3ZDZB

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3zdzB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3zdzB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3zdzB03
1MQ8B 3ZDZB 5E6UB 1QCYA 5KYWB 1QC5A 5E6RB 1ATZA 1NA5A 4O02B 1MQAA 4MMYA 4FWWA 4G1MA 3TW0A 5E6SA 1BHQ1 4HQLA 4IXDA 3AL8A 1YVPA 4BJ3A 4HQOA 5ES4B 4WK2B 3OL2A 4Z7OB 2NUTA 3AFCA 4PN7A 5HDBB 3IJEB 3EOAI 1M10A 2VDOB 3T3MB 1OLZA 1L5GA 3Q3GE 4FX5A 3GXBA 4DMUB 5KYYA 3NIFB 3ZQKA 1DGQA 1SSLA 2ADFA 1PCXA 3QA3E 4NENB 2XGGA 4WFQA 3V4VB 1PD1A 1PD0A 5HJ2A 4JDUA 5KYXA 4WK4B 4Z7NB 1JLMA 3M6FA 5KYUA 4G1EA 3OKWA 4MMXA 2XWBF 2ICAA 2IUEA 4UM8B 3T3PB 1SHTX 3NVQA 4Z7QB 1RD4A 1IDN1 3NIGB 3ZE1B 3K72A 1N3YA 1T0PA 1YVRA 3AL8B 4HQNA 4CN8A 1ZONA 2VDPB 4O3UB 3IBSA 3OL2B 1M1XB 1CK4A 1M2VA 1RS0A 1XDGA 1U8CA 2NUTB 1JEYA 2P26A 3ZDYB 2UZYB 3EGDB 3RAGA 1JEQA 1M1UA 3F78A 4IGIA 1AOXA 4M76B 5HGJA 4HQFA 2I6QA 5KYYB 3ZE0B 1ZOOA 3BN3A 3TCXB 2VDQB 1SQ0A 3EFOA 3EG9B 1UEXC 1XUOA 1PT6A 3PPVA 3FCUB 2NUPA 5KYXB 4UM9D 4GZ8A 1MHPA 4WK0B 5KYUB 5E6UA 2O7NA 1U0OC 3FCSA 1AUQA 4O02A 3BQMB 1SHYB 1QC5B 3ZE2B 1SHUX 2QTVA 2VDLB 2ODPA 4MMYB 1YUKA 4G1MB 3E2MA 4HQKA 3K72B 1TYEB 5E6SB 3K6SA 1T6BY 3EGXA 3EOBI 4CN9A 4NEHB 3HI6A 4A0QA 3K71A 1LFAA 1M2VB 2WINI 4IHKA 4C29A 1U8CB 3AL9A 3OKYB 1FNSA 3N2NA 3PPXA 1N9ZA 2VDNB 3TXAA 1JEQB 1L5GB 1MF7A 3F74A 3BQNB 4O3TB 4MMZA 5KYNA 1JV2A 3VI3B 2ODQA 4JX0A 2WW8A 2NUPB 4C2BA 4XW2A 1OAKA 1V7PC 4G1EB 3PPWA 5KYWA 4MMXB 5E6RA 3FCSB 1IDOA 4F1JA 1MQ9A 1U0NA 1DZIA 2P28A 3EH2A 4C2AA 1AO3A 3ZDXB 1M2OA 3K6SB 3EGXB 1CQPA 2VDKB 1IJBA 1M1XA 1FE8A 2B2XA 3K71B 2VC2B 4CNBA 5LN1A 3NIDB 3EGDA 2VDRB 1ZOPA 2NVOA 3TVYA 3PPYA 1JEYB 2I91A 3IJEA 3V4PB 1RTKA 2M32A 3EH1A 2X5NA 1RRKA 4K3JB 1BHO1 4F1KA 3HXQA 4WJKB 1MJNA 5BV8A 3HXOA 2XWJI 3EG9A 4MMZB 1JV2B 3VI4B 4NENA 3EFOB 1XDDA 2I6SA 1Q0PA 2VDMB 1IJKA 4UM9B
chains in the Genus database with same CATH superfamily
4ZREA 2IV7A 4BFGA 4P48A 1G7LA 4MSUA 4BNTA 2X10A 1ZUHA 3W8NA 3OF2A 3ZL4H 3JQAD 1O6VA 1NWOA 3LXUX 1R10A 3NBYC 1QE3A 3QEQE 2RGSA 4LV6A 3BP4A 1SOQA 2AI0H 4C57C 2F6AA 2L0XA 1FDLL 2GHRA 3WHLA 3SP1A 5JHDB 3IMWA 1JHKL 4TMPA 1J1ZA 1MDBA 3ZGXA 4KY1L 4KE6A 3FUMA 4CQMB 4YHZH 3HJNA 4R6UA 3VMFA 3ZSSA 4OIIL 4Z9XA 4F5WA 4JGJA 4MR8B 4JQCA 5EMJA 4L75A 4C76A 4U2ZA 3IEVA 3NCFB 3SE3C 2ZSKA 4ODSL 1JPVA 4JVWA 1E69A 1RM5A 4FLMA 2GX6A 3HXTA 3MLXL 3ZJAA 2F15A 3W04A 3VRJB 3UMFA 4LZPA 1JDTA 4WW1B 3SJZA 3I62A 1E7SA 4TZTA 3NSFA 2AXGB 4G3YL 5K59E 5HTKA 1RUQH 3OLZA 1XU9A 1M6VB 4GINA 1ESZA 4J94A 1OR8A 4YR7A 2VYVD 3MRQA 5BV1A 4M7LL 1PG7W 3PFFA 4D0CB 3FO1B 7GPBA 1CS0B 2VP0A 4P59H 2GBAA 5DOZA 2CD0A 1FFHA 1I4EB 2H17A 2R86A 4Z8YA 4YUVA 3ZKXC 5FWYB 1XGPB 3RYCA 5B3NA 4UTBA 2WGXA 1QHSA 2EDDA 5BVPL 1XSKA 4NGHL 5BV2P 5H35B 1KDVA 1D7OA 3QMPA 1GA6A 2TRYA 3CUKA 1QZZA 5G4MA 2JKRM 1N6IA 5DR5H 3SO5A 2ZRGA 7AT1A 4ZFGL 1XFPA 5I8PA 1SJVA 4PN7A 2D2CC 3CFCL 1FX0A 2YMXL 2PRZA 5E9AA 4BGVA 2FQ1A 1YRBA 5K8UA 3FIJA 4UM8B 1DXYA 1FMLA 3ZQWA 1Z8NA 1LPOA 5SY6A 3IHTA 1XF2A 1JWMB 3ZVNA 5IMOA 2WZCA 4F6RB 5FW7A 2PH3A 4W1SA 3DHPA 4MR7A 2R7AA 2VSCA 4GRWH 1VIAA 1JKJB 5GRYA 3QPQD 2AJYL 4OJFH 1D9KA 3HCOA 2QG4A 3RC8A 3Q8KA 5IJ0B 4XOAA 1RUML 4URVR 4M3HA 2WO2B 4O4IB 4JT4A 3D18B 2YJTD 3TB6A 2CK2A 3OEEA 1WS7A 1P4UA 4ZFOA 3HC3L 4A8JA 3AXIA 1L5GB 1OH6A 1T89C 1UXJA 3S2AA 3L7FA 2NU7A 2NQDA 1OF0A 2ZRLA 3ZDWA 4B6JA 3WN5B 1M56B 3PD1A 1GVNB 3C97A 2MQCA 5I1CH 1QBML 1Q9KA 3GLIE 1K7FB 3IKCB 2W37A 5G1OA 2G9NA 3MLRH 3FXAA 3RAFC 5C18A 3WSTA 3DLPX 3GPBA 1X5FA 3I28A 4JYCA 3W8FA 2FUNB 5ESXA 2QQGA 4RTNA 5I76B 4PGEA 3GPSA 2MYTA 4D0LB 1R6TA 2BFOA 3PGCB 3TNYA 1SCDA 2OP0A 3JV7A 2JHGA 2QKIB 3AFCA 3VC2A 5IBRA 1YZ3A 2VQSA 2VT3A 4YRLA 1JJVA 5FYJE 5A0TA 4ODSH 5D7IE 4MJ3A 3N0TA 1KFJB 5TMPA 2VZ9A 3DETC 1ONSA 5K1NA 1H94A 5CVUA 2J09A 4PANA 2AXEA 3P5SA 2BDTA 4F8TA 5LYJB 3CTPA 1OY1A 1F20A 3I9KA 4DM3A 1RQ2A 2O06A 3W56A 3GJFK 1NBMA 3WOVA 4Y4KA 2XQBL 4ZUSA 1XEWX 3LY5A 1OCEA 3IJYB 4C56E 1KCSH 1L4UA 4FA8A 2BEUB 1NI3A 2QBYB 4MKXA 5AB9A 4DJ5X 2IHUA 4MZXA 1CICB 5JZVA 4QJ5A 2Y6UA 1RQPA 3RABA 3X43A 3VU9A 3PNWA 4KI5F 2WOBA 2IODA 2JKZA 3ZKMD 3TIIA 1WCBA 3ESUF 2X15A 1F6DA 4XAKE 1VKRA 2VXOA 4EI5A 3IKTA 3BGFC 3QEQA 1XHEA 1OM3L 1MF2L 2VC2B 1XVVA 4L7QA 4BWWA 4O2AB 2ZKIA 4AITA 3NGMA 5EHIA 3RWFB 1KQNA 1VL2A 3ZWPA 4Y4FC 4L1TA 4NENA 2VERA 1H3FA 1C7IA 1D7DA 3GHPA 3LD8B 5KSOA 4GSUA 2KZBA 3Q7RA 1PHPA 4LA4A 2HKFH 5D7KD 1RFLA 5JDCC 1YT5A 2XZDA 3QOFA 3FHQA 4NJOA 3FOWA 2HFKA 4OYHA 1LBSA 1BJ1J 3L05A 4US2R 1RJYA 2QVYX 3IUEA 1W47A 5D7EA 1NJ9A 2NYUA 3IE9A 1N59A 4JASB 2EV9A 3TINA 2G9KA 4JR9H 1AQKL 4DUVA 1AX9A 5JXAH 2GOYA 1TQVA 4TL6A 2VEDA 3OQOA 3QUYB 1CB7A 4I2NA 3JZFA 1WD7A 2YSSA 3ZZSA 3UWKA 2Z34A 4PM1A 4ZXBC 1FCCA 2A0LD 3SDDC 4LPKA 4YRPA 4NERA 1I8MB 2FUKA 2H3XC 1XD2B 3K5IA 3G0HA 5J1AB 1PLLA 1U91A 5F7KC 1MNNA 3IFPB 3PUJA 4TNEA 1M7IB 1Q3KA 2AXFA 1GKOA 4PGMA 4CV2A 1UXSA 3D3KA 4X8LA 1JU9A 1IM3A 1DQTA 1EFLA 2PX3A 3S6JA 1SXJD 1Y4UA 5ABPA 2PUWA 3FTCA 4JFUA 4UQIM 3D3NA 4OLEA 3O1LA 3LNFA 4HJSA 1L5ZA 4H8PA 1OAXL 2D9CA 1J9EA 3L8DA 4MW5A 3DVAB 5B7EA 1Z6QA 1KFKB 4GWGA 4WJKB 4RGOH 4AWAA 4MVJI 3ZI7A 4RGNB 2I7DA 4NBXB 3M6VA 4J2QA 2DG2A 3W8RA 4YO8A 4DBVO 3FIUA 1AMYA 3GA0A 3FG9A 1DAOA 1BHQ1 2A74A 5ITFB 4F15B 1KTVA 4BLPA 3F49S 1XGRB 3ZKWB 4LNUA 1X80B 3QKTA 1Z1WA 3K15A 4WUTA 5FOVA 4RAOA 4DILA 4RRPG 1T1JA 2W6QA 1Y98A 1YS2X 1AOHA 2Z8WC 2F43B 5DK0A 5AFSA 3EO9H 5FBKA 2HM7A 4OZHF 5L9DH 4E41A 4J12A 4PX9A 1NZDA 1FL3A 4PYOA 4WT7A 5F1YA 1CVRA 1PLAA 3JD0A 1KNOB 2Z4SA 5DUPH 1EX9A 1H2RS 1XO1A 2C4HA 4RGMB 3NDZE 4PFSA 4EWLA 2OV1A 1DHRA 1ZOIA 2RJOA 3TOXA 1ETA1 2ID7A 3GC6A 4CLRB 4AFNA 1I7NA 2WM0A 3V8BA 3ALWA 1NXWA 2HMWA 1SHLA 1NAKH 5JFOA 1EQWA 4YYEA 2JJ2A 1T20A 4MRPA 4EPSA 2ZIVB 4P49A 4IFIA 4NE9A 1ZLWK 3A9VA 4IJUA 3WEOA 2SNIE 3AVUA 5D7IA 3LW7A 1XHFA 1AKVA 2EZ9A 1CDDA 4U6VH 1EGJH 1KIPA 4XWKA 2EQAA 5ANMB 4DV4B 5C4MA 3K1AA 2XUDA 1KMCA 4OLWL 2ZDQA 2WXQA 1GZVA 3VYRB 2YV3A 3OR7B 3HI1B 1W0KD 3BZDA 3NU1A 3IJ9A 4R31A 2KERA 3PL5A 5CVTA 2XQYG 1YL6A 1S9XB 3A1SA 5TFSH 1XXDC 4C56A 3NONA 3BN9D 2DTEA 4XX1A 2W2LD 1HR0B 4HAKA 3RDTD 5EZ5A 4M53A 4CM1A 1P7CA 3U3OA 2EKSB 4I5IA 3M8OH 5B7FA 4G6AC 3LWDA 2ZCVA 3ONEA 2KBFA 5REQA 3I5XA 4OD3L 2L7JA 1AI1L 4XM0A 1LY1A 1JDUA 1X15A 3P4YA 2EJVA 2JFWA 1IMJA 2QV2A 3MRLB 4MA8L 2HFEA 3PXUA 1IC6A 3A11A 3GGDA 3TWOA 3GEFA 2PGLA 4PW4A 4UULA 1OCCB 5DCYA 4IU3B 4AIOA 3IAM1 5DHFA 2NY4C 3QHZL 5B2EA 3E1ZA 3MRDB 4LSGA 2ZULA 1OL0A 2X1QA 3L4TA 5CDYA 3WB2A 2Q4OA 4KQGA 2PBZA 1KPIA 2IEDA 2NZIA 1L2TA 4WMLA 2NPIA 1CXEA 1AZLA 4KV5F 3FUJA 5C2UB 1DCMA 5A6SA 3VSVA 4PHGA 5GRJH 5LCVA 2W8CA 2BJHA 5CEZE 2BFEB 3QPBA 1TIKA 5FO0A 1G64A 5FM4A 3R9KA 1L3CA 4ABYA 1GRQA 4DAGL 5GQSA 3EYOB 4JEMA 2RCSL 4WXPA 3T65B 4DP4X 4QHNA 2GCOB 2RI6A 4Z0NA 4LRXA 4BIKA 1IGTB 3E15A 4BGUA 3U37A 4CM9D 4L8BB 2B15A 4ZGWA 1V25A 3MQ4A 2XCMC 4TVPH 2PMZA 4YL9A 3WGTA 4WBXC 1XR9A 4O4YH 1XKLA 1X9LA 1M9NA 3E82A 2YCBA 2A9AA 2R4QA 1O6SB 3GHHA 5F3BB 5G1NA 4JFQA 1OPXA 3CWZA 1ZMOA 5FL7A 2WJAA 3OL2B 4NEGA 4WTZA 1JI0A 5KYKA 4J1TA 3HCFA 3NV7A 3E2PA 1FFYA 2EYUA 2HKHL 4HIEA 1QAQA 2HRHA 4NKOA 1J39A 1TVHA 2CCKA 1OCRB 1W6RA 3OJOA 4I2XB 3UPCA 3TBHA 4O3MA 3B9QA 2G2RB 2MHAA 4AV5A 2HBQA 3DMTA 4J1QA 5HWSA 2FRDA 3UAJD 1UT9A 3GRZA 4FJ1A 2B4RO 3FHLA 4DCOA 1ZV5A 4HKBB 3SG0A 4JC8A 4IZOA 2WWWA 2L04A 2HLFC 1KXHA 3TEMA 4ZDHB 1GZUA 1BOFA 5EUOE 4CEJA 2BE7A 4P7JA 1Z3IX 3V7FA 1DSFH 2WINB 5A5FA 4B3BA 4YNYA 1GO2A 4KFMA 2W2KB 3OU6A 2CDGA 2J4CA 2FJGB 3QKRA 3THOA 2VHWA 4P2OB 5G0UA 1V11A 4ZDJA 3EMBA 2IHZA 2RFXB 2AFHE 4HZIA 4ZUTB 3REWA 1MFBH 2ERYA 5IPFA 1P0FA 3P9QA 2R87A 3N1UA 3GMNA 3UT6A 3KYIB 4R2GB 1XGUA 2XJLA 4APQB 3FB8B 1KWGA 2FOIA 1SY6A 4N2KA 2EACA 3DTVD 3MPOA 4H0HB 1JYEA 3BK2A 5MEQB 5BMVA 3F1LA 2XAAA 1UIMA 2CBZA 2YPVL 2FMIA 4X98A 4EATA 1X19A 3ZQ4A 1BXVA 5FHRA 3FZEA 4WK6A 3OGCA 4JI3B 4JHAL 3FB5B 1NJ6A 2AR7A 2ZRBA 2PYED 3B3QA 4ZMSA 4Z77A 1NU8A 1R16A 5AI8A 2ZIGA 3B43A 1XTMA 3NNNA 5SWSB 3ZIMA 2JIDA 3RFZC 2BFVL 2QXTA 4UBLA 4IQFA 4DLAA 4WFED 4BE5A 3HB3C 2OGZA 3FF8A 1LE5A 5ENWA 4Z7UE 2PF6A 5DMKA 1IT9H 3LGSA 1Z5YD 4JJAA 4ML3A 2PT9A 1F41A 4RLQA 4OLXH 1F6FB 2Q5EA 3F7NA 2RAUA 4P0QB 1RUAL 3NGLA 2ERJC 4IRUB 1BWMA 4DAGH 2KLHA 2XT6A 4DPCX 5DN6D 3PFCA 3X1DA 3QUBA 2APWA 1MQ8A 1RRMA 3GNTA 4CN4A 1K85A 4LARL 4WZ6A 3ZHSA 2BSTB 4BEIA 3DUHA 4PZEA 5CJQH 7PCYA 4OHCA 1CQPA 4EFKA 5BRPA 3K91A 3OG9A 5A4AA 3O8RA 2H6PA 3WZLA 4AUUA 5E38A 3KXKA 4EAAA 3SMQA 5LZ4A 3HBPA 4YBRA 2MOVA 3R3JA 4HWEH 1BQLL 2GHWB 1W9HA 3LWBA 5HKKA 3I0ZA 4JM2D 4K94L 4XWYA 2ZUUA 1QFMA 4UNTA 1XEFA 2H48A 1K6EA 5M34A 2N47A 3DUUB 3T7CA 4E5UA 3X1MA 3KEDA 4WSKA 3PGMA 4I89A 4TTDD 1MABB 2WOOA 4E32A 4TLEA 4N9GB 1MAMH 2I66A 5ER9A 4K73A 5GJCA 3UKJA 2N56A 4C0KA 3DQPA 3I6BA 1RWXA 1E3WA 4ZP1A 3IDJA 3JWOH 2IU3A 3Q15C 6PCYA 4EEKA 2YNMA 4Z3GA 5HX7A 3I5YA 2IYWA 5GAJA 3WNMA 2QENA 4TWJA 3FMGA 4QO8A 3WFIA 2A6KA 1YZNA 1K1EA 2OB2A 1KORA 5K0TA 3U30C 2UXCB 2WIIA 3D85A 3GRYA 4P2RE 2YGQA 1XXHE 3WIAA 3B2MA 3OLEA 2CD9A 3ZE2E 4NHCL 1EM6A 1AVAA 3SIWA 4B2LA 4RV5A 3FT9A 4ALAH 4HFUH 4NBNA 3G1WA 5BS0B 3HUJE 4KTTE 3PXDA 1G8HA 5DI9A 4BRSA 5KKAA 4UT9H 1KXJA 4P5KB 4P46C 4RV9A 3HG0A 4XR8C 4JPVH 4WN3A 3CAFA 3AJDA 3IU3B 1TF4A 1P4IL 2QZZA 3QWNA 2VXQH 3LH9A 5FKPA 1MEJA 5EJ2A 3RL1B 2H1VA 4L8WB 1K6JA 4P58A 2FWPA 2Z91B 2G75A 4XPZA 1WKVA 4W7IA 1OXUA 3IP7A 5L51A 2B1AL 2RHCA 3DA8A 4QYOB 2IEBA 2HRLA 2RGCA 3U1QA 3Q7QA 2OGSA 1WFTA 3QJHA 5HM8A 2ACKA 1ORTA 3B6SB 1KAEA 1LDYA 1KSRA 3NSXA 1QO3A 4GKVA 3WP1B 1QDUA 2OOSA 4HOYA 4YDZA 2ZU6A 4LXUA 3ZK8A 4BYHA 4KUZL 1RRGA 2PGXA 1D7FA 2F55A 1H0RA 4IW3B 1D3AA 4GUDA 3S7GA 3WFHA 3WLFA 4ENSA 5B30A 3WDHA 2O6DA 2IU4A 1P1RA 2NO4A 2PRIA 4ZU3A 5EUOA 4QWWD 5IBTL 3D2UD 2ICES 4LDJA 3FH0A 3UOWA 2Z8SA 3DJ9A 4D3ZA 3NC1C 4HGNA 4DN6A 3GW8A 2ED8A 5CFOA 1NFDF 4QVKA 2DQKA 1UWGL 1J0ZA 4EDXB 2XBLA 3T5MA 3PTLA 5IVXA 4KKVA 3ZO9A 3IGKA 5TF1L 5CLGA 3SJVE 4U0QB 1MLCA 4YJDA 1JNHA 3CEHA 1C9KA 1OAOC 2FATL 1T9HA 1I3RB 4UT7L 4I9HA 2VCEA 4QT0A 3QORB 4YDSA 4EUPG 2ES4A 3IDSA 1JJFA 3KETA 2UKDA 3BVPA 1L7XA 2COVD 1BDJA 1JWSB 3REGA 4Q16A 1U2RA 4OHMA 5K8CA 1XNHA 1TYZA 4OFZA 2ZG1A 5EYPA 2NQTA 3WBDA 5FOTA 3VZCA 1DLFL 3R7RA 4CRWB 1C7JA 1S96A 2XG4A 3ROOB 3GRKA 1UODA 7MDHA 2IYOA 2FF5A 2XA1A 4B6SA 4HQQL 2MINB 2B59A 3T77B 5IBUG 2DSTA 2HUHA 1ZJ6A 1C0LA 1FL9A 2QN3A 1NXTA 5FF9A 1NBZB 2LGJA 2DH3A 2NVBA 1HYQA 2W6NA 4FDWA 4FYQA 2DLFL 1KJQA 4PU0A 2OR9L 4CQLA 5E6ZA 3H9SD 5AOMA 2YVAA 4EA7A 4IOSD 1ET5A 2I6XA 3IXMA 2H1LA 1FP5A 2YD8A 2IDUA 3QZWG 3HGQA 5DHVA 1TR7A 2Q76B 3QWRA 4Q52A 2ZRHA 3DLQR 2JFVA 2ADGA 4UPDA 3RSOA 3N85L 3ZKAA 4R0LC 4UYQA 1AOZA 2F64A 3V7YA 3DBRA 1RZJH 3OKOA 2YXPX 3W3AD 5JXJA 4RVFA 2MH4A 3BRWA 4QTUB 2WP8J 4FYVA 4M8UA 1PJZA 1YL7A 2YC1B 3C3XA 3E5RA 2DT8A 3IMSA 3DAOA 4OJYA 4HNRA 3MS4A 1FYFA 4M38A 1L7IH 4J39A 2FMUA 2ZSWB 1NQAO 1UBNA 2VTKA 2IIBA 4X6EB 2JCCA 3O2JA 3U9TA 1AMNA 2PWHA 3F3HA 3CLUD 2WIMA 1AURA 1H3EA 3AETA 4TS6A 1IKFL 3VO1A 4F1ZA 4MD4B 4LVCA 3G5XA 3HO6A 3P4XA 2ZJ1A 3WJMB 4MQ6A 1KO8A 2YFKA 4D99A 1A8UA 4F86A 1YDPB 4UOEA 3GR6A 9LDTA 3EAQA 3HCCA 3CNQS 1OILA 1XDZA 3SKVA 4MUGA 4YHPB 3IQGX 1TTTA 2FEOA 1CXFA 2CCVA 3GVCA 1Q95A 2K7FA 4C2TA 5J9FA 4U1LB 5B8CB 3HCVB 4ORGA 1UXHA 4PFJA 4ENEC 5AVSA 1S2MA 4WWHA 1K3TA 4OFVA 2VCYA 3GINA 4DTCA 4KGJA 2JEOA 3FPCA 5AZEH 2PUVA 2WCGA 5JD5A 5CB6A 1XXHA 3TN0C 3JD2A 4ASUA 3DOHA 4FFNA 3QIBD 4GOLD 4XN2A 1TK2A 2R1TB 4KWIA 2DLNA 1NLDL 3E9DA 2BSSA 3EJZD 1LO5A 3TBTB 1S8FA 3TJHD 1NPDA 5HGBB 1ZVHA 1M7GA 4DA4A 5DD6A 3A4FA 5BZXA 3EVNA 3VUEA 4M5SA 1O6BA 1B88A 1ZH0A 5L45A 3U4BH 4QZVA 5D7LB 1QFWI 1XVTA 3M83A 4PHCA 5B58T 3L3KA 3E58A 3T9BA 2H11A 1T5DX 5GOTA 3PX3A 4D6XA 5KVGH 4UU1A 1U8ZA 3NJ4A 4YUZA 2WUFA 3UG7A 3GEGA 2AANA 2B4TO 4CAGA 5IOPB 3LLSA 3ARDC 4WHCA 3RYIB 3NM4A 4IOFD 3IQIX 2R1VA 4XCEA 4XI5C 2Y1VA 3RAJL 3L3GB 4UVEA 2H1LM 2G36A 1MUUA 3NVMB 4G1VA 3GRFA 4ZMRA 3ZIDA 5J7CC 4MVJG 1V5IA 4GKNB 5CP3A 2HOQA 5B2FA 4WCFB 2DLFH 2OMYA 5JNSA 3QYJA 4JBHA 2OZ4L 3EJQA 3LBHA 1FFNB 3BT2L 4ABVA 1G7SA 1K2WA 5L3VA 3KTAB 3B2PA 5GRZA 3N85H 4PHTA 2BP0B 1C8BA 2ZB7A 3KQWA 4LHZA 1BECA 4DANA 1TTHA 5HHTA 1DQML 4M61A 3L82B 5U4QA 4HZ1A 1EUYA 1DEDA 2QTWB 3GMOA 5K0LA 3TEFA 4F8JA 5JCJD 4YAGA 3DNKA 4EPRA 1XQVA 3EXIA 1WVGA 1EGMB 1F2VA 3SJVA 3EZ8A 4OLZL 3DR3A 5ACLA 2BGRA 3CQ9A 1TYJA 4RWEA 4R1MA 4M2LA 3RTDA 1YCSA 4FNPA 1U5AA 1YZVA 3CJTA 5JW4Q 3EIWA 1RZFH 3UACA 4FFYH 3EGCA 4F8YA 1T5BA 1F8XA 3N0VA 4CKXA 2HXYA 1KEZA 4Y88A 3RYFB 4PP2A 2A5FA 1PBTA 5JCZA 4L9DA 4UHBA 3H85A 1ONBA 1MXGA 2XBDA 5KANG 2VXSH 4OR1A 1QZ1A 4ZOBA 3FJYA 3HRZA 4YAQA 4JITA 2W6ID 2ZRJA 2H1PH 4YE4L 4M6MH 3SZ3A 2LWIA 3CZAA 4OBSA 3TO2B 3K8YA 2XG5A 3VFSB 4KTVE 2DQHL 2WB7A 3GLEA 3NJLA 5LQBH 3QE5A 2XTJC 4RE5A 1CFVH 5K0NA 4YUEL 3IAXA 1IJKA 3IEPA 2H32B 2R8RA 3I6YA 4RTKA 3O82A 4J7XA 3BUDA 1T5XA 2MQ0A 3P26A 1UOOA 3PNYA 4LPTA 3PYXA 1UJ6A 3FU9A 1CCWA 1OGYA 3FCXA 2HFGH 4IHQA 4LHUD 4JHXA 2VQ1A 3LPMA 1I8IA 1DU4A 5EORL 4BEJA 1M8FA 5F71A 2BOVA 2ZF8A 2Q20A 2RGRA 5A3JA 3S2SA 4XXCA 1D6JA 3L9RB 3P52A 1YB1A 3HDHA 1Y9JA 3QY9A 1AXIB 2OP4L 4EFLA 5J4YA 3IJ5A 2OI9B 5JBIA 2W2PA 4LBVA 1IAOA 4GFDA 4F96A 3E8MA 2C9AA 3KOWA 4JFED 2PFKA 1XQWA 5FJJA 4GUCA 5KBPA 1RU3A 3BUBA 3MBWA 1YEFL 4MPDA 3UGJA 2YUTA 1J0XO 1F14A 2JJQA 2FZVA 3KR3L 5CW2A 4X4YB 3N42B 1PFUA 4EYQA 4CI9A 1YS9A 3CKKA 1ACYH 4EB6A 3CVXA 4I77H 3V6MA 3MXTA 2NR6C 1T6VN 5DD1H 2JKTM 1DQKA 2B0CA 5JOPD 4QTZA 2PZFA 5FUQA 2DJ4A 1U1EA 3DF7A 4GRAA 4P5EA 4JMNA 1U2QA 1GMEA 1X8JA 3K9CA 3O8QA 1NSTA 4D3FA 3B3IA 5DVLA 3RSHA 4LSQL 2NV6A 3V0VB 4UZFA 4YIHA 4TULH 4M6OH 1K3ZA 3NWJA 2OHHA 1UXIA 3UBGA 4MEAA 5E2TH 3P20A 2XQIA 4HN9A 1WFNA 2EX1A 3ZPDA 1C0IA 5ABAA 1A9XB 2X89D 2AQIA 3VFOA 3UG5A 3MWEB 3DGGA 3H6AA 3TT3H 4BVJA 1M7BA 4NOKA 2GYYA 4X9BA 2C1OB 4Z7OE 1ISFA 3DUFB 4N2GA 4R16A 1I1FA 4K2UL 3ESYA 4F91B 4KI0A 1RSFA 5DJAB 3GSRB 1KTDA 3TGPA 4HS8L 2IZOA 1KJNA 1BXGB 4HPWA 2ONKA 4XSHA 1N6NA 2FZLA 2V4UA 2BNRB 1LTXA 3B89A 3UM9A 2X2FA 1L7EA 1NCJA 4F7WA 4Y6OA 4XN5A 2KX7A 1GCUA 1OB1A 2B3RA 5JI3E 3GMLB 1L6PA 2ZWMA 1QSEE 1J0EA 2WNIA 4B35A 3P30L 4R3SA 1DLHA 2WLHA 4F58H 4I4LA 4KJWC 1PEZA 1V4NA 2DQHH 4OBRA 5IESL 3VFMA 1O9HA 3R8BB 1GA4A 5CLHA 2AFHB 2HVKA 1UB5B 1N9ZA 1NY5A 1YNOA 2ZK7A 1CLZL 3QDMD 5AVYA 4LFHG 4OGYL 2PNDA 3U0VA 3IXTA 3CLVA 5B22A 4ACBA 4YSAA 5I8CA 4NU6A 1B1CA 4YE0A 3WKDA 4YBQC 2AEPL 3QYPA 4YR9A 3E8UH 5BUAA 1EXUB 4YHOH 4JYPA 2FZ3B 1B43A 5FYKL 4EG8A 3FWHA 3T2LA 1IMHC 1MFVA 3TBBA 2D1FA 5EORH 2VNKA 3OIFA 4XWAA 5F3HA 3JVIA 1FU7A 4J90A 3PABB 1TL7C 4KLZA 4MTLA 3BGOS 4UHHA 2VS1A 4X5WA 2VAWA 4YDHB 1ZLUH 4U8GA 2Y93A 4YSDA 1KZ9A 1AHWC 3G08B 2EWWA 2DFNA 4YX2L 1HDEA 1DRWA 2EYRB 4JBWA 3CRRA 3IOEA 2JBAA 2Y0BA 2F3QA 3BYTA 4IKNA 4GRWB 3B70A 5B4MC 3PL6C 4Z7UB 3ECUA 1P1ZB 4UTZA 2IGLA 5BOPA 3WK6A 2WZ6A 3QZMA 4G36A 1GC1L 4RGVA 3V0HA 4MUJA 5FUZH 4ZUVB 4HXAH 2ESVD 4NUGL 2FVYA 2YQBA 4KRMB 5HGAB 5DM1A 1JCVA 4G82A 3EGDB 1CUUA 4MCZA 3S35X 4G8AC 1JCKA 3NEOA 1PJ8A 2YJ3A 4KI7A 4RSMA 2DMCA 5F0JB 1DMRA 1A3LL 2E7ZA 2LNDA 4PN3A 3WIHL 2HWZH 4J0JA 2L19A 1DQJB 3OXSA 4QIHA 4MASA 3Q88A 4OO3A 4IDJL 3LHKA 2QI9C 1E58A 2R11A 1QAOA 5AVTB 3T1YB 4M5ZH 2HL6A 5J2UA 3KYDA 1GRRA 4H4CA 2C59A 4BMVA 3PWZA 3BH6A 4MZDA 4PICA 4XQ0A 3SQBB 1CWUA 4NZFA 1RRKA 4PHFA 4NEQA 3U2SB 1VJ5A 3QJFA 1MCRA 1C4OA 3ZRCC 1R4NB 2CUNA 3W5JA 1CGUA 2PGJA 1O5PA 3OIYA 1E5LA 3UP1A 2EDXA 4WAFA 3R2JA 1J05A 3I01A 3ZMRA 5SZJA 3NP4A 1GZ3A 3CHXA 1TZIB 3OB8A 5HYJB 4ER3A 3UV6A 1F8UA 1HHGA 5K9ZA 5TVGA 1VAHA 2YOGA 3QIUD 2DDQH 5FF6A 3DZIA 1A27A 1ZGLA 3H05A 4H3KB 1J8HD 1NBHA 1DJXA 1K8XB 1KTLA 3ZDZE 4KX5A 2C20A 2K8MA 3MNDA 4UFOA 3N0XA 3W2FA 1BFDA 3QXXA 4A2FA 3Q0IA 1NVAA 2CKBL 2B5IB 2QZ5A 3FOMA 4PQFA 2O7SA 1LDEA 3VXSE 1D6NA 4HJXA 3RROA 4RTPA 1P6WA 2VUTA 3G9QA 1FYTB 1P9OA 4KROD 3C5CA 3OKNA 2R97A 3D0VA 4BN0A 3S3SA 3V9AA 2C7OA 4IKJA 4W4OA 4ZMBA 3HZMA 5CLXA 1QOKA 2HJFB 3MXWL 1WAEA 2ZJ3A 4MAYC 4ZW5A 4GI7A 2VRQA 1QFHA 3QKUA 4HZAA 1EZVX 1IEXA 3I04A 2YIDA 3T1FB 4DZ8B 5G3YA 1NCDH 1V7MH 4HHGA 2EADA 4ONFL 4PRDA 3SB3A 3QK0A 4MX7A 2FQGA 3GD1C 5IJ9A 4N2IA 4DN4H 1PSWA 3BDAA 1D6EA 2AT1A 3DCIA 4ZVRA 4M48L 1H8HA 5KTMA 3UC0L 4GRDA 2UUBB 2PMCA 4B0MB 1E1RD 3LQFA 5F7MC 2BFDB 5CIPB 3VDQA 2R2CA 2GLUA 3GPCA 3RJ5A 4E09A 3LN9A 1ILUA 5BV7A 3CWQA 3LLVA 1A3LH 2QN9A 3Q0HA 1FQJA 5D5MA 5C4GB 1WSWA 5DLEA 4OB6A 4BYGA 1BVNT 3M6MD 2EWMA 4TV9A 1XZMA 3E3NA 4P04A 2EARA 2ZX6A 4DH2A 3H1AA 1PEKE 2NG1A 4S1QH 1GPWB 2AZMA 1Y1DA 2JLWA 5B38A 2PYDA 1TJIH 2JBWA 2JI1A 3KB2A 1HOCB 4HH8A 1HCFX 4YHNA 3Q8WA 1VLQA 5AW0B 2AVNA 1OBVA 1CHDA 2ZSEA 4C04A 3M07A 3KRTA 3O3EA 3KE9A 3NEJA 5LBTA 4PCLA 4NZPA 3P54A 3I01M 4HUUB 3COPA 4KZDH 1MJ8L 1GG5A 3FFOA 3K1TA 2C3MA 3BN3B 2YWXA 2OQRA 1ZVSB 1YZHA 4R5VA 2O0KA 2E6KA 5KVGE 4B75A 4K7PH 1KI4A 1ZGLM 4LL1A 4TXMA 1EJ0A 4FGUA 3RQSA 4L8SB 4DVBB 4K0OA 4HS6A 1RXYA 2HQ1A 1SM3H 3ARGC 5DNWA 3ULVD 5MHTA 5ACZA 3K6RA 3NRJA 4UE3S 3X2EA 4CF5A 4MS6A 4Y19E 2H92A 1GSKA 3KSZO 3MAAC 4REMA 3UYOD 1WC7A 1T3HA 2FW1A 5TX7A 3C6ZA 4PWIA 4ADJA 4OD1L 3OPNA 2CBQA 4CF6A 3MF4A 1SQFA 4EHFA 1Y7IA 1IAII 1U8NB 4IS6B 3EMKA 2XA8H 1HH6B 4F4JA 2XB4A 5JY6A 4K9EH 1E2PA 3PR3A 2EIBA 1J9GA 3HR5B 3FONB 2O48X 2J8UE 3B2VL 1YJBA 4RJ2A 2JI7A 3WV5A 1U58B 5CZVH 1ZK1A 2XMSA 1CIUA 1IY8A 1X9GA 3DYPA 1X14A 3PTZA 3I04M 4FN5A 2JLAA 2WBJD 1JFFA 4OLJA 2YA0A 1FDIA 4MPRA 2PJUA 4DV1B 1AP2B 4CMEA 4NBYB 4DGQA 2YK1L 1TYBE 3A3YB 2I78A 2YQGA 1DKPA 3N1MC 5KYUB 4KTDH 5KDLA 4KOCA 2ID9A 2H9AA 3TIDA 1GZPA 4H26B 5JZOA 1T8SA 3C9NB 1LD9A 3BKWA 3VR3D 4AY0A 4TQ9A 3DVNB 1SWWA 3WENA 4D0RA 1IULA 1ZIBA 2OMNA 3FCGA 4AIIA 2XX1A 3VXQB 4PJDE 1FUYB 1WSBA 1T4KA 4YSTA 4Z3TA 3VXOA 4CT4B 2WLTA 2P46B 4HEA6 2WZPA 4KKLD 1L1FA 2GNOA 3IMUA 1LO2H 4J8QA 3GSNA 2YWGA 4XNMB 4BC1A 1I1AD 3AP3A 4MRBA 4IRJD 5FGBA 3T2NL 3L46A 1G8GA 4FMCF 1DKQA 4YHIA 2NSHA 1N3BA 2XN0A 4JHZA 2XZOA 2IYRA 3ASOB 4NQUA 2P5WD 1MCPH 4M46A 4U1KA 2P8LA 3S1AA 4Y1AA 2JAOA 4BUJA 1I1RA 1JG4A 2BOLA 3IA7A 3U4EA 4HKZB 4YCSA 3AB3A 3GNML 2BINA 4W70A 3F4LA 3U2QA 5I3ZA 3VXSA 2ZNWA 2CHWA 4DPRA 4ICIA 4JCOA 1G8YA 2GMWA 1GCFA 5DJDB 2VTEA 3ZW9A 1MXDA 5DDIP 1FMJA 3CXHJ 1OAYL 1MVNA 1PKEA 3GUYA 4O51A 3D3JA 5KVCA 3SGJC 3VMPA 2NY1C 5JHDE 4H7VA 5E08L 1PL6A 5T1DH 4MA3B 1OZTG 4NUMA 2JF1A 1JUFB 3DMMC 5CLQA 2X40A 3LV3A 4IHJB 4KX3A 3HWRA 4I8DA 4X92A 3D69B 1JEEA 2IDSA 2WVGA 1UVQB 4BFLA 3IT2A 2Z4QA 4RIHA 2J44A 4K9SA 4NC9A 3TJPA 4ODHL 3EPPA 3V4FA 2PU5A 2F9FA 1XGQA 5IV2B 2EE6A 4I5DA 3TXAA 4WEBL 2GJSA 5C07D 1ZSDB 4O1IA 5C0IB 1DC3A 4DEPC 5DW3A 3T9CA 2XYCA 4GMSH 2QTTA 5GISL 5CBEA 2BFFA 1P5RA 5EEVA 2IXBA 2X6AA 1F2TA 1VCNA 5IH3A 3MRKA 5GRXG 3G6KA 2XXCB 3R5SA 1DPFA 3OAYH 2GUWA 3B3JA 1XIWD 1W93A 2PPFA 3WLSA 3NYRA 3O3UN 4YJFB 4WKCA 5I1JH 2E5WA 4X7EC 4S3MA 2C9QA 2QNRA 3O6FB 4HZUA 4NM8L 1E79A 4L5IA 3ARFD 2QRVA 3O74A 1RK0A 4FFVA 5DSTA 1EESA 3P32A 4KXVA 2Z9DA 1XR3A 2OL3A 1T9GS 4BFRA 4BFUA 1GYAA 1J8KA 4UTPA 3B3BA 3AR8A 4FQLH 3WHXB 1E3EA 1XZEA 3D6AA 1N5RA 1L5NA 3WL5A 2P2SA 3L5OA 1XTSA 3DDHA 3FSGD 3FKSD 1OXKB 3M6FA 3MA9L 3B1YA 1E0DA 2KE5A 3DXXA 3KJNA 3IEMA 4AUMA 4FJYA 1EEZB 4JRYB 3QC5X 5D1ZI 1R88A 4JU9A 4TSAH 1PZMA 5H4ZA 3CSBA 1QZXA 3MROA 1TGYA 1KJ2A 1F4WL 4GC5A 4ODUA 4Y2VA 5EULV 3ZKSD 2ISCA 5CF3A 2ZWLT 4R7NB 3JVDA 5HUJA 1NN3A 4WFJA 5A7BA 3SWWA 2EZ8A 2F5AL 5FOBA 3GGPA 1FI8C 4CR7A 4QCIB 1PQZB 5FOUA 4RX4A 3NZSA 4RA9A 4XMVA 2FB4L 1YEKH 3CB4A 1Y9DA 2D8KA 3WEXA 4XN9A 3OZKA 1L3NA 2PMFA 3BTVA 3ILPA 3GL9A 1KEVA 4P82A 3MCTA 2EECA 1MOSA 1II8B 2I6GA 2BGKA 4PYHA 5B39G 3GNMH 2ZR9A 2W59A 1U93A 5FLKA 2AJSH 1XGYH 3X11A 4E0RB 3Q2LA 3BE8A 5IAEA 3F46A 3FJTA 1J9QA 5FBLB 5BSTA 1BFOA 5HHMB 4UTAA 2EINB 1CSEE 2QN7A 1VGEH 4YROA 5BN4B 1RE1A 4HVCA 2ZUQB 2AJUL 4Y2OB 1GTJ1 2Q1SA 1VSQA 3AXSA 1CFNB 4DZTA 2V1XA 3EVCA 1N6HA 1NF2A 2Z83A 5NLLA 1GUYA 4WKZA 2XVGA 3S3DB 1L4FA 1V48A 4B09A 3ISVA 4LSUH 5AVVA 3S34L 3FQUB 5IFLA 4XPAL 3HZOA 4TWRA 3PDOB 3AHIA 3P11H 1UZ8B 4X83A 4MQ4A 1GJUA 5EZYF 1XBTA 5JRJA 1YEHH 5DDHB 2CNYA 3BH9B 4XCNA 5J40A 1IM9A 1XPRA 1R5IB 1RVFL 4MS1A 5IZCA 5F1IB 1ETZB 3U60B 1L0BA 4LZZA 2EEAA 2CO1A 4OJTA 1XH1A 1WY5A 2FIRT 3G7TA 1JIIA 1JSYA 4RD2A 1R5VB 4URFA 5D1ZC 1YN6A 1T66D 2VDQH 1KIFA 4DMMA 3VKUA 3BL8A 4F5EA 1AN0A 2FEEI 2OMBA 5FB8A 2VL7A 3TASA 2NX5D 3JX9A 4LOAA 5JROA 2CNOA 3CVIL 1REIA 1BG9A 3GSOA 4P9HL 3ZVVA 3P9KA 4JVLA 2H1XA 5DI3B 1D04A 2VM4A 1Q74A 5HEKA 2PV7A 4CIAA 1TEFA 1B3BA 4L0PB 1RCYA 5AW7B 4XNDA 1HN1A 4JUCA 3BEWA 5CB0A 3JWEA 3DVIA 1RADA 2WXPA 4DPMA 3OHXC 2R0ZL 1GGIH 4OGAD 1EQ2A 4QJ4B 3FTFA 1I4TD 5JHDA 1S9VB 3ONWA 4K2HA 5CHEA 2G70A 4U2DA 2X0WA 4OCYH 2EDQA 1QVRA 3A6LA 2I34A 1N5YL 2GW5A 4KOAA 3JQ9A 3ESBA 1F4WH 4QAJA 3T71A 1XDBA 3KLHD 1NEZA 3HNTH 4MR8A 4BB5A 5JAZA 5KVEL 2GVDC 2NIPA 3QSYA 1W4RA 4FKMA 2WCPA 1RU9H 5LN4A 1QLWA 1FIGL 1EGQA 2BHZA 2FB4H 43CAB 1MGOA 4KUEA 1NBVH 1F2UB 2OT3B 1RHHB 4PTLA 2BRQA 3WYGA 4WW1A 3U16A 4QQ8A 5A7HA 2AXGA 1EX1A 3WFBH 2O0HA 1IOLA 3NQKA 2QQ0A 1MRSA 2R48A 4Y89A 5IROC 1CS0A 5P8WA 5KNBH 5GSRB 4D42A 3EYUL 3U3KA 3ZGZA 3PITA 1PAMA 4X4MA 5AXDA 2XKUA 4CBPA 1YOBA 4N8EA 5FWYA 3CFQA 1B0GB 1XGPA 1J8MF 2QY6A 1CF9A 3LZ6A 2R6HA 1JHOA 1C5KA 3DG9A 4AMKH 5H35A 5CXXA 2MTAA 2R29A 1PJTA 4KRLB 4MQEB 2WXMA 2E6JA 1IC4L 1VF5C 3RFCA 1Q7TA 3B5EA 1XTLA 2QPAA 4ZS6D 1MJNA 1OZAA 4TM8A 3K81A 1K06A 3O03A 1NXQA 4CU8A 4JDEB 5SX4H 5G4OA 5HVFB 3V00A 4E12A 6ADHA 3OB0H 3U7WL 4UM8A 3TFQA 1V3JA 4RVHA 4RGNE 1H5NA 1ZFNA 1X1AA 3CUEF 5TQ2H 2AVDA 4M0EA 1SVNA 3EOZA 5AENA 1MBZA 1SUFA 3FT2B 1JXFA 4B6FA 4NIMA 3E2HB 4OCWH 1JKJA 4EYKA 5BT8A 3AWFA 3F65A 3PQ6A 1JHVA 4PHXA 3G0OA 5IJ0A 2C29D 2V8OA 5ICXB 4B33A 4NAJA 1NFIB 4HBGA 4HUXB 1RS0A 4LIQL 4PV9B 1OK8A 1GRCA 2UZYB 2PSEA 3OAAA 3KXLA 3U6KA 1ZJZA 3OPYB 4A2PA 3VYNA 3MX0A 1JDSA 5I9LA 2IF7A 4EPYA 1Y8AA 3TV3H 5KVAA 3QVUA 2XB2A 1EX0A 2VYFA 2ODPA 2D7OA 1PYWB 2L4OA 3CFUA 4WZ9A 4MCIA 3ADBA 1JZEA 2QPEB 4XA8A 1NNSA 2R0ZH 4V38A 3IKCA 4OGQC 5AKKA 3JARA 1FSGA 4WDRA 5GJTH 5A2LH 3DJFA 3DH0A 3L08A 3U0BA 1N2GA 4E36A 4B40A 5I76A 4V1CB 5SV4A 3PGCA 2ZBUA 3L95B 1ISSA 1JTFA 1QHPA 2FW7A 2GQHA 1HT2E 4U9UA 4YJ2F 3RX7A 1RHFA 3WFEL 1QBKC 2G6BA 4J3FA 1FDTA 4Q4HB 3ZDZB 2FSVC 4MDEA 2X8JB 1RL1A 5AWNL 5ANME 4OM0L 4OZIB 3H53A 1W29A 5LYJA 4IOIB 3BB3A 3W82A 2B99A 3MOBH 5H94B 1ID2A 1K8QA 2WWXA 4B9IA 5SWQB 3IJYA 5A3RA 4RTOA 5CN2A 3VWKB 2BEUA 4X66B 4PEVA 3QLUA 4FNGA 1CZKA 2QBYA 4XASA 5FTMA 5J1SC 4X7SL 1U8QB 2JIZD 4XP4L 4HK0A 3CFEA 4AMWA 1J9RA 3L7BA 3OUZA 1P1VA 3FNHA 3VHRA 5DJZA 1KI7A 1IGMH 1U3NA 3L16A 4DW2H 1MRCL 1N7IA 3F0TA 3KYCA 2OEPA 3OJFA 3QV2A 3DWTA 1NUQA 5EMYA 3N6YA 4MVJF 4A2MA 2BDNH 4E9VA 4O2AA 3TLEA 4JDVA 3RWFA 3GBNL 1PZXA 3IBFA 2WK2A 1LZKA 1F90L 1QRTA 3VA6A 2HJGA 5D93B 3LUBA 4ZCQA 4XSGA 3OAUL 2Y07L 1JJBA 3U7YL 2NTVA 2W8BB 2JAXA 2Q1YA 3AVYA 4K6HA 1YVUA 1A3CA 5CCHE 4B84A 5K4AA 1K68A 4EXKA 3K0YA 2COUA 4P3DB 3EEBA 1FYWA 2AS0A 3OQMA 2XGSA 4XB7A 2XW6A 1M75A 4IX1A 4OB5H 2EFJA 1SPDA 5F9WC 3RI3A 3IJSA 2VK4A 4ZQBA 3AEYA 4BNFA 2HV9A 4P4SB 2ZVDA 4L5FH 3QZNA 4KQWA 4BFIA 1LMKA 3POCA 2QAGB 1APBA 3LKNB 1I8MA 4OZFH 5TQ0H 3JWNC 1XD2A 3N3BC 5FNVA 1E66A 2OMWB 4JFDB 5J1AA 2BKEA 1C14A 3GQFA 4RAQA 3AC0A 1MPAL 3AG2B 3ECBB 1DN0B 1M7IA 1IJEA 2HT2C 4XVTL 4RAHA 2VW4A 2O07A 4B4VA 4R4JA 3C8KB 1CUEA 1GCIA 1QUEA 3VO0A 2R68A 4GW3A 3NOIA 4MXQC 1NYLA 3KPTA 5IUKC 1FQOA 3ZLUA 3U36B 2ICWI 3RUPA 2Y4OA 5HVHB 5IN5A 5DHSA 5IAAA 3MUJA 1NGPH 1FQ9C 4JHBA 1XZBA 4HETA 1UKSA 5F12A 3ZHTA 1NXPA 2V65A 4QWMA 1Z9OA 2COEA 1CZ8L 3MRHB 4YIKA 3GO4A 4Y19B 2CJSA 2VQTA 4A0RA 4U3HA 1FYDA 1MAAA 1IX2A 4ITRC 2WWTA 4OP3A 5DK3A 4BEVA 4CVXA 3OMZA 4Y9RA 3WHKA 2VDJA 4K3GA 4WF7A 5HMLA 2HVBA 4G1EB 5CD5C 2ZE5A 4UTOA 2CDFB 5ITFA 1XGRA 2Y68A 2C7UB 1XMOB 1TCVA 2NZUG 3ZIAD 5DFTA 5DURB 4EIBA 1G0NA 4QHSA 3WLHA 3O6MH 2NADA 3FPHA 4I0WB 4N8DA 3R77A 4MQFB 1X87A 4N3CA 3AO0B 3A23A 1JQ3A 1P6UA 3E18A 3UATA 4RK5A 5EKTA 5F21A 4BGDA 4AL8C 3S36X 2CXXA 3B5IA 2Z2XA 3H2GA 4IDBA 3MUGB 5GP1A 1PZFA 2HSZA 4KO9A 3RTBA 1KKLA 4JFOA 4CLRA 1JNNH 1RWPA 4HNHA 3PGFL 3D8TA 4GXTA 1WVZA 2O2IA 4KNVA 2H2AA 4QA9A 5EOVA 4RKYA 3RGVC 4NQEB 2OFQA 4IGIA 2PT5A 3FSJX 4X4KA 2Y07H 1Q3HA 1O0VA 2VJKA 3TIEB 1JPTL 3C3WA 4PJ5B 3AESA 2J8OA 4I18A 3U5TA 5SWSE 1XRRA 2ZQYA 1DG3A 1G7TA 1L4BA 3NCEB 2CSPA 2Y8EA 4CIWA 3B9RA 2Z6AA 4O3TB 2FUG6 4D6YA 3VCLB 2F90A 3HJFA 1FV1B 2AUNA 3HC2A 3TNNB 5BRQA 2CL7X 3SOBL 2GM4A 4HKJB 5J5AA 3C5EA 5D1XD 4DQUA 1EXWA 1NQVA 3OR7A 1M2OA 1C5BH 3HI1A 4GX2A 1AS8A 2YR3A 2BY4A 2W2OA 3FVWA 2R7LA 1LDPH 3DTYA 1S9XA 2VZLA 3D7SA 2CFCA 1XSJA 2YIVX 4WDIB 2P8PB 1MPAH 1CWVA 4WENB 2QEQA 4U0JA 3LXMA 1FVFA 2JGKA 1A02N 2VEOA 4MV3A 2X5PA 5MP6L 4GZ6A 3RS8A 1DL7H 4AGLA 3SKXA 3PXGA 1KEMH 4NYIQ 5GS1C 3DP7A 2EG5A 2F2TA 3H9GA 5CINL 2FWOA 3NCMA 4GE3A 3M0EA 1T83C 4RH4A 4HX5A 4EKDA 3HMWH 4ZCMA 3PWPB 5DRXA 4UNVA 3PLNA 2IT1A 4X80L 4RJJA 4WHMA 1MIEH 2HU7A 4UPVA 2E56A 3MRDA 3TH4T 4RA3A 1MJFA 1X5IA 3SE4C 1G8FA 1T6BY 1CLUA 3OAWA 1NMBL 5BW7C 5B3JC 3ARBB 4MKIA 3JWDL 1GSHA 3KD2A 2FT7A 4ZVPA 4R0NA 1BMFD 3GT4A 4KHXL 1UWYA 1YMQA 3WYNA 1CR2A 1AHMA 4RFSB 5BS0E 4BQ8A 3T65A 2YQZA 3VO2A 4XWWA 3NIGF 3CLSD 4L8BA 5GOZA 2FFBA 5AI4A 1UPUA 2XNAB 1F51E 2I67A 5T1MB 3PA8A 3B9VA 1MVOA 1JGEB 1ODCA 3T1VA 1O6SA 4LEXL 5F3BA 3HCPA 4TM7A 5KNLA 5KOVC 3IOMA 5LXTF 1X9HA 3OL2A 1JZ2A 1NF3A 4OMCA 4F7PB 2OMXA 1KJVB 1YR9A 2Z0MA 2OCLA 2INGX 3GGSA 4I2XA 4QF1A 4RWZA 2G2RA 1N5MA 3RVRA 4A7VA 1MUJB 3R18A 4I4TF 1NBYB 4F2WA 1UANA 3TIGA 4FE9A 4XGZB 3KVDD 4ZDHA 5TLSA 1NW7A 1YYLL 4BVFA 3TKAA 1QFPA 2WINA 3EXHC 2ALWA 1VKOA 3LZDA 3SYMA 4LUCA 2A58A 3N87A 4CSPA 2NAPA 2B8TA 2WICA 3M1YA 2W2KA 4XIGS 2NNXA 4KWUA 5MI0B 2FJGA 1PQ4A 1M6EX 3KKZA 5ALZA 4FYXA 1PVHA 2H51A 4YRAA 5G0WA 3SE8L 1FDLH 4GLLA 2RFXA 5IW6B 3ST7A 1JHKH 4ZUTA 1G3IA 3RJ9A 4KY1H 1DFGA 2D3VA 4ZT2A 4B3RB 1G4AE 4DCCA 5ALEA 3DKVA 1NT2A 2GHZA 4OIIH 3ZTJG 1DBBL 1FTGA 4WA8A 2O5RA 1BZOA 4H59A 2XVBA 5MEQA 3SSNA 3AOEC 4L57A 5CINH 1ULBA 1E4EB 3MLXH 2BW0A 5EA0L 4BO8A 4GX1A 3NIWA 1IBCA 4QOSA 1PFVA 3PDIA 1NR1A 3FB5A 2O2HA 35C8L 2A67A 1UP7A 4G3YH 1NL0L 1NNI1 4C4OA 4MDIB 5PAZA 1F2DA 1HLFA 4DP7X 4Z9YA 1TEYA 2CDAA 3EXEB 4M7LH 1GYCA 3VDBA 4XB3A 3I92A 5I7VA 2YJGA 4BNLA 4A2DA 3CWGA 2UVPB 3VR5D 2X44D 4LHWA 3DUSB 1G6OA 2HPAA 4AQYB 4F9FA 5JXWA 4GDMA 3M5CA 4CN8A 3U49A 4AX8A 1XF5B 1RP7A 3FU5A 3SYAA 1M2HA 3RS7A 4P4RA 5BVPH 5AMXA 1L5KA 4NGHH 4NN6C 3REFA 5CVEA 5DFWH 2JKNA 5I74C 2V6IA 3RKDD 4WNYA 3CUYA 1FP6A 3TUIC 2I2WA 5D3MB 2GB2A 1TYCA 3U09A 4ZFGH 4EB8A 3KKOA 3QXUA 5KTOA 3CFCH 5DVKA 2BSTA 1U0LA 2RGNA 2YMXH 1YK0A 4RJKA 3QHQA 4HZLB 1CNFA 2FW0A 4Z1OA 3I1IA 2C97A 5E23A 4KLCA 4F8OA 4LQFL 1NURA 2H29A 2WXNA 3FMVA 2Z04A 1XFAA 3EEYA 4PJ7E 1N1EA 5AKRA 1SD5A 2CO4A 3G2QA 5MN4A 2IWRA 4GW5B 5ESWA 4QX6A 1DXHA 4P36A 2MNUA 2E4WA 3DXAD 3LRSA 4EJSA 3US9A 4CDNA 1FU8A 2CLLB 5L8JB 2AJYH 2DQFB 3OY2A 3DUUA 3EG9A 1Q2XA 1LV8A 3ZN2A 3B3FA 2YXBA 4N9GA 1RUMH 4I50A 2A88A 4WCYL 5CIPH 3KYOB 4ZKDA 1IU9A 1TXGA 1XCQB 3O92A 3HC3H 1LUAA 2GILA 1I9RL 4PJXF 3QWBA 1DJPA 1VCIA 1TDQA 2XUQA 3FYIB 4C30A 5E8NB 4KQXA 4QOHA 2Y22A 1SOAA 3P9YA 4ZAKB 4F3TA 1VL0A 4YBLC 1TU4A 4NQDD 3TF7C 5IXSA 4NARA 1QBMH 4I9FA 2EJCA 4JUAA 4ND3A 5KJFA 1W44A 2KYRA 4MQUA 3GLVA 3HKFA 4PXYA 1HORA 3UZEA 2G0NA 1FZJB 3MJGX 3VACA 3I8SA 3LY8A 1WH0A 3ZJ5A 3THML 4RW0A 3B2UD 2WM2A 2WOYA 4NT6B 4RUKA 5CT5A 4PG7A 2QSTA 5EINA 5D7LE 3VFVB 4FD2A 1GXEA 3LS4L 4N2EA 3V5NA 5IAOA 2EXYD 3J81k 3JTTB 3SEQA 2QSCL 2G17A 2X3FA 1Q6ZA 3GS0A 3MMNA 4YLEA 4PB9L 4A7TA 5CCDA 3KR0A 3GXNA 5K6AA 4QYOA 5LUMA 2NT1A 1ZVKA 1VI6A 2ZIXB 4D7AA 2Q41A 4ZO7A 1MX1A 1KCRL 2XQBH 5DJ0A 1XT6A 2ROQA 1Z2DA 3UIEA 2H0JA 5IVOA 3WEMA 2R1ZA 2WG1A 4OZHB 2GJAA 1VP9A 3COSA 2WXFA 2OHFA 4EL0A 3P2EA 2X9LA 5EFZA 1E7VA 1URPA 4PY2A 3SDXF 5BW4A 4EDHA 1RQRA 4CVZA 1K66A 3BD5A 3DROB 1AJ7L 2GFQA 1QQAA 1OM3H 3IP3A 2X1XR 4QLAA 3L3BA 1MF2H 1FYEA 3GLIA 4A6PA 3R76A 1SN7A 3UERA 1T8TA 5GONA 5LAXB 2ZJ6A 1JXAA 2AK4D 3CNHA 2XOTA 3SCMD 1DJIA 4HQ6A 2XHZA 2YOAA 4C6HA 5KANI 3QORA 3VI4F 2OBXA 2WDZA 3T3IA 4UXJA 3MWJA 3SSMA 3WFDL 1X7XB 3GUVA 4AKEA 3DDGA 4FBLA 3MYZA 3KH3A 5CXSA 3D9QX 3HN8A 2Y1ZA 2XBZA 3LW8A 2XKNA 4LJRA 3RVBA 5LB2A 1JWSA 4N7JA 1BBJB 1XQ1A 1IXZA 5MENB 1TA4A 4DSAA 3QUAA 1AQKH 3BEDA 2FPKA 4X8OA 3H8VA 3TW8B 3RJZA 3QXDA 1JFTA 3MTQA 1CVSC 1ZV9A 3U4HA 2RMKA 2O4EA 3AZQA 4NO3B 3F8SA 1P6FA 5DM2A 1TUEA 2OOKA 4B8YA 1J0AA 3JWNG 2SKDA 4ZW8A 2NOAA 3DYMA 1EHNA 4JJOA 1BQUA 3CIFA 1NBZA 5DIZA 3ZU6A 2IPAB 2MOQA 3EAGA 2C34A 2P3SA 2D8AA 3CNOA 5DTIA 2E4XA 5IANA 2DQ6A 1U8XX 4TMZA 1TAHA 1FH5L 4A1OA 1WZEA 1N0UA 2AEQL 3CMOL 5ICYA 2LCQA 2Q76A 5FCUL 3RVOA 3ISWA 2ET6A 3GBEA 2QVBA 1H5BB 4ETIA 2QGDA 1RBZA 4PJ9D 5CR9A 3OZEA 4D8XA 4EXPX 2AN9A 1M7DA 3NC0C 4JDUA 3QUMA 1J20A 1OAXH 5EEHA 2QUZA 2WD7B 5A16A 4YFLI 3QVSA 4TLAA 1INLA 4AG4L 2CFSA 1SQGA 3SSOA 2YC1A 3RILA 1L0QA 3IC5A 5BOSB 2Z35B 1A4JB 1UCBL 2ZSWA 2IPKB 4OL9A 1E2JA 3WXMA 3C87A 1UK8A 4MD4A 3A0RB 3MOQA 4QUBA 2C1ZA 5M94B 1QBLL 2P3QA 3DW1X 3WNQA 3N6RA 2R2AA 1JHMA 3RM3A 4ZZIA 2GUOA 4O1MA 4RX1A 1TT6A 1J5IA 4H1LH 3QWOB 5TH2B 4JAMA 3VOSA 4U1LA 1DMSA 3WSVA 2G1PA 4AJJA 2KL6A 4B5ZA 3L6FB 5B8CA 3HCVA 3EJWA 3GC3A 3UICA 3KQNA 3GN2A 5JR1L 3M7IA 1YYCA 5ANRB 1P0CA 3TTTA 1MNAA 5CSZA 5TNXA 3RBAA 2EZ0C 2V1UA 4G5HA 1CPUA 1QKKA 2ZLBA 5JEEA 4XIIA 4E2OA 1WIUA 2R1TA 1IWOA 2JH3A 1IGCL 3UPRB 2VRCA 2AQRA 2PU7A 2CDNA 2XNSA 3O95A 3NAAL 3WFDH 1ZLVH 3LN4B 3VGBA 1OT3A 4RZQA 2OILA 3IBYA 4NJAL 2O4CA 3NJXA 1YC8A 1S89A 1T1IA 2YW2A 2FECI 1YC2A 4NFSA 4R2HA 5HMMA 2C9PA 3X44A 5FR2A 5IARA 3BD4A 4NZ8A 1V4BA 5J3JA 2BNRE 1RYMA 2OECA 4OLWH 3KFXA 1ZMRA 3GNLA 4JFSA 4AQ1C 2FSEA 4YCAA 1I4LD 3BUPA 3PQ2A 3RSLA 3TI9A 4Z7NE 3OCXA 4Z7WF 3L3GA 4KUCD 5AVKA 1OTUC 2C31A 3HA3A 3EYQC 2CVPA 5TDNB 3T0EC 4PS4L 3ML8A 1FXUA 2H3EA 1NLMA 3H2IA 1KJZA 4HS9A 3P97A 1Q0XL 2XX0A 3RRJA 3CMOH 1R47A 5C8YB 3BPCB 4NP6A 1ADQA 4U7GA 1NVTA 4LYJA 2DBJA 2NP7A 4OD3H 1U3YA 1Y82A 2D2IA 2BP0A 1AI1H 2HLHA 3UB2A 2WABA 3KPSE 3R40A 3GBSA 3BPOC 3TCXA 3ZHCA 2RONA 3A14A 1Y0LB 5INDA 3BMVA 3FQWA 3V4VL 4MA8H 1W4BA 4X6XA 1IQDB 2B4QA 1X7ZB 4FDTA 1ZHLB 4NV0A 3DZDA 4HKXA 3FB7B 1MNQA 4Q15A 3D39B 2FW9A 2Y66A 1SIWA 1CRPA 2WYUA 2BFGA 3QHZH 3PWJB 3IBTA 3EVTA 3DVRX 3D4IA 1GVIA 1UL1X 3BDYL 1O94A 4JOSA 2TSYB 4GRWE 1TLTA 4PZDA 5I7FA 2VSNA 4V2BA 3BAYA 3KQYA 1TF2A 2IYPA 3OWOA 5LZ5A 5CBPB 4R0VA 3JQ8B 4L8DB 1L4EA 3A1TA 2Q8BL 2FZ5A 3PX2A 3QDJB 3MLUL 2RCSH 3OG4B 5LPNA 3K6JA 4J27A 4OQQA 3MMXA 1HK6A 2GYWA 3DJTA 1PEAA 2ICCA 1S2OA 3L8MA 2XCQA 3TO2A 3IMVA 3VFSA 1NWCA 2DM2A 4U2GA 2VLIA 2APSA 3GCZA 3PJGA 1GJWA 5E2AA 3NANA 3I8XA 1CFTA 5IN4A 4WWKC 3GMQB 3C7KA 3CNNA 1WE5A 1YQXA 1ULHA 3GFQA 5DFAA 2HKHH 2R2BB 1MXHA 3PYLA 2FR4B 1WJ3A 3SKOB 2EGHA 2EDNA 4R8RA 3DFKA 2GRUA 1B0RB 1A6AB 2VWHA 4OLVL 4G70B 1L7BA 4BLOA 3V33A 2NY6D 2GVZC 3D51A 2O3TA 4B3JA 3L9RA 3BFVA 3RS2A 3JALB 4QNPF 2W0MA 1NW4A 5IW8A 1S01A 4FQQB 4LY9A 4Y1RB 1R5WB 5L8VA 2ZJFA 3R09A 4C1NA 2H3KA 2DR2A 3TJZA 4P2CG 5DYGA 3JU3A 4KFZC 2CEAA 5HYJE 1YS6A 1KBWA 4LVNC 2D31B 4D9BA 1EERB 1VYTA 4ZVSA 1AGYA 4OQZA 4XP6L 2XT0A 2ZJBA 3T6ZA 4Y5YA 4LSZA 2G25A 2VDQB 1J11A 3PC7A 3VNYA 2ZM6B 3AVPA 4FL4B 2H2PD 3LM8A 3B1WA 3BGIA 1O9WA 3E2MA 3FSOA 3RIGA 4TN9A 3RZCC 1M2VB 3VG0L 3V0VA 1NKSA 4JL5A 1FYTE 2YPVH 1WICA 1ZRMA 4IX9A 1X7YA 4V3CA 4K6FA 2D7NA 3BQNB 4XP9L 4XHJD 4G1BA 3CZFB 1PO7A 3BX7C 4JHAH 1A9XA 3X1BA 4OAWA 4REQB 5CCXA 1FDSA 1ZNXA 3HS0C 5MFZA 4BB6A 3MWEA 2JD2A 3HBMA 1JXOA 1CJSA 4ZYUA 1EH9A 1Z29A 5AM4A 1TEZA 2BFVH 3IDQA 1J33A 3T7AA 4HG4J 1C30B 2IZ6A 3ICWA 4RLSA 2EICA 4HFMA 1XVSA 1G7IA 2ZTBA 2P27A 5EO9A 2FJUA 4K0RA 2FA9A 5DJAA 2PKYX 4C0XA 1RUAH 1NP6A 5KSBB 1B1AA 1I2CA 2NT4A 3O8BA 1V39A 1KAHA 2H4ZA 2BNRA 4HLUC 1E6CA 4XZ4A 4HT1L 4OHZA 1VC2A 1W1WA 4LARH 2B9BA 1H2ZA 1ULZA 5JH7B 1G2IA 1AB5A 3D54D 1AZZC 5JWOA 3GMLA 1TO1E 4MA1C 2F58L 2KDGA 3CTTA 4BBZA 1SQ6A 2GSGB 2JEZA 1EDZA 2AFHA 4HW6A 3RWDB 1UB5A 4ZWNA 4BHUA 1OWLA 2A3NA 4CL3A 4YBZA 2G3XA 3OA2A 4LJ7A 5A9TA 2V4MA 1YY9C 1BQLH 5IW1B 1U4NA 4ENQA 1PX3A 3D7PA 4K94H 2GKGA 4EOWL 2IO5A 3LIZL 1EXUA 2FZ3A 4RL4A 1EAPB 5IM5A 1DCKA 4XEUA 3B9BA 1OLUA 4RHEA 5EJ4A 4DQXA 1UDBA 3N59A 4AF8A 3QQ3B 4WV1B 1U99A 3GD7A 3RVTD 3T08A 4AU1A 5IB3A 4G83A 2Z5VA 4QHLA 4KAAA 4DR1B 2ODQA 3QV1A 3PABA 3T61A 3CMMA 1YZGA 2IPUG 3OZWA 1N75A 4WLEA 4NHUB 4HS3B 2QTVB 4PJFF 1S9KC 2PD6A 3G08A 1ODIA 1U7XA 5JIKA 5TQ2B 1YWGO 2VPZA 2EYRA 3PJSB 3W6NA 1QKJA 2PVCA 4O4HF 2XWJI 4ZX5A 2VISB 1XZNA 4Z7UA 2BFBA 5I8WA 3LNHA 4CMKA 2JLCA 5I7RA 1NINA 2EHJA 4WA7A 4NHCH 4N0CD 4ZUVA 1O7VA 5JHLL 3DHNA 1A98A 4KVAA 1DJYA 4BRUA 3CZSA 1ORDA 4DJFC 5E95A 4K55A 4WFHE 3I9V6 5FO8B 5JOEA 3U3MA 1AMOA 4KACA 2G77B 2HA6A 1E2ZA 2IQAB 3GHEL 1HURA 1PUJA 4GP4B 1VSTA 3W05A 2O1WA 2XDQB 1LDBA 1P4IH 4HA1A 3R1GL 3T1NA 4WI2A 3FU3A 2VHYA 4F7DA 3TX4A 4PJ7B 4JRXD 3TA3C 5BT9A 1WA0X 4CLEA 4DA7A 1KY3A 3QUXB 3NFYA 4ALLA 3RS0A 1IUPA 2WJ4A 4BXOA 3S5LA 2B1AH 3EDJA 2O8BA 2BGTA 1MOZA 1GGEA 1P1JA 2CJYA 2ZRCA 1FTWA 2FUQA 2IXDA 5DM0A 1UG9A 1I1HA 4KKBD 4LLAA 5B7GA 4EN3C 4KUZH 2X12A 3U2SA 3UT0A 2N75A 3ET5A 1LC3A 4V0OA 4YT4A 4FGLA 3TQHA 4A6YL 1SFDA 3L3DB 1R4NA 5EP4A 5IXJA 5KJCA 1G9EA 1AF4A 2NNAB 3NZHL 1PV2A 2WUVA 1ZD1A 3UTSD 1Y7VA 5IBTH 1WTGT 2XN1A 2WI8A 4EY3A 5CJ8A 3AWIA 3D3QA 4LB8A 1WZCA 1H2XA 2A83B 1G19A 4GEGA 3LFHA 3CHOA 4AN4A 5DGIA 1UMCA 3FOEC 5HYJA 3HO1A 1UPBA 4P7GA 1GQOA 3O4LD 2ROXA 4P2RA 2CRIA 4JO4L 1UWGH 5DJ6B 2Z4RA 3WTVA 4P23A 2ZTSA 4MJXA 4ZAVA 3ATEA 2R59A 1I5OA 3LC7O 4Z3KA 3C5ZC 2I6UA 2BM0A 2E5LB 2XZTA 1AS3A 1ND0B 5TF1H 4U7DA 4JZNA 4M9RA 1CD8A 3W1ZA 2AN1A 3ZBQA 5EB9A 1ZVMA 2O6LA 4R8KA 3HUJA 2FATH 4UT7H 4BDVB 2JGRA 1EDQA 1YUMA 3K74B 4L4XA 1LI7A 1P62B 2HYIC 3H18A 4JLUA 2NM0A 4U4BA 1YZQA 1AO7D 4F7MB 2CMFA 4MSWB 2Q6KA 3TH2T 1V5JA 4OGZA 1JN0A 1OFIA 3LFUA 2BZGA 4ZZ2A 2W0KA 1O6FA 1B4DA 4M76B 1DLFH 2FSIA 2HJFA 5CEYA 2WVSA 4BL5A 4S0SD 4JLNA 4HQQH 1XTRA 3DVFA 1Y3AA 3SC3A 3T1FA 2HRRA 3OEHD 1QR2A 4AZ3A 3WFJA 4V03A 1YKFA 3W6UA 3Q8XB 1JVLA 2YKGA 1JAYA 5TJHA 5C3TA 2ECOA 2DM6A 5DMGD 1YR3A 2OR9H 1N0LB 1X7WB 3CF6R 3O9WC 4DERA 1SOMA 4HCGA 3WD5L 2IV8A 2IOMA 1NC2D 3OESA 1QHGA 3K6SB 2BFDA 1DAGA 2JZOA 4ZEVA 4WOBA 5HTOA 3I8OA 2HT4C 4H7DA 3AKEA 5EMHA 2WD8A 2NAFA 1BMQA 1WAPA 4FYSA 1SHSA 2FIKA 4BNGA 1JV2B 1FVOA 3TOZA 5ACMA 2I60L 3WBJA 2WMNB 4O2EB 4OZFB 5TQ0B 3BIFA 4TVPE 2Y5TA 1ISJA 3HDJA 3VAYA 4OHOA 1XJCA 5DT2A 3U4CA 4IIFA 4YPVA 4KAJA 3RUFA 1BWPA 2VXVL 3SYPA 2WCSA 3AREC 4B3SB 2EU8A 3VX1A 1W0YT 2AEFA 4X3CA 3T0BA 1DJLA 3A9WA 4JSYA 5AAMA 5CGZA 1HFJA 1IKFH 1GA2A 5AW0A 4KXDA 1SJHA 1O4VA 2REBA 4PW9A 3I9NA 4K9NA 1JGVL 2KYIA 4HUUA 4E5XA 3O4RA 1Z9SA 4JRYE 4ESHA 4YHKL 3ZK0A 4WLCA 1I7TA 3BN3A 1X13A 4GM0A 5C5IA 3GP3A 3VMMA 1P2DA 4D3SA 5B1SA 3G2NA 5LGJA 1W581 3M6LA 4RA6B 1JF5A 4JK0D 2V8MA 4Z3JA 2NXZD 5JAOA 4PPTA 2M1KA 4ETYA 3BWMA 3KUDA 2Z1PA 4L8SA 4F2EA 4LX0A 5C0NC 3S2UA 3CT6A 2CGEA 3SY0A 3LHIA 1M6NA 4ED9A 3QXVA 2PBFA 4P3CL 4HGKC 4FGJA 4DSTA 2AW5A 4KBYA 4XNZB 1NLDH 2II6A 3CH7A 3IUSA 5D4IA 2XTLA 1ZLYA 4IS6A 1E6OL 2ZSUA 1HH6A 4UHKA 2FAUA 1BLNB 2Y4SA 2O1EA 4U02A 2WVVB 2KB0A 4YZFE 3G8AA 2H1CA 1F48A 1U58A 5HHME 1NHWA 2WLZA 3V2UA 4DHLA 3TVMB 5EBWB 3K1JA 5JBNA 4AQOA 3BH7A 4MAFA 2BI4A 2DRUA 1G6RL 3ACCA 1R3DA 1CS6A 1ZGAA 1L7RA 2XR1A 1DJOA 1AP2A 1V3VA 4LSDA 1HFKA 1T4DA 3A3YA 2EE0A 3QIWD 3C3KA 3NHZA 3RFVA 5JANA 5KYUA 3LKVA 3RAJH 4RDQG 3IJ8A 4W9GC 3TKLA 2KBEA 3WGOA 3PV6A 3JQFA 1FN4B 3UP6A 2AC4A 3U0TB 1CR6A 4Q7KA 2MNJB 2FHPA 2OZ4H 3I34X 1XUOA 3WD5H 2BSEA 3VXQA 3BT2H 4Z76A 5HGDB 1EGJA 5JS2A 3FNFA 2YHBA 3WQSB 4BO4A 4Y6PA 4F71A 4TL5A 1DQMH 1WMEA 2W1NA 4XNMA 1TCMA 4N9QA 1XAIA 4IJQA 1QUNA 1JIXA 3FYTA 1BMDA 4GYWA 2ED6A 3QBJA 4DPAX 4R84A 2JWGA 5LQJA 1BE0A 4X91A 4OLZH 5K51A 2VXVH 2C3GA 3EUUA 4NQCD 1T0PB 4HKZA 4RD6A 1TSRA 2FMKA 4PLJD 2P9BA 2J9RA 3A1FA 3PNPA 3Q6GL 2BEWB 3QEMB 1AXTL 5DJDA 1GOFA 4HUJA 2R25B 1DTWA 2I25N 1C9JA 3C8HA 3ISJA 4OJDH 4AC2A 3EVBA 3ALXA 4P07A 2WWHA 4UCWA 1HYSC 3CPJB 3H5AA 10MHA 2V5UA 3OZXA 4O25A 3KYKL 4U3XA 1OGIA 3A4LA 5AK0A 5BQ7B 3UT5A 1TQCB 4N54A 2AXHA 1J2UA 4KI1A 4QOKB 1VBFA 5TPZA 4YE4H 5ITVA 3A06A 4Z7NB 1D5IL 4C7XA 1XELA 4TUJA 2IADA 4WO0A 1GNQA 4FNAA 3ANMA 2EDFA 1LFDB 3AACA 1FQKA 3ZZ0A 3IR6A 1JSXA 2BVOB 3R3ZA 2HWUA 4PGCB 4J3SA 1C7ZA 5EESA 4D9HA 1QTRA 4P3CH 1AMXA 4YUEH 1VJSA 1QU3A 3KAAA 2ORBL 4MZ2A 3R7LA 3EA5A 5KBLA 3LSYA 2LR4A 3WY4A 4NYLB 3KJXA 5DSCB 5E4AA 4Y5VA 3KPSB 1DX9A 4F38A 3PPEA 1W2WB 1HHKA 2F8OA 2QW8A 5JQIB 3LYHA 3P0EA 4QT5B 2O8DA 4JCCA 3PGVA 4MHHG 1A9SA 1LVEA 2OP4H 5F7OA 4PB0L 3RBSA 1HLDA 2V7VA 3TEUA 1HE3A 1SCBA 1ZIXA 3CO0S 1UFVA 3RZWA 1KOLA 3MFFB 1OZUA 4JP2A 5G53C 3KPQB 4LRIC 4IINA 3NHFA 1YEFH 3HVRA 4MWFB 1DR9A 3C6BA 3KR3H 1UH4A 3UXEA 5I75C 2O7RA 3CA8A 4ILEA 1B73A 3UZQB 2HSEA 1EEZA 5IWAB 4JRYA 1PW3A 3Q3GB 1NUSA 1E3QA 1TMQA 2AXNA 3PIQA 1HLPA 5I0VA 2O72A 2QX6A 3GRCA 1H1LB 1BGXL 1NEUA 4R7LA 1E9BA 1U6IA 1MH5B 4R7NA 1CDHA 3FBQA 4LSQH 4FS8A 7REQB 2PWAA 3ZGOA 1PQZA 4IIGA 3CQFA 2GIMA 5E1DA 2JFPA 2J0SA 1E1NA 2KKQA 2WO4A 5A6LA 1BW9B 4XVUA 4F2GA 4HZGA 1R19A 4DSOA 2WY3B 1Z5OA 1ANKA 3AR6A 5TS3A 5JW4R 4L5BA 1NGXA 2FEDD 4P84A 1Z36A 1S78C 4DTIA 4IO1A 3FC8A 1ZUWA 3OTHA 5J3HD 3GBVA 1OB5A 1YJQA 4K2UH 4E0RA 3LUHA 3ZCQA 4PBRA 4NDZA 5HQ3B 1FSSA 3O21A 1HNGA 4MWCA 2Q99A 3H8WA 3T8XB 4XC3L 5J63A 4HS8H 1XVAA 3KPRE 4GQAA 5BN4A 5HILA 4B71A 4Y2OA 3MHTA 2VQUA 1CFNA 1OZHA 3DO8A 3MUY1 4DNPA 1PTKA 2CCJA 3DGCR 3L0IB 3MHZA 2QQEA 2QUJA 2CCLA 4O5OA 1IHOA 3P30H 3D9AL 2DFPA 4YS6A 1MW8X 3PDOA 5KQMA 3I23A 4OCXL 5IESH 4DYVA 2FQQA 3DBHB 3ABKB 1T4MA 2C4UA 4OGKA 2IKQA 1CLZH 2GEJA 3BH9A 4OGYH 4ODXB 2OTWB 2Q8NA 1FIUA 1HZHL 2OTUA 4OZIE 1R5IA 3WYRA 3FM9A 5FUCE 2VA9A 5F1IA 1WQ4A 5GS0D 2AEPH 1DLJA 4O5LL 4M1WA 3O47A 1W4LA 5FYKH 4W6ZA 2XKBA 3ZN6A 2Z31A 3KCPA 1XMSA 1INEL 1R5VA 4PJ8A 3PQEA 5LQSA 3B7YA 2V37A 3N2GA 1QFWL 3CNEA 3NYQA 8ABPA 4WNCA 4FNTA 1O89A 2K7QA 3FQTB 1GWNA 4A0FA 1V35A 5AKEA 3S4SG 5DI3A 4HAWA 3GPLA 4YX2H 3PLYA 2VAXA 3UH0A 2BJVA 4BHTA 2VO8A 2AP2A 4FQ5A 5AW7A 3KQOA 2CY0A 3W11D 4A8PA 1JGTA 1MCNA 3MNFA 5MN6A 1GC1H 4N0DA 4B43A 3S2YA 4I85A 5HKOA 1QMUA 4QJ4A 4N12A 1S9VA 4MCYA 4NUGH 1WT5C 3AG6A 4KFTA 2JJTA 1IY0A 2HA7A 3KR2A 2PUHA 3HUFA 2UZPA 4ANXA 4B79A 1ZDMA 2PWYA 5JA8B 2QNIA 1NI5A 1BHO1 4WW2C 1L6XA 4G4GA 1QSEA 5HY9B 1U3UA 2JC3A 2HW8A 2HX8A 3AKCA 3HPLB 3U4QA 3WIHH 3WOHA 4E3ZA 2C95A 2RHBA 3R5FA 4FQCL 5E1HB 3BILA 2PYZA 3MFQA 4IDJH 1TT5B 1F2UA 4XP5L 1RHHA 1YZFA 2CB0A 4QICA 4MWGA 1ORSA 3Q41A 4JT2A 4J4BA 2YS4A 4Z4GA 1CD5A 1MO5A 2BGMA 1AKJD 5KVVA 4X4XA 1R9NA 2IDKA 5IF0A 4WFGD 5LA6F 4B6OA 1XBRA 5AXAA 1YHNA 1W85B 1WAAF 2HUNA 1WB4A 5GSRA 4ALIA 1K7XB 4RZ3A 4JFDE 3FU8A 1UR5A 2OLEA 3STLA 3NIDF 4NAQA 3EN0A 5BZDB 1KK1A 1BOOA 3U1PA 2Z56A 3UJ9A 3DURB 4LJKA 4RIRA 3BI9X 1ASOA 1PY4A 3H83A 5EVJA 4PFQA 3GF4A 5F72S 1NUPA 5K3BA 2WKGA 3D5OF 1KYDA 5KZCD 3C8UA 3OD5A 5H2BB 5AOVA 1I2AA 3WS7A 4NFCA 1JF1B 2EZUA 3HUUA 2Y2TA 4N65A 4H4EA 3R0JA 4MAZA 3FVVA 5IB1A 2N0MA 4JDEA 2X9VA 3ECVA 4FZEL 3E5HA 5C31A 5AD0B 1C1YA 3PS9A 4MUFA 1Z8HA 1C1XA 1HZHH 4WLVA 1N6VA 1KO1A 4AGPA 3MRNB 4BXVA 2XZPA 3MTEA 2QLYA 1XEDA 5CK4A 2CKBH 3QUZB 3FT2A 4WY7L 5GGSY 4O5LH 5FM5O 5T4FA 3UMYA 4WUKL 1M6YA 1QVWA 3N50A 3LPOA 1O03A 1MOEA 1YMMB 1INEH 1T3FB 3DKPA 3EFFB 1MIOB 1ZIDA 3V2IA 4WO4D 5ICXA 2VTBB 5IDXA 5K5EA 1TF5A 2UZIR 3LKQA 1VIYA 1CYXA 2UZYA 3MXWH 5FH9A 5ILOA 2ESRA 1QOPB 3OPYA 4TN5A 5KSZA 4FVTA 3CUSA 3OKWA 3TRHA 4CMCA 1DWOA 4HV8A 4ONFH 4HN2A 2DYPB 1NBCA 2IH9A 1PYWA 1YJAA 3IB4A 4NQXA 1BC5A 2FHFA 4Q3KA 1THAA 5THQA 2YD9A 2CWWA 4IRSB 4Q05A 5CBKA 1JOIA 1Z5HA 3QI9A 1GITA 4AE0A 1IEWA 2AOTB 2JVUA 4M48H 1BGWA 3W34A 4NQEE 3UC0H 5IFJB 3RRZA 1KLFA 4Y4HB 2PZJA 2WIKA 4D41A 4PJ5E 1Y6JA 1FNEB 2ERXA 2VJQA 4QOJA 3KLAB 4CMIB 4L0MA 3V1UA 2FDBP 3DI2B 5E0KB 3A7DA 3VKWA 2VXYA 2NO9A 1W9MA 2GJ9A 3JQQA 1OH7A 1XRJA 2JF0A 5I45A 2Q0XA 2FN9A 4X7MA 3GVIA 4Q4HA 1UBGA 4DBLE 3QJQB 2X8JA 2GN1A 4MGHA 2Y77A 4OZIA 4YDVA 3BF7A 4CMMB 1XX9C 5KC9A 2W6ZA 2NVOA 4EDFA 3PZRA 2XWCA 3TLGB 3YASA 1KCWA 5HHQA 1BM3L 4OVVA 3KB8A 3LZOA 3RB5A 5H94A 3HE7C 1MW9X 4FMPA 1CJCA 4E4TA 5SWQA 1MCZA 4CMAA 4EZLA 1GUDA 2NT3A 1MJ8H 5KSAB 3WNPA 4Q21A 2R1UA 4HFWB 2NSDA 3HG1D 4MS8C 1LX7A 1YQDA 2J41A 1GYVA 4WOKA 1MAUA 4K8RC 1Q92A 3MJRA 4CN6A 4I9WE 4BV2A 4CR8A 3VB9A 2ENJA 1KK3A 1DBQA 4DXDA 4ZYYA 2H00A 1O5TA 4J3TA 3APCA 1L7NA 4F4HA 1D4ZA 3FMPB 1VADB 3AUUA 2HADA 3C5JB 4HAOA 3JQGA 1LQTA 1A1VA 1FJGB 3OLGA 5E1GA 4BNWA 1F2XK 4AQ7A 4E51A 1LXCA 1TD1A 4OD1H 3G5UA 4E9WA 4LRTB 3BAXA 3OPZL 5FBZA 4UM9D 3PWPE 4V0NA 2CGYA 1JZ6A 2W8BA 4G8JA 4BK5C 3VRIB 2MJLA 4ODBD 3O4HA 3UGXA 5JXED 2PFGA 2IOHA 1F1AA 2QPFA 4GRLD 5ALGA 2FCRA 4H1LB 4DKJA 3KJHA 3B2VH 4UU7A 4QULA 4W1QA 2YQ3A 4G72B 3L49A 2H7CA 2XXAA 3GMMB 4P3DA 5K39B 2GJKA 1YC5A 1NMEA 4DNXA 2HMAA 4DV0B 4PM4A 2HT3C 3CSYA 4KQ1A 3B78A 1SUJA 4TL9A 4TSCL 2Z1NA 3ULKA 2JIXA 5TJ9A 4E9RA 4Y2HA 5C34B 4MIYA 2Q3HA 2DLHA 1KMGA 2IY8A 4PYMA 4M8SA 4NMHA 2YK1H 1ZX1A 3N0PB 5HRAA 2P43B 1DL5A 2GFBB 3L8EA 3DK2A 3KOZA 3WKYA 4LL9A 3LX9A 5F7LB 3CIOA