3ZDZB

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 111
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3zdzB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3zdzB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3zdzB03
4CN8A 4NEHB 1ATZA 3FCUB 1U0OC 3PPXA 3EFOB 1L5GA 1JEQA 3EH1A 1M1XA 1RRKA 4WJKB 1QC5B 2NUTB 1IDOA 1UEXC 4G1EA 4A0QA 3T3MB 3NIGB 1DZIA 1SHTX 1PD1A 2ICAA 2NUPA 4F1JA 1JEYB 1RTKA 3AFCA 4JDUA 1FNSA 1JLMA 2NVOA 1RD4A 2IUEA 1MF7A 3NIFB 4MMXB 1XDGA 3T3PB 5E6RA 1M2OA 4HQKA 3K71B 3FCSA 1Q0PA 4G1MB 3QA3E 2VDLB 1PCXA 3EGXB 3V4VB 5HGJA 4MMYA 3N2NA 5KYUB 4WK2B 5HDBB 4O02B 1AUQA 1JV2B 3K6SA 5E6UA 2B2XA 1U0NA 5E6SA 5ES4B 1M1XB 3NIDB 3F74A 1BHQ1 4C2AA 1YVRA 2P26A 4UM9D 1AOXA 1IDN1 4Z7NB 3EGDB 1MJNA 1M2VA 1T0PA 2NUPB 3TW0A 2ODQA 1YUKA 3BQMB 3ZQKA 2VDMB 2I6SA 1LFAA 2I91A 3AL8A 1XUOA 4Z7QB 3ZE0B 4GZ8A 4O3UB 3FCSB 1OLZA 2I6QA 3HXOA 2M32A 4NENA 4PN7A 1BHO1 4JX0A 1SSLA 4XW2A 4MMYB 1PT6A 3RAGA 5KYYB 4UM9B 4MMZB 5KYXB 1U8CA 4WK0B 1ZOPA 2ADFA 2VDQB 4HQOA 3EG9B 5HJ2A 4C2BA 5KYUA 4CN9A 5KYWA 1CQPA 1SHYB 3TXAA 2VC2B 4WFQA 1N9ZA 1M1UA 3EFOA 3NVQA 4M76B 1L5GB 3OL2A 1JEQB 3IJEA 1QC5A 4HQLA 3V4PB 1DGQA 2XWBF 4G1EB 4Z7OB 1XDDA 4FX5A 4WK4B 3ZDZB 4HQNA 1MHPA 1MQAA 1V7PC 3BQNB 1IJKA 3F78A 1OAKA 5LN1A 3PPWA 4UM8B 3TVYA 4MMXA 1YVPA 1ZOOA 2QTVA 2WW8A 2XWJI 3K71A 5E6RB 2P28A 1MQ9A 4G1MA 1M10A 1IJBA 1AO3A 3PPVA 1SHUX 3TCXB 1U8CB 4O02A 1SQ0A 4IGIA 2VDRB 3EOAI 3K72A 3VI3B 3PPYA 4IXDA 3K6SB 3AL9A 5E6UB 1NA5A 3Q3GE 2VDNB 3ZE2B 2WINI 2UZYB 5E6SB 3OL2B 3IJEB 4C29A 5KYNA 1ZONA 5BV8A 4HQFA 3BN3A 2NUTA 1FE8A 1TYEB 3EGDA 4IHKA 4BJ3A 2VDPB 1M2VB 2X5NA 3EOBI 3ZE1B 4FWWA 3HXQA 1T6BY 1JEYA 3OKYB 3OKWA 3M6FA 1N3YA 3IBSA 1QCYA 3AL8B 1CK4A 3HI6A 4K3JB 1RS0A 4F1KA 3ZDYB 1PD0A 4NENB 3VI4B 3E2MA 4DMUB 2VDKB 2O7NA 2ODPA 5KYYA 3EGXA 4MMZA 2VDOB 5KYXA 3ZDXB 2XGGA 4CNBA 3EG9A 1MQ8B 3K72B 5KYWB 1JV2A 4O3TB 3EH2A 3GXBA
chains in the Genus database with same CATH superfamily
5AXDA 2VC2H 3JQDA 2PKQO 2IIVA 3JD4A 4Q4IA 5KJEA 4DLNA 5KHLB 3CIAA 1TJNA 1OO2A 3LDGA 5L95A 3VXSA 2WUCH 3P5SA 1FGVL 3VXUA 1U3YA 4IGBC 1NCTA 5IAOA 1XGKA 2XNCA 3LZLA 2HFKA 5GZNA 1EGQA 1TCMA 3LVEA 5E6SA 5EU6E 4DDKA 4KIFA 3HR4A 4U9HS 5CEJA 4V0NA 1IGIL 3GNQA 5AW6A 1JXOA 3ZIDA 3ONDA 2AXFB 3F1LA 3VJ6A 2DQIL 3C16C 2GQHA 3EF0A 2W7TA 4QG7A 4CIWA 3QEQD 3DZGA 1OOAA 4GGMX 3TVMD 1LNSA 3RIGA 5DHYA 4E88A 4MV0A 4D9RD 3BUYA 3WLMA 5L2KD 4KKAD 2EE0A 4O4HA 4JVWA 3LP8A 3FS9A 3PFKA 3V80A 4BYHA 1CFMA 1CXZA 5LNEA 5CA1F 4YZWA 2RGDA 3KVDD 1UKCA 3BESR 1KA9H 1RP9A 1JNJA 4H60A 1Z9PA 2IH3B 2I76A 4IOKA 1H6TA 2EDXA 4Q2ZB 2D03L 5K59E 1USQA 2YHGA 1BBDH 4Y88A 4DQOL 4LDPA 2CSXA 3RI5K 3PQ8A 4ODTH 2AXFA 3AXIA 2LUOA 4KQ3H 1TEZA 3LUGA 2JB6B 1MFBL 3B1TA 4OUKX 4BHTA 1YNSA 1WEJH 4Q19A 1JPUA 4Q1DA 3I8OA 2FW7A 5IT4A 1WAAF 1DBAH 2QHLA 3AQXA 1CBVL 4N3TA 4RZUA 4D0RA 1GMEA 2KPWA 1DJHA 5JQGB 2BEVB 1NPUA 4CDRA 2CMDA 2F54B 2YRFA 3K4DA 4Y1TA 1UOQA 3CUUA 3KZNA 2MCG1 4Y2RA 4LNUB 3NVDA 1EDYA 5D1QE 3A21A 3KWWB 1UZ6F 4UZEA 3C60C 4J3WA 4O6VA 4TRRA 4P9ML 5K01A 2IH3A 2FSEA 2OFQA 4Q2ZA 1GDDA 4J2XA 5CT8A 3NM5A 2FL5A 3WMRA 1MWOA 1AX9A 4J49A 1ZO8A 3JYOA 2JB6A 1QBKC 2O8CB 1W19A 2GITB 3IJHB 2YUWA 4HQOA 4DB2A 4AQAB 1NP7A 4US2R 5LQNA 4UUPA 2FX7L 2FWJA 5C8YF 3KK0A 4PQEA 3WXBA 3VRLE 3TL3A 1FAKT 4BLPA 3T0AA 1EK5A 3NTUA 5JQGA 2BEVA 1MJHA 4GPTA 2J57A 1TETH 4MUKA 4JJKA 1M3SA 4AO6A 4LNUA 1AXRA 4EKEA 3GP3A 4WUUE 2QGCA 1P4RA 1XJCA 4PYOA 3IJEB 2EG5A 5IBUG 1JKMA 4JENA 1RMTA 1UQSA 4ZNCD 3PFIA 3S81A 1YDPB 3TJPA 4ZMRA 4RK6A 5CP3A 2KZ1B 4MRBA 2H48A 2ZUFA 1FI8C 1CK0L 2GITA 4BVLA 3IJHA 3RBVA 4UMDA 4AQAA 1PKQB 1M6VA 3OPUA 5CYFA 4RFLA 1QZ3A 1OT1A 4HJJH 4FUTA 4DANA 4XCEB 1BU5A 4R54A 4U6HB 3EGEA 1N0HA 1YEJL 1LS1A 1YZUA 1I7QB 1V6SA 3JTSB 3OCZA 2IPTH 5CIWA 2PX5A 4WO4B 5CXQA 2VTDA 1QHYA 3EGCA 3O6LL 3RVUD 3M1LA 5IESH 1ZD8A 4D74A 5HYJD 1YR9A 2O5YL 4PG9A 5EPMA 3QI2A 2OHHA 3DV4B 5B1KA 3H55A 4OCLC 4UXHA 5BMFH 3HDQA 3CVVA 3V9CA 3DB1A 1YDPA 3VSUA 1DBQA 4QGAA 1CG6A 2W9DL 1KZYC 3L9BA 2VT6A 3FHTA 4GRDA 4FGLA 2R8SH 2B9EA 5T1MB 3S2SA 1PKQA 1VSCA 3T4XA 4PR0A 4TSCH 3C8KA 2A9DA 4DT1B 1QO3B 2P9EA 4WA8A 1FNHA 4XCEA 1KP2A 4BLQA 4PYHA 4U6HA 4FE4A 3CPJB 2H7XA 3OUTA 2R6JA 4MWEA 1K8ZB 1MQAA 3HG5A 5PCYA 3QVLA 4WO4A 4IKOA 3F58L 3PRHA 4M8LA 2J5QA 1RWKA 4X4MA 5LD2B 5I7FA 1JGIA 3NVMB 1HRKA 4NCKA 4R4NC 1NUTA 4EHBA 4N0PA 3NYQA 5LBGA 1SBQA 3QQDB 5IULC 4JYCA 5AKSA 1ILUA 1YNTB 4BYGA 5TQJA 3B37A 3DV4A 2CU9A 1R5IB 2WCGA 2GK6A 4YCAA 3HEIB 3NSJA 4ZS6C 2BZ0A 2DJUA 3PQYE 5HDLA 3BZ5A 4MVWA 4ZMAT 1Y4UA 3PC8C 3UJCA 3WFCL 2CJWA 4DT1A 2HTLD 4DCPA 2I29A 4E9QA 1PX3A 4G8AC 3NYWA 2B25A 4FQPA 3GYBA 3MUOA 1TJGH 3M6MD 3OESA 1U4EA 5IF9A 3RJMA 3GKZA 4AS2A 4UT9H 3LT4A 1IFGA 3G7SA 3QQDA 4NN6C 3P9NA 3RROA 1QF7A 1CEEA 5EUOB 4O4LA 3GRWH 2NX5B 1R5IA 2O2EA 1FZOB 2DWEB 3HEBA 4E41D 2G7ZA 2WU8A 2FPPB 3BZ4B 1IHPA 5AUNB 2DY2A 4ZOBA 5AVZB 2I7CA 4E2XA 4J91A 3SKUD 2GLUA 5EXPA 1Z68A 2EQBA 1HCYA 1B14A 3HNVL 5EMHA 2EKBA 3A2NA 4CQMD 2H4FA 3KSZO 4HSEA 4S1VA 5FULA 2AE2A 3E3MA 2CW5A 4RH0A 1XO8A 3AT9A 4ZU1X 1FORH 2AFHB 5A7FA 3NBMA 3FSZA 3QUQA 4FQXC 3D5EA 3EMDA 1JDAA 3N43B 4I55F 5ECWA 1LO3L 5E4TA 2IU6A 4PC6A 2MKWA 4P23D 3WQHA 2C7FA 3CE9A 1R00A 1XXHE 3KQMA 2BH0A 1T24A 3TGWA 4DV0B 3QSKB 3UZVA 1BXRB 2NVBA 2ZRPA 1X5AA 4MVJM 4NQRA 3CNLA 1FZOA 2DWEA 3T3IA 2GTQA 1H4SA 1URIA 2FPPA 3I76A 5HYEA 4HDCA 4TUOB 3QWFA 4YHIA 4B3GA 3D69A 3SPXA 1QZTA 2CL7X 3S6JA 1RUKL 1XTUA 3T5CA 2CCGA 4E5SA 3FMOB 1HOTA 2VQ3A 1MX5A 4BO1A 3ILPA 3DZHA 4X61A 1OTSD 3EO9L 1XL6A 4TYWA 1QCZA 4NRZB 3BEOA 3RVJA 1OD6A 2XWBB 2W6QA 3ARFC 4TL9A 3B12A 3X3GL 1T7YA 5FJIA 4RRPG 1E3FA 1KTKE 2B21A 3COPA 4B79A 2XBUA 1A47A 5AKIA 1RU9H 2H26B 1NSNL 1EFXD 3SDCD 4MAUL 5JCJD 2EDOA 1UJCA 1CULC 4UUMA 1NCBH 1DXQA 4PJAB 3M6UA 2EATA 3KUCA 1QI5A 1MF2L 1S7QA 1X9LA 4A1RA 4OXYA 4DMHA 1Y6JA 3GMMB 5EN2A 5K9ZA 2EJUA 4D81A 1MT3A 1ISHA 2UY7B 5DFAA 5JO9A 4O51B 4WFFE 3FIUA 1VPTA 3GLRA 3GIZL 2ZIGA 3F6PA 4QTZA 2PUHA 2XWBA 4L37B 1YHYA 4FDVA 4JVLA 1JIIA 3FDIA 3TCXB 4G59C 3V4VH 4L16A 3KUDA 1N2JA 1R3KB 2QQKH 4LX8A 2HHLA 2AERT 3BDAA 3TPZA 2F61A 5JPMC 3ZY5A 2WY3B 3FF7A 4JFOB 1G8HA 1OP3H 1D4FA 3GVPA 2WIGA 3W0WE 5DR5L 4NBYB 2ODBA 3FT4A 1FYDA 1JDSA 1P5ZB 5DNVA 1E8XA 1K9TA 3K0CA 2HC9A 2XYQA 3U3RA 3D4GA 4HH4A 3TEFA 3GMMA 2HIMA 2P46B 2UY7A 1G59A 2CA3A 4JOSA 3GFTA 1BFDA 1JSLA 4K9SA 4KXYA 1N9KA 3W82A 2CBQA 2J1XA 3QW2A 2JEOA 1U0JA 3VI3E 4L37A 2BVNA 5KSOA 3L82B 5F9AC 4ETQB 4GNKA 3TCXA 5DI8B 5JSYA 2ISQA 3TJEH 3LW8A 3T6ZA 4MH0R 5MN4A 1V55B 2BSCA 3ZVVA 1TTPB 5F1KA 3R3UA 2Q3BA 4UDTA 1UYWL 3MXTA 2WSIA 5K2OA 5FTLA 1XF3A 1VCBC 4PM4A 1S6YA 5BPFA 1TM4E 4QOKB 5BN5A 4YLGA 3R4RA 1OFGA 4KWUA 5FLVA 4I85A 2Y93A 2JLBA 4BA0A 2ZX9A 4GI9A 2N0KA 1XMOB 5HIMA 4ZYXA 4TROA 2A67A 3Q5EA 1TLKA 3QJSB 3KB6A 5DTQA 4WAFA 3KYMB 4Q4EA 2VSXA 3V8CA 3O95A 4W1QA 2C3OA 3K0FA 1DKUA 4MS4B 4UM8B 4UOW1 3GF4A 1HNNA 4ETQA 1U8LB 5FM5M 3LDBC 2AXGA 4ANVA 2GAAA 1Y9ZA 5DTRA 3HCEA 1MH5A 4N2HA 4YECA 1YQ9A 3Q43A 1B15A 4TMWA 5L8VA 2A1TS 1OZGA 2B6HA 2ENWA 3ULUD 2XIQA 3KCQA 2G76A 3SPHA 2RHMA 1YB2A 1H5NA 1JHAA 1A8UA 5A02A 3TPUA 1TEHA 2Q86B 5B7PA 1KJMA 5BV7B 4IHJB 4PYIA 1BDYA 2JANA 5JMRA 5ED4A 1TG8A 1T8TA 1X8XA 1WAAE 2C77A 3DULA 4BLVA 5BSRA 3KYMA 2RDMA 3OZDA 3GK8L 1TKWB 4JR0A 1IAKB 1O6VA 3BKXA 2FMUA 4RULA 3TZVD 4UM8A 3B5EA 5DQJB 4CM9D 1IQUA 1M8PA 1U8LA 3Q0IA 2FHPA 1E7UA 2IDKA 4O5LL 2AJVH 2AJ8A 1BE0A 3L6UA 2MH4A 3S8FB 3KYKH 4V0MA 1X7YA 2CR6A 1DRUA 2AJYH 4Q9RH 3P9XA 3PGCA 2CFSA 1OV4A 1E4JA 2AV7B 3WSWA 4UARA 4PJ7F 4GC9A 4BK4A 1FVHA 4IL5A 3DKIA 1DWUA 5BV7A 3N0PB 4RX4D 3TA3C 5TXGA 5BMVB 3B1KA 2MJLA 2Z7YA 2XN9B 2JI3A 5DD1H 4E42A 4U2YA 3U39A 4U2GA 1XKXA 1EJ0A 1V9CA 5EJMA 4WK4B 1M4KA 4JUDX 1PYGA 4ABYA 1NGZB 3VPHA 1IBCA 1SNYA 2W6ZA 3S9DB 1K6QL 1KQNA 2APSA 2VAJA 3AACA 4HX2A 1JDJA 2B98A 3FMPB 4NQCD 4WW2B 1N12A 1UZGA 5IBRA 2VW4A 1FG2B 2AEJA 2J5RA 3A3OA 5ERWA 1GZVA 4AEIL 4KQ0A 3BN3A 4G6JL 3KELA 1R0AL 1EE1A 4HZ1A 2JF0A 5D72L 5DK0B 2PCJA 1JWUA 1N2XA 2O3TA 4J7RA 2NDGA 4DM3A 2EYTB 3DE0X 3ZDRA 2QQQA 3K2QA 4QQFA 4BINA 4XGNA 4REQB 3BEWB 1RJCA 4JNKA 4HJXA 5T1KA 1AM4D 2D13A 1TU4A 2PMFA 2NY4C 3BKYH 3BVPA 2ZUVA 5C1OA 1DFXA 3BVXA 3PSAA 4KQHA 4TMKA 1EM8A 4PZAA 3OB8A 4HX9A 4W1TA 2UYHA 1FG2A 1A6TB 4UAOB 3OZVA 1QEWB 1I3CA 2NYYD 2FO1A 1TFHA 5D7IE 2CJXA 4G97A 1EUQA 1TC1A 4DKAA 5FBRB 2WLYA 1YQVH 1E2NA 1Y42X 3PDHA 1TI7A 3UWPA 5DK0A 1XR8B 1HQYE 1Z4JA 3RAJA 4UQEA 1UD2A 4KXVA 1X44A 1Q0XL 2VK2A 2H92A 1OF1A 3L3OC 2EOAA 1LNZA 3SYMA 4Y5YB 3ISRA 5JAIA 1YAIA 4REQA 1MQKH 3BEWA 4WXPA 3QQ4A 2UXCB 5KNCD 2HO4A 3M1CA 4OZHB 2IVZA 3HHMA 4X5RA 1YN7A 3EAFA 3R5TA 4KR9A 4ZW5A 2JIXD 2AXPA 3G59A 1PFGA 3JYLA 3I05A 1IC7H 3D6JA 3QXTA 1FYXA 4DPMA 1Y5LA 3AZUA 2O8EB 2J6HA 3HMWL 1LJLA 3UB4A 1QEWA 2WHQA 1JZIA 1JR4A 4WWHA 4D2IA 2UVEA 3KKLA 4I0PC 2I9TA 2IG2L 1SVIA 4OHFA 1J1PL 3Q6FB 4ND6A 4OQTA 3Q3JB 4F1KA 6GPBA 3A23A 4I3FA 4WFEE 1W2HA 4A7GA 4NO5A 4QJIA 2JLSA 4NCC2 3WTVA 3ENEA 4OZHA 3GLEA 2FPLA 1VQ1A 4ZVOA 4F5WA 2GTWB 4M7OA 3TC9A 4J90A 4M8IA 1UANA 1YDGA 2IHKA 2X6TA 1W9MA 2X9VA 3P0VL 2ZOUA 2XUFA 2XGJA 3CVOA 4QRPA 1AH2A 3K6FA 1SCBA 2R0QC 1IE5A 4LESA 5DRTA 4L8GA 4XGKA 1CF2O 1XKLA 2C7GA 1A6WL 4OF5A 1FRGL 3S3TA 2A84A 3LVBA 3VYSB 3CVHA 4YRDA 2WG2A 4FXLA 3H1AA 3NIDE 1CUEA 4DEWA 1W5BA 3F2IA 3UK1A 5CLZA 3EDJA 3JX9A 4PSDA 4XN9A 2I03A 4NDAA 1I1AC 3BCDA 4DXHA 4WEBH 2WR8A 3WGJA 3MMNA 1KTRL 1WFTA 1HC7A 1W73A 4G5ZH 3ZLQC 2GUWA 2C95A 1ZSVA 3I09A 5I1KL 4UFPA 2V5AA 2DYPB 4IJ5A 1TECE 4FFVC 2I3AA 2MNJB 3H8SA 3KJGA 5LYJB 4KQWA 4B8ZA 2P2YA 2ZCVA 4G5RA 4JMXA 2OFXA 1DC3A 4XXCA 4LFHD 1S7UA 1QH8B 3GJSA 3WLAA 1JPTH 3MJ9L 1QW9A 5B3LA 1H3EA 3CU5A 2VQ4A 4D8WA 4LCCC 3UEZA 1TU3A 4FNRA 1MC8A 3PXLA 1VIDA 2ZZUT 1NGWB 1VC2A 3QEJA 1SGWA 4S1NA 1R0CA 5A04A 1B26A 5DGXA 5HOQA 3J81k 2ZPKH 3UFIA 2YUTA 4YBRA 4I50A 5A40E 3UZQA 4XEUA 3H4HA 1E4XI 1COZA 1PR9A 2DYPA 2FSUA 2CJ3A 2QRQA 4FMCF 1WUNT 4HUTA 1WQVT 2FFQA 3FMGL 3BZFB 3B7WA 4EVIA 3H6KA 4AQ1B 4HEQA 3DOOA 4WOJA 3WL3A 1ZT1B 3I0MA 1QH8A 1K5NA 3TMKA 5HHQB 1SVNA 2V3WA 5EA0L 2I6QA 3MMPA 4H6PA 4HKXA 5FCDA 3MV8D 4D96A 5B38G 2QJRA 3BFXA 4XTRC 1NGWA 2Q76B 1G87A 2WXRA 2AS5M 3A1SA 3DTVB 3CPEA 4B3SB 3VVLA 4JLDA 3H1ZA 3N76A 13PKA 4NN5B 3C5ZC 1DOZA 1JR6A 1V7PC 2C9UA 1ZUNB 4NQDD 3NHLA 4MLDA 1I8UA 4B4KA 2IZ1A 1N5KA 2NPOA 2DD8H 4F1ZA 1V25A 5CZVL 1P29A 3N3AC 4PBDA 2WKSA 1K5GA 3KSDO 3ARFD 1G16A 4AQ1A 1Q77A 2V8OA 3OVUB 1UP6A 2JJTC 3QBTB 4NUGL 5EFZA 5KJRL 2PM8A 3ZTCC 1NDGB 1EFHA 3AGPA 2W0KA 2Q76A 4V03A 5C0AE 4Z86A 1WDAA 2A14A 1G5AA 4BAZA 4MVJD 2FATL 2M98A 3WGLA 1QVAA 3VVBA 3M6AA 1ZUNA 4EOGA 5FNZA 1QM5A 4XJVA 3QXUA 2YWXA 1L9QA 5A3RA 3OPYI 4H7HA 4MD0B 3WNPA 1SC6A 2HYMA 1J8MF 1NPTO 5LQUA 2BFDB 2FEEI 2COKA 4F2HA 1LQ2A 1G6KA 4WTOA 1SOAA 3ZWBA 2AGJL 4RDXA 5DDHB 4YPJA 1AJEA 3AWIA 1ZUHA 4DLTA 3DMMC 4JCOA 4Z3IA 3LLVA 4BNWA 2X1PA 4LOJA 4EG0A 4DP8X 4UAUA 3SKOB 1NASA 5D7KE 4MZXA 3ZQ6A 2GVZC 1BTOA 1E7WA 2C2BA 2P5TB 3BGWA 5JS8A 4MCJA 5SY4A 1J86A 1J18A 4J6FA 4MD0A 4KUZL 4JY4B 4AWBA 3NT2A 2BFDA 1R5OA 2LGJA 3MO1A 1AZCA 3BF8A 3KBBA 4E5UA 1G42A 5DT2A 2QVLA 3L8EA 1K4DA 2I8CA 3RYFB 4D7AA 3ZE1B 1T6BY 1EGHA 5JJBA 4K55A 5EC1A 5E9DD 2QAGC 2OZ4A 4BX8A 2W2XA 4LTDA 4DA7A 4LRXA 1S9HA 3FRHA 1BYNA 3SKOA 4OFZA 5IYZB 3UAGA 1EX0A 1U8FO 5AB2A 5CGTA 3CW9A 2GJKA 3BGOS 4XA8A 4D9KA 4PRHD 9ATCA 3CFQA 2XNJA 1F0PA 4O00A 2O2SA 4NX2A 5JHDE 2BTOA 3CHYA 2B16A 4JLAA 4BWGA 2ESVB 4OFQA 4D4IA 3U7HB 5C0CD 1P6UA 2BHSA 3V4LA 3VGAC 1EDOA 2Y0PA 1HDXA 3FGOA 4KX7A 4PJ7E 3RYFA 4B3XA 3JTMA 4FI3C 4N9QA 3MBWB 3DE1X 4QUAA 1UH3A 4W6YB 3WLIA 3K9WA 2RAVA 1HCZA 3NB0A 4FHBD 1YVUA 2YHAA 5IYZA 3KQPA 3EVEA 2WWYA 1QR2A 3MOQA 1BIFA 2ACKA 3TTXA 3L3JB 1IGCH 3W2EA 4FJ1A 5L7XH 4BXVA 3L7BA 3WO3B 1J2EA 1SMKA 2IZZA 5DGDA 4KK6C 3DX2A 3O0LA 1JCKA 3P2EA 2ICEB 2ESVA 3VR3A 3S1LA 2QKIA 2IJGX 3QFCA 1PLLA 2ADMA 5JPNA 5KAPA 1XH1A 4FFBB 2KX7A 1FNEB 1KEVA 2QZPA 2R1UA 1V7ZA 5IC5A 5B21A 5EOVA 1OYOA 1ND0B 4ZTBA 5LVAA 2HCTA 5IQLA 4C4ZA 3IT1A 3MBWA 1KYFA 3IUJA 2V9ZA 4KOEC 2DKOA 4R98A 4WCFB 3NFNA 1Z2OX 5C35A 5JZBA 2QEQA 1QQDB 4WUKL 4EI2A 5KYWB 1IPFA 3BSWA 2ENJA 3EYWA 3BMNB 4YHYC 4LRUA 4F6LA 4KXBA 1HEZA 2Y07L 4ZS7H 3H0CA 3IDSA 421PA 1MEEA 4J1UB 3TA3D 2CBMA 3V5KB 5CH8A 3P0EA 2WMNB 5FA6A 3MF4A 2DECA 1R0SA 2EEAA 2E7LC 1A4UA 1HFUA 5D8JH 4WW1B 5CUQA 2DYSB 4FFBA 1BDHA 1V4NA 2FUEA 3ATBA 4C22A 4B7LA 1THTA 1ND0A 5IHUH 4Q34A 2A74B 4Z9FA 3EWAA 1DAMA 2Q3HA 4WEEA 3QX3A 4B3EA 4WCFA 1HKUA 1NFDB 1QQDA 4U6SA 2EXSA 5KYWA 2ZR8A 4KH1A 3DHVA 2LR4A 5IR1B 1BQLL 3VPXA 1KAQA 3RC3A 2V65A 1R8QA 2CKNA 1TO4A 1WZUA 5LMZA 1EZ1A 3TF5A 1WISA 5CYGA 3ZHKA 3JZIA 2O54A 4O9HH 1MCQA 1HNXB 3VU8A 4AF8A 4RAHA 4IIEA 1QX1A 4ZOLF 5LQJA 1ESMA 4FKMA 1XRQA 5LBSL 4KO1S 1HT6A 5IDQA 1M7HA 2A74A 1X1AA 3E8MA 5F7FA 1UBFA 1PT7A 4GLJA 2CB9A 3PJEA 1T4KB 3HZRA 1KK3A 3SICE 2P9BA 2R5FA 2AJ3B 1ZTXL 3S70A 3MV7D 5JNUA 1DCKA 1N75A 2CL5A 1LO5A 3FRUB 1ZD9A 3QRGL 1JV2A 5F88B 5AI5A 5F9JB 4J3UA 3SE9H 5A3QA 3E05A 3R6TA 4JYBA 2VHCA 1Z36A 1L7IH 4YUEH 4H2CA 2YOGA 5LZ9A 4WY2A 2DEXX 5ENDA 4RGBA 3CZAA 1FZMB 3AONB 4H8PA 5L2JB 3ESUF 5I0DA 5I8OL 3GW8A 2O57A 3O8QA 3W38A 2KKQA 1OVZA 4M9OA 1YZYA 3W5UA 1J8KA 3N1MC 2R23B 1ZN7A 4G6FB 5C2UB 2X9YA 3BRGC 4GM0A 4PLZA 1LSJA 4DR3B 1T4KA 3HL4A 2FPGB 2A30A 2AJ3A 3O8XD 4B17A 3PYXA 3MLEA 3RWMB 4Q8BA 1J0EA 3A6GA 1SC9A 3MQFA 1WA0X 1ESZA 2IV9A 3GIWA 5ALFA 3P9LB 3QMMA 4I0PD 4TM9A 1CW2B 4X7FC 1Y7IA 7MHTA 5F9JA 2BRUC 1W16A 2PZBA 1OP9A 5ESQB 1QG2A 3L6EA 2Q7NA 1TJHL 4JJFA 4DYDA 1FZMA 2HUEA 3FJTA 4X9GA 1A3LH 1G98A 3FQXA 3WIIH 1DEXA 1IGFH 3QP3A 1PSZA 4EQ3A 4MWDA 3BF7A 4MW9A 4PB9H 2R23A 3INOA 2RARA 4DA6A 5FWDA 4AL4A 4D98A 1O95A 2WZPA 1JI3A 3CX2A 1PGQA 1AGDA 4O4IF 1EXUA 4X5XB 3HUDA 3QRBA 3IVCA 2DR2A 2VNCA 2YUXA 1I8TA 1JEJA 3MRGA 2GBAA 3SIWA 4ZMNA 2CMRH 2ZT7A 5DTMA 3V9EA 1QFUH 3FCBA 4FJYA 1AQKH 3IQHX 3D6HA 3KPQB 2FY8A 3I2CH 4F37F 5ESQA 5KVGH 1UM8A 2O2IA 1GN8A 3FTSA 2XWEA 3CG8A 1MOZA 3AFLA 3L6OO 5KJCA 4BV9A 2PPCA 5JAMA 4J43A 3LTVA 1XMWA 3LQAL 1WKBA 1L5MA 3L8HA 2HG5B 3I5MA 2HZBA 5EJIA 4MCYB 4XNXL 3UTQB 4JI0B 2C4WA 4R7TA 4TKVA 4WXMA 2CLVB 2W8ZA 1I7TA 4V0QA 4GKJB 3G17A 2H1WA 3L1IA 5C0ND 4YFYA 1VPDA 1J7KA 4OV5B 1KDVA 5IVKA 2E87A 3A9WA 2Z2KA 4XP4H 4RTPA 32C2A 4Q9IA 1N0XH 3V1LA 1CS0B 3M49A 3IKCB 3UTDA 2NT1A 1MZZA 4R90L 4J0DA 4DQDA 2EIBA 4GO9A 3GFGA 3QI9B 2E1PA 3CLEH 4G1FA 1BROA 4QRDA 1IAII 1RQGA 3MLYH 1XAHA 1V1RB 2VDNL 2B5WA 2GCEA 2WUBH 3VD9A 3QWRD 3BX1A 2HG5A 5A2IH 2YYSA 4XO9A 1RZKH 3GMPB 4MCYA 4DY4A 1US8B 2CLVA 5CB4B 5SICE 5F6IB 2BVQB 1YA4A 3MTBA 2Y1OA 5CR9A 1DJSA 2JFBA 2PGIA 3EIUA 3GLKA 3ULKA 4AF7A 3KQSA 1U8KA 3FO2A 4PS1A 3RZWA 1X5GA 2J0SA 4JSYA 3WBDA 4FXGC 2JCCE 3IKCA 1Q1NA 3D3EA 2DGDA 4IK7A 1YS7A 2GZRA 2P49B 3T3DA 3DEAA 3QI9A 4JZOA 1P4IH 2QYOA 3T9WA 1QRNE 5CLHA 5FYJH 1S9YB 3I01M 4BO6A 4R97C 1MCDA 2NO4A 3C7CB 3CEHA 5JDCA 4IVPA 1RR6A 3WNKA 1US8A 5AK3A 3SCMB 4QFDA 2BVQA 3JPWA 1T1EA 1W0JA 4YP1A 1KMGA 3NFPB 3ABMB 3MCLH 2QE6A 3UICA 1Z18A 4ZVKA 3UZEA 5FFNA 1FFNB 4RESB 5TQ0A 1IG0A 4AI7A 4NIKB 3AEZA 2OP0A 4P2OC 3QYCA 5B3NA 4OLWL 5D2NE 5E4OA 3AVWA 3LBFA 1YYCA 2LABA 1S9YA 4HIIB 5HVWA 2FTAA 5EGSA 1U8YA 4GRWE 5DD3L 4TL5A 5AXBA 3DIFB 3QXVA 2E59A 4EWLA 3SEPA 3BPNC 2QGDA 3Q6GH 3ROQA 2G5RA 1C9YA 4N0YH 4FTDA 5HCUA 3OLZA 1L9XA 4JLMA 3GC3A 5DYNA 2XKNB 3FSVA 3NFPA 3SZ6A 3LY8A 4DKFL 4H35A 4PTLA 2NXYC 3NZ8B 4Y2PA 3MJ4A 1WW3A 4HUQB 2DPGA 4RESA 3QR0A 4GQ9L 5F7DB 4S1QL 5KBLA 1RYEA 2Z8WC 2EADA 1PT9A 5EZOH 1C8KA 3CUWA 1BJMA 5SWZE 3ZH9B 3RDTC 4ZXBC 5ACZB 4E30A 1AKRA 2P4AB 4YDLC 2XMGA 3OQJA 2VITA 4HIIA 4CCYB 3CPSA 1WLHA 2J33A 5ABPA 5KWEA 5BOSB 3MZ0A 2XBTA 4XIFA 5CX1A 3IHLA 5F2FA 1ABFA 3SE8L 1FUKA 1AURA 3X11B 1BCIA 3FCSB 3C3WA 3F7MA 2H2GA 4PJ8A 1D7FA 4JRYA 4BFOA 2D8AA 2K8MA 5HXAA 4A1FA 3NZ8A 1NVUQ 4LEBA 1DQNA 1Z34A 3CRNA 5TJWK 3R0XA 4HUQA 1ORVA 5IKXA 1WT5C 1XCQB 5CAYB 1XZNA 3HS0B 2C5GA 1UJTA 4ZFOB 3LIPA 3Q8FA 3ZEIA 4ZW3A 2D0IA 5ACZA 1SULA 3D4LA 3AP1A 3SIXA 2APJA 1UJ6A 2KS6A 2COUA 1MR3F 2PAFA 2AC7A 5GOTA 2B15A 3TLGB 3ZIMA 3SXUB 4I19A 1WMDA 3CC1A 3U9LA 2HLFD 1IUZA 4H2DA 1YZ3A 5JYBA 3OR7B 2AJTA 1V54B 1CD1B 1P9WA 2H9AA 3SJ7A 3SO5A 5J2TF 1G7LB 1UA6L 1E3MA 1N70A 4JAMB 3H42B 3V9AA 3CUKA 4XOBA 2YXWA 1WMBA 5IAKA 1NLMA 2EGGA 2IH8A 3VR2D 4RF5A 4OLZH 2I4TA 5BR7A 4DQVA 4A68A 3HS0A 1YQDA 4ZFOA 4BKLA 2WYOA 3NIFB 3U7GA 2CUIA 3ZWQA 3NV9A 4OHRA 3KDPB 3LH2H 3SXUA 2WTNA 1HNYA 4JFHE 1MUJB 2CO7B 1J0BA 2G2PA 2HUPA 1XD8A 3OR7A 4KQKA 3N3EA 1MI5D 3R7BA 1CD1A 3G5XB 1G7LA 2LLNA 1WPXA 1ISMA 3COYA 4N9GA 4XN5A 4PRBB 3DDCA 1W581 4JAMA 3QDHA 1GXEA 2F9BT 3TD9A 3NSDA 2NVUB 5SWSD 1MFUA 2HDHA 3U1QA 4KMQA 4JO3H 3UH0A 4IY1A 5I9NA 4N5UA 2G88A 2GT1A 3GB7B 5D7HA 1AY1L 1NWCA 1B4JL 4DCUA 2E4ZA 4L3AA 3MVEA 3NCHA 5LJYH 1E5AA 4X7CC 2VDOL 3W39A 1U5BB 2O9JA 4PLTA 1J0XO 1N2OA 2AJCA 3OEHA 2R0LL 2YHSA 5HJ7A 2W2LD 3VM7A 3BCHA 4IV8A 1SQ0A 3MXVH 2Y1DA 4H7KA 5DLDA 5JLJA 2BH2A 1MUJA 1SCJA 2WZ0A 3FTVA 1OI3A 4UT6A 1IOVA 1I7ZB 3MA7B 5TE6L 1JJAA 5KVVA 3G5XA 3X3FL 2ED6A 3HG1A 4PRBA 4M7JL 2QMKA 1ZISA 1B0UA 2NVUA 4CMIA 4NUQA 2EWVA 3EGIA 4N6QA 1QFJA 2K87A 1GAXA 3T08A 4YDVB 4MPDA 3GB7A 3CH7A 4EL5A 1CLCA 3FXIC 1E50A 2E18A 4HPYH 1E2GA 4QXGL 4K6KA 2WSLA 4OCSL 3WTSA 4J16A 2VLKB 1U5BA 1KCRH 1VPLA 3RY5A 4KTEL 2H4ZA 4RO0A 3DVNB 3ILVA 2OD7A 2I9KA 2B83A 3KYOB 4RKRA 3GHHA 1THAA 4GOXA 1FWXA 4YSEA 3MA7A 3SPVB 1X5IA 3MINB 2RH0A 3ABRB 1L3IA 4EHIA 3WXMA 4MWFB 4BFGA 3ACCA 1GW0A 5ALKA 3UWOA 5I75C 4RZIA 3FT2A 2G1AA 3K9LA 3KJ6H 1SCUB 2IF7A 4BZ2H 2ORBH 2JFFA 2WTEA 3PFHA 4YDVA 1JRLA 4O2BF 4JLRB 3ELAT 4DHEA 4WOCA 1IY9A 3OQVA 1CXEA 1D04A 2FBOJ 3H16A 4RU1A 2BI8A 4XIJA 1P1RA 1L5YA 4Z7UE 2VLKA 4G86A 2VYND 5B1JC 4QL3A 1C7EA 1NULA 3M6XA 2IGBA 4F3YA 4HNAA 1JECA 5DNDA 3ZDFA 1KFAH 2A77L 4ERNA 4FQ8A 4OVVA 3LY9A 4TVPL 3BD5A 2UUDH 3IDOA 3MINA 3HZOA 3OT4A 1XG5A 4MWFA 2WM9B 2FKNA 3EOTL 3FTYA 1A82A 5F9WB 2G83A 1XAJA 1SCUA 3O84A 1RD6A 4I1SA 3OZ7A 1KLFB 5HHXH 5FL7D 4Q3OA 2ZXEB 2WSBA 4JREB 1E1QA 3TF4A 1KYWA 1L9PA 2XOKA 1UGNA 1FRZA 4IBWA 3ZHNA 2R79A 4GI3A 3QA3E 2FPOA 3CXUA 4QKTA 3NDPA 3OO1A 4JYPA 2X4LA 4HZIA 4IHBA 5CSBA 1JA1A 4Y30A 5KKCA 4U7WA 1V11A 1OAUH 2JHPA 1QS0B 3X2EA 2QB5A 2ZYWX 4CSSA 4PWYA 5HUQA 5J1TC 2OBMA 4KTDH 3IP5A 4W9RA 3BXXA 2I9LB 1ENYA 4HEPA 4Y5VC 3UCRA 1KLFA 4LVHB 3MILA 2PX4A 3B34A 2AE1A 3G85A 5HCIA 2I5YH 2CK3D 2REXB 1JALA 2VCYA 2X42A 4BJHB 5CJJA 3D6UA 3FB8B 2VRNA 2NZ1A 1EV2E 3H9JA 3RBZA 4TTIA 2VDVE 1G7QB 2NADA 1NBMD 3MJEA 3K2UL 3KPVA 1ZC4A 4JSTA 1QS0A 4ZMBA 5H3LA 4HJEA 3F7TA 4HUUB 4XBMA 5DP1A 3ICWA 5D1ZI 4DZZA 3B7SA 1G5TA 4DUPA 4JRFA 4B85A 2I9LA 4G8IB 3CNOA 2WD0A 1A0QL 3CVBA 4M6MH 2ZBQA 1P39A 2CMKA 2YJLA 1PZGA 2WXGA 2MCPH 4QU8A 4W82A 2YAMA 2R51A 1KXVA 5JBIA 1AQIA 1LM8V 1E5XA 2RC5A 4FLFA 3GVHA 3IJSB 3Q8WA 2J41A 3FB8A 5I01A 2O1XA 2C2WA 3IT8D 1RCTE 2UZAA 1G7QA 2QWXA 1KCWA 1NC2D 2CDEB 2L7EA 4JN6B 5D5PA 1GZ3A 2QZJA 4LY0A 4G8EB 4OTZA 2C4KA 4I4TB 1L3WA 5EO1B 3PICA 2Q6VA 4M3KB 1G9ML 2PZLA 4YHBA 3LKRA 3TH4T 3IR5A 3L0BA 5JDJA 2RC6A 5EL0A 2AEMA 5LNK6 3IQDB 2F19L 1ZVNA 2EWWA 3C6LA 4V2CB 2QMUA 3DYVA 4Q9LA 3SSOA 3IJSA 1WUZA 3HA5A 5T3XH 1VL8A 4LDQA 4LBEB 2WG1A 3H1GA 1NCCL 3O11B 3PQFA 4UHFA 5EZQA 3AXLA 1QFWM 1VJ1A 3QDJE 1ETB1 3B2XA 4DTGL 2AI0L 4NQVA 3HC0A 4G8EA 4I4TA 3RK1A 3TFBA 1BEYH 1O9WA 2NY7H 4LNVA 2ARJB 2Q3AA 4YCDA 4PRIE 3AX6A 4ZT7A 1GPMA 2NTEA 5C8DA 3GN2A 4OYYA 2YZGA 3IR7A 1A7BA 3B6KA 5BZZA 1GGMA 4B97A 5C9KA 1H6AA 3VO9A 3E22B 2KQUA 1MKYA 5H8WA 3D6FA 3G04A 1V5GA 3VXQB 4U7HA 1KBGL 2VABA 3SS7X 3KR1A 1T8RA 2FLRT 4AT1A 5IMOB 4DJ5X 3STTA 3O11A 5FPPA 4YXKH 4YMLA 4U7TB 1MDAA 3KQTA 2BVUA 4DVJA 4PJ9C 1ACXA 5IFHH 3UGTA 1E79D 4U7KA 2WXMA 3HS8A 4E9SA 3IB4A 3LN5B 4MDJA 2JJYA 2OLEA 1QK5A 1Y1KE 3CSPA 3CZGA 4MAMA 1O0CA 3ULVE 4RS4A 1KSHA 4PVBA 4KX9A 3MJTA 1JNHA 1RXUA 1FQ9C 2F08A 3HZZA 3SF8B 2AMYA 3APDA 3E22A 5CKAA 3Q1KA 4JHWL 1KENH 1KYTA 4OP3A 3VXQA 4Q9JA 3H5IA 2P1YA 4TLMB 1VPOH 4MQ5A 1P6WA 5HF5A 4OD3L 3QBDA 5IMOA 3C74A 2YKLH 1QBAA 3MTQA 3NJKA 5ERGB 1HTYA 4JQXC 2Z91B 3VMMA 4EF5A 2PSJA 3BP6A 4U5XA 3C1OA 2P8MA 1WFUA 3OL2B 4WNJA 3KQNA 4RETB 1O6SB 2VYVD 3GZNA 3HBPA 2DOKA 1C8VB 1JTTA 3NC1C 4EKIA 1NPYA 2VPWA 4FHCA 1TRHA 1UKAA 3GJXC 2HMSA 3LX4A 4AJ4A 1XLVA 3AI7A 3EVZA 4JN1L 2A4KA 4U02A 4P22A 3ZDXE 1C8PA 4WI1A 2N7AA 1A5SB 4IS3A 4NFSA 2FFHA 3UGEA 3ELUA 5A2JH 3N5AA 1JJVA 1ZGLM 4BZZA 3P19A 3ZTJH 3I6LE 4RETA 3OTGA 3QSYA 2FSPA 4AYFB 2FDBP 1L5WA 3HY6A 4MR8B 4CKCA 3H1EA 4KR0A 3IR6A 2HKAA 1TNMA 1ZZEA 3WBKA 4BE7B 4LRIA 3E0QA 3DZJA 1VSUA 5C0IB 5JHLA 2BZGA 5JH7A 1X5KA 1FQWA 3SKJH 3KCWA 3VXMD 4NIMA 4Y2HA 2PG3A 2V98A 3G7NA 1A8PA 4BJ6A 1C41A 3HFJA 3PQDA 1CB0A 3MCUA 1N64L 4IH1A 1WZMA 3GUCA 1SNRA 4OHXA 3SFZA 5AHKA 3HCVB 4P4KB 1GJUA 2ZLBA 2QQEA 5ESXA 5KCMA 3HBLA 1M0SA 4IVQA 1G3RA 3U3ZA 4Y1AD 2XMZA 5IB4A 1RP7A 3JD1A 2C26A 5DXFA 2WD8A 4MR8A 3T3EA 4A66A 4TWAA 4LVNB 5DRYA 3CFDB 1OAAA 3DCIA 2OCDA 5EJ7A 2YJTD 2WK1A 5B1IA 3RWOA 1H9VA 4INJA 2CUNA 4D25A 3H0KA 3RQIA 1JSCA 1JMYA 2XOXA 2IXDA 3AEXA 1BM3L 4YHOH 4CKBA 4LYYA 4P4KA 2RGYA 2D3WA 3ZE2F 3QUAA 3EJYC 2CGEA 5D9SB 4K87A 4M1OA 3K9CA 1ZA2A 5AFSA 3OV6A 4DLZA 5IK2D 5EF3A 5TMDA 3D39E 1OBFO 2O1AA 1LO4H 2YPLE 3U7JA 1JZTA 3ANSA 2Y23A 2ZSFA 3KOXA 2RKBA 4Y9EA 2GBIA 2IPKA 4LVNA 3CFDA 4Y0AA 5CD1A 5KAQG 4DE5A 1G7MB 4ZOAA 1NFAA 1D07A 4B50A 3Q4GA 3RGVA 1ZLEA 4C3OB 5K9QG 1VIYA 1J2TA 1QA9B 5FDYA 3R1GL 2V6GA 4EUPB 1E58A 1A7QH 1EINA 5E6RB 2GC7C 4HHAB 3CTTA 5D9SA 2R4SH 4PC7A 2AFVA 5LBTA 3N0XA 5FGRA 3ZRSA 1WP9A 2VUOA 1RQXA 5DHVH 4QCIB 2WHEA 3OTTA 3OHPA 3LMJL 1J0CA 3ZT6A 1WKCA 5BW7C 1RWQA 2YPVA 4RVUA 1RRFA 1OOWA 1TMKA 1G7MA 5B55A 2EXXA 4HMEA 1CQJB 2XEXA 3T7JA 4DTCA 5GS1B 5GVSA 2G9KA 4BAUA 3D4ZA 3FDJA 4UEJA 1W72H 3AVXA 5DHVB 4IRXA 3EZ9A 1JYWA 1CUBA 2BZ7A 4FXPA 2PQ0A 4EUPA 4DNQA 4HZAA 4LASH 4G65A 2IXQB 5E6RA 3V8RA 1OI2A 4HHAA 4Y4HC 1P84K 2D2OA 1K6IA 3HYNA 2KI5A 1YE8A 1F5WA 3HBFA 4ZFGL 4EK9A 3D9QX 3AEUB 4GBXA 4D9BA 5HHMD 1YR2A 3DX8B 4A91A 1NMYA 2GJ6D 3BZUA 5KNBD 2Y7QB 4WTQA 1ZGLP 1TVHA 1X3SA 1QOPB 1UC9A 2QTAA 4KXZH 5G41A 3AS2A 3ETCA 4BEVA 1CQJA 4MLIA 5GS1A 4KWTA 1KT2B 1WLYA 3RWFB 3H4TA 2EEBA 3K0HA 4X41A 5DLEA 2D8MA 5F98A 1NMCB 4FFTA 2PN5A 4WKPA 3VYOA 2BCJQ 4CYMA 1Z08A 2GN0A 1T03H 2F68X 2IXQA 2HHHB 4MNTA 3TAHA 3O3BB 1Z4LA 5KYKA 2JRCA 2WZ6A 1A50B 3NP7A 3BH6A 4BK8A 2YA0A 1Z9LA 4FGUA 5BWMA 3DX8A 1ZE3H 2APBA 2WBLC 3C3EA 1SXJB 2Y7QA 2M2DA 1I7NA 5DEZA 2IYTA 1P6FA 2DERA 2IYVA 4HD8A 3AHFA 4IKJA 2OMNA 5AALA 5JC8A 5B7NA 4OCMC 2QZ9A 3ZWWA 1KT2A 4BLTA 3SC2A 1E5LA 2C2GA 4KTVE 3Q8CA 5GS3A 2XV3A 3KPNA 1AJ7H 3PWNB 4OJFL 1XRMA 2PSFA 2FQXA 1DAPA 1YJQA 3P45A 2XCTB 4EXKA 2CBZA 4OT1L 4N3UA 3TAUA 2IY7A 1AGNA 4GP5B 2DI8A 1PZFA 3NNDA 2JF1A 2H2DA 4FA6A 1XRJA 4PQFA 2IGFH 3FQWB 5HXMA 3VPCA 1OC4A 1SXJA 4CKWB 3IEXA 4Y1RB 3DWIA 5IS2A 3ESQA 4Y98A 3B6ZA 1NVTA 4YDKL 3RA7H 1E2IA 1CTQA 1NPNA 5JNLA 4DEPB 3PWNA 1NJ5A 4I66A 2FJPA 1WFMA 3KT0A 4HK4A 4HNHA 5DZVA 2CV0A 1QKZL 5E38A 1FLVA 4LRWA 3N1QC 3KR2A 1JN6A 3S5LA 2V74B 3EAQA 4HFUL 1OAOC 3MMSA 2PWBA 4WDRA 1IRIA 3G8BA 1YQXA 3GBDA 1PZBA 1Z0NA 4PW9A 4Z54A 3FQWA 4CEIB 4RDCA 1B43A 4EY8A 2GN9A 1HGXA 4Y1RA 3FOLB 4XWOC 2IHNA 1IC0A 4E2ZA 1JHKL 1FFXB 4HIEB 4LOAA 3ZK7A 1ODSA 1PJZA 3LKDA 2GF0A 4LF5B 1PZDA 3ZDZF 3ASUA 1NOFA 4NQSA 1MPTA 1I3RA 1PNQA 1A4BA 3SFVA 5DVZA 1MFPA 5DM1A 1TD1A 4EYKA 4C0KA 2ENQA 1DE4B 2X1LA 1RYZA 3H3XA 3X1GA 5JECA 3EF7A 2IAMD 2W9EH 4R2JA 4YH6A 4DJAA 3DAPA 2DZDA 3A47A 3BGSA 3WP0A 3QO1B 1EXHA 1VEOA 3UT5B 3UUEA 4EG5A 4TYMA 3LXUX 4UMEA 3VXSB 2GK7A 3FOLA 1KJNA 2R6ZA 5I7EA 4HJSA 5GS2H 2BINA 4JUTA 4M0PA 4OUDA 4ZRMA 1FFXA 5C2JB 3Q6IA 3VZPA 2FZCA 3E2IA 3ZH2A 4HIEA 3G23A 1NCWH 2J87A 2C8NA 1MQSA 4YSPA 1QIDA 2IUSA 2I87A 2PEZA 4KKZA 1NXTA 2JFHA 1EGJL 5E8RA 4N2EA 2Q6IA 5JZ7C 4TXNA 5AW6B 3MRLB 1DE4A 3VJ6B 4QGSA 1GY2A 1WFIA 4NBNA 1WDTA 1LEKB 5DHYB 4FX2A 4OJNA 5FKAB 3BUYB 4P7GA 4O4HB 3QO1A 3UT5A 3MLUH 4C5BA 3D81A 1YA6A 1BMWA 1V27A 4YSQA 3HE3A 3WN6A 4U0JA 4MV1A 5FA5A 4FBLA 3OJEA 4YE4L 4HC1A 1PUJA 1WD5A 2BJVA 5DBHX 3VOBA 4ODHH 3AHEA 4Z2YA 3N7TA 3PAUA 4RK1A 2ZT6A 1XGZA 4UDXX 1H2FA 5CFPA 1X1TA 3AY2A 4CC4C 2I24N 2XYRA 3MRLA 1XQWA 4LAJH 4DM7A 1QP1A 2HPHA 2PBRA 3FU6A 1NWPA 2COVD 1LEKA 1N5OX 5EDXA 5FKAA 5I1JH 1XSEA 4YS4A 5J57B 2JAHA 4TZTA 3TO5A 1GTL1 1SZDA 1H05A 4QRRA 4MPTA 1P8JA 4LC9A 5BO1H 3PPEA 1HIMH 1TZGH 3HNTH 3ARBA 1ANUA 4XPGH 1T29A 5HG0A 2WKLA 1ZTMA 3HRHA 5DK3A 3AF5A 4FQ1L 1RI4A 4OLAA 1YMQA 2OAGA 2FSEB 5B1SA 3B53X 1N1EA 2FT7A 4TLUA 5FO7A 3I52A 4MV3A 2FL5B 5AZEH 1CD5A 5FFFA 4TTSA 4HWNA 5AOVA 4EFDA 1XVAA 3BCRA 2Y92A 4DUWA 3O4GA 1BJ1J 4L08A 2V7HA 3JV0A 1IEXA 4AQDA 3FG9A 3ZI7A 2B4YA 2EAEA 1DXOA 3O90A 2Q3EA 3UMRA 3NP4A 1EJ2A 2C61A 1IBDA 4DPLA 3B1WA 4OQ4A 1AQHA 4P2QD 2J4CA 3OKPA 5DHAA 4JFEA 3ATAA 5CP3H 2ZOKB 2YASA 3KH3A 3TIXB 3FPCA 3M1OA 3GXBA 2ATKA 1K5WA 1AGYA 4FHKA 2J3DA 5A3JA 4U6VL 3GGCA 2XZQH 1UQSB 2GDJA 1M7DB 1NVXQ 2OSXA 2Z56A 1Z17A 1JJFA 1U5AA 4CMJA 3ZE2E 1UH2A 4QQNA 3K1KC 3LVQE 2I3BA 4X6UA 4MD5A 5FOWA 5JROA 4OXQA 5EWIL 3AJ7A 2FZ3A 2XN2A 4D8PA 5INDA 1PJCA 1LU9A 2JFPA 3BUBA 5CDTA 2K9UA 1M6VB 1L0QA 3VH3A 3CJQA 2WT4A 2BD0A 2B8OT 5CPBA 4P5KB 3KTDA 1UXJA 4UV7H 4Y6QA 4HV4A 2EZTA 3FFCD 4G5OA 2XWDA 2E5WA 4U31A 1AZZC 5CW1A 3PI7A 2GSIA 2IGTA 4E11A 4OB8A 1FFYA 1YI8A 1UZ8A 5HMMA 3W2IA 4G43A 3IV7A 2ZOKA 1MVLA 2FG7C 1NLBL 2Q3DA 3W7BA 4PG9B 1M8KA 5EPMB 5B3JF 3C3DA 2P1ZA 4ILDA 1HT0A 3H99A 5TF4A 3QTBA 1OIVA 1RXSA 1M7DA 2H59A 4EY3A 4I6JA 1HXHA 1G21A 4Z7VF 1LCIA 4IDNA 3WNMA 4TLCA 3E1SA 1KEEB 2WHXA 5KSWB 5CCKH 3NSFA 4LC1A 3A1TA 1K8DB 4WI5A 3C8KB 4FQLL 4P5KA 3M2TA 1C3VA 4DZ8A 3S35L 4LSPL 3L6DA 5LWHA 2APVA 3BDBA 3OZSA 4FLSA 2JHAA 3NJMA 3I9PA 2DQJH 1C8QA 2C3XA 3ODGA 1YT5A 2JI8A 1XTBA 2B92A 2PUWA 4WDIA 4EKXA 3G5UA 4KH0A 2VMJA 4H5SA 2YD8A 4MARA 3RS0A 3VGJA 1SLXA 2V8MA 4G80A 1XJ0A 4YPOA 4UMFA 3Q8EA 3NIGB 2FJGA 4ALLA 3GZQA 3OMIB 3OQPA 1JLMA 2A9JA 2DLGA 4G4SO 3V1MA 1KEEA 1USVA 2VRCD 4FCAA 2XRAL 3G5MA 4GG6B 1K8DA 1MNUL 1J8HA 2JAWA 2CJWB 4B6SA 2OK8A 1F6WA 5C1IA 1AC6A 1E9AA 3RFFA 2XTAA 5C1MB 2CNLA 4H88L 5EHXA 1KI3A 2D2IA 4QRBA 2JC3A 4XWGA 2BNRB 3AXTA 2YWZA 4NBKA 5C5DA 4IDAA 4L1SA 2PQ2A 4XM0A 1DDIA 4DP7X 3T0BA 1ARZA 2ZWKA 4E5YA 4O4LB 4Y2DC 4QUJA 4XPAH 4WKOA 3SOBL 3T2QA 4NPYB 2HA4A 1TF4A 1YEKH 3C9NA 1FRQA 5E9WA 2QG9A 3EW7A 3OIDA 4QBHA 4RVBA 1YEIH 3GI9L 4S1WA 4HWRA 1MLCB 4BZYA 1NPDA 3VR0A 3T1YB 1P4LB 1A1NA 3S28A 5EAIA 2UVQA 4GG6A 2NO0A 3W04A 1IKNA 4J0IA 4BWWA 1L8XA 4ZTUB 1L9SA 4NN7B 3QCTL 1K0UA 4DDWA 3UC5A 4X5WA 2ZUCA 3O83A 4CLEA 2NY5L 4FMDB 2VRBA 5GV7A 1GPYA 1EUYA 1K85A 4F38A 4AO7A 4R7LA 2BNRA 2CDGB 2DDQH 1LP9B 3DGDA 2Z1MA 4B6FA 1LDYA 3OA2A 2XWTB 4H31A 5D93C 1P9RA 2O6DA 3EIOA 4FPXA 3UZVB 3SY0A 2PR2A 2YC4C 2NY1B 3MRQB 4NPYA 1MO4A 4X6YA 3DVQX 4DG9A 4JC5A 4BN4A 5HHOA 4GKLA 3EE6A 4YHIB 2VPZA 3D69B 4JM2C 4J7XA 1JDZA 1VBKA 1MLCA 3T3PB 4HGRA 4EO5A 3UNXA 1P4LA 1U5CA 3I6IA 1MXDA 5TDOB 3OF3A 4ZMTA 5IAJA 2XHNA 4Y9UA 1OH5A 3VFGH 1JG4A 1ODIA 3ILPB 1S2GA 1VF5C 1M6HA 4HZUB 4L0YA 2R44A 4A23A 3K2KA 4F7WA 4Q0MA 1E28B 3M34A 2CDGA 2B1OA 4BMZA 1LP9A 5D55A 4RAVB 3EOZA 2WWMC 1QUPA 2XWTA 4DNPA 1U8CA 5MEQB 3DJRA 3MRQA 4X7DC 4LQ4A 1X4XA 2QZQA 4DDVA 2J5LB 4OJDH 4KY1L 4ACTA 3S0PA 4RKYA 5TDOA 1S7QB 5AKEA 5CWSA 2P6RA 4DLWA 5EN2B 4XUGB 5F23A 2VDRB 3VXPA 1ZXQA 5EB9A 1KRXA 1SUAA 2ZP1A 1CKEA 4RNCA 3RREA 1Y7PA 1E4OA 5TVGA 4HZUA 4HRVA 2ZAHA 4OQNA 1ZD6A 5T1LD 1E28A 1Z6QA 4ECNA 4ALAC 3UGJA 4RAVA 1W0KD 4ZICA 1GMIA 4IXTA 5EUOF 4R3UC 2J72A 3L4VA 3MZGB 5MEQA 3BERA 5E6YA 2QZ4A 1DYZA 3BRQA 4L1TA 3ROLA 2YYYA 3ZT5A 4NJEA 3ZJYA 3TN0C 3ZVNA 4DEXA 4ABUA 2VP5A 4IVNA 4WUTA 4EI8A 2YRXA 5DPMA 2O6HA 3FT4B 1KQGA 2HT2C 1U28C 4MYUA 1U2GA 4UVGA 1XEDA 3AWGA 3L0CA 2QP4A 4ACBA 4BTEA 4YASA 3WFHB 2HZ7A 3L6BA 1RUMH 3MCWA 1XCPA 2IIQA 2ZJ3A 3JZDA 1GYAA 4GXUM 3K6RA 1WBXA 1OA1A 2YZ2A 4FGWA 7ADHA 2XMRA 4Y2NA 1MHCA 1BWMA 3UOGA 2CXSA 4GNKB 4JK0D 4Q7DA 2B20A 5T64A 1H42A 5C5EA 2WJ4A 3PXXA 2X4OA 4JFDE 4XWOD 3RZCA 4UDTB 3WHXB 2FQ1A 5KYTA 4IDLA 1SQFA 2HT3C 1W88B 4YJDA 1XF3B 5JHGB 2WNKA 2W43A 4K7FA 3EHBB 3LCVB 5BN5B 2E3VA 2J9FB 3V4ZA 1V3LA 3H2PA 4MASA 4M49A 3EA5A 3LAWA 3RODA 4D6XA 1GV0A 2B0CA 3WFHA 4FINA 3MLWH 1G9HA 2XMSA 1CGUA 2WKOA 2OORA 4BAGA 5JQ6H 4ZTZB 2YV2A 3DDGA 3K0FB 1UFKA 3JYHA 4GW3A 3QEBZ 1Q1JH 1MOSA 1WXWA 2BKVA 5E8OA 2QORA 3MBOA 4DPAX 2AXGB 3F46A 1QTSA 4ES9A 1AQYA 1EHKB 1D1PA 3ULVL 1MH5B 2WTOA 3ANYB 4LF9B 3WHXA 2Z6AA 3SQXA 1W88A 4LKRA 1TM7E 2QADC 1N2HA 1YD7A 1DX6A 2JLXA 3T8YA 4PJAF 5DSTA 2HJ9A 3GVCA 3RSFA 2J9FA 1BHGA 3TPUB 2WVJA 1KJMB 1KWKA 3H8WA 4WNIA 1LEIA 2HV8A 3VYTB 1QQ6A 4J3FA 3SC6A 2Z2JA 2QV7A 2BFMA 2EC5A 1PG5A 2CLRB 3V6OE 4UNPA 4B81A 1GL6A 2CM6A 2WM8A 3K8ZA 1R3IL 3ZCSA 4WXYB 2IALB 1BX0A 3M1IA 2AJBA 4B7ZA 1O9BA 3PL6C 1CBJA 5BV7H 3F7PC 1J8DA 4EY6A 5CNMA 1YA5A 4UM9B 4OYHA 3LA8A 4V38A 3F4LA 1X7YB 2WP3O 4IGBD 2Y0DA 5DM2A 3PGCB 1RKQA 4LP4A 3ZVLA 4O2LA 1C7ZA 2IQIA 5C6WH 3JUZA 1T6XA 2XT1B 4FZ8H 3CMGA 2RTTA 3RJ9A 3NTVA 4MHOA 3UBXA 3MACH 2E37A 5B1EA 2UXGA 2FCRA 4BJ1A 3CBJB 5EZYA 1ZHHA 4H1HA 2JTYA 4E42B 2CLRA 3MJRA 3OMLA 4ASUD 2C3HA 1PEWA 4RSGA 4XX1G 2H00A 2YV4A 2XE7A 2XB6A 4TV9B 1OAQL 1MCWW 1TA0A 4R9UC 2YMLA 2IALA 3K8MA 5J40A 1FYHB 4NQZA 1UZ6E 3G9VA 4UM9A 5FTWA 3S34H 4LMRA 2NT3A 2V6IA 3RIFK 4CN8A 4NJ9H 5ERWB 1OLXB 3DLPX 5KO2A 1X2EA 4AYWA 3BN3B 1NSYA 3KYBA 2CUAA 3CN1A 1GLVA 2AEPH 4EJSC 3P9RA 4JC0A 1JWUB 3VNUA 2FMHA 1V37A 3KLHC 2EJBA 5HSGA 2XVAA 3FLEA 3DDUA 3H3FA 2O59A 4R4BB 2V9CA 4V3BA 3H5RA 2PZKA 1RAFA 3O21A 3WLFA 2X8WA 1TQBC 5T1KB 5F1OB 3PTLA 1BCSA 1XQVA 4TV9A 4DQXA 4KXNA 2BV3A 3Q9PA 4G89A 2P7IA 1RZJH 4AIZB 1TTBA 1QIJA 3ECBA 2WXIA 3TA4D 1EM8B 3SQWA 2IAND 1BQKA 4DW8A 5HJ2A 1UP7A 3S8MA 3C5HA 3WLTA 4E0BA 1F48A 4HLUC 2AMJA 3IELA 1KIAA 3F6JA 1OLXA 1DMSA 3T4UA 4PZDA 4Z7VE 1G8JA 3P1JA 3C60D 1FDTA 4IJWA 3AZOA 4A6YB 1EXMA 3WE1A 1SHUX 5LUBA 1E89A 3ES9A 3WO1A 4OVUA 4R4BA 4XH2A 3N5KA 2EICA 4UV4L 4MYDA 3MBKA 3QQ4B 3MROA 5F1OA 2XUQA 4MKFA 1PZXA 1ADYA 2Y2TA 1E6JH 1YN7B 2VAMA 3G6DL 1E7QA 2EDNA 2JKYA 4AIZA 4NYJR 3VHXA 1S3SA 2YWBA 1J1ZA 4OQTH 3DOFA 5C0JB 3CNHA 4MD4A 1L0XA 1MRDH 2AJUH 1BO6A 4JQIA 3B7GA 1Y1PA 2Q10A 1UUFA 1SCIA 4LZNA 3VA2C 1JNLL 2I9TB 1UXSB 1O8BA 1JWBB 2E6UX 4RGVA 1ND5A 1I7UB 5BMVF 2DICA 4A6YA 1SG9A 3IPBA 3SJVD 3JTBA 3C6KA 2A2ZA 3QG7L 1NCOA 1SC4A 4NO5B 3W57A 2NZ2A 2FX9H 2BO0A 1VKZA 1QIMA 3BWMA 3WOHA 3WJLA 1T0PA 2GK3A 3LL7A 4IZ6A 5C3IA 4M7LH 4EG4A 2BGWA 4DJFC 5C0JA 4WW0A 4FLRA 4OLVH 1ET5A 1J7VR 3NCCB 4QRPB 1U11A 1LK5A 1LTHR 1SBIA 1L9MA 5EHGA 1RK0B 4EBQH 5DD5H 4DFHA 2GN2A 5KQGA 5AKRA 1U0LA 1VHWA 1WS7A 5FO8A 1UXSA 2WIDA 4N3CA 5EE1A 3O6KH 2P27A 1YS9A 4MLCA 3CVHB 1I7UA 1SLUA 2I62A 1GOHA 4IFEA 4LEXH 5DZNA 1QTYT 4OM1H 2D3TA 4JJGA 5ICGA 5LP6B 1RVFL 3L1FA 3P9SA 2Q6KA 1DEEB 3U7YL 1J0JA 1W4LA 3H7LA 4V02A 1TA9A 3UABA 1BNCA 5E9AA 2H4EA 5EMNA 1TYZA 4YMWA 2C8LA 5HGHB 4A2LA 2XZTA 5T5FL 1N2BA 4BNHA 4A6PA 5K6AA 4N8CH 3HABA 5FAKA 4CL0A 3CE6A 1MQ8B 4AL8H 1RK0A 3EVDA 3W5SA 4P2AA 3QG6B 2XOTA 2FSDA 3QOXA 4R4ND 3ONFA 1S7UB 1ZG3A 2J48A 2D7QA 3P2KA 4Y2DD 1W93A 5K6TA 4UTCA 4KNYA 3MYRA 5FEMA 4ZS6D 4EDXA 5LP6A 1A66A 1M71A 4PCUA 4MJLA 3WD5H 4FKHA 1DEEA 3LPLA 5K7SA 4BNNA 3K53A 1Q72L 4U1LB 4MULA 5CLIA 5F2KA 4KACA 5D1XA 4I50B 4JZKA 3UZQB 1Q1PA 1WXGA 5HGHA 4RGOH 5G40A 1YZQA 3VVMA 1IHXA 4FJZA 5KAQF 1MQ8A 5H80A 2CKBL 3NBYC 2Q99A 4AT6A 4Q5IA 1CTMA 1BFTA 3QG6A 1QLHA 1CTNA 4LPVA 3KPYA 3U9UA 4YROA 4RD4A 1B1CA 3I9LA 4QXOA 1K5NB 1PZ5A 1KZQA 4RFVA 3VNQA 5AW1A 3FGZA 5AHOA 2NMVA 3L7LA 3FUUA 4PCSA 2I80A 4HKXB 1PNCA 2FZVA 1VFOA 4IMJB 2XSZA 4RH4A 5AKLA 3S2UA 1F02I 2PGNA 3KLPX 4UBDC 4U1LA 2Z9CA 1X4YA 2JGDA 2ZYIA 2Q8BL 3FNHA 2QW8A 1E6LA 2ZPTX 5E2BA 2HV9A 2VQDA 2PS9A 2QLLA 2WF5A 4AKTA 4LGCA 5K3DA 4JGIA 1GPBA 2DCUA 5F73A 4FQXD 5LKAA 5JJLA 4XC3H 1T7ZA 1G5QA 4JRXD 1RC0A 2DWCA 5JT1A 1IM9D 4X3PA 1UD5A 4IP0A 5KVFE 1QASA 4ODSH 1PK9A 5TE4L 3KPMA 3K5HA 5NLLA 4DJEC 4E9XA 4ZT2A 1VCIA 1JXJA 2F8VA 4FNUA 3ZL2A 2GILA 1OYVA 5F44A 3E5HA 5SYNA 3HWWA 3AW8A 2B7CA 2WWOA 4KMTL 3THXB 5LYJF 3RLSA 1O5TA 5J4HA 2HA6A 3RHWF 3ZDBA 2B4CC 3BSZL 3KGRA 1CN4A 3A25A 5A5GA 2DAPA 1AY0A 3KR3L 3L6FA 2RD2A 3DFUA 4CSZA 3IJRA 4PLGA 2Z4SA 2P3SA 3K4AA 4PLWA 3DFZA 4M5YH 2Y1YA 1J0ZA 2DIAA 2HT2D 3Q3IA 1A7NL 3LBIA 2EDFA 2PRYA 1Z9OA 2W42A 2DULA 1YUKB 5AM2A 1D5RA 4JI4B 3THXA 5FXCH 5HDOA 5IB1A 2FN7A 4GUDA 1P4UA 2OZ4H 4KJPC 1C0EA 3QBVA 3PENA 3EY4A 3MO1B 4RKQA 3MWJA 4S35A 2XWQA 4RBPK 1L7QA 3BXPA 2AITA 4J75A 4UAJA 1K4DB 4NMXB 4GT0A 1RJGA 4MRPA 2V7NA 2B78A 1ZNYA 3WK4A 1JFLA 2ERYA 3H4VA 5EC1B 2ZJ0A 4RHEA 4CL3A 3LK6A 3G2QA 4OBBA 3WIAA 4Z4FA 2LQRA 2O14A 4H0IA 1XVLA 3ZTDC 1YUKA 2Y06L 1PKXA 2FX8L 1U7TA 1IN1A 3V3KA 3ALXA 3ZHZA 5KTMA 3APNA 2FPRA 1AIFA 3NASA 4CC1A 3S2GA 4WV3A 4W9LC 4C0JA 4X6BA 3RSCA 5I47A 3X1XA 1UJ3C 2XCOA 3AOEC 1KN2L 2ZTHA 2VXQA 2JB5H 3QNFA 2DYRB 1D6SA 4MA1B 4P7BA 1DC5A 2D4DA 3I9FA 4DC1A 5EEXA 3GAFA 4LHUD 1XF1A 3IP3A 2EECA 3HC7A 3AVPA 1UKYA 2G7MC 2J7KA 3ZGIA 2ZRJA 5C09E 1YNKH 3KS9A 1ZKMA 5AAWA 1GGFA 4NDZA 5EXDA 4KK8C 5H4HA 4GZ5A 5CS7A 1KYIA 5TGTA 2IPAB 4L22A 4HS4A 3ZGVA 4XBEH 5IHLB 4G9FE 1T1RA 2V7WA 3VFMA 2QLYA 5A4AA 1F58L 1XDSA 5BNXD 3E03A 2QKIB 1EO8H 3U3DA 2V97A 4YLYA 5JPNB 4KI5F 4NONA 2FXIA 2OHFA 2QPAA 5LIPA 4Z8YA 4MJ5B 4CT4B 4D9FA 3A6OA 5BQXA 1QVZA 1MV5A 3T1HB 4R71A 1J11A 1E43A 4XVUC 2IKQA 3ZTJG 5HIJA 3NFNB 3QFJE 3G02A 4PCKA 1YGYA 4H6XA 4FE3A 5TH2A 5A4IS 4N1HB 3X3HA 1O7DC 1D2MA 1EHCA 4MJ7A 1GLGA 4LJ8A 1EE2A 1HR0B 3MCYA 2I6UA 4QQ8A 4RKFA 5FWXA 1ULHA 1HEZB 5JXJA 3GGJA 4P8RA 3VTKA 1K63A 1TMOA 3WN5C 2BFAA 3I2IA 3DVAB 1S4IA 4PCAA 4X6CA 3JWDC 2DY1A 1PG7L 2G0NA 4IFIA 3MI6A 5FH9A 1L1RA 3SD2A 3O3OB 2Y68A 3L5OA 4URUR 4MJ5A 1L7AA 1QFMA 3R75A 4XYBA 1RZVA 1N8SA 1CUOA 3LS5L 3WRYA 1EHXA 3CU1A 2PGLA 2DRUA 8MHTA 4QPDA 3W7VA 3R0JA 3GNSA 3OE7A 2MYPA 4RDQG 4WJ5B 1P7YA 4D4KA 4TXHA 1G9SA 1T9GR 2TSYB 2XYBA 4S24A 2MR6A 4W9FC 2GPNA 3QFRA 3FDWA 1DJYA 3CVUA 2QPFA 1MG2C 4LJ9A 2WLMA 4QOEA 5FA3A 3JVGA 5EKUA 3DVAA 4PH8A 5E2UL 4X66B 2ZRNA 4M61B 3HUJA 2MOKA 2ZTVA 2Q1TA 4GOMD 5AUOB 2V7GA 1N5MA 2REOA 4XB6B 2O4CA 1DVRA 5DZAA 3L4JA 4AVJA 1UZUA 3OKFA 1IDOA 1MAWA 2CBPA 1E8YA 4EARA 4ARIA 3CMOH 1NHWA 3NBUA 1XF9A 2YAPA 2C04A 3MTGA 1TJ3A 2DQHL 4WWID 2YXBA 3NGMA 1P2TA 3NH7L 1T0IA 3RDJA 4WJ5A 2KT6A 1QHSA 3MBXL 3TOVA 1LO5B 2ZT8A 4NLAA 4NV0A 1JV2B 1ZLSL 4NUMA 1QBML 1ZIAA 2V9PA 3N58A 3GCXA 4HDRB 1OILA 2XZCL 3PNLA 2PIAA 1RZ7L 3X2QB 4IPTA 1Q4NX 1R8JA 1LS6A 4G67A 4M61A 1ZD3A 4AY2A 2CRYA 3Q1SH 4M7KH 3GGPA 4UDOA 3O8QB 2IFGA 3FPKA 2NY4D 5EINA 4KJWC 3R6LA 1W36C 1JKIA 2I2CA 1CNFA 1TAQA 3LBYA 1RY7B 1M7BA 4QC2A 1IIKA 2XPCA 2LZ0A 3DV9A 3I6YA 4ZPTA 3OTWA 4TWJA 2CO6A 2C9RA 3N28A 3V4FA 3VPBA 3WK5A 1WBZB 1I4DD 3U3KA 2OTPA 1MABA 1Q44A 5C52B 2DBLH 4KC0A 5DUBB 1GGNA 1AQ8A 1DIAA 2ZS9A 3CEAA 3M5WA 4HDRA 1OSPL 3O1HB 3N8GA 2PKDA 1ZR2A 2EEXA 5HKAA 4RGYA 4RMNA 3VO2A 3GXDA 3FQXB 3E3NA 1NPJA 1NMEA 1MBZA 2JKJA 3DMTC 3SGJC 2X4SA 4DSZA 3IS3A 3DCNA 3WIVA 3MK31 5EPUA 4QXPA 3OIWA 4OB5L 1X7XB 4JYMA 2MYUA 5K3SA 3ETTA 4E46A 1AGDB 1EXUB 4OG2A 2ZYAA 2NUPA 3QZWB 1U36A 5ICUA 4KHPB 1A8IA 2CCLA 3MRGB 3X1FA 1OX5A 3IPYA 4LK3A 3DDWA 2VLBA 1XVIA 5T6MA 1WBZA 3L1VA 3OJMB 1SIWA 2XVGA 3L4WA 3ARWA 3O5AA 4MKRA 5DUBA 3LT2A 1GHFH 1CYWA 3P96A 4MNQB 1BFVL 1ZKDA 1T2FA 4YIHA 3HU3A 3MOAL 1KO8A 1L4BA 1PZAA 4YMUA 2JJSA 3D34A 2BMAA 1EESA 2P9RA 1EJFA 4A2EA 4WCVA 2JW5A 2KM1A 1PF7E 1U9JA 5JOPD 3FXAA 2GD6A 2J12B 1GJIA 1X7XA 1JJUA 2SNIE 3QZWA 4TKVB 1L7DA 1GA2A 1I7TB 3AJEA 4W5RA 1VFPA 3G0IA 2WYWA 3B9PA 2ROQA 1JVKA 4QBIA 3IB3A 1E4YA 5BORA 1Z7EA 1U2QA 1TVBB 2CRIA 4DKEH 32C2B 2YQBA 3RV4A 1VPEA 4Y8VA 4FA7B 2DFLA 1KZ6A 2PKWA 4JL6A 1I1AD 4MNQA 4HEJA 1CLYL 4QUHA 4B6QA 4DUGD 2DJ4A 2P9GA 3RUPA 4NHCH 2VDKB 1ZLWK 4JAVC 5EGNA 4YHML 2WJJA 4G8CA 4FFVD 1P1JA 1HQRA 1ETUA 3TJMA 2LBPA 1OW0C 3KNZA 2FN8A 4BB6A 1MXHA 3FB1A 3D3JA 3LPAA 2R68A 2X8AA 2B2XL 3FOFC 2GYWA 1U8KB 3FO2B 1TVBA 4HAZA 2BISA 2YEQA 4G0UA 3H9CA 1DG3A 3BO8A 1UXHA 4GYBA 1U9YA 2J71A 1AHWA 4JZOB 3RFVA 1M8GA 4C7MA 3U16A 3BXGA 1YS1X 2HA0A 2D0PB 3RSSA 1NLZA 1M6NA 2XT6A 5HVHC 4HULB 1U7XA 2WIMA 4R5TA 2Q3JA 4WSOA 4LL4A 4QE3A 1VCNA 4GKVA 5TQ0H 1TQUA 1MSPA 2B7DT 4N1EA 2E5FA 2DV6A 1Q6ZA 3A4LA 1MO2A 4LSTL 1ZLVK 1FYFA 1GVHA 1L5ZA 1X8LA 3NCFB 3L5JA 5I15H 1ZANH 3IPFA 3KSBC 2PKEA 4L9LC 4GFDA 1FE8L 4MVBC 1YEEL 5TQ0B 5DMXA 5DUMH 2LP4Y 4E5XB 4XTRD 3AB0B 1L9OA 4WA7A 1P7QD 2H1FA 2EKDA 2LCIA 3FU8A 4IBUA 5EOCL 3DHWC 2RCNA 4QQKA 3C5ZD 2KYRA 2X0RA 4A7VA 3VWKC 3HDJA 3WUWB 5K9QI 1GC1L 1XRPA 1EEYB 4J0EA 5CFLA 3KLBA 4DV7B 2J5WA 3D18B 2YK1L 1JYFA 4FNTA 4KREA 3CXFA 1RI8A 1X39A 4NFCA 1W49A 3N9GL 3U2IA 4KRYA 4O63O 3H7IA 5DI3A 3WLEA 2X5JO 5FCUL 4II3A 1BREA 2GJSA 2PMDA 1E4WH 5HQTA 4E5XA 4KHZA 3R7FA 3QEAZ 4MXQC 1DFBL 1KIQB 1FNCA 2GOYA 1WUTA 2YJ6A 3Q3GB 2PWAA 2P5WB 2VITB 4X9IA 1JGLL 1NLUA 5BSFA 3FOEC 4BLOA 1AS3A 2V7XA 3WUWA 5BOPA 1XZMA 2YD5A 3GGGA 1EEYA 3CFIC 3K8LA 5CB4F 4LGVA 5JANA 4UU9A 4HQNA 4AEEA 3D18A 5CX1B 3HM9A 4Y0VA 1CWVA 1NMAH 4PJ8B 4Q24A 3JRWA 3LQFA 4JRYB 3FDFA 4OLYH 4B3BA 1B0GA 3L1KA 1TZOA 2FECL 3DMMD 2KLSA 3P7MA 3A6FA 4UNRA 4I5GA 5IV2A 2Y7LA 4HK0A 3L06A 5C7IO 1KIQA 5DHDA 1RT9A 1Z7WA 2FGKA 3A0RB 3Q3GA 3E7FA 1JMZA 2DR0A 1FDUA 3DVIA 2P5WA 1KJIA 5I9MA 3BWUC 1P5UB 2VLJE 1P2BA 1FZQA 4XE5B 2F7RA 1V9SA 4JG1H 3PXAA 3R76A 4CN1A 2X6BA 5I7OA 2DIBA 4L15A 2ZXFA 5JCPA 1WJGA 1CRLA 1TVMA 5LDHA 1HOCA 4QTXA 4KQXA 1ZNXA 2QLFA 4BRSA 4OH2A 4FEIA 4XQ9A 1MRNA 3BKJH 1CFNB 1K2WA 4AS3A 5AHWA 3ZXAC 3L18A 3EK2A 2Q7YB 1SIUA 2ZEJA 2BGGA 1THCA 1OX6A 1EFUA 4UTPA 5BSWA 3B1FA 1U2HA 3L7NA 3AVVA 1G9XA 4A2DA 3W5CA 2AK4A 4PZYA 3NAQA 4BKLB 4MX7A 2OZKA 2HRPL 4WXHA 3CF6R 5FPQA 3CEJA 2WWKT 4QWWC 3F96A 2WY2D 3H42H 1P5UA 2ADFA 4XE5A 3V97A 5LDGA 2GG1A 1K27A 1Q20A 1EBPA 4MJJA 5I1HH 1VA5A 2JJWA 3VUFA 4TTDC 1N3IA 3LCMA 3LUPA 3GT6A 4BK5C 2WG0A 1E5TA 1XDUA 4DLLA 5LZ8A 2FW0A 1NE7A 1CFNA 4N9GB 3ONNA 1JLHA 5IVZA 1FSGA 2XB9A 4EHDA 2J0QA 2Q7YA 2CDNA 3ISYA 1FLTX 3BUSA 4RYDA 5A06A 4WECA 1Y9DA 3QORC 2K4AA 2PHZA 4ATNA 1BZDA 4D97A 4BFJA 4UT6H 1RNLA 1DQJA 1FL9A 4U1HB 3W39B 2FMIA 4MGKR 2R9VA 1KCVH 1YCSA 2QQNH 2XN0A 3TTSA 2O52A 1KKLA 2Q5QA 1N8ZB 4KK6D 4FA8A 4RH1A 2XLLA 1L6RA 4KGXA 5CM2Z 4OAWA 4IMKA 1F42A 2NQ8A 4RWEA 4AKGA 2IHYA 1Z5VA 4KFUA 4D3XA 4J3SA 1BAWA 3CNBA 3DJTA 1NU8A 1UWXH 1PZEA 1N6QH 3HG1B 1J20A 5KCZA 3PDWA 3O0RH 1VGQA 4UXJA 2FLMA 3CZPA 3JD2A 4CMIB 3HLKA 4YAOA 2A0UA 2IOFA 5I0WA 2YXEA 2AOVA 2GKIA 1KYDA 5AJXA 3CPUA 1T89C 2O19A 2KUTA 2FPSA 1WUYA 1HDRA 1C7SA 1MW0A 3I1FA 3BB3A 2YOFA 5GQSA 1LSSA 4U1HA 2VF7A 4MNGB 2QAIA 1N8ZA 2OBYA 4M9QA 3JV5A 4UU0A 3KKQA 3D7SA 2XRMA 4CDMA 1V5IA 4ATTA 3N75A 1B8VA 4ZANA 2PAAA 3HUFA 2Y2UA 4RENA 1V7ML 2F58L 1H2XA 1HHIB 3OURA 4HG4J 7MDHA 3LAFA 1RZIA 3KEFA 3NW9A 4H17A 3HRKA 3V0FA 3FT2B 4APQC 1FY2A 3VISA 2AN9A 4AMGA 1EHNA 1SYVA 2TMDA 3SZUA 4PMFA 3A9UA 2JQMA 1TDQA 2V55B 1DX9A 3MUGB 4WHYH 4PRPE 4XWAA 1DO2A 3N2GB 3U56A 5FYKD 3IGKA 4R6UA 3NBKA 2VT2A 4MNGA 2VZOA 3FT0A 3KSMA 3U4GA 1HLFA 4HNAB 1GSOA 2EH8H 1TD9A 1CRQA 3ESZA 2W07B 1E4XL 2FR4B 3F47A 4H8WL 1SVCP 3OCCA 3N6RA 4ZHQF 5LBUA 1F2VA 3KQKA 4Q3NA 4BWFB 1QPKA 2GBLA 4YMPA 1Q2UA 1HHIA 2FGWL 1Z6AA 2GARA 2CNNA 2PLRA 1XWWA 4NNPH 2A78A 1Z56C 4IDHA 4GIOA 3GXFA 3T7IA 4OQYA 4Q4JB 4IJ3B 3D4CA 3MUGA 5I1GL 4BQFA 2HFGL 1U3WA 4PJ6A 1OCRB 5IOKA 3N2GA 4RK4A 5KVAA 1ZVKA 3RJTA 4FQJL 1NVWQ 4TMPA 1ZH8A 3FX2A 5IXYA 4F60A 2AMUA 1UAGA 3FZQA 1T91A 5D85A 4KZPA 1ZI9A 3I6MA 1FNBA 5KANG 5TPZD 5KZMB 2W07A 1KFCB 3F7VB 2FR4A 2EILB 1X0VA 5C3TA 1V11B 5JAPA 3VQLA 3LC7O 4XD2A 3DYPA 2AJZB 1AC0A 1S9XB 3WS6A 2J9YB 1OKKD 1G9EA 1PEYA 1XTLA 3KP1A 3WMGA 3UX9B 2DQGH 2CFIA 4YRTA 1Y1LA 2C98A 3FSGA 2OCKA 2FQDA 1RYFA 4S2SB 3WY3A 3MTIA 3GTTA 4KNTA 2DSTA 1UBGA 4Q4JA 5DWDA 4PG2A 4ONGH 2FFJA 4POAA 5E6IA 2UZ4A 4I4NA 2HTEA 2HRRA 2IKSA 5CBPA 4YHZL 5F6HI 2DQTL 4EGAA 3S2YA 4ZHSA 3WLNA 2HMYB 3HI1A 3TFOA 3F7VA 5G4NA 2H63A 4AIRA 3T99A 4QULA 1JHPA 2AJZA 3HLYA 1S9XA 12E8H 1J5PA 2JFXA 3KJIA 2FEEL 4HSAC 4R26H 1UWYA 3NCBB 2DBZA 3TE7A 5AMXA 4OCYH 4N28A 4N7BA 3GP5A 4MJHA 3GY0A 4LV8B 1KZ9A 4QXQA 2QTLA 5FUCE 4PRAB 4S2SA 2P5EE 4EYSA 4F12A 3S8YA 3R5FA 5I8EB 2JCYA 4GMTH 3G0GA 5DRZA 4IUCS 2YJGA 3ZHRA 2C4XA 1SBSH 5JXEC 4AQZA 4RX1A 3EW3B 2JJ1A 1QSFA 1PKOA 1FYTD 3T5TA 3FOMB 3NHSA 2WUWE 3D2TA 4HAOA 1V2HE 4E51A 2QT0A 4PRKA 2PW2B 1L9TA 4DERA 3HYLA 2XX1A 1T4DA 1WZ1H 1ASPA 2RMNA 5B7QA 5I71C 2CSUA 1WBBA 3LKRB 2SICE 1OI7A 1TQHA 2FA9A 5JEEA 2E6JA 1TCRB 5C07D 5IW6B 1I5RA 1OXUA 2WKPA 3ID6C 3Q85A 1JXDA 4PRAA 2R4UA 3WLWC 5I8EA 4LDEB 3FOZA 2FWLB 4W99A 1VSBA 2ZVQX 5LSAA 3AR7A 2MNUA 3C6LB 1NMBH 1QACA 3VDQA 2PUDA 2NAFA 3IEUA 2GK0A 3FOMA 5KVGE 5D7JC 2JH8A 2D7TL 5HFJA 5K1NA 2C5LA 1RZ8A 1SKMA 1E9CA 2IXEA 3AXLB 4BSVA 2HNAA 1K9SA 4MSUA 3H9SD 5L9DH 4NQVB 3HC0B 1VSVA 2JFNA 4IW3B 2PW2A 5D70H 4DAGH 1WIOA 1CTOA 1JIQA 4PPNA 2CBTA 3TR6A 4R9NA 1DL5A 3KPSB 4ZTOL 1TCRA 3B8YA 4MBRA 2I4IA 4PRYA 5IW6A 1ZLUK 2YJZA 5UKDA 6ADHA 3HMKA 4CIXA 5BW5A 4WBXC 3FN3A 3SQRA 2QSQA