL7X 2X44D 1O1YA 5D70H 5KVFL 2WINI 1PY4A 4HIIB 3ZNNA 3K72B 3TN0B 3WHE0 1KP2A 1U8XX 1GPOL 1U3ZA 2NUTB 3NWJA 3ZBPA 3Q3GA 3DE1X 4TVKA 4WPGA 4WHYG 3DUFA 4HY3A 1AN0A 2FQFA 1JDVA 4MZ2A 1UZ8B 3K9CA 3EDCA 1T5IA 4L1DA 3IFPB 2W7TA 3LY8A 5B6IA 1C5CH 4NLAA 3C85A 4M46A 1YJDH 2XYGA 3NASA 3PGCA 5I9TA 3QWNA 5TF0A 4UEJA 3GWZA 1CE6B 2QZ5A 1DIOB 4PFQA 4CCAA 4DWHA 3KJIA 4Z3GA 1ZEAH 1JUDA 1XT5A 2OZEA 4Z7UF 2GH1A 4UNIA 4WACA 4PJIA 1Z16A 2PYIA 3HADA 1Y6RA 3PV6A 5IT2L 5C0CB 4Z51A 3AWEA 5CEXA 5EVJA 2FK8A 4K9SA 4YHZH 2FB4H 5DD5H 2IBMA 1DVFB 1E79D 4YJKA 5IESH 3KB1A 4FHFA 1P8AA 1YOVB 2OCPA 3KVPA 4KUZH 1GPYA 4LU5L 4G3YL 4FD2A 4FQXD 4IIBA 1M2NA 2IE8A 3FH0A 1UEJA 2OMEA 3ICWA 1U3DA 2W58A 2WF8A 9PCYA 2GYWA 2VWGA 2CXUA 1TNNA 1JFQH 2HJ9A 2X4OB 3G7SA 4J4PC 2JKLA 2C3UA 4JMLA 3NU1A 3CPLB 4DP4X 4V0OA 3IJ5A 4G7VH 3RPIB 3LV3B 4X9YA 3CX2A 4YRMA 2V5SA 1OP9A 1SAYA 2FPGB 3TQTA 2LFEA 1TGYA 1JHLH 4OCMC 4P7JA 1FUEA 2BGGA 3BPNC 3T9FA 2CF5A 2PUQT 4S1TA 1ZD2P 1VTKA 1RZJC 5K9JL 1R4NA 2ERXA 4MS4A 3B2MA 2QA5A 4OGKA 5B58T 1V8OA 2CWRA 3LKOB 4GNRA 5EU5B 3LQQA 1IQ0A 5D7LE 4M2LA 4UBNA 1IMJA 2BDTA 2ECPA 3VFSA 1BXVA 4PRAA 3QEHB 4PPGA 4CMEC 5C07E 5JZ7D 2Y67A 1LO2L 4PPFA 4JSRA 1SCUB 1IQPA 5SYNA 2E5LB 3BREA 1YRQA 3FKQA 1BBDH 1OXTA 5IGXL 5CJOH 2CVHA 1NA5A 5KMGA 4DJTA 1R0LA 4FYMA 1XZDA 3H2PA 4M37A 2FK9A 1JWBB 2HHHB 3LDBB 3AY6A 3BE8A 4KBGA 1SDAB 5FWRA 1OE0A 3R6LA 1SUCA 3SJVD 3BHBB 4HS8H 4IF6A 4I0PC 3EGSB 5E7BA 4RGQA 1HG1A 2EF1A 2CLSA 2FZ4A 2HEIA 4Z95H 2GT9A 4P48A 1K6QL 3AFLA 5IS2A 4NQDE 2IUTA 4YQXH 1FLDA 5AVQB 2ZSFA 2A1IA 4LRUA 3AS1A 3JZAA 3BH7A 3ACDA 2E6QA 4NV3A 3RTLA 3R4RA 2PKDA 4MW2A 5CP7B 3N05A 4WU7A 3DDWA 2VDLL 3FU9A 2WY3B 4Q3KA 5B1KA 1GZSA 3K8YA 1AGDB 2BNRE 4FNUA 4Q1AA 2XTJC 3O2DA 1IQRA 2Q8BH 3QPQD 3AF0A 2XWJI 4LQ4A 3IKCB 5L2JA 1Z5NA 3T3ME 2R9VA 3HB5X 1LMKA 3HA3A 1SHYB 4RCYA 2ZCLL 4DKEH 4UREA 1A4CA 1JUFA 5TE9A 1LDPL 2Y36L 1WQ3A 2JFFA 4HI0E 4LHQB 4NV1A 3W8EA 3KLHD 3KYKL 4OXYA 4DLXA 3HE3A 4X8GA 1CWUA 1OWOA 4ZKEA 1QACA 3X2SA 3EOAA 3NFPA 2B4TO 4LXTA 2W07A 2YQZA 5CG2A 1M7GA 3BAXA 3RNQA 3UZUA 4IDBA 3WHKA 2RI0A 5K45A 3L8DA 3IDGB 2H54A 3KNBA 2Z4RA 5K09A 3MRCA 3MJFA 2AKEA 3BKJL 4KYUA 4U6QA 3ED1A 5I1HL 5EF1A 2ICCA 4TNWK 2JH8A 2KLBA 2PS0A 1T2AA 1C16B 4JVLA 4NZFA 4HLNA 4DILA 4ONGL 4XAKD 1XFAA 5BZDA 4J1SA 3CN2A 3H8VA 3HCEA 3MD9A 3PGFH 3SSMA 2OFQA 1SYVA 4PJXA 1XRMA 2BP0A 5NULA 1XZ0A 1M71B 2VPPA 3JQBA 4A6YH 3C8MA 3PAYA 5CT5A 3EUAA 3AJEA 1LZLA 5CFNA 4M88A 3WMXA 3KQTA 3AT1A 2BZGA 2ZSIA 4DNQA 2E49A 5BNZA 1D7DA 1NZFA 4Z0XB 2MSWA 2G2RB 4QOGA 4QRRE 4LEIA 3D2LA 1NMAH 5D9SB 3JWDL 4RQBA 4I7EA 2EDYA 5G1OA 4F3CA 3L5HA 2HD4A 2DF8A 4MROA 4R69A 4BDVB 5MP6L 3N58A 4C5AA 4U0RB 3ZWVA 1YV9A 4NC9A 2P5TB 1ZANH 1N6LA 4L9LA 5G41A 1AQDB 2Y1DA 4QGFA 2WKQA 2Y9RT 1BYIA 3C8HA 4MV8A 5DWUH 3KZOA 5D4HA 4NMLA 4QR7A 3KBHE 2BCJQ 3QLUC 3TA3A 1B1CA 4MCAA 2NY5L 1UMBB 4FYKA 2QADC 2FK7A 4OSEA 1YEGH 1HQRB 5JDIC 3I3DA 4Y4FA 4P7BA 1ZIDA 4MUEA 1WHPA 2YEZA 4XWTA 1AZZC 3KOUA 4B73A 2P3YA 1AMUA 3F6JA 4CVNA 3FRPA 4QBFA 4HRXA 5AMXA 3O4LD 4ND7A 4TTIA 4DNFA 4D9KA 1V8ZA 4XCQA 1XEDA 1JAZA 1XN1A 3FFBA 3LYLA 2VXQA 4Q6WA 5G4KA 4IG9A 4LWQA 1N19A 4KYIB 4H5SA 2ZX5A 2AX4A 5M7QA 1X19A 3GM8A 1I36A 4Y9SA 4EDXB 5TPWH 1OK0A 1HHIB 2H7XA 2C9YA 2P4EA 3MYJB 1VFUA 1XP5A 1O9GA 4HVTA 1B3BA 5I66A 1I7UB 1F48A 5FYJL 5MDHA 2QJFA 4YXWD 3V00A 3M6DA 4UATA 4KQWA 4N3CA 2E3VA 1SUSA 3VFMB 3TH2T 1GLVA 4Q6KA 2W65A 3G8DA 2PWHA 5BMVA 1L9OA 2JIPA 3ZS9A 1HNFA 4K2AA 5BXQC 4YK4C 4CMMA 2ZANA 2G9UA 4C8XA 4PB0H 1EXNA 1B2WH 1IUNA 3WIFB 1ZJJA 1D6EA 4Q7LA 2UAGA 4QOHA 4EG0A 5D2NC 1U7PA 3L5XH 1N2RA 2B8JA 5LWYL 2J08A 5AD0B 4M9UA 3D87B 3DXFA 3L04A 4Q9CA 2O07A 3O6LL 1DBRA 4Z23A 3OKMB 5KS9A 1QVWA 3CBQA 1I7PA 4RHEA 2IYNA 2YQBA 1GJIA 4WI8A 3GARA 1PCXA 5A5VA 2CLZB 3L3IA 5HHXH 1HYHA 4KP7A 3KZ8A 4L8DA 2V9RA 1NE7A 2CH8A 2RG1A 1JH8A 4TNFA 1PG2A 4IBUA 5DNAA 1Y9JA 4AGNA 3VTFA 4ZQKB 2PTVA 4NHUB 5KTPA 4QF1B 3WFCL 3CEMA 2NU7B 4OHPA 5TR9A 1RM0A 1XFPA 5E1AB 5FPTA 4ND8B 3BTOA 1EVZA 2VLRA 4IDCA 3BPCB 2B7BA 3A67L 1KJ8A 2A4MA 2ZZNA 3O3CA 3WOVA 2XT1B 1C5KA 4MV4A 1K2DA 2OQRA 3DG9A 3L02A 2LVEA 3W5DA 2Z91A 3BH8B 3BXPA 1YZVA 2GHIA 1BCRA 2H7WA 4YHHB 3EZGA 1UA6H 2P42B 1VDMA 1JFFA 2O3SA 2FPOA 1FU4A 1T8WA 1LYQA 4DV2B 2R2HA 4YUZA 3OHXB 4B9CA 4EY8A 3I34X 7FABH 3TN0D 4TTVA 3NDPA 3R6WA 5TJ9A 1A8JH 2HDWA 4BUJA 5C6WH 2DI9A 4YRBA 1UBSB 1BJ1H 4UCFA 4UCXA 3KDMA 3D3WA 1R5OA 3KCWA 1R3LA 4GT1A 4GWKA 1JFLA 2PUWA 1NEZA 2EDHA 3BMWA 5FS5A 4PO8A 3NM5A 3BAEL 1EUUA 1Z9SB 3OKKB 1FRVA 1YCFA 2ZVJA 1J0JA 2REXB 4GYKA 1I3RA 4JIGA 1TZ2A 3ZWXA 5AOLA 4EB3A 4JLWA 1JZIA 4JX0A 1XGZA 3V6ZA 1EX7A 3WNBA 2BVPB 3NT5A 4CXMA 4Z77B 4YCCA 2BEVA 4J2QA 3K1KC 2BM9A 5EIAA 1ZD8A 3EXG1 3IPAA 4D9HA 3BGVA 1D3CA 2DH5A 2G7MC 3HCCA 1KP9A 5I9MA 2EJTA 5EOTB 1Y6GA 2BNQD 1XRPA 5C09B 4OXRA 5DM0A 3RR2A 4GQZA 4K73A 4J3UA 1M6YA 2I32A 1JZ3A 2AFRA 2EDJA 2I33A 2YRXA 1BO6A 3AT9A 1TD1A 4BLVA 3CR7A 2BGKA 4XSVA 3LJ3A 2YMXL 3TJMA 4XCCL 3QAZB 1O0VA 1N92A 3FUMA 3KPRE 1EO7A 4WO4A 3V8BA 3D6AA 1Q15A 4NO5A 4B85A 3FB8A 4MYDA 4QECA 5JA9A 5EFOA 4LNRB 3LLUA 3W11D 1CZNA 3Q3VA 1QX4A 2JIBA 4OP3A 3B12A 3GC6A 4M5ZL 2IZ0A 2V7EA 4ALMA 2GM4A 1D9KC 2FFHA 3VPSA 3Q3GB 4J0CA 5F76A 2BS8A 1DC6A 3G9ZA 1UXSA 1D1TA 2BC4A 3DUFB 2EUXA 1KOJA 4IBZA 1E5VA 3LPAA 5L0QB 2B1AL 2DU8A 1G94A 1S96A 1AMOA 4L3AA 1Y4DE 4XMZA 5COAA 1T89A 2X9ZA 1CETA 1AO7E 3KTAA 2YUWA 5J4VA 2QMEA 5B6JA 2I99A 5DP2A 1LDMA 3QEQA 3KLLA 5C2UB 4Z7JA 4I6GA 5L2KE 2WXPA 5CR8A 4QYTA 5B1JC 3KLNA 4F58H 3GUTA 1CDDA 4LAQH 4UMDA 1VC2A 3EB9A 2AXEA 4PJIB 4NESA 1A7RL 2FAXA 3QIAA 5CEXB 1S5PA 3H56A 4L2LA 5E8DL 2X8BA 1CR9L 3UBGA 2JV6A 5D86A 5FBRB 1Z47A 1GAFL 1RYBA 3EVCA 3D85A 4S1VA 4UU1A 3FYUA 4HKTA 2EZ4A 4NUQA 4QRIA 5E56A 1Q72H 1ZGLA 3TVMC 3LCRA 5BQPA 5IHBA 1TM5E 3S2AA 5TT0A 4GKZA 3NM6B 1ZOOA 4J49A 4OGZA 4MR8A 3GQFA 4N9GA 1J0BA 2CKBA 1UBMS 3SGLA 3WEXB 1V8FA 3Q3CA 5DJCA 3Q9SA 3T1WA 4PSKA 2WYIA 3PC2A 4QD3A 3QBTA 4ZCSA 5A6MA 3MERA 3CMMA 1KGUA 3DE2X 1XXHA 3WYNA 4AL8L 3RVNA 2Q1UA 1NW5A 3DYBA 2O6LA 4W1SA 2N7BA 1R4NB 2FE0A 4MS4B 1SMOA 1TTQB 1DVYA 4XMKH 1DBBH 3QFJE 4DUYB 5DB4A 3UK6A 4Y9BA 3CPUA 1WTCA 5F7EL 2QSTA 2K8QA 5C37A 3Q2LA 1KRHA 4CA4A 1MFAL 3VFSB 4PRAB 1BQ5A 1H9CA 2YUTA 4LRWA 4RIGA 1TUPA 4H0GA 1JG9A 2J1YA 5CINL 3NRFA 2HLEB 4XB1A 2PTGA 3I6YA 1X9UA 1F2DA 4ADJA 2Z3FA 3PNYA 4HOMA 4OAWA 1FRGH 1SEQH 2ZK7A 5KMGB 4OLHA 3EFOA 3P97A 4RD6A 4P54A 2VT7A 2J45A 2DQKA 1TVBA 2FMTA 4YMHA 2OOKA 5ALGA 4XGNA 2WSSD 2GT9B 4WSKA 4PQFA 3GEEA 1MW8X 2DYPB 4S1DD 1Z62A 2PJRA 1GNLA 3K0FA 4OLYL 1NCCH 2C1PA 4K7PY 4MAYA 2X1MA 4FQLH 4A82A 4U63A 3NCYP 4WU7B 3QORA 2O1XA 5BQFA 5E6IA 3CLEH 3CXDL 1H0KA 4P4LA 4X7FC 5JD3A 1RQRA 3V9FA 1KDRA 2YAEA 1WD5A 1LE9A 2UZIH 3IT0A 5DW3A 5LQSA 3JQ9A 3K16A 3GSRA 4N85A 2C42A 1OYYA 1C8VB 5E4YA 1JUFB 4U1KA 2RB5A 4RMHA 3QMVA 3NIGF 4DCNA 3HW7A 1I7TA 4FG6C 1NQTA 4JM4H 1RHFA 1XL1A 3JQ7A 2W88A 1AA9A 3D4OA 4RH0A 4MKFA 2JFYA 1DVUA 4CM9D 4TWJA 1WZ1H 1KYAA 1XJWA 1UT9A 2OJZL 3EOAB 2X0NA 3NFPB 3VHLB 2MSLA 2W07B 2PBFA 3MXWH 4G1EA 3S5LG 3RNQB 5A3ID 1E2ZA 1GAXA 3FFXA 5DI9A 3AQIA 2OMXA 3I39X 5J23A 4AXXA 5ELLA 3KNBB 5ANMB 3KW7A 2HIMA 4GSYA 3MRCB 1IZZA 5TS3A 4CNBA 3H8SA 4NO3A 1OLLA 4JJ4A 2RAFA 1OTUC 3SGKC 4G7YL 4YT2A 5JZ9A 1INDL 1NC3A 5CTAA 3UGQA 4TX1A 1U65A 1MEXH 5T5FL 5BZDB 4L0DA 4M7KH 1A9PA 4WTWA 1M6OA 3RKUA 4FR0A 1B4RA 5DM2A 3JX9A 1NRXA 2BP0B 1XZ0B 5T1LB 1Y7LA 2Y0PA 3FRJA 1NN0A 1PVVA 4E22A 2ENQA 4M9PA 3AM5A 1QZNA 2EABA 2JFZA 4P5MA 2ZI4A 1ENYA 5JYDA 3VFVA 3L54A 3Q8WA 3MB5A 2NXYD 2JCSA 4DLTA 3RIFK 3IUQA 1U41A 4UBDD 1VPDA 2X6UA 1Q0UA 4FS3A 5DCYA 1ZU4A 4ARVA 1ZUD1 4G5OA 4NICA 1MB3A 2Q49A 1N0WA 4P5SA 5A4JA 2JCCF 4M6NL 1EMDA 1SN7A 5FEBA 2NV6A 1Y4ZA 2XNAB 3HDYA 1U8MA 5LXGH 4L9LB 3UPRA 1BG6A 4JI6B 2C0CA 4Y9EA 1WIUA 4BSVB 1D4ZA 4TLBA 4ZFNA 2NZJA 3LXRA 1D2GA 3T34A 3LHKA 2C9DA 1TZBA 3E9NA 5JTWA 1A3CA 1YO6A 3CCBA 3RCBA 4GSDH 3HYTA 1YC5A 1GEEA 2GYUA 4BX0A 4Y4FB 2A9QA 5SY9A 1ICIA 1IE5A 2Z4SA 2CFOA 3VA6A 2B2XA 2JQZA 4UOW1 3WLIA 4IMKC 2YEZB 3VVVA 5A43C 4M7JH 4GNKA 4PRBA 2QQEA 3FRPB 3ZI7A 2XTJE 2RGGA 1CVRA 1KNOA 3DLIA 1WDAA 3ARZA 5FHQA 1HDOA 1VCIA 1B0AA 5G4KB 5EKTA 3NCBB 5C0ND 2PG3A 2ZWOA 1EFDN 4H5SB 1ENPA 4DLYA 2J41A 3QVTA 2NZ8A 4UTVA 2QDXA 3OPNA 4R8VA 1C08A 1TZCA 4ONFL 3MV9E 4B35A 3GCXA 2E7BA 5I66B 3NCJL 4TN9A 4L3ED 1NUUA 5KX5A 1A2QA 4LVOC 5C0GA 3PFCA 4CLEA 4E41E 5D55A 2KMWA 1O95C 1TAUA 1ECZA 1FYXA 2W65B 3MLTA 4K6FA 5BMVB 5AOCA 4U6TA 1DC7A 1MJUH 4X3OA 4ZXBD 5G40A 4CMMB 1I4TD 4EN3A 3HS0A 2PN5A 3VFTA 3DMFA 3BGFC 1DCTA 4BQEA 3SQWA 2CK2A 3U1PA 3JVEA 4NUJA 1D6EB 3RI3A 3CUEF 4LZOA 4LE1A 3LQZA 3U4HA 1N2RB 4ZOEA 3PS9A 5DZAA 2IYSA 4DFIA 3PXJA 4WNJA 3H9SD 1H3TA 1Z37A 3L3IB 3V6OA 4L8DB 3GO1H 1Q7TA 3CPJB 3L77A 3PICA 4DIBA 1QRRA 1A3RL 3BDVA 4DT2A 3K5PA 2GN9A 1I53A 3EC1A 1RL1A 1FA9A 5A2CA 2FECL 1IQWL 4KBYA 3GJXC 5FLVA 4BO0A 1I7NA 3QZMA 4PLZA 2P5WA 2WPDD 3TNNA 1E9AA 2AF2A 1MCJA 4UYPA 1EXHA 2VLRB 1CR2A 4XB7A 1IGYA 4EUSA 3BCDA 1UBJS 4UAOC 4AYEC 2LGJA 4INPA 3N0RA 3NGLA 1K2DB 2QJRA 1EGHA 4ZAVA 1VIWA 4AEHH 2XV2A 3D5TA 4M76B 4B43A 3UX9B 3OP1A 1S7VA 1A3QA 1Y8RA 3HXQA 2Q3FA 3Q3EA 2Z91B 5KTOA 1JHPA 4S1WA 1BCRB 1XEXA 3FQXA 4K0KB 1D04A 1JFFB 2C5SA 2R2HB 1P4LA 1QH1A 1ZT1A 5DGHA 4KUHA 3ZCTA 2EX1A 1UVQA 1Z26A 5EZSA 5I8PA 1GGIL 2GM3A 2WC1A 3CLRD 4QTHA 4WWHA 1LLAA 3M70A 5L4JA 4HDQB 2VUKA 3KDMB 3D3WB 4C3OB 1R3LB 2EVWX 1KB5H 5ALBL 2X4NA 3ZNPA 4TLDA 1MDTA 4YO0A 1XK7A 4YMWA 4Y19A 5DMGD 5JCXA 4ZNEA 3D69B 2PUDA 2CV0A 4NBYB 2P1YA 3THWA 4J29A 4NYJR 4PC1A 1I3RB 3AQDA 1EHIA 4DZZA 5LQMA 1QABA 5LQUA 1UWEH 4NKIH 1BHSA 4LNUB 3V6ZB 2OMVA 5DHEA 1QGUA 3SBQA 2BEVB 1OQXA 5LQBH 2FATL 4RLQA 1JQLB 2W0PA 5D2LE 3NBFA 3IP6A 1NOFA 4HLZG 1NASA 3QHPA 4H8VA 1NSNL 1NW7A 2O2IA 5GRJL 5LMUB 3H8NA 3PWUA 2OBXA 2J5LB 3KGSA 1FFOA 4QQRA 1E1NA 4K71C 1R0CA 1AS2A 4A1OA 3NSYA 3DW3X 1JRHI 1U02A 4C0WA 3UUGA 4BLRA 4P3KA 4NO5B 1A7OL 2ZKWA 1Z0ZA 4PNZA 1ZCBA 1G5IA 4UFOA 3F74A 4AK9A 2PX0A 4YP0A 4MV0A 3H54A 1SRRA 4GLJA 3IPCA 3L7FA 3GHBH 1MAUA 1U42A 2UWEA 3WNJA 2IK8A 3AIIA 4IJ3B 5ID1B 5EIIA 4L8VA 4MJIA 3QMWA 3VR5A 5D84A 2EVFA 3FTGA 2GFHA 4FNQA 3S36L 2QMYA 5T5NF 4PN6A 2YJTD 4TWIA 5FV4A 1FMTA 2X77A 4NXNB 4RORA 3L40A 5EC1B 2DFNA 1H3PL 2C8VA 1GP2A 1Q16A 1IBCA 4ENSA 3P8ZA 1U7TA 3KTAB 2VPQA 3MLUH 5B4VA 2OL3H 5BR1A 1Y34E 2VPWA 1F4PA 2C2OA 2W6JA 4D8PA 4MB6A 3RRMA 1G7LB 3QEQB 5K0TA 3WGIA 3GUTB 4KDTC 3LX9A 1HS6A 3V7UA 3HFRA 1E59A 4S05A 1LX6A 3TD2A 5IZ4A 4HOWA 1PG7L 1MAHA 1FNCA 5JY1A 3BH9A 1S4QA 1LLUA 4IDQA 5DJ5A 1AIPA 2XGJA 3M9LA 3NH9A 2WM3A 1G6KA 1GFZA 4TS1A 3D85B 3FYUB 4XUCA 1ZGLB 4RK5A 1QLEH 3RQSA 2D3VA 1J18A 5E7FA 4QEZA 1G7JA 4LHJB 4BHTA 3DM5A 4GAAA 4GKZB 3UADA 4AH2A 4LGMA 4PJEF 4PG6A 4MR8B 2R59A 5JMOC 1CDOA 4LLDA 4N9GB 3D7RA 2CKBB 2J21A 2DYPD 4ZI8A 1WQ1R 5DJCB 3H2IA 3NDIA