3ZDZB

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 111
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3zdzB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3zdzB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3zdzB03
5KYXB 1QCYA 3ZDZB 4HQNA 3IJEB 3OKYB 1MHPA 3EFOB 3HI6A 4CNBA 1M1XA 4MMYA 3V4VB 1RTKA 3EG9A 4IGIA 4F1JA 1JV2A 2P26A 1PT6A 3IBSA 3HXOA 3K72A 1CQPA 5KYYA 2VDMB 4JX0A 1L5GB 5KYWB 1BHQ1 3FCSB 2I6QA 1XDGA 1SHUX 5HJ2A 2ICAA 5KYUA 4JDUA 1QC5A 1OAKA 2O7NA 4NENA 4G1EB 1AOXA 3QA3E 4O02B 3ZDYB 1DZIA 3T3PB 2VDKB 4Z7NB 1SQ0A 1IJBA 4MMXA 4IXDA 1IDOA 4BJ3A 1JEQB 1TYEB 1OLZA 4FWWA 4HQOA 3OL2A 3N2NA 1N3YA 4O02A 4C2BA 1UEXC 4F1KA 1N9ZA 3EGDA 1T6BY 2WW8A 3TXAA 4UM9B 2I6SA 2P28A 1L5GA 2VDNB 3OL2B 5KYNA 2VC2B 3K72B 4Z7QB 3PPXA 3BQNB 4MMXB 3ZE0B 3FCSA 2VDOB 4PN7A 1MJNA 4Z7OB 1RD4A 3ZE1B 1V7PC 4G1EA 4GZ8A 5BV8A 4FX5A 1FNSA 1LFAA 1AO3A 3IJEA 3EFOA 3PPYA 3K71A 4UM8B 3K6SA 3AL8B 1FE8A 3EOAI 1JEYA 5HGJA 3NVQA 1QC5B 1M1UA 5KYWA 3PPVA 4C29A 1XUOA 2ADFA 2VDPB 3E2MA 4G1MB 1T0PA 1CK4A 3NIDB 3VI4B 3NIFB 1U8CB 3OKWA 3BQMB 3ZE2B 3EGXB 2VDQB 1IJKA 3EOBI 2XWJI 1M2VB 2NUTB 1IDN1 3TW0A 5ES4B 1MQAA 4O3TB 1PCXA 2XGGA 5LN1A 2XWBF 2B2XA 2M32A 1ATZA 2I91A 4WK0B 3PPWA 1RRKA 2NUPB 4G1MA 4NEHB 1PD0A 3HXQA 3VI3B 1SHYB 2QTVA 5E6UB 5E6RA 1NA5A 2X5NA 3K71B 1JLMA 2VDRB 3ZQKA 2UZYB 5E6SA 3TCXB 3GXBA 1PD1A 4MMZA 1XDDA 4WJKB 5E6SB 3T3MB 3V4PB 3RAGA 4WK2B 5E6UA 2VDLB 4A0QA 3AL9A 1M2OA 4O3UB 1U0NA 1ZOOA 2ODPA 2WINI 4WFQA 2NUPA 5E6RB 4NENB 1YUKA 3AFCA 3EGDB 1JEQA 1JV2B 4K3JB 4MMZB 5HDBB 1SSLA 3F78A 3NIGB 3EH2A 4CN8A 5KYYB 1ZONA 3FCUB 4IHKA 1AUQA 2ODQA 1Q0PA 1BHO1 3EG9B 2NVOA 3ZDXB 1ZOPA 1M2VA 3Q3GE 1MF7A 3TVYA 5KYXA 3EGXA 4M76B 1M10A 5KYUB 4WK4B 4XW2A 1SHTX 1M1XB 4MMYB 4DMUB 4HQLA 4HQFA 1DGQA 1U8CA 1U0OC 1RS0A 1YVRA 1YVPA 3F74A 3AL8A 3K6SB 4UM9D 4HQKA 3M6FA 4CN9A 1JEYB 3BN3A 4C2AA 2NUTA 1MQ9A 3EH1A 1MQ8B 2IUEA
chains in the Genus database with same CATH superfamily
1Q83A 3SD7A 2A1TR 4ZZFA 2Z9TA 3THXA 3T5GA 2Z7UA 3MBIA 5FUZL 4Q82A 3LV8A 3V7WA 4PWIA 3QA3E 4RZXA 5TJHA 2NXNA 3DXAE 2UYOA 1WOMA 2MPAL 4OFKA 5LJYH 4ZUVA 2OTWB 3GMOA 4B9CA 1JJBA 3CX4A 4Z3EA 3K72B 4J7RA 4D79A 5LG1A 1M34E 1IT9H 3CCFA 4C78A 3QJZA 4EIZC 3M6AA 2OMNA 5HP5A 1QNLA 1ZS8B 3AL8B 1UPAA 4QRRD 2Q3DA 2K6WA 2JBWA 5DN6D 2O0MA 3GB9A 1BN7A 1U6KA 2RH9B 1YC2A 4JQIL 3H86A 3FKJA 5DZLA 5MHTA 4FL4C 1XMVA 1N3NA 2GS9A 5LKAA 4IIDA 3C9NB 5C31A 5D1XA 2A4MA 4PJ7A 1H3NA 1MH1A 4NZNA 3R3YA 2B1JA 4CEJA 1N8SA 5E6SA 1TETH 3WE6B 1P5UB 3LO5A 1R3JA 4PS4H 3D30A 4PJAB 2UZXA 1FVFA 3QDMD 3VCLB 2L0DA 3EG5A 4TWRA 1XJQA 3FRPB 4JM2F 4JIMA 4I1OA 4IQFA 1XEWY 4UQPA 4FQ2H 2ENYA 4QPNA 5I8ZA 3Q8LA 4NAUA 2XV2A 2ZOKB 4PJAE 1P0FA 3SDDB 2LCQA 2LVBA 1KMIY 4Z8FH 5DLMH 4YWGH 1HYBA 1E3TA 1YZ3A 5F3RA 3OJLA 4QXUH 5BPFA 3EGCA 3KAJA 1MQ8B 5KZMB 1IC5L 4YTEA 2O2JA 2C98A 1J97A 2ZCVA 3IDMA 2PLRA 2PYDA 3M6UA 2WOOA 3U7GA 5HYVA 4MS8D 4EEZA 4XQCA 1O87A 1UJ5A 1FUIA 5DM1A 4JFED 2G28A 2P5WB 4G24A 5ALQA 4PEVA 4O29A 4N8VB 4XWTA 2XYCA 2CHGA 3VUFA 5E9AA 2W9EL 1T5WA 3ZHBA 4GM0A 3T3IA 1EHLH 4KFCA 4Y5VA 1FO0A 4Y6GB 3SJVD 4PGJA 1KEMH 4ZUTB 1CWUA 1JLLB 1QK4A 1WEKA 1IGFH 3JVVA 3QO1B 2YPVL 4AMKH 1Y3CE 1FN4B 2CLDX 1FFOB 3VW3L 2HA2A 1JIVA 3ESMA 5D1QC 5GOZA 3SZOA 1B88A 2H9GB 4JO4L 1W52X 4HT1H 1IFGA 2B2XA 4OBBA 5CCDA 4QJ4A 2VLJD 4BZYA 4RVGA 3R5TA 3DJZA 2YMXL 2V9UA 4UU9B 1RBYA 3BAXA 1OK8A 4MVJA 3BHBB 4KJQD 1E1KA 1M7DB 1Q0RA 4LQDA 3F5QA 3TZVC 3G7TA 1JXGA 3BORA 4LCBA 3H2JA 2CFOA 1IZ0A 1Z4IA 4E33A 3HBGA 4TSAL 1PJ8A 4DETA 3V8BA 4JVSB 5AHKA 3T06B 2A0WA 1AIZA 1E9QA 1LMKA 1RPAA 4OLHA 3SK0A 3ZYIA 4I4NA 5I51A 4X5RA 4M8RA 3KR3H 4F8NA 4HCRH 4EI8A 1R9GA 1EA7A 1F7VA 3DJ9A 1AP2B 3DKPA 3WGHA 1I8KA 3W9SA 1C3OB 3HJRA 1KY2A 1D5IL 4ZD6A 2NW6A 3LDBB 4FFWA 3U3KA 4UV4H 4Y5VC 1KE1A 3OPXA 3PNRB 4UNQA 1SEQH 3BH0A 4LIQL 5DFAA 2L04A 4N0PA 4RVOA 4OCLC 1ARZA 4P2OA 1BBDH 3BFWA 2EH7L 1J22A 3UKOA 4I85A 5D1QA 1DJQA 1YUHA 2CDFA 1N2JA 3T6QC 4ZFZA 2HA6A 4DADA 2HRBA 2WJ4A 5EJ9A 1LO3H 2OAAA 3EE6A 2IDSA 1CFBA 5IG7B 3SYQA 1GC1C 5B22A 3BWCA 5ABZA 1Y6FA 4X4ME 1C2TA 5HFJA 4ZX3A 5EKTA 3C8HA 1QFWL 4XXDA 1IM2A 2VDJA 5JASA 4KXUA 4LEXH 1WEJH 1NAMB 4ONHB 4JKPH 3WGJA 1ISSA 1IAKB 2FR0A 1HA3A 2ZIEA 4CVZA 3WFBL 5F1PA 3NR2A 1G87A 5B39G 1CS6A 1MVLA 5DD1H 3LEYL 4YHOL 2NX5B 5LXVA 5IQ7L 2YD7A 5HYJA 4EG0A 5A5EA 1BVNT 3GPLA 5CO1A 5KTPA 4TUOB 1NDQA 3VC7A 5ITWA 4HDNA 3JZYA 3AHGA 3PDOB 1NXWA 3RAFC 2HMSA 4J0HA 2GHQA 5FO2A 1Y7PA 4AX4A 3GJRA 4OZHF 2AR7A 1OAUL 1SHUX 1JK9B 2XG5A 4I0PB 1JNXX 1M7BA 3JWNC 4NYMQ 4M5SA 4WBNA 4OLEA 4NX2A 1JPSH 1FTQA 4G8FB 3RU8L 2R85A 3QJFA 1PI3A 2VPYA 5T6BA 2AAAA 2V6FA 2L7JA 2H3NA 1IKFL 3HC0B 2X2FA 4IR7A 1G41A 1IC0A 5ANMA 5DUML 3VXTB 4QUHA 4IIHA 3IDYC 2TRHA 1FHGA 4ZYWA 3GWGA 1R5JA 2XZCH 1MQKL 1PS9A 5I9LA 4M1CD 2B1AH 4YR6A 5BZDB 2REQA 3A06A 4B5KA 1RLMA 3GO4A 3JWNH 2HUNA 1A9TA 4R4JA 3SHOA 1AB5A 5IHLB 4MDIA 2I91A 1ND0B 3OFNA 2M9MA 1KY6A 2VZSA 4Z99A 4EF5A 1E20A 5TDHA 3GMLB 4MJ6B 3O8OB 4FTWA 3CN3A 3H4HA 3QUYC 1U4NA 2IP1A 4CKCB 1NASA 3R3ZA 3O45A 1E4VA 1KIFA 1NUQA 4J3JA 3E0XA 4RSHA 4OPMA 4YAGA 4CT5A 2Y1LA 3SPGA 3TBYB 2FYYB 1YEDA 1CVSC 4KROC 1C8LA 3MOIA 1HHKA 3UMYA 5T1LA 3MBEA 1T4DA 4P86A 1UUFA 5KYWB 4DAEA 4XP9L 1GY1A 2O5VA 4YDZA 2IAND 5IJVA 3MX0B 5CZXD 5CGBA 3EH5B 5TS2A 2PAAA 4RDCA 1HDCA 2UZAA 1JD9A 3BIBX 1E7WA 1ACMA 2ANCA 1YEFL 4KB5A 2V7QD 1F0YA 4G83A 4G0ZA 3UCQA 1F41A 3GD5A 1N5MA 5E6IB 2V7UA 2VWQA 1BCRB 2OL3L 2BGWA 2ZCLL 2Q28A 4RHXA 4RQTA 1UJ3B 5MN5A 1JHQA 2KMLA 1ONBA 4XJXA 1ZT1A 3CLSC 3KYKH 4KGVA 2DOKA 2Q6WA 1NCGA 5I66B 4NOLA 4HAZA 1EE1A 4X54A 5JMWA 1MFVA 4WY7L 3DNFA 1AQ6A 5AVJA 2FLKA 1BD3A 4WSGA 3SJVA 1XZNA 3P0VL 3NMEA 2KS6A 3M6VA 3CH8A 4K7PX 3NT0A 4FLOA 4K55A 3ZX1A 2BVNA 4Q34A 2WCGA 3HPQA 2MNUA 3DHYA 2HWYA 1BMQA 4BEVA 3OFSA 2DTSA 3I61A 4R7NB 4X8OA 1L5SA 3P27A 1L7DA 3N3BC 3URKA 2XD9A 5F9AC 3D1JA 3I8XA 4GKSA 2IIPA 3OH8A 4R51A 5EO0A 4MYWB 2WZQA 1R75A 3CWQA 1XCJA 3MBEC 1P1ZB 3W5SA 1ZLEA 1KJIA 3I3SR 4N5ED 2J0QA 3CNNA 2XA2A 4GRLB 4P4KB 4NJ9H 2P75A 2RJOA 2E56A 2BL4A 2XD4A 2EXSA 5L45A 4WEQA 4IXNA 4S04A 1URZA 1KBPA 4YCCA 3H84A 1S8DA 4YSSA 3WXBA 3S0PA 1A4UA 4TLUA 4YLEA 4LSTH 4WZBA 2D0IA 2VDQH 1M83A 3E18A 1RK0B 1RDFA 2UYHA 4A55A 4NYJR 4PGDA 3OPYB 4EKXA 4IUBS 1BZ8A 3CO0S 1NGYA 3CVJA 3HCDA 4J8RB 3TZCA 5LP6F 4AIIA 3BQNB 2VYCA 1BVHA 2XN9D 1T36A 5DW3A 3SM9A 4PYIA 2DM6A 1KYYA 3OKWA 1E4OA 1BA9A 3UWPA 4M88A 4FE3A 3TMAA 4F86A 2XXGA 3A6BH 3OJWA 4N1EA 3FUNA 3VR5A 1WISA 3OKNB 3PBKA 3SYRA 4MFHA 3PP8A 1GYCA 3L5XL 1MC5A 3MRRB 1ORVA 2H32A 4U6YB 4JFOA 5ALOA 1AH2A 1UBTS 3BP5A 1AYRA 2B5OA 2GA8A 2GD6A 3MCUA 4DE5A 2O59A 2DJ4A 3GMOB 3HG3A 4LEBA 1DXOA 2MSPA 1LO2H 4PGZA 1THCA 1JF1B 4EVIA 2WQUA 1FK8A 2ZSVA 4ZVRA 2AJ3A 3U6BA 5AQEA 3NJRA 4WTXA 4ANVA 4EB6B 1P2UA 2ZIDA 4LMPA 1BX3A 4L8BA 1V3LA 3I2CH 3H4FA 2Q6LA 5JBQA 3Q7RA 1XF1A 4UNRA 4BHUI 4MIKA 1KXJA 1QHQA 1SXJC 2YFKA 1TQ4A 4NNPH 4NQXB 1RM5A 3KXKA 3TMKA 3CSFA 2E7DA 1S5PA 2NSQA 3ZHZA 4BFSA 3ZMNA 1CLOH 3TBSA 3GL9A 4A3SA 2XWXA 5CUQA 1P4UA 4WV3A 1MCQA 2IALB 3PWJA 4OJTA 3LWNA 1YRKA 3CGWA 4O4IA 1XE3A 4R90L 1P62B 1QCDA 3ZZSA 3FPGA 1NFQA 5KVDL 4ZYXA 2IV9A 1DJXA 3O11B 1S7RB 3FCSA 5BOPA 1YL6A 3MRMA 3KPUA 1XR9B 3SJCA 1SF3A 2DMRA 4X6CF 6Q21A 1FQWA 2Y7QB 3UJ9A 3VQ2C 3BZFB 3FPYA 4MZ2A 2IBTA 3ZW8A 2NT1A 3GZPA 4GMKA 3DHPA 2Z4RA 1YMUA 5GGUB 2QN7A 2VPQA 4KVGA 2XG4B 5DQ9B 2WSLA 2UWEF 3KOOA 4EKNB 4PY8I 1A14H 5LQUA 3II2A 1T2EA 1KTCA 4KJXA 4BEBA 5KG9A 2A5FA 1I85A 4Q3EA 3L3IB 3T7AA 2VAAB 5DZJA 4MWOA 1ZD4A 4AY5A 4BZ1L 3WFEL 1WMFA 3RREA 1QOPB 1KIRB 2X3UA 1BHGA 1DJZA 3FKUS 4JL1A 1U9ZA 3TKLA 2HTKD 4LJ5A 3KLKA 4B3JA 3D4YA 3ZXUB 3VR6H 2GK7A 3FVWA 821PA 3B7RL 4QDZA 3IFNL 1JFQH 1F6LL 2IPXA 3LXUX 2C94A 3HTXA 3P2IA 1G3IA 3R3SA 5C1IA 1P0QA 4Q6KA 1GW6A 3H83A 4KVZA 1IL1B 4H13C 4BV8A 5CU9A 4P22A 4LU5H 5JPCA 5A6VA 2NY5H 4KSCA 2LU5A 2BDUA 4I5GA 5DGTA 1H8NA 1EFKA 4D98A 3IRUA 1Q2UA 3X1NA 2VXSH 3LKQA 4LAJH 2FUEA 5HF8A 1A69A 3PG2A 3QTBA 5FJIA 1H3PL 3OXSA 2LR0A 3CUWA 1LS6A 1UQUA 4QRSB 2WU3A 3ZCRA 1NCTA 1TZGL 2LVCA 3QFJA 3S7GA 3UG7A 3CVUA 5JNWA 4QTHB 1I9IL 3FPSA 1KBKA 3BVNB 2ORYA 2Z4QA 5FM4A 3NEPX 4LYEA 4B6PA 2YXMA 4HB3A 4KNVA 3MFFB 4HAKA 1E9PB 2OXCA 1KY4A 4H6XA 2R6R1 2Q1SA 3TV3L 1S6YA 2HV9A 4QHSA 4CLHA 4MWFB 5FV1L 4E2ZA 3HLAA 1NW3A 1ZG3A 1W9HA 3C7CB 2AQSA 2EEZA 4E13A 3INGA 3UK2A 4X5PA 3CE1A 2XETA 3WGMA 1W1IA 2QKIA 1KMHB 2YLHA 1DOAA 3QLTA 4L3EA 2VDPL 5FV4A 3PJSA 3SY0A 1DEOA 2XZZA 4GQ9L 4K3JB 3ANTA 5JHDA 4YJHB 3ROFA 4DRYA 3Q10A 4YHNA 3OQVA 2FEOA 3IM1A 1UFOA 3MJTA 4GPEA 2E21A 5EPEA 4DP4X 3QIWC 3SXPA 3I30X 1XSJA 1F4WL 4N2AA 4M8SA 1ACJA 2H7VA 4AUEA 2AZDA 4CM1A 5EU6B 5D7HA 3NPSC 4TNVK 2P7IA 2VUTA 4F1JA 4P4RB 4JHXA 3ZL4L 3VXUB 2W38A 2B1OA 5CFOA 1CB7A 4FD0A 4B0PA 2DUMA 1DAFA 3AG5A 3FWNA 3K8ZA 5E99L 2LVEA 1HEJC 4IIGA 3AB0C 4YXHL 5EEZA 2V7HA 2NO4A 3PNWB 3PDUA 3I5YA 2P28A 2IEBA 1XYGA 1QO3B 1BX2A 1LTQA 3SOBL 1P5RA 3EZ9A 3TL6A 4ADJA 3GLVA 3INUL 1HEZA 4JKIA 1HFJA 4HKBA 2JNZA 2H9AA 4CQMB 2ESVD 4R2HA 4BNIA 4Q4DA 1HPLA 3CRW1 2GCYB 4FFVA 3OTTA 1GRWA 3MOAL 4J16A 1P6UA 4UAGA 4YRZA 1T1XA 2JA1A 1IGIH 1PDOA 1BFDA 4QE3A 3TWOA 5C0JB 1Z82A 1LK2A 4CU7A 1CQIA 3IBEA 3NJNA 4HMQA 2XBTA 3TBFA 5BSKA 5JT1A 1FJ1A 3AKEA 1KI8A 3C4JA 3MNVB 4QU5A 3D5OF 2C1XA 3K32A 2ADJA 3P2KA 2P46B 2XLCA 2R9HD 4OCMC 3DEIA 3H4VA 1K4DA 5DEIA 2PRYA 4ZCMA 1FSKB 5B6JA 1UXKA 1RYNA 4GXVH 1TXGA 4TXVB 4BQNA 4LJ9A 2WMDA 2X76A 2F74B 4JYAB 1T22A 3V4RA 1Y4SA 3QDGE 3R4DA 2J7KA 4A39A 3P7MA 4N3UA 4DLWA 4P4SA 4UVHA 3EH1A 4P6VF 4QYIA 2ZBGA 4KX5A 4L2IB 3SNKA 4IHAA 3VI4A 5I1AB 3ATBA 1EQWA 4DCOA 4A63A 4MUKA 4IX1A 1Y8ZA 2VXQA 2OHGA 4E22A 2PYEE 3A10A 4M83A 1Q0TA 1J8RA 4ND4A 3SODB 3T1OA 5TQ0L 3FSRA 4XIIA 1GCOA 4DEPB 3OA2A 4R2GD 1ZN2A 1XU4A 1EHCA 4F4IA 3WQRA 4AENB 3BQUB 5JNYA 1Z07A 4HIIA 3HZ3A 2OZ4H 2FX2A 2D7NA 2HI0A 1GCGA 2VJDA 4MQTB 4TVBA 5DA0B 1WQVT 4JB9L 3BEVB 2RHLA 5AAMC 2BCGY 4TKUA 4RIFA 5EMJA 1BDIA 3LRGA 2RDMA 1LO5A 4ABTA 1PJ4A 4KO7A 4QHPA 2PO6C 2VDLL 4AF6A 5AD0A 2IV2X 4CQNA 5JPNA 3F73A 5IH3A 2DKOA 5E08L 3KETA 1RRMA 4R96B 4TKLA 1P4IL 4KODA 3EIUA 2HHCA 2XFXA 2UX7A 5JZMA 2K7PA 1JK9A 4WRLA 3RS0A 1BFUA 4YBLC 3V2AR 4BDVB 4JZNB 3G5VB 1ZUNA 4JKKA 4Y19B 3DIDA 5C0GA 4EF4A 1M2KA 2O1WA 3HB9A 1W2WB 3LKOB 3O4JA 1N0UA 1OFGA 3SYLA 1TIUA 5DFVD 1GPOL 1QKZH 4BRJA 1M67A 4TQEH 1LXMA 3C6LA 4YROA 5I5GA 3R6WA 5BYJA 4M5YL 4A6PA 4HU2A 3DSNB 5LGJA 1S4QA 2WAYA 3DBVO 2HWUA 5G0UA 1EX1A 1V7MH 1FNFA 2BSSB 3U4EA 2YAQA 3QHZL 2P2SA 3Q1SH 3NWEA 1X87A 3L48A 2R23B 4YHIB 1CPUA 5LIRA 1NAIA 2DMGA 3EWNA 2J48A 1HI9A 1SULA 4GKLA 2VLME 1FNCA 4OHKA 5EUOE 1TJ4A 3A36A 4GPVA 1E0KA 3DTVA 2IOFK 3MINB 1DEEA 5C0BB 5HM8A 2X5OA 1J10A 4OFQA 1Z2AA 5EQFA 5HPMB 1PR6A 4MLDA 5I4BA 3DDHA 3MCKA 1RHRA 1IYZA 4DCQB 1XZFA 5JUEL 4HJJL 2YQGA 4HJUA 2PO6A 1MC8A 3NP4A 1HHGA 3H1PA 4BOYA 1UC8A 1JFLA 3IQGX 3VNVA 5A2IH 2VOEA 5EQJB 4RIGA 4AW9A 1SN5A 3BYZA 4XNXH 4CCYB 4GKVA 1RVFL 3IS3A 3IELA 2HN7A 3DIFB 3K0BA 4BFYA 1RJZB 3BJIC 5HI3C 2VL7A 4OKDA 3E22A 4QREA 1Q0XH 1NR7A 1C3OA 1Y4DE 3KDMA 2IPOA 4F58L 3I5UA 4MI9A 3FTVA 4UUOA 4RZIA 3HVUA 2FGWH 5BN4B 4CN8A 2I7VA 1SCQA 1LC0A 4P8QA 3AJ7A 3T65A 2V2XB 1GG8A 4FOSA 4EHFA 1XC7A 2G2RB 3L3JA 3S44A 1BVLA 2C5EA 5KC9A 3QNMA 4QGFA 2H6UA 3ZDZB 4QLAA 2WD7A 4IWXA 5I74C 4JP5A 1KT2B 1KK0A 5FO8B 1AXEA 3GPDG 1U99A 2A84A 4OIMA 1ILWA 5ALBH 1MNNA 3GP5A 2KBFA 4LCCC 3X14A 3VH3A 3GD7A 2LNDA 3A3PA 3W0WE 1TYEB 3MBWA 5GGSY 4UT6L 1QQBA 1RJYB 2O5XL 1KXZA 2JCCB 3C5EA 2BP5M 3QA3A 1QI5A 4XZUA 3A26A 1A2OA 4C4ZA 4DDMA 3CWZA 4Y5YA 2FDRA 3EYAA 3ZHVA 1HILA 2OXGA 1FFYA 1KFEB 2CLKB 5FWDA 5C0CB 4M0LA 2PYEB 3ILSA 4GR5A 4NZ9A 4KIUA 3RWBA 4ZFOL 4UPDA 2QPFA 2CEAA 1U3HA 4FQ7A 1VZIA 2JK5A 4CT0A 2HADA 2JNWA 3TF4A 4MVWA 4FNLH 3L46A 4L1TA 2A74C 1NLZA 5BY2A 4YFYA 3BZFA 1EB8A 5D4JA 5A3RA 3E6HB 1MFNA 5ESQB 5E3JA 4HMDA 3SU8A 3U46B 1RADA 2A6KA 1NBMA 1C8BA 4CU5A 1F3DH 3F5MA 3SDXE 1Z6XA 1QP7A 4BM7A 4WZBB 3OKOB 3OKDB 4CFYA 4P5PA 2F8SA 4HHGA 1VJ0A 4UHEA 3BWEA 4AYMC 4HGRA 2DH2A 1T9CA 5I23A 5LGJB 3WNQA 3ZS8A 2FJ0A 1L6RA 1S8AA 2Q50A 3WEAA 3D1VA 3GDFA 3L06A 1D6SA 4JNKA 3MT8A 1A7OL 2FNWA 1ZRUA 4P2RA 2C03A 3QJGA 2RCYA 2VDMB 3QFJB 4IJQA 4EDFA 1EJBA 1Q7BA 1ENYA 2Y05A 2ISQA 4JHBA 4WFGE 4MRSA 3RB8A 3Q40A 3TH2T 5FO9B 2FJUB 3ONWA 1XTIA 3PGDB 1ZI6A 4LEXL 3PS6A 1MCIA 3SYOA 2JAUA 4KYVA 3EIXA 1UXSB 4JPQA 1D9KC 1W8OA 4U6YA 2Y76A 3K5PA 2C5SA 4P81A 1GNVA 1NLDL 2Q7DA 4CL2A 3NJMA 2VN4A 3RPIB 2Z2XA 1UJ3A 1DDHB 3KLNA 2HD4A 1QWSA 3FT4A 3PP4H 4U1GB 1Y4AE 2Y68A 3VGHA 5LO7A 3ADCA 3NGBC 4ABUA 5A7GA 1EP2B 1JMXA 1V10A 4KKCC 4DA8A 3ZBUA 3K9QO 5F3WB 2HZHA 3ROEA 3DHEA 5AVWA 4Y4FD 4NENB 2B7CA 5MEPB 3QBTA 3OUZA 1DHKA 1JPGB 4Z8XA 4Y8VA 3RQ3A 2P0AA 1JWBB 3ITNA 2YS4A 1ZOPA 4EJ0A 3BD4A 4NC2B 1JGEB 3FN4A 1XAJA 4JVNA 1RUKL 2AA3A 2F3QA 2CPCA 4M2LA 5ALXA 1HQRA 2DQMA 4TSFA 2VNAA 1V9CA 2H65A 4HXFB 4RMUA 3PNLA 4HFJA 2P9BA 4D8TA 4P4KA 1R8JA 5LBVA 3NKVA 3RIXA 32C2A 3AGVA 4JJIA 1WDLA 5E7BA 1RQ5A 4W1RA 3EJYD 4OCWH 1H2EA 2FEJA 5FDWB 3NJGA 2G82A 4BJ3A 3IP6A 1G6RB 4JDZA 1LYQA 1ZM3A 1PY9A 3DRQB 3OEEA 3JQRA 3EZGA 3O2JA 3WHE1 2ROXA 1Z8HA 4PGCB 4EFMA 4F9PA 2CN1A 1S9VB 3SCMB 4B9JA 3EDFA 4H0CA 4CFSA 4G0OA 2ZRGA 4TV9F 1UOVA 4BNVA 4FJZA 1PZBA 4GVXA 3THSA 3VC2A 1CS0A 3TW8B 1RWPA 1D6EB 1H6UA 3NBNA 4XVJL 5HNKA 4O2FB 1YI8A 3HOGA 3WHPA 2HH9A 3PFNA 2M26A 3FXAA 2ILTA 3H1EA 5PAZA 1PP4A 2AUMA 3TN0C 1SFDA 4R9HA 4R9VA 3JQCA 1V37A 4GSUA 1J1XH 2OM6A 2CLOB 5AJXA 1G43A 4X66B 2Z35A 4Z5RB 2VJCA 3MUNA 2ZOTA 1E66A 3QRFM 2ERYA 3OAYK 2QR0A 3AG3B 2QT9A 2W93A 2OORA 3TVMC 3ZKXB 1OQXA 2IU3A 1YA4A 4RSGA 2C2YA 1VCNA 3PC7A 1V43A 3L49A 2ZZKA 2ZUQB 4G8GB 2QRNA 4QWWD 4A7QA 4PJGE 2WKQA 2I33A 1TFPA 2WG2A 1WA5A 2RK4A 3LX6A 5DEJA 1OD6A 3U3RA 2PMDA 3M07A 4QYOA 1ZOXA 4AH2A 4ZYKA 4LCIL 1WUZA 2EYTA 4TUKH 4X1YA 4PN3A 1C9MA 3QZUA 1BQ3A 2OBNA 5DVKA 4HQKA 2CUMA 5DQ9A 2OP0A 2JBAA 2I29A 1DVTA 4E5VA 1K7FB 5KYKA 1U9KA 3H9SE 3K2KA 3MV8A 4DKAA 1XPJA 4IMLB 4B7ZA 3SC2A 1HL8A 4M1OA 4JM2D 1ONPA 4BNHA 3KO8A 5HD8D 3EEBA 3RWFA 4PM4A 1ZGHA 4QHMA 1E61A 3NIFF 3C85A 1D1TA 2IBZX 2FJPA 4ZZIA 4CMIA 5F76A 4HFRA 3GHBH 1RYZA 4RD3A 4OV5B 1Z4PX 3NATA 4H4EA 3LI2A 3I9KA 1CD8A 3CSGA 2QJWA 4GOJA 5HYQB 4XCQA 4D44A 1DKQA 1OEZW 1BPVA 5TK2A 2KQNA 1QU3A 3KYDA 5DSTA 2ZQYA 3UEZA 4ZXFA 2D62A 1CFTB 3AEYA 3T9AA 1W36C 4YAOA 5BSEA 1LI7A 3ZTDC 1XKTA 1P4AA 3VUAA 3HZYA 2HX7A 5D7KE 1KVRA 2QVXX 1T9ZA 2IODA 4JZNA 2VDRB 4BU0A 4BBWA 5DJ0A 3MOBH 2QYOA 3TD2A 4N5DA 1YBAA 2H06A 1YUKA 1HQDA 5DI8A 3AP1A 3SBXA 2ZWVA 1EMTL 3VG9C 4JFZH 3CGGA 3HRZB 4KX3A 2ZYAA 1WK0A 4R54A 4DVRH 4LRSB 1WC7A 2ZJ4A 4FI6A 2WPDA 1BSIA 4X1OA 4BK5C 4YDJA 4IMPA 4ASUA 3V8RA 1H94A 1ET8A 2YJNA 3CLRC 2NSYA 4NK5A 4FGWA 5DMGC 3NIGE 3HHEA 1NUDA 2XT1B 4MCIA 2R0LL 3RVVD 1TZHA 3HCCA 3ZHXA 1T4GA 4LNRA 4BCZA 2B39A 1M7UA 1Y8RA 4O08A 3VFMB 4I5BB 1E4WH 4GZLA 5IBTL 2C5HA 5I1JL 4ZMOA 4XMZA 4X80L 3TRKA 1PZ5B 1WCYA 4ZD3L 2QSQA 4FHJA 3U5TA 2GYUA 5BP7A 3K71A 4WJ5A 1DDGA 3X1GA 5EU4A 2REXB 4LPXA 2QAGB 4GKZB 3R8XA 5IEHA 1QX1A 3Q87B 4CL3A 1YJBA 4TKZA 2R9VA 2CW5A 1W85A 1TJ3A 4M48H 4GOKA 3B9QA 2HJKB 5ARBA 4KQMA 2YFNA 4EKGA 2Q5OA 3VWJC 4RNCA 4WERA 1AGFA 3NTVA 4CKXA 4JT4A 1PJWA 1II8A 4L02A 1ZSDA 3M45A 3SIPA 1U8HB 1V2HE 3W0WD 2VR6A 2VIIA 1ZLXA 3RIFF 3AY6A 2O2DA 1ADFA 5ULLA 1VRVA 2RBKA 5F88A 2V0AA 4B9KC 2PVPA 1CB0A 1EKXA 1J2RA 5H4ZA 3ASVA 4D9IA 1OF2B 2CGEA 5KPJA 2PSFA 4DIOA 1XIWB 3DS8A 1T5IA 3OLIA 3UBFA 4NKIH 5IKEA 3X1WA 1C14A 3SVLA 3T04D 1VBKA 4U0RC 3RFTA 2AK4E 2NXYD 1EHYA 1U2ZA 5FFOA 3SO3C 1AD9B 2EEAA 3NN8B 4J5VA 4YMHA 3MHPA 1SYVB 3FCEA 3HJAA 3V7NA 3HYLA 4EY6A 4ZEXA 2GBLC 4BNZA 3TJHD 2B2XH 3MYZA 1IVNA 2Y4OA 2F1EA 1JF1A 4CEJB 1N0XH 2VP4A 3VXQB 1ZMYA 1T1ZB 2VC2B 5D5MB 1GZSA 2AVDA 1MEXL 4CIYA 3QVGB 5JALA 3IDJB 3KLLA 3MCTA 6PFKA 5FHAL 4ZC1A 5AT1A 3Q7JA 1SVUA 4OVKA 3F1LA 3JV6B 3GSXA 3GBSA 2BH0A 3IIKA 4I77H 4G59C 3AH8A 4UTBA 4KVPA 4HXAL 1QYGH 1IJKA 1CGVA 1WPXA 4XDZA 4A66A 1TTQB 1WSAA 5K59F 3NTLA 1T0NB 2VF8A 5TFSL 2JFBA 2CLRB 2IYSA 2DD8H 4J3SA 5GZOA 1QNFA 4OGXH 1UDRA 2AC7A 5IEKB 1QG0A 3CIQA 4W9RA 4EGSA 4N25A 4EQ6B 4N6OA 4U1MB 4D56A 1EDYA 4NAQA 5DHVH 3M88A 1Z5YD 3DYBA 4ND1A 2GRJA 3X11B 1H2HA 4XJSA 5E2AA 5JBNA 2H1SA 3BX1A 1MW0A 2WVJA 4TTRA 1NN0A 1XSOA 3IXMA 1BAGA 3MTBA 2N7BA 2H4WA 4Y4KA 2WMPB 4U6QA 5C34B 2O8CA 4YIHA 4JFSA 3W34A 3FOLB 2RAUA 1BJ8A 1OTUD 1XNHA 3RQIA 2E4VA 2NY1D 4V0NA 4Q9HA 4GP9A 3UJJH 4E51A 5E03A 2H1HA 4CLEA 5ENVA 1OH7A 4GWGA 5FX3A 1OP3H 4R2WA 3RWCB 3PFQA 1M6VA 3FRUA 2G83A 3TH3T 4GMSL 1KARA 2SBTA 1WFUA 3UHOA 2NO1A 4ZSOE 1MQSA 4LXIA 5AW4A 3SPHA 1S1CA 3PWTA 4YJ3F 1JIQA 5I15L 1RQRA 4JKPL 1QNIA 3ODPA 5ESVA 1RI2A 3TLEA 2I9KA 4YVNA 3VGFA 3BRGC 1TT5B 4YC7A 2BNRA 4CF6A 5NLLA 3AL2A 1ZKMA 1LO0L 5EPUA 2OTCA 5J6SA 1F20A 1NLDH 3TDNA 4DNOA 4I4TA 3IP7A 2P8LA 3GRKA 3V8VA 1FW6A 3IGFA 3HMWH 3BHBA 2VN6A 4PJXF 2OV2A 3NRJA 4OM0L 4BLPA 1X5HA 3IEKA 1PLKA 3FJYA 1UCBH 3S4SB 2EDRA 5DWVA 3EAGA 1YPZE 3O2DH 3NORA 1RYYA 4K8RD 2WWIA 2EDHA 3HV2A 5DJCA 3OB8A 2XUFA 5D5PA 2BMFA 3QIWB 4FQXD 4AP6A 2ZUTA 1A9PA 1HZZA 4GSYA 1E28B 3KLMX 1A3ZA 1G8FA 1ZN8A 3U3DA 1J0ZA 2EFHB 4GLRI 4IRSA 4MEJA 4H6VA 2JKYA 2R8RA 1SB8A 2RB8A 4KLRA 2WKOF 4OQNA 2UVEA 4S2UA 4RSMA 1G0YR 3F6EX 4X8MA 3BIAX 4UHDA 2PBFA 2AFRA 3V6ZB 4QM7A 5ESAB 4IBTA 3ZPDA 1M7GA 2FUCA 3GCDA 1BGVA 4KYIB 4BECA 1B74A 3OF2A 5CLGA 1XP8A 3BK7A 4MMXB 3KXFD 2ZP0T 3UAEA 3E03A 3H9ZA 4C0JA 4DV1B 4H0NA 4P04A 3E1ZA 3VTKA 4PLVA 1LBTA 3C3JA 3VSDA 3SC2B 2EJ1A 4PG4A 2G40A 4RULA 4FLHA 4INZA 3AO0B 4JM0A 4L6IA 2YA2A 1SXBA 4D9LH 3ARBC 4LEOA 4G9FB 5KWEA 2AI2A 2JFQA 3T4UA 1GLVA 3W1ZA 2X86A 3G0OA 1K7XB 3CVBA 1GZ7A 4L8LA 3MNFA 2VJAA 4XFKA 3RVUD 1Q6YA 2V6MA 2NNAB 4NNYB 4KNWA 5E6SB 5C9JA 2DETA 5KS2A 3MUGB 2VE6B 5FFLA 4Y8DC 3BL5A 3QK0A 1UM4L 4HETA 2OJZH 2WIMA 4K2AA 1NFDB 1OSZA 4TL8A 5K3AA 4K15A 4ONGL 5E08H 2ORIA 2ZXEA 1MFBH 4AQ1B 3W2DH 4XQGA 4RCVA 2O2XA 3PWVB 4WY7H 4QRFA 2RR3A 3PWPB 1XDZA 3LQQA 4PTYA 1NFKA 4AC2A 3TNYA 1XJ0A 4MUAA 2EIJB 4IJ3B 3UO1H 1AZSC 4F5WA 2MCMA 4P9MH 3NTCL 4CW1A 1G4UR 5E95A 1FY2A 3WYRA 1X4ZA 3MCG1 3T0ED 1YQDA 4MWZA 1DQSA 4MD4B 1G7HA 4DPKA 2XWTA 4KR7A 5BRZE 3MJEA 2KLBA 4Z7NB 4DXDA 2Q27A 1CT9A 4F1KA 4LSRL 1Q2XA 4BN4A 1GRCA 1WFOA 4I13B 1N5JA 2AKAB 1OQAA 2D3NA 1MB0A 4BQ8A 2H9YA 2WJGA 4P83A 4AJLA 4Q9IA 3CFUA 4I9WD 3TZVB 4TUKL 4M5YH 4I7ZC 1GGJA 5JXEC 1RPZA 1B4TA 2JFCA 1R3KA 3HAEG 3N28A 4WADA 5C0BE 1NTDA 1PV4A 3L7IA 4ICWA 1F13A 5KSWB 3HMXL 3OFJA 2IKQA 5EY5B 4IEFA 1MHPH 1DBKH 3RSZA 2H0JA 2NU7A 1W75A 4JREC 1K1EA 3EQ2A 1W0JA 2JWGA 2HFGH 1MHTA 1II8B 3IQIX 1TO2E 2PEZA 5AIAA 2FHCA 1PX2A 2DDQH 3U7QB 1KTKE 4W9ZA 2WNXA 4CC0A 1PLBA 3F7KA 3F67A 2F19H 2YQ2A 2HDHA 2MQ3A 4H1TA 3MOBL 3AM5A 4LF3A 3C7AA 3IHKA 3QEHA 2A9OA 5KUTA 3K0FA 3NHFA 2R1ZA 1PEAA 2PV7A 3LEVL 3RARA 5FUZH 3FQ4A 3VXUD 4B3DA 2YZ1A 5AVYB 3LCJA 1CDHA 1DANU 4GLOA 5E2WL 3FQNA 4MAFA 3AT9A 1P8JA 2JDID 1QH9A 1F58H 4OHBA 2NPLX 4GYYA 2WQ8A 1A0QH 2V03A 4NDNE 4QEZA 4WI0B 5HIIA 5D6NA 3C9NA 1MX5A 3L84A 4KBGA 1GC1L 2XUOA 1H8OA 3ARDA 2FPSA 3JVGC 1H22A 4LYJA 1SUSA 4GQBA 1G6Q1 5D7JC 2J5WA 4RNRA 1OLLA 2IOHA 2FUQA 2A92A 1L9RA 3UDWA 4LCVA 2HSDA 1M54A 4WHYH 4BQCA 3ZVLA 5T67A 4G8JA 4RQBA 2A9QA 2L3BA 4RGMB 3K09A 3IGUA 4BFXA 4HCIA 2NW3B 5DD0L 3EVFA 4C1NA 5K6AC 3QIBC 1I36A 1U1FA 3C08L 5IJKA 2KT6A 4I50A 3M5CA 4KI5E 1HL3A 1ZGCA 1G5TA 1ZSDB 3DHNA 3S37X 3UXMA 3EYWA 3ROKA 1M33A 1DQQB 3CHOA 3MJSA 5IM4A 2XBZA 1WZAA 1FZKB 1VPWA 1EAQA 3Q3GA 2OKCA 2DFDA 1JGVL 3MV9B 2IYEA 4U1SB 2VZ1A 2XITA 2E3JA 4EI9A 4ZZKA 2C2XA 3LYAA 4HAWA 3WJMB 2CJFA 1YB7A 3BSGA 4FQ1L 4HKJA 4MJXA 1BXXA 2JF1A 2EJUA 4JFFB 4G5YA 3L2NA 4E2XA 4LP5A 1DXHA 3LIZH 5E1AB 2RCSL 2CM6A 1JILA 1B8OA 4HRVA 4AMZA 5I1KH 4NBNA 4AGOA 3PGLA 3NALA 5AVUA 4GG6E 2P8SA 4W5QA 3VXOB 2WKOA 5J4YA 3BZ5A 3L7BA 2RK6A 1QANA 1JFFB 5DHPA 1MJNA 1EK3A 2R83A 3SSOA 2FTKE 1A7AA 1PT8A 3HWRA 4G8IB 4BLTA 1TUIA 3UDWC 1T0PA 3QIAA 3CXHK 2JF0A 5B3LA 3O4LA 2JJQA 4X7PA 4AFNA 5CEEA 4RDHA 4FULA 1JMVA 4GE3A 4HRYA 2G5TA 4KDCA 5JQHC 3UBHA 1N2CA 5K6AA 4TTIA 5M34A 3G04A 1Q95A 1BVYF 5ISZD 3AABA 1NCUA 1XR8B 3MBWB 2EX4A 2ODAA 4L6CA 4JMXA 4CJXA 2HT3C 3MFQA 5JR1L 5DEOA 1WWCA 2M2IA 2YD5A 5KREA 3LKNA 4GKKB 3PAVA 4L4TA 4RE6A 2XN2A 2RQEA 5ARCA 3R18A 4FXKC 4IDGA 1PYWA 1NONA 1FAIH 2ZUQC 2J9YB 3BPLC 1AZUA 3TE7A 2WT4A 4PRDB 3UAVA 5AQ0A 4ZGGA 3AR6A 3JQ9A 5GSRA 5EUMA 2QD1A 4UU1A 3UPUA 1SKYB 1D6EA 2NZ9C 3FAXA 3POCA 3OZLA 5AI9A 3E3NA 1W72L 3BGMB 1A1NB 1PL3A 4X6DB 3HY6A 4MQ7B 4PLKD 4TSAH 1NCCL 2GZMA 1W4ZA 2AN5A 3ILYA 3L9RA 3VFDA 2BTEA 3OZGA 1YJQA 4A2FA 3UC9A 3BIFA 2HVBA 3T8XB 2AFIB 5JIDA 1YB6A 1Y18B 4GIOA 5F9JA 3CXRA 1S89A 3AQXA 2WYTA 2WSSD 3QPWA 4WU7B 3KCQA 3H65A 2OVBA 5H0IA 4GD3Q 3NBXX 5FUWA 4DS3A 1BRMA 3SD2A 4U6XA 2F17A 2LOEA 3TO4B 3PFHA 3GFOA 4S1RH 3R24A 2WWTA 4IIQA 1UZMA 5DD6B 2FO4A 2VJXA 5GPRA 5BV7A 1B6GA 1NXQA 2QN1A 3I2CL 3FO9B 4RMWA 4DV0B 3VH8G 1E4WL 4B33A 3QA3B 2H1FA 4Y2RA 3K1YA 1QZ1A 1HEIA 4XAKE 5T7BA 3JQ9C 1XXLA 4X3OA 4XVQA 3ZE6A 4HYYA 4FTVA 4R7DB 3N2ZB 5IROD 1LBIA 2FP3A 2RQ8A 1JSXA 1RIUL 1U8ZA 3Q0TA 3UMNA 2PQ6A 3PQ2A 1KK2A 4Z9YA 5LU8A 2EZ0C 1X8LA 1VB3A 1E8XA 4R1PA 2FFBA 4O58L 3QQ3B 1MAAA 3GIVA 4PRKA 4JZYA 1PW7A 3QWNA 4XTRD 3GSNB 3OD1A 3HM9A 4ENWA 4HC1H 1DO2A 3AETA 3WGUA 3X17A 3UXHA 3FZQA 4YSPA 3T4YB 3QR0A 3A2LA 4D5EA 1JHVA 4FG4A 1EINA 2JKLA 2ZULA 1HMPA 3GEHA 2JI8A 4QARA 2OL3A 1AHHA 1QZ3A 1JYSA 1UM8A 2H2AA 2AE1A 1S7QB 1VMDA 5I9QC 3ZDBA 2Z3VA 4G8GE 3NWOA 5IHXA 1I3OA 2CLFB 1L0XA 3FPEA 4BTVA 3EUWA 4EL5A 3OX3A 5J23A 1B26A 5HMMA 4AY4A 3TIEB 2CUKA 4J7AA 5D3KA 4L85A 5GGSB 4YP0A 5LYYA 5GSVB 4KJZA 3IP1A 4Y18A 1HLGA 1BX0A 2FEXA 5DHVB 3T3HA 4NU5A 5T1DH 5JNLA 1JGEA 2BNRD 4LBEB 5FHBH 4KTTE 4TMVA 5IAJA 3LNTA 1LNZA 4C22A 4LHVA 4YOKA 2WBJA 5EVJA 2XX3A 2OP1A 4IVQA 4AV0A 4HUJA 5KBPA 2IH2A 2NVUA 1DVSA 2HTLC 1NJ2A 2J88H 3IQDB 1P81A 2DBLL 1JHTA 2Y7LA 4LFAB 4G43A 1XXHE 2K6GA 3KP1A 3UT5A 4QAQA 2QM0A 4V0LA 4UMVA 1FL9A 5TT0A 2OZLB 4RJ2A 4O9HH 3V4VB 2RKBA 4Z1MA 5GJBA 4QJBA 3QVGA 3CMMA 4TQHA 5LBGA 4XNMB 1X1RA 1Z0JA 3ZSTA 3FDIA 5BSMA 3TSOA 4TLTA 4ZAXA 4YT4A 4BQSA 3NVMB 3DBHA 3MROB 4EDXB 4OM7A 3ZOZA 2QGDA 3T1QA 1QO9A 4D9QD 4ESOA 4AVYA 4BO0A 4OCZA 1XF9A 4MH0R 3DR3A 3K6IA 1LFDB 4PS8A 4IIZA 1J8DA 4XWYA 3KBBA 3IGLA 2PRZA 5JCPA 3AREA 3KVQA 4EYEA 5E8EB 4QQRA 2WTOA 5DZVA 3DVGA 1YU9A 1JPNA 5DLQC 4MZRA 3N44F 2X8JB 2DQUL 1M74A 2XWBF 3Q3IA 2O0JA 2PPAA 3VRHA 4JBHA 4RZCA 2WBJC 4AMGA 4JPIB 4KNYA 3BH4A 1A1MB 5AYQA 3RI5K 3P0HA 1G8JA 5E56A 2J57A 1PLJA 3CVHB 4AI6A 2VAMA 4XO3A 1A3RH 4RA6A 3EZFA 4GPZA 1ZCBA 3GRBA 2PO6D 3TU6A 2J5QA 2AEWA 2P5EA 3MCKB 5DBHX 3U2QA 4YE4L 2MCFA 1EVUA 2I6FA 5HOEA 5JAOA 2UX6A 3UPDA 3WKYA 3PP3K 3OC8A 3NX4A 1NBZB 1QOKA 4IV0A 1USQA 3DV4B 5AWNH 3QJYA 4W1SA 5TJ9A 1A88A 5DZSA 3TGLA 2YZNA 1P2FA 1PG7X 5B2FA 1NGSA 3RTQA 3BT2L 3D0LB 2CXOA 4YJGA 4HD8A 3GLKA 3HJHA 1S2GA 3P4XA 1V5EA 3D69B 1RMTA 2YPVA 1SZCA 5HZKA 4Q1BA 4U31A 3KZMA 4ARCA 1W5BA 5JXAH 3HS8A 3NJHA 3N2EA 2Q20A 4KKRA 1LI5A 3BIWA 3KPWA 3A4FA 5GRWA 2OV8A 1GMEA 1KCRL 1TLTA 2A33A 2XMGA 1NC2B 5FCSH 3SBPA 3NG5A 4N0RA 1IUNA 5LMNB 5DR5H 4KMOA 1DXQA 3U4BL 1ZANL 1CK4A 1GOHA 4MV8A 2EDYA 4XN7A 4BVAA 1Y7VA 3AT1A 5CB6A 1HHJB 5F7ZA 3RWEA 3CFDB 3MNMA 3HC0A 5KZCB 2J45A 3OR7B 3GLTA 4YRTA 3GZKA 1RURH 4PJBE 2JL1A 2DLIA 4CMHC 1TZJA 4OFIA 1X5LA 3PCRB 3KM1A 1RQ2A 2X9GA 1HEZB 1A8SA 3TBTB 3UZVB 5H82A 4HIQA 5CB4B 2EE9A 3BA1A 3WFHA 4CILA 1USWA 1RZ8A 3R1GL 4DLVA 3CE6A 1VFNA 4MA7H 5F3HA 2C8JA 3JRWA 4AMVA 5EZPA 1PJLA 3HO6A 4ZPXA 2IFFL 2B0JA 5FQOA 5BNIA 1AUOA 4QYXA 4IDJL 3VVVA 3T9DA 1NCOA 3D8NA 1JSCA 3DSRA 3NA9L 1Q0EA 5BNZA 4G4JA 4ARVA 4WKCA 3DX3A 3C45A 3LCRA 4P93A 2VQDA 4JZJA 4LDLB 3BZWA 3FGOA 2WWGA 3LLMA 2JGMA 4UPEA 4IJKA 4XP1H 1RK0A 3G8CA 3ZWKA 1PIFA 4Q3KA 4BKLA 4C20A 4ZAKB 3QXSA 4DN4L 3O4RA 4QYSA 2ICES 1PFGA 4S1WA 2H6OA 4D8UA 4QYIB 1EH5A 3SYCA 2AOWA 4YFLF 4HAUA 4BFLA 4QKTA 2ZUFA 2V9RA 3FUFA 4QL3A 1A7OH 5C0OE 3HNSL 5F89B 4CBZA 1BU5A 1QFUL 1RBQA 3AG6A 5FPTA 1SXGA 5TGBB 3FQUB 1XGZA 3U48A 3PKIA 4UTXA 2XYHA 4Z4CA 1OH6A 3BRFA 2FY8A 3IDUA 2YUTA 1RRGA 1GSIA 3T77B 4U6SA 4P2RE 1JRHI 4X97A 4RESB 3WRXC 3S2FA 3RC2A 2ZE8A 3TPCA 5LFAA 1DJYA 4UQEA 2AJSL 4A0QA 3GH3A 3QYJA 3FHQA 2JGJA 3TT1L 3LOQA 1YKGA 1ECLA 3UTSE 3TIDA 3GFRA 4QRBA 2W11A 5A16B 2YW9A 5F7JA 3OVMA 2PKXA 3OLDA 3BZ4A 1EXUA 1P9MA 2FWBA 1IM8A 4FLQA 4QFMA 1LLDA 3T2LA 3JZMA 5CA1F 2GTZB 1YTLA 1DIRA 4NZJA 3VFNB 3FTDA 3TWCH 4OKIA 1QRTA 5LLSA 2I80A 4BSVB 3LT4A 1TA0A 3WBKA 2HWZL 3FTWA 2H08A 5BOVA 3VB9A 4EZKA 1U3TA 5HD8C 3CRZA 4UDOA 5H1YA 1SKBA 1T43A 1KTLB 2NR6C 3VXMA 1U8MB 3R1GH 1OLZA 5KNCA 4U1NA 2MCPL 1OCWL 1XGRB 2LQRA 1L2TA 2P8MB 3HCVA 3QQ4B 4KIJA 3BUYB 4ELMF 3ZHCA 1DQJA 2Q6KA 4DEYA 1CQKA 2YEQA 2EIXA 4L7VA 4UTZA 5HF6A 1XDWA 5HGAB 3GAZA 1G60A 4Q4CA 2COKA 1IBBA 4W8GA 3AFGA 3VGGA 2CCKA 1ETZA 1TYBE 2X4RA 3KQTA 2DHEA 3OESA 3H1AA 2O8VA 4EN3D 4H7KA 5AVVA 3RAJH 3K1JA 4RFSA 4Y16B 4L5IA 3DDZX 3U7QA 4KHTL 3IAUA 4N20A 2G5BB 5ICCA 1E96A 3FCTA 1KP2A 2D06A 2ZKMX 4QCIB 1KXQA 2VZLA 1ZGGA 3QYPA 1J6UA 3VDBA 3IDGB 4JT2A 2PQ2A 1YMMA 3NEXA 4RTOA 5TE6H 1WCBA 4EGAA 3SDYL 1LBEA 3EZXA 2DTDA 2CDNA 4FFTA 3ZX4A 2BS8A 5I9QB 2BFFB 5KX5B 4XMVA 3ZKND 4F6RA 2JJVA 2O2YA 4JUFA 4CI0B 1AMOA 4DN3L 8FABB 3SZLA 3L8HA 4DB2A 5KAQG 1AI1L 1CXHA 3JSAA 2GYVA 4AG5A 5HGDA 1MTOA 2J55A 4LRWA 4ETYA 4UE2A 3OAAA 4LGSB 5T3ZD 2FHPA 2WWFA 2Q2VA 4N2GA 1NBVH 3TM4A 4DSAA 1QO3A 4M1GL 2OPCA 3AK4A 1FVCA 2EDOA 3G0GA 3JQ6A 4QPCA 1T89A 1B6UA 1F2XK 5C0RH 2I24N 4OZFH 3Q6GL 2ET6A 1A1NA 4XDHA 4APXA 4LXTA 3A67L 1DRKA 1D5CA 3HO1A 3BKML 4EY5A 4O8CA 4J3OC 3H13A 2ZSKA 3KUUA 2BEVA 3OAAD 1YR3A 5HVHB 4MR9B 1V9SA 4JANB 3WKDA 3BL8A 1NGQH 5EA0H 1NQ5A 1TA9A 3TPUB 3UJAA 5M94B 2AWOA 4DR4B 1AH1A 2BE7A 1BZOA 4LISA 3B9PA 1QACA 2OTWA 3QFDA 3E1KA 4XJVA 7PCYA 3MXWH 4A2HA 4BRVA 4WY5A 4CN4A 3RIHA 5LLTA 3RADC 2EGUA 4PRPB 2TS1A 4RH3A 2WLLB 1OXTA 5LBSL 3SY0B 3OIFA 1X2BA 3LS5H 4OGAD 2XNDA 2JZCA 2I2XB 4PRAB 3APNA 5DUJA 3RJ5A 3IUEA 5BQFA 5EZOH 1DG1G 1YU6A 5MFZA 2QVTA 1YECL 3QEQD 1YJXA 1OZUA 1U42A 2PT5A 3VDMA 4CN9A 4DCUA 2NTNA 1GSMA 2W65A 7FABH 1KA9H 1JPUA 2WKGA 1KNOB 4TLEA 1GPJA 5JVDB 4AGPA 5KNDH 2O3QA 3OECA 1KCUH 3KD4A 4Y19A 1EYZA 4LI0A 4UT9H 1PYWB 2BVEA 4LCWB 4M62H 2I5PO 3UL4A 1JQ5A 2R97A 1KJ8A 3TAHA 4HTAA 2E7ZA 5EU6E 3DX9B 3PNYA 3P4MA 2UXCB 3P0YL 1LNUB 4M29A 2HU5A 3F7VA 2Q1EA 3G5TA 3TZBA 4HG4K 4NHUA 3GIVB 4LFBB 2W9DL 4PJBA 5CNMA 3D5EA 3SY6A 2GGSA 3WK6A 1TJHH 4FQIL 3KPOA 4BWYA 4WDIB 4GXVL 2WJAA 3F5SA 3NIDE 3BE1L 1XD8A 4CVXA 4TYUA 2F7RA 4S1OA 4E1BA 2WSPA 1E4JA 1DOHA 1N8KA 1KS2A 4AGLA 1UQSA 3FBKA 1H4VB 2PHZA 5KTOA 1AZBA 2HT4D 2O2CA 4F33B 4F6LA 2FQYA 5JOPE 5CJ2A 4TNWF 1ICIA 1Q94A 4DNPA 4D92A 3ZXXA 3VRIA 1KRXA 3VI3F 1Q7TA 2WF8A 2GM3A 3DCIA 3RSHA 3QJ5A 3FMGA 4PB9L 1PWZA 1FTSA 2GEDA 5DHYB 2CZQA 2JJTC 1MX1A 1E1YA 4DMFA 3N8GA 3LIUA 3QUXC 5J6GA 2DEWX 1ENOA 4BH7A 2ICEA 2R25B 3V0EA 1RWMA 1PSWA 2XXAB 2FEDD 1KJ9A 4BRUA 1A4CA 2K8QA 1T2XA 3NOXA 3VXSD 2R1XB 4PR3A 3GLFB 1O5OA 1UCTA 4V2BA 3RZCA 1OSEA 2RCNA 1LSUA 4N6GA 5H94A 3FFCB 4AJ0A 10MHA 1MAJA 1T1JA 1NX9A 3CISA 3PSHA 1EFRA 4K46A 3QOFA 1KDPA 1QGUB 1B6TA 1E5VA 3VVBA 1WZEA 2OM2A 1LQTA 1TEYA 4EN3B 2PPCA 3TVMB 4FZ8L 2W00A 4PQRA 4WFJA 3S3PA 1GXSA 3L05A 1EWVA 3UABA 2AC0A 1Z6PA 1WV7T 3MRBB 1NMXA 3EVAA 1OP9A 4P3DA 4G6ML 3PQFA 3SEAA 4Q4HA 2AZXA 1L5HA 2MIIA 2BLLA 2JFNA 1SJXA 1SRDA 1T2QL 4YAQA 3VR3A 4RGVA 1W6WA 2HJRA 4MRMB 2P9FA 3HG1D 4UHBA 4W5OA 2F3UA 3T5PA 4TUYA 4XOEA 4BZ2H 1K9TA 1LDPL 3BN9D 4DUYB 5AB1A 2VUHB 1P2VA 1ZGLA 1RS0A 4B6EA 1AE6L 4DVBB 4UB0H 1Q16A 3M6FA 5JAUA 1XQYA 4LI3X 2RG7A 1FFOA 1EWRA 2P80D 3Q3VA 4YUVA 1AJ7H 1HYEA 5LG6A 4UU0A 4P7KA 2ZOUA 1MHCB 1JSLA 1UBJS 1M3SA 1USVA 4IIEA 4M9ZA 3AINA 3G1UA 2P2GA 2B5IC 2IMNA 3GUTA 4P5KA 3EGWA 3DYOA 2F1OA 1DP4A 2W48A 1G38A 4CM4B 1AMUA 5A9SA 6PCYA 2AL7A 3VOBA 4X2UA 3VFTB 5CMLA 2RB4A 2IIBA 5I7FA 3RC8A 5MEQB 4EZLA 5JQ6L 5K9QI 2P35A 1IULA 2WNIA 1YEIL 3OQIB 1HS6A 4PJCB 1LLAA 3LV3B 3MRNB 5JU6A 5J1AA 1U7UA 3KMDA 3HLKA 5BQ5A 2RSLA 1S4MA 4M1GH 1A22B 2YPKA 2YZ2A 3ESBA 4LE0A 5LGHL 2NY4D 4QQ8A 3JSSA 2QLLA 1VHPA 2OGUA 3EGSA 3DO7B 4OIFA 3E70C 2P4EA 4D80A 4PJFB 4KLAA 1FDVA 4HUUA 4F8EA 2DQZA 3DLCA 4DC9A 3PU7A 4MAYC 1V3TA 1JYFA 2H2SC 3DHMA 3CJJA 3HM2A 3NZ8B 4Z53A 1MCHA 4FI8A 4I1VA 4HPOH 2Y27A 1JNYA 1N5DA 4TQUS 4WIQA 3HC3L 2XEDA 5IBCA 5IW6B 4YIQB 4G85A 4M98A 3CZEA 3RGVD 3MRGB 1SMAA 1ZV2A 5GS0L 4HO1X 4LNUB 4WGWB 2B2CA 3QUML 1JZ3A 1JYVA 1VFOA 1QBAA 4G3XA 2C1PA 1TYRA 4TYYA 1KBGH 3AVOA 4XC1H 1ZNZA 5CT5A 5BVHB 3VSAA 2H0EA 1JNHB 1DP0A 4LTMA 3EZLA 2FZ4A 3IXQA 2IAMB 4RCYA 2EJWA 3KOMA 4XWGH 4HLEA 2Z93A 1UENA 4UQ3B 3O81A 3G2PA 4W4NA 4JGUA 1A6WH 3IFOA 3PDIA 2YSSB 4XWOA 3K0AA 3HFML 2LT9A 2X3CA 4GRMA 2MTBA 3A6FA 4G1BA 1C0IA 1MCEA 1QTQA 3LY9A 2WMNB 4Z6KA 5HOQA 2B25A 3JD4A 1AKNA 3TIGA 3BSSA 2PXXA 4HNAA 1G8KA 3TBYA 2ZG2A 1YRBA 1G9NL 4R2GC 2ACEA 4I4CA 4HNUA 3JAKA 2BI8A 2WU1A 1SGKA 4WKBA 4XPAL 5EE3A 5AW9A 5J6HA 5KVQA 4DW8A 4B9PA 4IKLA 4IO1A 4P5MB 4ZVUA 5KW9H 1HT0A 1EDBA 1P7QD 3HKDB 2E1PA 4R16A 3VHLB 4N85A 5C2UB 3IYLW 4MV3A 3GHEL 1HIML 1P7WA 2NACA 1BOOA 3I74A 3KB2A 4IDDA 5I3CA 2VVTA 2PWBA 3CNOA 1FDWA 1KEKA 3I9PA 43C9A 1ZXKA 1O7DC 2YYSA 3ILDA 3ARFB 4AO7A 1UPFA 2Z08A 3EYVB 2IC5A 2EIBA 4NKIL 1WUYA 1Y3HA 2Q3ZA 4TVPH 1KB5H 4XVSH 1ZITA 2REQB 3C98A 3VXRB 1ZK2A 5LNK6 4IRJD 1CUCA 4BO6A 4Y8AA 2YBRA 2N75A 3CLTD 5C5DA 2EUZA 5IROA 3W39B 2IWKA 1GARA 2R8ZA 4PB0H 4YRPA 2AF2A 4MYPA 5AO9A 4YPOA 3A6CH 2CZCA 1JZDC 3NOVA 1W46A 3AFIA 5T3ZE 1OAKL 5EZIL 1BCSA 25C8L 2P9TA 4NNPL 5I0ZA 2Y7SA 3BAJA 1E3IA 4NMHA 3IXTA 3A6JA 1ZZGA 1RURL 1W6UA 1E79A 3TLRA 1Q1AA 3EJSA 2R1UA 2X15A 2FW9A 2NRDA 2Q1UA 1UBRS 3QWQB 3HE3A 3LX8A 4RMIA 1CUAA 4HWPA 2HSEA 3ABOB 4WI3A 2Y0SA 3M17B 1V8OA 1TEVA 3E9DA 1X6VA 4DW2L 3L6EA 1QF9A 1SVCP 4MP8A 3TTVA 1GAFH 4QPEA 2ZT6A 5AW6B 1UBUS 3EWSA 5D7IA 2JLBA 4ETWA 2QV2A 1DBAL 1YEHH 1OFUX 1ENPA 3EIEA 2ZW9A 1ODAA 3E9RA 1HJBC 2XDQB 3TOSA 2PCJA 5LQKA 5THXA 4U1LA 1ILEA 3I0ZA 1YQUA 4KLCA 2NYUA 4KN5A 1RYDA 3SQWA 1L6XA 3ZVKA 1P7QB 5H9WA 1LKZA 3GUHA 1KFAH 3C6XA 3G7SA 3PC3A 4B9IA 3WMQA 5IWAB 4F3CA 4GBED 1PHPA 3GJFB 1GPWB 1F3RB 3FHOA 2LP4Y 1J87A 3TC9A 4HRAA 4MS4B 4CG2A 4QHKI 4YE4H 1ZLUK 4V39A 4O2RA 4JXZA 4DIDA 1HWHB 1RRFA 4FMDF 1WVZA 3MV7E 4F2MB 3FU7A 3L5WA 2LRHA 5KOHB 3L1FA 2V3CC 3JQBA 4EJFA 3S28A 4GSXA 3SDCB 3W38A 4MMXA 3O3CA 3WDHA 1CGWA 3T1NA 2FLBT 5A9TA 2RGWA 4F45A 4JN2B 4AW4A 5L7XL 4HGQA 5KYNA 4R6UA 5EO1B 2FW0A 2C1PB 4PN7A 1IN4A 3EDOA 3L0IB 1N25A 4MKGA 5EL0A 2B9AA 3TFKC 1FSGA 1L7PA 2DPHA 3JTEA 3CD4A 2VRQA 3L41A 4ISVB 4QHYA 1OXVA 1UD6A 2XQGA 4NCBA 3RY4A 3LMJH 3KE8A 3ZBTA 2GKOA 4UEWA 3R7QA 1J06A 3K8YA 1C7FA 1SKAA 3O03A 5E5MA 4ND8A 3N1GC 4IS6A 3QJOA 4O5AA 2BZGA 2C4VA 2C3UA 3C3BA 3LK7A 3IK2A 3FFXA 1O0SA 3EDDA 4ZANA 1OHQA 1BS2A 4IFBA 3TCXB 3DUFA 3FVRA 3B1WA 5JEEA 3LZFH 1NQUA 4HWEH 3CHQA 1XX9C 2EIKB 4MDJA 3LS5L 2B1QA 1VACB 1KIAA 5E6RB 4ZAWA 4LJAA 2O5ZH 4HYEA 1Z9OA 5BJTB 2IH1A 4OK3A 3FFOA 4TL5A 2W94A 1YR7A 2R8YA 1EVLA 3HFJA 3VMMA 1K3UB 1TAQA 1M10A 3MVEA 1SHTX 3HI1A 4EZJA 4JBYA 3OTHA 4HX9A 4PHGA 5DSCA 3SJAA 3WL7A 5IJZA 2YZ8A 1M8JA 2W2VA 3QEGH 3L45A 4W9JC 3PSAA 1R3LB 3D3KA 3OF5A 4BIKA 1WZIA 5AM0A 1LV8A 2ZSAA 1QC5A 4FR2A 5ICZA 2MYNA 3QCTH 2BS71 2GCOA 3E4CA 3VFMA 3LWZA 1ZTXE 1TJGL 3N5KA 2ED8A 2X89A 4PQXA 3FRUB 3RTCA 5B6PA 2XV1A 4W1QA 3KZVA 2VDPH 5C7IO 2A3NA 1RJGA 2YWFA 4LVHC 4C0SA 1VEMA 4WGFA 4ZV4A 1NNSA 1M1UA 3C3AA 4N0QA 3EPLA 4QXOA 1F1GA 1T9DA 1YASA 2XVXA 5D1ZA 2SECE 4LPWA 5A6IA 3D0KA 4P38A 1NBEA 4F3RA 3B9KA 3UERA 3T0XA 2FDXA 5EESA 4RGOL 5D72L 1P1KA 3WB9A 3B20A 1KQNA 2NUPB 3ZUPA 4OQDA 3V2IA 3DX4A 4HWRA 4FG6D 3DO3A 1HG1A 4OFPA 2WVTA 5AZ2L 3V4VH 5T4HA 4FW8A 2XUAA 4LRNH 2XTJD 4TKVA 1UZNA 1S9XB 1I24A 4ABYA 2IQAA 1EZSA 1M8KA 1GXSB 3IT2A 3A9SA 2IYXA 1A1SA 3SEZA 2BBTA 5J1TB 5I75B 2D5AA 3EA4A 4C7OA 1O7DE 4JSTA 1ZEJA 2PTTA 3L79A 3A3YA 3NONA 3FFCE 2G9VA 4Z86A 4OLVH 5ILTL 1F4XL 4YRDA 4CM7A 1RWVA 7CGTA 2NZUG 5TF1H 2WXHA 1K88A 3MUOA 3EF4A 2O0LA 2NZVG 4BBZA 1O6ZA 3CV5A 3OQ1A 1CD0A 4EBBA 1OSZB 1BCRA 4PRPA 5AJZA 4M1ZA 1SBQA 5CAEA 4EH1A 2OMVA 2J1KA 1N3BA 3TDMA 2BOVA 4HZGA 1MT3A 4YJ3A 4D5GA 1LO0H 2QN6A 4RYLA 1QWHA 1D2RA 2BWQA 2VIRA 2WIBA 4ENPA 1K6XA 1EIZA 1LL1A 1HZHH 1Q0YL 5BV1A 5CEXB 2AGJL 4LBVA 4RPGA 1CUWA 1T5XA 3D9AL 3CPJB 4GW1B 2C96A 2GAIA 1OQOA 5CP7B 1W19A 3UGTA 2C8LA 5FYJE 5IMBA 4B45A 4RJIA 4AY2A 1OU4A 2GTQA 4IJUA 4RFNB 3BB3A 2D03L 2P41A 4QXGH 1C7QA 4M9OA 1U7TA 4J0IA 1TZGH 2ADGB 3ND8A 4YAWA 3B9AA 3DHVA 3BRDA 4QLWA 5EJAA 3U4GA 4FFYA 4N90E 5F64A 2FSIA 5FB3A 1WD8A 4KR3A 4XMKL 4Y2XA 1WFIA 1CXLA 1FJGB 3H9GA 4RADA 5K3FB 3ENEA 5JQ6H 3HYTA 3U30B 2EOAA 1YYMH 3ZUGA 4XX0B 3O8NA 4NO3A 3RFZA 1GGBH 4MCNA 1T4CA 2UVPA 1G4AE 1YONA 3A2KA 4IICA 2VNKA 2IOYA 3I45A 3HCRA 3JV4B 1OCRB 1T7ZA 5JECA 4HZIA 2CGRL 4IH4A 1BEZA 4IHJB 2WQVA 1LO4H 3LLUA 2J8HA 3IFPA 4ZAFA 4ECAA 5FYKH 4ZDHA 4IBOA 3GXTA 4B79A 2ICWB 5T1KB 3RIAK 1X13A 1T6VN 1COZA 3TIFA 3R6TA 2I1VB 2JLSA 5GADl 1NBAA 4UINL 4L3AA 3FTSA 4ZFGH 1VENA 2VJYA 2COQA 2E7MA 1OIVA 5HGGS 1P1RA 4L75A 4XN5A 9ATCA 3HDHA 1JI0A 4YK4B 3MRDB 5F8QC 2VQUA 1E2HA 4EQZA 1X4YA 3KWUA 3TM6A 1QD0A 3E2HB 3WY3A 2WQSA 4P4UA 4MQFB 4PJBB 5T5QA 3OV6A 5B30A 3KXFE 5HHOB 1UEJA 4FEEA 1UJNA 1E5YA 3QJQB 1GHTA 3ILVA 1SU7A 2H57A 2QQKL 3V4UH 3WDLA 3UROR 4PJ5B 1N10A 4GO8A 1QI3A 1KAHA 2BNRE 2HMVA 2QMUA 4QGTA 3LLVA 5CLZA 4N1AA 2C95A 1KGCE 3W9YA 1PKOA 2DWPA 1M9WA 1L5FA 3FYUA 4QRUA 1F90H 1H3UA 5GGVL 3BAKA 2Q1WA 4G8GD 2BGJA 3OZDA 4XNZC 4BKOA 2BCKB 3N85H 3BWVA 3WS6C 5JPMB 5FCDA 3I1FA 1XDGA 5DKFA 5BV7L 2N7AA 4IBQA 5F1OA 2IDJA 1B1CA 3V8QA 4P3DB 4BA0A 1DTWB 1UEYA 5LBIA 2NY3B 2QHLA 3WNPA 1U0LA 2VCEA 4NJAH 1H6TA 3BQUC 2X7XA 1CYWA 3UTZA 5JNSA 3H7LA 2VJMA 4HJSA 4UBKA 4K3HA 4EN3A 1ONNA 2Q4TA 2Q2OA 1IZYA 1RULH 4JHAH 5L95A 1ERNA 2BFNA 3OKFA 3C24A 4U7GA 4HDAA 4CL0A 5HY9A 4O4HF 4KXCA 4K23L 1O6VA 2VR5A 1M7XA 2BV3A 5CJPA 2D7CA 2DKUA 2QGZA 1HZJA 3RVXD 4P23A 3JV6A 3P3RA 3ANSA 3FZEA 4POOA 2DAPA 5JYBA 3ETTA 5BYKA 4M4PA 4Y3UA 2W2PA 5C0GB 2Q6TA 3T3MB 5I28A 1JGDA 2V2TB 1W88A 3IDZA 3A31A 2H2SD 1CE6A 3CVHL 4HQRA 4IY1A 1XZAA 3WMPA 2VRCD 2XLBA 2BUBA 3HVHA 1KEWA 4CF7A 2DLTA 2MOVA 2ZE0A 4JY5H 1WDAA 2GCYA 3S2YA 1W8EA 2AQQA 2VWHA 1ROCA 1UIMA 3NHMA 1UXLA 2CL0X 1KJ2A 2G3XA 3UPTA 1WZCA 3JD0A 3EHBD 2P0EA 3J81A 1F0PA 1MGPA 3FPXA 3UOAB 2QRHA 3QH3B 1M34A 3DPIA 3FCOA 5E7QA 1YEKL 1IJ9A 1RPKA 4BAUA 5FBKA 4X95A 3RY6A 3WAKA 1E9OB 3V8OA 2HPTA 1PK9A 1KR5A 3OGCA 2YWDA 2EKLA 2HVKB 2Q5CA 3DGCR 4A2MA 4MQFA 1ZIPA 1GPUA 3WP1B 4KU4A 2DTML 4CLOA 2X2YA 4Y9FA 3UO1L 5TDNB 5DTFB 5FYJU 3ZZMA 3DGEC 1DN0B 1ITBB 4ZZ0A 2RGCA 4DYVA 3HS0A 4ZXBC 1XNJA 4JHVA 3ZL2A 3DE2X 1TD9A 2FJFA 4PCVA 5FPKA 1MQAA 1NCHA 2NMSA 1MFBL 4ODWA 3JQDA 3ZY4A 5LP6C 5JD4A 1QIKA 3QU9A 3E7XA 1SBIA 5F73A 1E9RA 2CHUA 1G8HA 1JP7A 4CMJA 2TECE 2V2WB 1GV0A 5IT0A 3QRGH 1XTBA 1MG5A 4JRXA 4B35A 3ES9A 3M1CA 5BUQA 3JAWA 5EIIB 4DCMA 1HHHB 4B2PA 4XNZB 1U65A 5F21A 3N75A 2OV6A 4HA1A 4FT4A 3BXEA 2W65B 1NPTO 5HHMD 4MW2A 2AHRA 2QB5A 3BMQA 2PUVA 3K91A 1F00I 3AEKA 4DZ8B 1YEEH 3DTUB 4ID9A 4HRXA 5C0BA 2IY8A 2HJ9A 3HYRA 1MAVA 1F45A 2EICA 3T6ZA 2PH7A 4CQMA 5DS8A 2W6JD 4EB3A 2Q0QA 4EW6A 3FDJA 1UPXA 5ENWA 4FAAB 1U8KA 5IK3B 3DX1A 3HUJB 4A6YA 4B2YA 4WI1A 5C08A 3BHIA 4UTBH 2R8OA 4XC3H 2BY3A 2BHTA 2JJ2D 4HUWA 1IY9A 4U1IB 1HNWB 4QVGA 5ALCL 3H2IA 3SIKA 3DEHA 1VE7A 3ESXA 1BIHA 3KLAB 3QZWB 1A6ZB 3IT0A 1G20B 2B5WA 3WKCA 2WUDA 2XPGA 2Q3LA 1UFVA 2FEPA 1AKWA 3AEQA 4U7TB 2I5YH 2YD9A 3CDFA 1NAKL 1Y98A 3UTTD 3A9CA 4MV9A 5L53A 1OAQH 4ZK2A 3RUFA 3Q85A 1MXHA 4IS2A 3WGGA 2Y36L 2ZSBA 4NRZB 2MYUA 3HS3A 4FGJA 5DMIH 1TTFA 4QT0A 3RYIB 1ESMA 2C4TA 4C5BA 4MQBA 4LLVA 4L9WA 4WXPA 5KTRA 3INRA 1SFHA 4RKRA 5JW4M 1QTSA 4C6HA 3U0BA 1GR7A 2FE4A 5FTLA 3RS3A 4XXWC 2BVOB 1INDL 3NOIA 5AW5B 3BWUF 2XMZA 1WHTA 3O2SB 3T8VA 2QRPA 2RGNC 1AGCA 3WFBH 4YE0A 4G6AD 1YQ2A 3D6HA 2HCRA 2V7EA 2DWSA 3GHHA 3EHDA 5I19H 1TMKA 4CKWA 4B60A 3G5YB 3IPRA 2D5BA 1NN3A 1BEEA 5J3HC 1IM3B 5CCKH 3BDIA 1KIQA 1RT9A 4QRDA 3JAMA 3P52A 3TWCL 3CCBA 2ORED 2Z8YA 4TX1A 1LO5B 5HQ3B 2B7LA 4Q18A 2Y22A 3MR9A 3OCJA 3KG5A 4R1UA 4TZKA 4OU3A 1JLHA 5DMKB 5CLLA 5K0FA 5AM4A 4P5DA 2V0GA 2HVKA 4A36A 3NGXA 3WK5A 3KUCA 3Q0EA 4R2IA 1QBMH 2C4FT 1A6UL 1T6WA 2FGJA 4U1HA 4RZUA 4HK0A 5BUGA 3CVHA 3PQDA 4V1CB 5JJKA 2ARJQ 1Y1QA 3UUFA 3B53X 1VFAA 4JLMA 1P74A 4HS4A 1TO6A 1UODA 2RG1A 4AS3A 4B2LA 1RPQA 1MABB 1V7CA 3S1LA 4Y1RB 3B1TA 2UZIR 2DQTL 3H9SD 3BG5A 4J03A 1ZTXL 1TIPA 3DVGB 3B8SA 1N32B 1KYDA 3GK3A 5KWVA 3ISRA 1XEXB 3AWIA 2ZVDA 2XCSB 1DGQA 4K1XA 4OGZA 3OLWA 4LOKA 1FNDA 1J8HB 2XI9A 3VNQA 5FYLD 4R7DA 1NGWB 2WN3A 1O5PA 4WWKD 1JXFA 4AKQA 2OVFA 4AV4A 5EH1A 3CUYA 4TLMB 2QPLA 4CCSA 2HA5A 4KZEL 4JNXA 4FQ5A 1P53A 4Y2TA 1CYGA 2ZSIA 1B4RA 1OHHD 3TXAA 4U1JB 4ND3A 5D96B 1D9KD 1TF4A 5C3MA 1QKIA 4JZOB 3IV6A 4L8DB 4PSKA 4ZMQA 4ETNA 2CO6B 2V3WA 3HPLB 1ICTA 3L2LA 4WHCA 3JT2A 2VWEE 4D94A 1J11A 1JYXA 5IEJA 3EOAI 4AP5A 2Q5FA 2J1ZA 4OW6A 3N8KA 3AUFA 4RJKA 2JIOA 4I8XA 4JUCA 4C6TA 4DJ5X 1BZQK 1J9SA 1JN6A 8PAZA 1YYML 5A5VA 3M46A 1BF5A 1IIKA 1OV6A 3ORYA 5FLUA 3ZTNL 5IF9A 3ARGD 3ZDCA 3BJEA 1XRMA 1JA0A 3O4FA 3L7YA 5I1CL 5A3JA 5A3ID 2XV0A 2VO1A 4JFXA 2RGAA 5M7QA 1UBCA 2GRAA 2FPWA 4PSAA 1I01A 3MF4A 3D39E 1AE1A 4BWUA 3OPNA 2BKEA 5JADA 4TRMA 5IP5A 3M1BB 2P69A 3FH7A 1AKRA 5DLLA 1A72A 2F54D 4FABL 2IE0A 1Z5GA 1CR6A 2FECI 2YJLA 3DVLA 2XV3A 2I85A 2KPOA 1FL6A 5ILTH 4M55A 4DR2B 3KZKA 4AWXA 1AUPA 4YWGL 4HLZG 1LX7A 3BB4A 1N0WA 4HEJA 2D5CA 1LVEA 3GLHB 1GS8A 1SUJA 1JHTB 1C9YA 4JX0A 3BSWA 4LAFA 2Z6QA 2N7SA 2HTLD 3LNCA 1HDMB 4FQPA 5KBNC 1NNUA 4MNQA 1ZO8A 5EMNA 3EUUA 3T3PB 3L4CA 1FGNH 4V1CI 5CITA 5JXWA 1G0OA 4G72B 4FTVE 1I9RL 3E7PA 4HDMA 4CUKA 4PGGA 3OZBA 1R6XA 4WWKC 4R5HA 2OC4A 2FX8H 1BE0A 4RK5A 2ZOSA 1V41E 1UB6A 5L6YH 2CBZA 3LZRA 2RFXB 3TEYA 1VE3A 1X7XA 4GMDA 4WN9A 4AZ0A 1MCZA 2ITDB 1Q0QA 3JQEA 2IQIA 5KSVB 5EUKB 3FYCA 1RNLA 1NVAA 2FN9A 3GRRA 3IKMB 1PT9A 2ZJ2A 3H53A 3FQUA 4ALLA 2HT2C 4BX8A 1A7NH 5A6SB 5JRDS 1YEGH 4WV1B 3FRJA 2FEEI 4CMEC 3D02A 2YHAA 3VOAA 1WBJB 4LSGA 3CDYA 3H3PL 2X87A 2EXTA 1BLIA 1JWUA 3FDWA 1OY1A 2A0FA 3LCVB 4YQXL 1KF0A 4UT9L 1LP9F 1QQDA 3GJ5A 1FNSL 3RUGA 5TEWA 3MV8E 4KTDH 2O8EA 3ROLA 3WO3B 2EP8A 5P8WA 4OQ4A 5T5FA 4LP8A 3VYPA 3TESA 2WD7B 2ZSJA 1H3TA 2PYZA 5KJ7E 2XH8A 4GBJA 2UY6B 3DEZA 2NG1A 2NDFA 3EJZD 2IGFL 4CM8A 1TIKA 2NTJA 4URFA 4JM2C 6FABL 3K70D 1Z7JA 2IOOA 1UH3A 1DLFH 3DUUB 3MLAA 4BVGA 1WVMA 2Z0BA 2L19A 3ZYZA 4YXKH 4BEIA 3UKJA 4B32A 1T5DX 2XAAA 3PR3A 5EKXA 1ZK4A 5A9RA 4E5KA 4LKXA 4JPIA 4UMDA 4ZT5A 4BLRA 4PW9A 3TASA 2ZSEA 2OWDA 3R06B 4FXKB 3ILQD 4XFDA 3ZHLA 3U3MA 5I6DA 2BSAA 3RK0A 3MD9A 3CH6A 1W4AA 4KVCL 4U8GA 3IAXA 1YNKH 4OZGB 3B48A 1RZKL 3G9UA 2XQBH 4B09A 4UULA 3V55A 5HVGB 2ZITA 5AUPB 2ZSHA 4Z3JA 4LK2A 4PGBA 1MJGA 4UASA 4WO4B 1QBBA 4CVUA 4J1QA 1A9SA 1UM6L 3IB4A 4RANA 3MJRA 3QENA 2Y8EA 1A9BB 4NPAA 4D0LB 4EM6A 2XBMA 5DHQA 3KDPA 1NKOA 2XV6B 1HE5A 5JDCA 4KUZL 2C3GA 4DP8X 4K3JL 4CJ1A 5DK4A 1ZVSA 4EUHA 3MLUL 2WA1A 3UO8B 1E92A 2F61A 4XZ4A 3ZE9A 4FONA 5KNDA 5KVGL 3Q9LA 3DV4A 3MGTB 1YXMA 3LH8A 4L8BB 3DHJA 2H3XC 2I22A 1M73E 2WT9A 4JRXE 2COUA 3MV9D 3ZPXA 1W2HA 3ZBPA 3WFDL 1HNGA 2BMKA 1BU8A 3DR5A 3T95A 3ARDC 4ZTOL 4ILKA 2OSBA 2CXHA 1CR9L 4IEIA 5D7JA 2ZIVB 1T29A 3BP4A 1NUNB 3MV9E 2QL6A 5IKOA 2C7FA 4UUQA 5TQ2B 3F84A 3EIFA 4OZHA 3OKEA 3ICWA 2GN4A 4Q6IA 4YSQA 2AS0A 5JLJA 1S5HA 5JIMA 3V5DB 3OHPA 2CSPA 1GCYA 3VA2C 3PL6C 1OGAD 2N3ZA 1CRZA 4MAAA 5E8EA 3EQ8A 2CY0A 1X5FA 3MRFA 5HX7A 1IGML 1VMEA 3V9EA 4IGBB 4TRNA 1T6BX 4OHUA 2D7MA 1RPUA 2RJNA 4PJHE 3WBBA 4FCTA 5EHFA 2HLPA 1D1QA 3GXBA 2FWPA 1U4EA 2PE5A 5IZCA 3OOJA 5JCZA 1T4WA 5FHRA 4FDMA 2XRAH 2JHAA 2B1HH 2ZSDA 3LSOA 2YOHA 1OI3A 5ITFA 5AOKA 4FT2A 1IE3A 1TUBA 5BN3B 4HN9A 3FN0L 1FFWA 3W3AD 3KH4A 1UWXH 3KR0A 2ETXA 5DX1A 4GRLA 1XF5B 5DGIA 3EO1B 1UAGA 4B3VA 4ZFZB 3CFJA 3CFEA 3O3AA 1BS9A 5H8DA 1UHVA 2ZRQA 3BFKA 2PWAA 2WJJA 1JBQA 1ZLSH 3MRCA 4Q9CA 1TNDA 4HLJA 1BZEA 5JUWA 1BXVA 4YRKA 4I55F 1Z9LA 1AQLA 2X4DA 1A7BA 2W70A 3P3TA 4C2BA 4IKPA 4QJ3B 3VGEA 1X1CA 2X8BA 4LE1A 2VZ3A 1TCRA 3C0KA 2CC2A 3F6JA 3FCGA 3PY9A 5A3SA 3GK8H 3KLBA 2ZXGA 5GONF 5LLDA 2DFVA 2FZ3B 4FHGA 1TF7A 4YLYA 3GRVA 2XB6A 5CUSH 3ZKWA 4ZI8A 3QVXA 1WXIA 5AVKA 4Y2YA 1JGLH 1KTDA 3BWUC 3RWJB 1I3GH 2VLLB 2XWJI 3RYCB 1IQWL 4KCGA 2H5UA 1H0HA 1A6AB 2M32A 2R0ZH 5FF6A 5IZCC 1SA0A 1DQRA 2E5FA 5D6DC 1UBFA 3PXGA 3PIQA 2I2FA 4M03A 2C7OA 4A8JC 5CCBA 2R8BA 4H25A 3JUZA 2VNJA 3S5ZA 1QSEB 3TFQA 2WVVA 4LVOA 4LRUA 2NU7B 1AKJA 4X60A 4M1YA 3NT4A 3GLUA 3LHFA 4NQVA 1XK6A 2JD2A 3RIYA 3DVAB 3G2QA 4G0PA 3U26A 2CCWA 3BX7C 4J0FA 4A6DA 4WDRA 1S3SA 3QI9A 5D55A 3IAM6 5I26A 1UKYA 4M46A 2QZPA 3OBBA 1TXKA 4WINA 2Z83A 3TTYA 4YRFA 1SDDB 3D85A 5ID0A 4QQFA 1X7DA 5FKPA 4F4FA 3C6LD 2ZBQA 3FQTA 5FNZA 4TYNA 3ZKNC 3HJTA 3CDGB 3A5VA 2JAQA 1F4VA 2WAQA 4B3FX 3N50A 1J1UA 4JNCA 1UFUA 3ZHDA 3IHWA 2OMZA 1C8KA 1B2WH 2KSQA 3FB5B 4HB0A 4P3XA 1TTGA 2C3PA 2E8ZA 4M6OH 2CF6A 4QWWA 3JZFA