3ZDZB

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 111
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3zdzB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3zdzB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3zdzB03
1N9ZA 3BQNB 4MMYA 3M6FA 1DGQA 2VC2B 2WINI 1ATZA 5BV8A 4F1JA 1SHTX 3BN3A 3OKYB 1U8CB 1BHO1 5HGJA 3QA3E 4PN7A 2NVOA 3FCUB 1JEYA 2O7NA 4IXDA 3EGXB 4FX5A 4WK2B 1YVRA 2I6QA 4A0QA 2XWBF 3K72B 2P28A 4Z7OB 1M2VB 3F78A 1XUOA 4F1KA 1JEYB 5KYWB 5KYXB 1IJKA 1ZOPA 2M32A 2XWJI 3NIDB 4BJ3A 3RAGA 1V7PC 1PD1A 1SSLA 3EGXA 2VDPB 1ZONA 4JX0A 3EOAI 4MMZB 2NUTA 3FCSA 1U8CA 1MHPA 1RS0A 2P26A 5E6SA 2VDLB 1RRKA 2VDRB 4IGIA 2ADFA 4UM9D 4M76B 5KYUB 1NA5A 3N2NA 1QCYA 3HXOA 5KYWA 3EH2A 4XW2A 1IJBA 4NENB 1T6BY 3ZE0B 3AFCA 4WFQA 3K6SA 2UZYB 5KYYB 1FNSA 1QC5A 1Q0PA 1DZIA 1T0PA 3K71B 4HQOA 1FE8A 1MQ9A 3NIFB 3EG9B 3EGDB 3TVYA 1RD4A 5HJ2A 1MQAA 3PPXA 4HQNA 4C29A 4G1MA 5KYXA 3V4PB 1L5GB 3AL8B 3PPVA 1YUKA 1PT6A 1OLZA 1CQPA 3T3PB 1CK4A 5KYYA 4G1MB 1LFAA 4CNBA 4CN9A 4WK0B 2NUTB 1YVPA 3AL8A 1L5GA 1JLMA 1U0OC 3EG9A 3EGDA 1IDOA 1UEXC 4O3UB 4C2AA 5KYNA 5LN1A 1U0NA 4MMZA 1XDDA 1AUQA 1M2VA 1M2OA 4NENA 3ZDXB 2NUPB 3K72A 2VDKB 3PPYA 5E6UB 3TCXB 4FWWA 3EOBI 5HDBB 2VDOB 1SHUX 3PPWA 4Z7NB 1TYEB 3TXAA 1SHYB 3HXQA 2ICAA 3TW0A 4CN8A 3FCSB 1MF7A 3HI6A 4HQFA 4HQKA 2NUPA 4GZ8A 3GXBA 1QC5B 2VDQB 3T3MB 3ZQKA 4WK4B 3EH1A 4C2BA 3NIGB 3V4VB 4MMXA 1AOXA 2VDNB 4O02B 3IJEA 4G1EB 1BHQ1 3EFOB 3Q3GE 4Z7QB 1XDGA 3VI3B 2I6SA 1PD0A 4UM8B 3OKWA 3K71A 4IHKA 1SQ0A 1N3YA 3K6SB 1MJNA 4JDUA 1JEQB 2IUEA 1RTKA 1M10A 1ZOOA 2X5NA 1M1XA 1JV2A 3OL2A 4MMXB 1OAKA 2XGGA 3E2MA 3VI4B 4MMYB 5ES4B 3EFOA 3NVQA 5KYUA 3ZDYB 2ODPA 3AL9A 3BQMB 3ZE2B 1IDN1 5E6SB 1AO3A 1JV2B 1M1XB 3ZE1B 3OL2B 4O3TB 1MQ8B 5E6RA 2WW8A 4K3JB 3ZDZB 1M1UA 4HQLA 5E6UA 4G1EA 1PCXA 4WJKB 4NEHB 3F74A 2ODQA 2I91A 2VDMB 3IJEB 4O02A 2B2XA 2QTVA 3IBSA 5E6RB 4UM9B 1JEQA 4DMUB
chains in the Genus database with same CATH superfamily
4GE3A 4LVCA 1HKFA 4X4XB 5CB4A 1UK9A 2B0JA 3PLRA 3ZG6A 1UAGA 2O8FA 2G5PA 4AYDC 5CH8A 4CLXA 4URYR 4EKEA 4Q4CA 1W34A 3X1XA 1Y9EA 3T1FA 1PN3A 5E9DB 1ZD6A 4JN1H 4DT2A 1I5OA 1HE4A 5DHMC 2OXFA 3LDBC 3LCRA 1RZQA 1L0XA 4MCNA 3KPUA 4GINA 4ZI7A 5TE6H 2YIHA 4PG5A 5DBFA 1I3KA 3USES 3VG9C 3FQTB 4ETWA 1M34B 1G0NA 4AC2A 4QXOA 5HUQA 4PJ8A 5FPYA 3UMJA 2O1AA 4RKYA 2J0QA 2F54E 3IX7A 4BGIA 3V46A 3KBEA 3ENQA 3NVKI 1THMA 4A2WA 3N07A 3AV0B 3WGLA 5KBLA 1LEGA 3KPVA 4WV1C 5IF3A 4UTCA 3JWNG 3QISA 3ZGYA 3T8XA 3OQIB 5B1IA 2BIMA 2P7TB 2QJWA 5KQMA 10MHA 5A7GA 4QHLB 2P6NA 2XR1A 1Y1RA 4NCKA 1D7DA 5BRJA 5EMYA 4IBOA 4B7IA 3UZVB 3ZQXA 2W9LA 4ZEOA 2O3QA 3LBNA 2WHXA 4M83A 1KJVA 4P46B 3T6ZA 3MJEA 3I6BA 3OVMA 4EOWL 3VQTA 2BHRA 5IFAL 4MQUA 2IYPA 4MZIA 2YWCA 1XWVA 2Z8YM 4TRPL 5DYTA 4A38A 3VFOA 5P8WA 3WEXA 4RIRB 3T35A 3CWZA 4MD4A 3DX3A 4FXGC 5JNTA 1DEEA 4TLEA 4IIYA 4N5MA 5BYAA 4YWGL 3Q8KA 2OSWA 3RZWA 1PJTA 1RC1A 3CUUA 3UWPA 3JXEA 3MX0A 1ASOA 2EDEA 4BDVA 4KDVA 1XMSA 4IF4A 2LBPA 1X5LA 4ZFOA 2VPWA 1HEYA 4F2WA 1MIEL 4RM3A 3VRHA 4BNFA 3DX1A 4GOJA 1UBTS 2DQTL 5AK0A 1NUQA 2PE5A 4WA8A 1I7DA 4ZMZA 1RY7B 1FNMA 3F1KA 2GBFA 1GFSA 5I8EB 2W70A 1D5MB 1A22B 2J2ZA 3OURA 4XD7D 4ZT4A 3SLRA 3AUSA 4BQBA 5JCZA 1AGEB 4MAYC 3NCEB 2ZS7A 2G25A 2ADJA 2HRQA 2Y1ZA 4Y5YA 3AW8A 4Y4KD 5FHRA 4RVUA 3LUHA 4B7LA 3UJIH 3E3AA 3PHCA 4LDLB 4FYTA 4IMIB 4L3OA 4OKIA 2IUEA 1B0RB 2XICA 5DVKA 3KOXA 4QIHA 4C3VA 2YMQA 1MKYA 5DJCA 4ZFFB 5FOBA 5HPMA 2COQA 121PA 1QKIA 2GK0B 4KMSA 1TLLA 4Z9YA 2HUEA 4X7SH 2P0EA 3GJXC 3EPKA 1I7ZB 4BO0A 2B3DA 5TY0A 2XVYA 4F7PB 1G41A 1KQ3A 4LQCA 4YRIA 4WJLA 2CA4A 4U2EA 3WLPA 3VXME 1DBQA 1S7TA 3ZGIA 4OGAD 5JLZB 4UARA 1O6ZA 4DSUA 1P7VA 4OKDA 1BYIA 1NC2B 1NC4D 4HRAA 1JEEA 3M6LA 3MPCA 5CCEA 3QU5A 2DFVA 1T9CA 5JNSA 5B1HA 3O8QA 3N87A 3O4IA 1FFEA 2Q3EA 4B8ZA 3H1AA 3IURA 4LF4B 1R6XA 1JKJA 1WOMA 3W1VA 2DLCX 5I76B 2A77H 3ZHLA 5CA1A 4UDOA 3OLVA 4Y1GA 3EGVA 2DWXA 4PLKD 2GUOB 4G86A 5J1AA 3UUWA 1XYGA 3EOBI 1R0WA 4KJWC 1UMCA 4WEMB 3H3KA 5JCPA 1BFVL 5TDOB 1ZA6A 1GJWA 2CM5A 5J9PA 4ER0A 4EL5A 4IRJD 1DVRA 4DJ5X 2Z8SA 2P5WE 2RH9B 1CY6A 2PLWA 4IU2B 1FU8A 2ZDGA 4YQYA 2DDQL 3K4QA 1QSFE 5C5DA 1Z33A 2WLNA 1WHSA 1JNHB 5F7EL 2B0SL 2YJ5A 3BE5A 1W2HA 4HB4A 3M83A 3T4YA 3ENKA 3C6SB 5KMGA 1X7TA 3DGGA 1PHRA 3HHMA 5JCOA 3LRLA 1HKUA 3SY6A 5KAQF 5DD3H 1E2KA 1KOJA 2HAEA 4J16C 1YJQA 1MJ5A 1LJMA 2JWYA 1WEJH 3APCA 5TDPB 3WIHA 2QMOA 1Y8CA 4FKMA 3UJBA 3WZ2A 1XGZA 4XM1A 4BDSA 3QA3E 4IQFA 3AUVA 3BULA 3B8SA 3EZJB 3CRMA 1DXHA 5CD3A 3WFEL 1E1YA 4TXNA 3BFPA 5CPFA 4CEHA 4NLLA 4U00A 5IMLB 5D6CA 2G2PA 3DIFA 1SSLA 3Q6FB 3QH3A 1LLFA 1U99A 1G9NC 1QUNB 2XRYA 4FDTA 3EIOA 4HQQL 3UTTA 3C43A 3DPDA 4MCZA 4E9SA 1E5XA 2Q4DA 1A8QA 4OJYA 3JWIA 5T3ZD 4HBZA 3HY3A 4WOBA 1EM8A 4MWZA 4QJ5A 3TUZC 2J3LA 2D1FA 3O31A 1UH4A 1IRAY 2WY3B 1LVEA 5DEGB 3QX9A 1CD0A 2VQFB 2F59A 1FNDA 1TU0A 2RALA 3GMQA 1PKQA 1WMEA 4BV1A 4KE6A 3SSAA 3WGTA 3DW3X 1IC5L 4UDNA 4ZODA 5IM5A 3TYFA 5F33A 3IVRA 4YRCA 3N43F 1AF4A 5K0BA 3OE7A 3W6PA 4AMKH 5HDLA 1QRUA 4IZIA 2GZAA 4EY7A 4W5HA 1GGMA 2X38A 5LGYA 2DP4E 1PNQA 4WNAB 4KJYA 3HB3C 2XB9A 3DCYA 3UPUA 3EYUH 2WIBA 3R4DA 1AIPA 3ZDFA 1A6TB 5FGBA 4EFNA 5DWUH 4IDHA 2XEDA 3BUYB 4PR3A 1A3ZA 3TE7A 3DMFA 4UZFA 2R11A 4O6VA 4MO9A 4M02A 5KBDA 1OLOA 4WLCA 1SVIA 2R0LL 4JGBA 1NVKA 4N9WA 2Z6VA 2YOAA 4WF7A 3JALA 3L7CA 5GRZA 2X6UA 4YSTA 3FYTA 3KX2A 5HHMB 4Q4EA 3CGWA 5F3DA 4OD1H 1R5JA 1NCOA 4YJFA 5C0DA 4HV4A 1KB5A 1QIHA 2ZRBA 1R4MA 1J5DA 3BXFA 5IHUH 3X17A 4X8OA 3TOSA 1MI5A 3M88A 1CUCA 4ADGA 4FIZA 5COAA 1NBYB 1R5VA 1UKSA 4O4IA 2GPYA 3HSKA 1JQKA 2F5AL 4F11A 2H1CA 3ZK9A 2VLKE 4HLZG 5IHHA 3R06A 1KORA 1JBKA 2ARJB 4B5ZA 4GPVA 3L1VA 1U90A 4UTXA 4F91B 1W48A 4IEFB 1RZVA 3TMAA 4L4VB 1SNRA 2JIZA 2DTEA 4JDTH 5IR1B 4YB8A 2Y2TA 3MRTA 4EYOA 2H57A 3ZQKA 4YRPA 2WCPA 3GMPB 4PJIE 4HU2A 1WCXA 2WUCH 4W9EC 3FNHA 4XN8A 4FQQB 3I9KA 4OMFG 4M8NE 5DMKB 2H32A 4Q01A 3SGDH 3Q85A 43C9A 3LQMA 1KZ9A 4C88A 3J80A 1KZQA 1E4WH 3V95A 5K01A 2QG4A 4MJIA 3IBEA 2QPUA 3TCTA 1IN1A 2B82A 1GOHA 2CLZB 3CWGA 4R97C 1NX9A 2IZ7A 3LPCA 2IH2A 2VCEA 4D44A 1MVUA 5D1QD 2D0HA 2AKAB 4RF3A 1E2MA 3I6KB 3BE8A 4J3FA 2BTEA 5FBHA 2HRDA 4FEIA 1EVTC 4DQDA 1Z73A 4BH8A 1EMTH 1H3TA 3IB6A 3OXSA 4X9YA 4EUPA 3LQ1A 3ZDAA 1KBPA 2O9JA 5JMWA 4CSTA 3T4AC 2FLBT 5KOJA 1Z5LA 2R97A 4L8YA 1KJ9A 1JFRA 1USGA 4EN2A 1UK6A 1ENYA 1ZFNA 2C04A 2J5KA 3KQQA 2JAWA 2QVBA 3BE6A 4JRXB 3AVEA 2H9IA 4B80A 4H1TA 5K0SA 1TEHA 2ZEJA 1YJCA 2UZ3A 4NZNA 2XUJA 4EBBA 3EEIA 3GYBA 3KFXA 3NBYC 2R7EA 1K75A 2Q5HA 4JL6A 2I4LA 4OVKA 3SYKA 4KQ9A 2J71A 2APFA 2C2OA 2K8QA 1QBGA 4YJ2B 2QMJA 2AQKA 3GTTA 2Z83A 3RWEB 3FLAA 3MLZL 3EPLA 4ZHSA 4PPGA 4BNKA 1Z34A 4UV4L 1DQJA 4MVJF 2XCUA 5JAIA 5LN8A 5JTUA 3WXWL 3PF2A 4QYIB 4PZLA 1WA1X 3WKDA 2A9PA 1EBFA 4OFXA 4LWQA 2C3MA 5CILL 4GMXA 3K73O 1U8KA 3FPJA 5KPJA 2ZP0T 6ABPA 1JF5A 3D25A 1FG2B 4N90E 2JJUA 4C07A 2FMKA 4OT1H 1P7BA 5JYBA 1YUHA 1OCRB 3BQ9A 2GFQA 3OTIA 3LKRB 621PA 3WI7A 2FQEA 5EZLA 1E9VA 4CLOB 3CGGA 2QM7A 1TF5A 2BDTA 3GROA 4B3BA 1SPDA 3WDMA 1ACMA 4R8KA 3HBQA 9PCYA 4H60A 1FMJA 2BJMH 4TNWF 4O4JF 4C7BA 1S2NA 2RGDA 3NUQA 4FD2A 4LY9A 5LLTA 1IGFH 3W82A 2B3IA 2PCFB 1CZNA 3H1EA 4U5XA 3ARXA 1SCNE 5H8WA 4E42A 4WO4D 3UFBA 2H4EA 2WK2A 4UANA 4NOBA 3LUBA 2GSIA 1FG9C 3U7WL 1FZJA 2EYTA 4MNQA 1EX6A 3ECAA 1UXGA 1JFFA 5AXBA 3GUHA 2VDVE 4YAQB 4JD5A 1DADA 1P5FA 1FYTD 2V74B 2R1WA 4JRLA 3H9GA 2XXAA 5DO8A 3KPNA 3AF1A 1NUHA 3O1IC 4JYMA 3IXMA 2VHZA 4ZTOL 2F7IA 3F6BX 1RIHH 1OPXA 1TW2A 4R8MA 1JUFB 1BDYA 4TKWA 2O50A 5E8OA 3O8XA 4G97A 3M8OH 1Z8NA 3R0XA 4O58H 5IDYA 5BRPA 2WE7A 4RCAA 3RZCC 3AXIA 3TZQA 3UBHA 4L8WB 4KQIA 3FBGA 1TQHA 3AWIA 4DS3A 4IHJB 3JTMA 3T08A 5C9JB 3L8MA 4JT9A 3QVOA 3LOWA 1GKYA 4PRZA 4MUHA 4XYGA 1NAKL 2WIIA 1VI5A 1ZLUH 1C3VA 5JORA 1XNHA 2XN2A 2B1HL 2IQ9H 5T1DH 1J2YA 4TOIA 4NFDA 1IIBA 2A5YB 3MRVA 2OMNA 1G3QA 1GQSA 3ZIYA 2PRKA 5EORL 3Q9UA 2EEZA 4L2LA 5MN6A 4NV0A 1I1RA 5A5GA 4ZXPA 2W60B 1RRGA 3HAEA 2NT3A 2JFWA 4K86A 3WLJA 4EN3D 1WPGA 2XE4A 3T4XA 3LCMA 4P38A 3EH4B 3R5HA 4YEDA 1JI1A 3MFQA 4FF9A 2PMBA 4EGJA 3LNIA 1YS9A 4I2XE 2MQGA 2N3ZA 2VQTA 5AW1A 2Q2VA 2I2AA 2QPDB 2KUTA 4BUCA 2Z31C 1VQ1A 2IEPA 4ZI2A 1ULHA 1MG2C 3AU9A 2BEWA 1T9KA 4H1LH 1E5VA 2XDAA 1RK1B 1BQLL 3Q2WA 2HHLA 5AAWA 2V37A 4LJLA 1CFTA 1QUFA 5ARBA 1TCBA 1BJ1J 4BNUA 2ECQA 2FOLA 4LTMA 3GS0A 2YUVA 3X12A 2QVFB 2G2RA 2R6JA 2CBGA 5JDSA 1NL3A 5FO2A 3ZIDA 4Y1AB 4D56A 4N48A 1ZUWA 3FB8A 1O96A 2QJDA 2ZT7A 1DIRA 4FKHA 1YH3A 3OAUL 2ALAA 1A02N 3OFJA 3IPBA 3CFNA 1OBCA 3T3ME 3TURA 3W8RA 1BYUA 1PR4A 3DS8A 4LLMA 1T1EA 4Q21A 4LBYA 1RWKA 4UD6A 4TLKA 4CLRB 2QM8A 2B4CH 4JZJB 1DEHA 2KLBA 4JR9L 4PGAA 2R751 1QTRA 2MYTA 3ISRA 2XWQA 4LXUA 1CF8H 3EZ2A 1ND0B 1N9PA 3GLTA 3TZ6A 2Q8BL 1D2EA 4PO3X 3FQ1A 1RUAL 3TJPA 3AHEA 5KYVA 1YBFA 1PDOA 5FA4B 3S81A 2WHEA 3HC3H 5FFLA 2NV2B 4ELKB 2JGRA 2BR5A 4PWHA 2YLHA 4WA7A 1FFNA 5C0BD 2IANE 3FWKA 3S1SA 1KTDA 4L4VE 4I89A 1II8B 4F4IA 4YAJA 3KOYA 1W88A 3AI7A 4E94A 2OV0A 4BX3A 1V25A 4O4YL 2WTUA 4I50A 1JNNL 3KNBB 4U3HA 2E7LA 1H3PL 4Y4FD 2HKHH 3FT2B 4X9IA 1MY7A 1QFOA 2X0IA 1RI1A 1O7VA 1U58A 1NKTA 2FJ0A 5F6HI 1BHGA 5SWSB 5GGVL 1B6GA 1DLHB 3QVSA 2ACWA 4U1JA 2CBMA 3KWFA 3AOEC 4TQGA 3AMVA 4M5SA 4A1RA 4NP6A 2AFIA 3MMZA 1U8OA 1NJGA 2E1PA 2FJGB 3TO4D 2C92A 2R84A 3A6CH 1WP9A 2AVDA 2QNIA 1OX5A 5EEGA 3IV7A 1OI4A 2BFNA 4LU5L 4P46C 4H15A 2QP3A 4AM0B 2R6DA 3D4PA 3R23A 3K0FA 5FULA 5FEBA 1HHHB 4KXCA 4G43A 1XDWA 3LRGA 4IRSD 2QP9X 1JKFA 1IX2A 3LZOA 5JIBA 3GB9A 4WCDA 3VI4F 3U9PL 4AYFA 2C3XA 1WY5A 5CVEA 2WVGA 2QW8A 3DX7B 3MGAA 1EK0A 4TSBL 2VHYA 2GJKA 2C2YA 1UYWL 4RAUA 1ENZA 1F48A 3S5UA 2Y06L 2IOHA 5DJXB 1K68A 4Q05A 2J20A 1CFBA 3EVBA 3JV0A 1A4BA 1VM6A 1ZICA 1G16A 2DQDL 5I1LA 2K2WA 5L9AA 4TUUA 4I7ZC 4PV8B 3QENA 2R4TA 1EO8H 1ONNA 3A47A 5E00B 4UIKH 4CQMA 1H4SA 3TFWA 1JRHH 1PEYA 2W8ZA 4PRNB 4HDAA 5C09B 5AW9A 2G1AA 2DJSA 3H8JA 3P9SA 4JR0A 2YW2A 3CPLB 3AL8A 1XTMA 4HEPA 1YEGL 4PSCA 1E20A 1IM8A 4PFJA 4MJID 3T3MF 3AP3A 4F58H 3V7FA 3DKHA 3VU3A 3AF4A 2NTVA 4KQ4H 13PKA 3A6DA 1HH9B 5BW6B 1IOZA 2PO5A 1XT5A 1JKIA 5LGHH 2O2EA 1T9GR 3FSGD 1JFQL 2R1UA 3IBYA 4H1VA 2OHIA 4RHFA 3PHSA 5LSAA 4ZW5A 4RIFA 4AEIH 1U3GA 3MGBA 1U3FA 4G5RA 1QQTA 3EHEA 4YNYB 3KEMA 3FTXA 2G0NA 3FGNA 3OLEA 1J90A 2O5ZH 3G88A 3I5XA 4MCHA 1FTQA 3K1KC 1NAKH 4D0GA 2H5UA 3LQAL 3RVWD 3QS3A 4NZJA 1P4IH 1JPEA 1N32B 5ICCA 3MWEA 3CCHA 3NOIA 5LWYL 3ZY7A 1K4CA 3GPLA 2AAAA 2XZDA 1U2YA 4FFNA 2IYQA 3QDAA 2XG5A 3F7YB 5AVJA 4RL4A 4JENA 3M8OL 1FZKB 1QANA 3U0PA 2DU8A 2DRUA 1JKMA 1MCPL 4ZTOH 4ZMOA 1V16B 3TO4A 4OQMA 4AJNA 5ALQA 3DB1A 4CM9A 4Q3DA 4B43A 4G8EB 1YDFA 1ZANL 4HX5A 4EE2A 4QTHB 2YZGA 4GWGA 2VN6A 1W49A 3X3FH 1UPUA 5CLGA 2GUYA 4D9FA 4TTAA 3G9ZA 1LTXA 3ECSA 4G8GB 1O4WA 2E4FA 4C1NA 1EHLL 1KGSA 4D8PB 1DKOA 4C8XA 4I8XA 2K8MA 2Y9RT 3AJAA 4RTPA 2JAHA 3NTQA 2CUHA 3TCXB 4N2OA 4JFHD 5EU6B 1BKSB 2YX1A 2CV0A 4ITUA 3U0TB 4RO0A 4PAWA 3LCYA 4DJAA 4GZ8A 2Q3FA 4EMSA 4PFEA 2HH9A 5CBAA 1RYBA 4LV8B 1JTVA 5HHVL 2CJWA 2Q1SA 4J0QA 3A7EA 3X13A 4Q48A 1GA1A 5D2LE 1E1RD 3IUEA 3SKXA 4B75A 4BFSA 4O8CA 1QVOB 4JB9H 2VEDA 1E65A 3FROA 2UVPB 3G79A 5KTEH 1A66A 3CWQA 6CGTA 4AMGA 1IBFA 4P9ML 1XBTA 3I2FA 3THYB 1QGAA 2DLFH 3VD4A 4P23C 2RB5A 4M03A 4ABTA 3CH1A 1J8HE 1TSRA 2JJSA 3E5HA 1JLKA 3OETA 3FE2A 4BFWA 1F90L 1VZHA 4YJHA 1JNYA 2EFYA 4JB9L 2COKA 4R7GA 2GKOA 2HX7A 2WWNA 5MN5A 5ID1B 2J3KA 1SCBA 3L7MA 3DV0A 3VX3A 4I0CC 1P69B 1GY8A 4XMWA 32C2B 4N9QA 4P4KB 1CS6A 4MHOA 1PLLA 4TSAL 2F53D 2F1AA 3Q48A 1KEEB 4RDHA 1IT9L 4P3OA 5DGDA 3ETTA 3GCGA 4O2EB 4JFPA 3WNZA 5EA0L 4JFDE 4E2ZA 1T6VN 1WAEA 1QGUB 1GZVA 2H31A 3RGVD 3QWRA 3U19A 3SDXA 4I1NB 2C4UA 3R4VA 4B44A 1EDZA 3V6OA 5L6MB 4LCWE 1Q9LA 1SIBE 5COQA 2CFSA 2YIMA 1ZIXA 1MCQA 1WA5A 1XP8A 4KK3A 2CVPA 5H4YA 5JY6A 3BD7A 4TWIA 1C1EH 3NZHL 2NUAB 4MRVA 3WIBA 4YE4H 3NCTA 4QPJC 2J31A 3EDOA 3UV7A 3RROA 3EQ8A 3O41A 2OV2A 1NMAH 1A4CA 2WXPA 2AN1A 3C75A 1OA0A 1SHZA 1UH3A 3C7TA 3V6BR 4ZQGA 4R71A 4XVHA 4B9EA 4YDNA 5DS8A 4TVKA 2ETXA 1A3CA 5EFIB 1EXVA 3IFPB 2Q1TA 1IAIM 4V0RA 3UMNA 1TTRA 3IDZA 2W88A 1SN2A 2DC1A 3KPRE 3T2QA 3DMRA 3GMRB 3VPBA 1Z4NA 2CCVA 4Z9XA 3NCJH 3EO1A 4NJMB 4EITA 2ZTUA 3LNGA 5FB8B 5LDGA 3LUAA 2DUJA 1XLTC 5A9SB 2RARA 2BFCA 3GZNB 3UPCA 3A6KA 1GZQA 5ADPL 1J0KA 5EYPA 2W95A 4IIHA 3EDDA 2O6PA 1O3YA 4OQTA 3EDJA 4LDEB 4CQLA 5DFTA 2O8BB 5F88A 3WNIA 1B8OA 1XZIA 1JN6A 4XPTL 4LI0A 4IUDS 4TLBA 3KR3H 2YN2A 3I23A 2QSQA 3ZKNC 5T33L 3LZFL 1GSHA 1N2CA 2IU3A 1RYEA 4M29A 4OD1L 4E9QA 3B2QA 1SN0A 2NUPB 3KQSA 1QACA 1KY7A 1E77A 5I8CA 1JG9A 1NDQA 1YEWA 3EOTL 5L2KE 2WLTA 1W72A 3Q8FA 2F7QA 1IGCH 5I1KH 1VACA 4FZRA 1FYTA 1I7PA 2R0LH 3IVXA 4NBNA 5IBUG 4OQTL 1E30A 3LH8A 3VYVA 3G2KA 4MB1A 2PABA 1ZNWA 2XT1B 2CMRL 3WE6A 3WG7B 1LNQA 3ZE1B 3NHRA 1R6TA 5MHTA 4KOAA 3H7BB 3K0EA 3NT4A 4MSWB 5KG9A 4P2RE 1E5LA 2ON6A 3U9PH 2BIIA 1SC3A 4M1GL 3QFFA 4YDSA 4BYHA 1TMCB 3WISA 1X80A 1QO3A 3CPJB 1S7RB 1Y7TA 3W8FA 2X8LA 1BD2D 5SV4A 1C9YA 1DIOB 4XPIA 2RACA 2TMYA 4B9PA 4AMWA 3A06A 3T65B 3LPPA 1E28B 4X6DB 5TQ2B 1QTPA 1BA2A 2X86A 3JZ7A 4X7MA 4K3HA 4WVFA 1XQWA 5AZUA 2VGLM 3PAYA 4PGEB 1C81A 1M6WA 4AZWA 4KRPD 4DGQA 2O4CA 4A27A 2GIYA 5IQ7H 5M3BA 3WB1A 3QIBB 3MRFA 4C4SA 4N0UE 3RIFF 4U05A 3IAHA 3GGGA 1VGKA 2DPKA 4TKLA 2O1XA 4AJ4A 2Y6UA 1YZYA 2A1IA 2ZJ8A 5CIPA 4OX9B 3C3AA 3LXUX 4PG2A 3R7WB 2J43A 2YXMA 1M7GA 2AERT 4K94L 3A70A 1HYSD 4QT5A 5GS1B 1TZHB 1S4MA 4US0R 5FUCE 5LJLA 1LO3H 5JXGA 4BXOB 4QKTA 5DCWA 1EGHA 2JKXA 4K3DH 1U91B 2F8LA 2EVJA 4C4TA 3FO1B 2IQAA 4ZD6A 3QCTL 1O9GA 3UUEA 3VJMA 1HHKA 3PKJA 2LABA 4XO9A 1T0HB 1RQRA 5LCXA 3MODL 4LGSB 3S2CA 2ZOKA 4DGIH 2DWEA 1VCHA 1VMDA 2E4UA 2CIKB 3IPYA 4TXJA 2G1KA 4CVXB 1SMKA 5CXXA 2I6XA 4F7DA 2X4NB 2ZXCA 2X7LA 2WM0A 5CA1F 4C56A 4GSUA 3VYRB 4YMVA 3B9KA 5F73A 4GYWA 4M0PA 3SZGA 4L3CB 1QB7A 4NNXA 3BW9A 2R1VA 5AQEA 1N1DA 4J8RB 4UV7L 3OB0K 4L5CA 3BGIA 1CUIA 1JZQA 1O5IA 3AW5A 2R0ZL 4PMFA 2NMVA 4Q2ZA 3PRZA 3CZGA 4XP9H 3K80A 4TQ8A 4BNMA 1DSWA 4KUCD 2NYVA 1JT9A 4F24A 1FZTA 2AV7A 1RFGE 2ITCA 4CDRA 2BNUA 3U3KA 1VDGA 3RRMA 2BY4A 2CEKA 1TIPA 1NCDL 5DSCB 2OJEA 1DVTA 4FU0A 3HMXA 4W81A 1BQLH 1TPXC 4G0WA 1QUEA 4QARA 3JWOH 4WKCA 4L1BA 2VAMA 3IP6A 3G6WA 2Y7QA 4LNUB 4GG6F 4MV4A 1BMFA 2Q1WA 4INJA 4TNVK 1XTUA 3JQ8B 4L9LA 2RHCA 3NHLA 1GS6X 3EX7C 3O3EB 4JFOA 1BWMA 4XX0A 3U83A 2ATVA 2AMUA 4NCIA 5EWIH 4QRIA 5BS0A 1DJYA 1ZE3H 3WS3B 4MJ6B 3VD9A 4JBXA 3QKUA 3DDZX 5I16A 4JYBA 3IRZA 4YRMA 1T66C 2ZTLA 1G21A 1DOHA 1H3NA 3HBZA 1ESNA 3M5CA 4OSOA 3IMTA 1U9KA 1U9JA 2QTBA 3QUZD 3IJ5A 1Z1WA 4W70A 4R5MA 4H0CA 4M9SA 1JFSA 3LFUA 3EHBC 4A91A 3QZUA 5LXTF 5I4KA 3WJLC 4WLFA 4RMSA 1KPHA 1AANA 5EWMB 2MPVA 3UWSA 2PLAA 4UBJA 4L29A 1P80A 3B6IA 1DG1G 1TAUA 4XOIA 4X6YA 4ZPTB 2QTGA 2FTAA 1NMCB 2WG1A 3DROA 1QZ1A 4R26H 3DVGA 1JJUA 2YO3A 1HNGA 1QRNE 1FZOA 2XPGB 1N6HA 4F5CA 5GPRA 4K1LA 2NVUB 1ZI9A 5GRJL 3DTTA 1A8UA 1D6VH 1GNSA 4KAXA 1OAUH 2HAZA 4FI3C 5HQTA 1IGML 4FCHA 1KZ6A 4R8WL 5ANMB 3FU7B 2PSJA 4O58L 5HCUA 2CGYA 4Z0PA 2LU5A 3FPSA 3QTBA 3IKTA 1DQLL 2ZT5A 4RDBA 2FCBA 3ZKQD 1Q6ZA 4WZAE 4X8JB 4YSEA 4G6ZA 1WEKA 2RB4A 2IYNA 5HHXH 4NLAA 4FUTA 3NNNA 2FWSA 2VERN 4PHHA 4F9LA 4C2BA 1XF5B 4NF2A 4CW7A 3L4JA 5IT5A 2IFFH 3V8CA 4HS6A 3QU4A 1GGYA 1D5BB 4AIXA 4EOWH 3G5AA 1LK3H 1LPBB 1BZEA 5C0BB 3M1OA 4RAHA 5IJBC 4XWGL 2LPMA 2W2MA 1RUMH 3K2BA 3ZVMA 3V52L 5GMOA 1H05A 3LVFO 4JI6B 1U6AL 4C3UA 3MM4A 1IGFL 4WI2A 1CUZA 3QXWA 4J6EA 5DEIA 1KZYA 4CMJA 4RGVA 1G20B 1WPCA 1UPXA 4RENA 1E3TA 5T1LB 1BEXA 1KTVA 3RX7A 4BAGA 4C89A 4PE5B 1M2OB 1EXDA 1KPVB 1G43A 1A2BA 2ZJ1A 2FK8A 4OM1L 4PTLA 2FX5A 2F8IA 4XB1A 2A6JA 1DARA 1DS6A 2QAGB 4JFQA 1CR0A 1T43A 4HADA 1WZ1H 4ENRA 3LHPH 4NRZA 4FQCL 3UZEC 4PGBB 1IATA 4JLJA 2FPLA 1IILE 2KZWA 3VHXB 2XACC 3H11A 1EH5A 3TN0A 3DTXB 1PR9A 4RXTA 4E5KA 5EOTA 4CVNA 3G5VA 5FYJE 4BXSV 4IMKC 4G0VA 1T29A 4LASL 4KAAA 4EDHA 4QO1A 1X0VA 4MVJM 3S88L 5F76A 3OU7A 1V6SA 4RL6A 3ATBA 4BYMA 4S1SL 5EI5A 2C94A 4W5OA 5L3QB 3BVNA 3WSWA 3TSZA 5DOVA 1BQHG 4C08A 2C5EA 4IRZA 3Q5DA 5D7EA 4U1NA 3ZU6A 1OGAD 3L7EB 4YDVB 5JZSA 3AB0B 5E6YA 1L3BA 4K8RL 1NC4A 4WV1B 3VFNB 2AJ8A 5M2QA 2B16A 4URKA 1JLLB 4MR7B 1OTHA 5KOHA 4KMTL 3I58A 1EMTL 5E94B 2UUOA 4ZVPA 1LNUB 1YYLL 5GSVA 1QH9A 5FF9A 5KIAA 3TL3A 3ZD9A 5FYKE 3PGCA 1FDVA 4EA8A 3PT9A 3HDJA 4FQ2H 3NUKA 1F11A 2MNUA 1W0JA 2NW6A 5JXIA 4NZ9A 3RY4A 1YNLH 1RKBA 4PPNA 4DUYB 3RWCB 1UH2A 4P49A 4WDRA 1N19A 4QTTB 3CMGA 1AI1L 4AO8A 2VDLH 1Y4DE 3LWNA 2VUYA 4KZEL 1YO4A 2Z9CA 4YQEA 4XWYA 2IE8A 1E4XH 1ELOA 3PCRB 3S5YA 2DUUA 4IJWA 1LBTA 5DGRA 1ND6A 1GILA 1ZNZA 3S48A 2PUHA 3NHJA 1DAFA 1CUGA 2GX6A 4Z99A 4DG8A 4BEJA 3OX1A 1P2TA 4IRSC 1A1OB 5IEHB 1H94A 2PZBA 3TXAA 1R50A 4LV5B 5IW3A 1NP3A 3GLFB 4H26A 3LC7O 5JIDA 3KEGA 1PVHA 1O77A 2FW8A 3PR1A 1V27A 3NIGB 3DPUA 5KJ6A 1E9QB 4P5PA 3QE9Y 1WB9A 1MKFA 1A8HA 1VCMA 4J3OG 5KSYA 5GRYA 4C0LA 3ULVL 2J45A 1MQKH 1S9XA 1M1UA 2A4CA 4NPKA 2A9KA 3Q3HA 4PJDE 1TVCA 5JSUA 3UTPE 4GRMB 4K3GA 5BNXD 1I51A 2WBLC 3JQAD 4FN5A 4PV1C 5DN6D 5DHRA 1Y1TA 2DEXX 4AKQA 1YEKL 2Q5BA 2UY6B 1KMHB 3TMKA 4PGGA 4OI4A 5B58C 4LZOA 4QPCA 3JQAB 1NMXA 4AT1A 2NZ2A 5DWUL 3MS4A 2XF2A 4MD5A 4XCCH 1WFUA 5KVEE 3UJNA 4P4KC 2QV0A 1XZAA 1KJ2B 2B2XH 2IDTA 1GTFA 1KK1A 1ANKA 2V45A 4Q9IA 5ED0A 1H2ZA 5LIRA 5FK9A 2HPZA 1J1XL 1YAZA 1FRFS 5KCMA 3TJZA 1URPA 3LRHA 5BVGA 3AUJB 1K8XB 5I18L 4KJZA 1G1CA 3NQ41 5E2AA 1UB6A 2GO7A 4RY8A 2OTWB 4ADSG 3UWMA 1Z6AA 4UPVA 2P5PA 1JHAA 4TX1A 4N3CA 1IHOA 1IQUA 1U7OA 3R24A 2YGPA 1TUIA 2R29H 4Z3GA 1T3FA 2DYPB 4OG2A 3PL6D 1LPAB 1DBBH 4BVAA 2CHEA 1JIKA 5HY9A 2GAZA 3TL2A 2IBSA 3RC9A 4DV3B 1R9NA 2R4RH 3A4EA 3D5TA 2QTHA 4EQ2A 3PICA 2JATA 4QBIA 2HF9A 2RQ8A 1Q16A 3ULVE 1RCTE 1L8OA 4N2NA 4ZAKB 1LRLA 2C61A 4YONB 5T4EA 3AMLA 1ACYH 2Y1YA 4LQDA 2MMCA 2FBJH 4ELME 1U4OA 2GWRA 4CTJA 1CZKA 3H97A 3IE0A 3OZ9H 4UQPA 1XHHA 2PETA 4IJUA 4KTDL 1Z3CA 2OTUA 1E90A 3HN5A 2IYUA 2WYOA 5DNVA 3KPWA 1HZZC 1ODUA 4WXEA 3MOIA 1IXKA 4EPVA 3MCLL 4GR4A 2P9JA 3KJEA 4XWWA 2NY2C 4WEQA 5D7IB 4KVAA 1IHDA 5JH7A 1NDGA 1WU8A 4FG2A 4QXRA 3K7EA 2FR0A 3CFEA 1G42A 5EIEA 1PD1A 3E1GA 3D06A 4I0PD 1N8TA 2FZ4A 1OAXH 4FYPA 2EX0A 4R51A 5JZBA 5EIAA 2W9EL 1BGXT 3OH8A 4MAYD 1SB8A 4M76B 3H5TA 4G7RB 2YINC 4AXBA 3VH3A 4PY2A 4TS6A 3UTZB 1BZQK 1BCRB 2PQ6A 4ZEVA 1DQRA 1VJ1A 2HA2A 3WMGA 2IADB 3CXDH 1L4LA 2I9PA 5KYKA 5DEFA 2CNKA 3GLGA 1G66A 5E2JA 3U3JA 3EB9A 4WSOA 2I6GA 2GRJA 3ZSSA 1POXA 4F4JA 4Z8XA 4WEEA 1Y8RA 1NWCA 2V55B 3RRZA 5I6DA 4MQMA 4HGRA 1G7QB 3RK4A 4K6CA 4P7BA 5EIQA 1PSKH 4A37A 4C0AC 2QUKA 3KUCA 3I1JA 5FAXA 1E64A 3MRNA 4JG1H 2WTNA 4R83A 2QT0A 1XROA 1B0WA 1MQ8A 2E48A 2X6VA 4MGYR 3FHCB 4OI1A 3K2QA 4BY9E 3DKKA 1GDHA 2WXJA 5F96L 4XNQB 4P58A 1XZFA 4WAFA 2XYCA 4WCYH 2VK4A 3CZ4A 1OAOA 5ABDE 4DQAA 4F1WA 4M3KB 3GXUB 2F4VB 1FRQA 2DT8A 1M2VB 5JQ6H 2WUEA 2PNDA 2BSDA 2ADGA 3B3JA 4EJFA 2DIJA 4Z6AT 3D8TA 4WI3A 2MFNA 5E2WL 1KPGA 3Q01A 3FYDA 3SIKA 4NYLA 5IZ7A 5D1ZC 1IHYA 3D4NA 2OXCA 1UZMA 5DSTA 3OPZL 1XQ9A 4RWYH 1XCWA 5ALGA 4K2UH 1SZNA 3L1JA 2CUNA 4ZYTA 4K8RH 2BHTA 4MWOA 5D7BA 4BFYA 4FOTA 4EF4A 4OZHB 1T4CA 3N41F 1OA1A 1BOGA 3LS4H 4IIEA 4NWIA 1DQTA 4JLRB 1O5PA 3C3KA 3TLJA 1HL3A 1LK7A 1SJHA 1VPLA 2RIKA 2JIBA 4NT6B 3UGEA 1EPFA 4MJ3A 4WW2B 2Y72A 2ZUDA 4L8DB 2JEOA 3CKLA 4GYYA 4JDEB 3RJ5A 2HIAA 1HDXA 2FPIA 4O2CA 3MWGA 5IJXA 4YAGA 4FE9A 1NIAA 3OEWA 5E5LA 1N8NA 1Z0SA 1Z5ZA 2F3RA 4H4DA 3D4LA 1MFPA 1S7WA 3AROA 5H9VA 3WD5L 5HD8C 1HSZA 4CETA 1W1WA 4FBLA 2G5BA 5IUCA 1I8MA 1Z16A 4OVVA 1H1LB 1KCVL 2I9TB 4RA9B 4LIPD 2J44A 1IHPA 3RRYA 2Z35B 3U4CA 3AESA 1RFLA 4M1CC 2XQBL 2R2BB 1JXFA 2J30A 3N5KA 5GQSA 3FUWA 3LW7A 1J8FA 2B36A 4XE5A 4Y2JA 3EFDH 3TW8B 2BFVH 2BMKB 1DBWA 2AJXH 1FXWF 4HOMA 1G5HA 5FTMA 2CLEB 4M9PA 3VRLF 4G1MA 2X4UB 3GUTA 1KG0B 3W0LB 1I85C 4NKIL 5EQTA 4BZWA 4LXXA 3U3MA 4FFTA 4RVGA 3T9DA 1VI2A 1H9CA 4RLHA 4DZTA 2GN4A 4IGBA 2O0JA 3K46A 3WCYA 5IULC 4LWOA 3ADKA 4MV0A 4HY3A 5DUBA 5T6MA 2BIHA 1KFBB 4DP7X 1NDMA 3TKYA 4WI4A 2BUAA 2ZR7A 3LB6D 5J6SA 1HDZA 4W7HA 4XNAA 5L8VA 4R4BB 3NZ8A 4TVPD 2DEWX 4RNRB 2X9NA 4ZEXA 5KEZA 7PAZA 4PPTA 3NTOA 1V7CA 1Z9SB 4Y2DC 3GU3A 5KSAC 3PWKA 3BVWA 5ITZB 5H94B 3DLBA 1C9MA 5JOPE 3VOAA 1CEYA 1UPCA 3RGWS 4UHKA 1EHAA 1JRLA 3TNMB 4WASA 2J3DA 3INUL 2EIZB 4KJPC 3CA8A 1NT2A 4GQPH 2JFXA 3KOUA 4IUCS 3DH0A 4RTSA 1ULSA 2XECA 2E5LB 3J81k 3QLUA 3NP4A 4DLXA 2YW9A 4A23A 2PBLA 1NCHA 2WVHA 1GUZA 1HV8A 2VMDA 2HWYA 4GPBA 2YL2A 3IOCA 1ZN9A 3BP7B 1DBIA 2P6PA 2AMGA 5B55A 4RFSB 4MJ4A 3I8XA 2EYUA 4DCSA 3LL7A 1CD1A 3NHPA 3BH9A 1IZZA 3CHXA 1E79A 4CTMA 2JEZA 2V3EA 1LHZA 1JTPA 1B0ZA 1D2HA 3IR6A 3QQ3B 5E2BA 4MCIA 3NV9A 4R0VA 3H9SD 2WLLA 2VISA 1IM3A 3D02A 1MJFA 4O5AA 4HVCA 4G9FD 1KZ4A 2O7VA 2NAPA 2XMPA 5AZ2L 1RM4A 4X24A 3GA5A 2X6BA 1S9WB 1M7DA 4ZV4A 3GB7A 5J3HD 3MGCA 2Z31B 3OG4B 4XPAL 2Q4RA 1SQSA 3M07A 4DIOA 1ML4A 3TQRA 4EIUA 4XB8A 4XNZC 3R8XA 2ODAA 5KVDH 4LIQH 4RMGA 1F4WL 2GERA 1OP3H 5G1PA 3OKKB 2H5EA 4M6WB 3T77B 2ZUVA 3CYFA 4WSKA 2HJFA 3B2MA 3WGOA 3I6LD 1P62B 4RX1A 1E6WA 1E99A 4KH1A 1PNTA 4DUXA 4D92A 4B6GA 3EZFA 1Z18A 1OT3A 4QHKI 1CJSA 5C97A 1A21A 2E55A 4HEME 4MKMA 1AKVA 2PVCA 4LNRB 3NHFA 3U1BA 1NRJB 3OJXA 1HPLA 1H3WM 4WEOA 1BEEA 2J9ZB 4HKTA 4FNLL 4NGHL 3Q41A 4U6YB 1QHFA 3FTFA 3ML9A 1T91A 5L88H 1E1RA 2WP3O 4GKBA 4ANKA 2K6YA 5DM70 3FRPG 4WEBL 1TE2A 4FC3E 3T4PA 4JHAH 1NR7A 4JL8A 4CV0A 1T25A 3A0UA 1F6AB 3P45A 4KZEH 1J88A 1ODIA 3WUWA 4BZ1L 2DIEA 1BS9A 3L7NA 1OQOA 4ZAVA 4F57L 3RYIB 5DD6A 1YEFH 1FGVH 2I22A 2N0SA 4CDGC 1P5VB 1E3DA 1R16A 4PBWD 5BNZA 5G3ZA 2RFLA 1UWGH 2QYHA 4E5PA 3MLTB 3MQFA 3UMYA 4A15A 4HWZB 1EWYA 3BI9X 3O3DB 4JFWA 5LXVA 1KQNA 1CE8A 3A37A 4GOLD 4DFDA 4KI7A 3OB0H 7MDHA 4NUPA 1UUNA 2Z2KA 4KQXA 2OAQ1 1GNLA 3JW8A 4R2XA 1B0GA 1U2GA 2DKMA 2BVQB 2DQUL 5BXYA 3VCLB 2DYPD 1L5YA 1N7ML 4NPAA 1N6IA 3JR7A 3PUXA 2O8DA 1XWWA 3ZYZA 2XA2A 4H18A 2XV2A 3CFJB 2FCAA 3W1WA 5E1MA 4EVRA 3LNHA 1XMPA 1UD5A 3WE7A 1CY2A 2WQ7A 5BSMA 3DMGA 2GD1O 4XVOA 5KVMC 4JL1A 5GPBA 5TMDA 1EEZA 1RHQA 3K4PA 4G11A 3AV3A 4E08A 5EUQB 3LIZA 3NBUA 3AEZA 1Z4LA 5EO0B 2OMKA 1GAXA 4IJ6A 1G9ML 2X9GA 4L1SA 4DP8X 1HORA 2Y1GA 1FSPA 4G5AA 3FKJA 5EY5B 2HA0A 1Q1EA 2QSJA 1YJDH 4OFYA 1VFNA 2P4SA 4JS7A 3CMCO 1FV1A 2JIDA 4BECA 1XEAA 5FOXA 1SVBA 1XAGA 1UM5L 1WHSB 3AI3A 1JLMA 4XOCA 3C5XA 5GP1A 1YB7A 1OJ7A 3FWNA 4K9MA 1FLNA 2WQAA 3QKTA 1MCNA 3TLXA 4FD3A 3ATEA 4CJ1A 3S37H 4REMA 3WE1A 5K0EA 3QJ5A 3LVEA 4OF8A 4RD3A 3T6VA 2XTJD 5C1DA 3L3OB 2W71A 2EZ8A 2FUCA 5BRZA 5B3JF 4W8HA 2NZ8A 3BVPA 3V6ZA 2ZJ7A 5G0UA 4JJOA 5T33H 2Z7ZA 4ZV7A 3W37A 3E3OA 2J0EA 1CDGA 4O3MA 5C4IA 4XNUH 5I71B 5F1SA 3MLRH 3WHE1 3MLWH 4NFCA 3Q2KA 2Z09A 4NNPA 3HHSA 5A4AA 1IBSA 4UDUB 4L95C 1QQDB 3D7NA 5B12A 1SXSA 1URIA 1G7LA 2CWWA 2Z8RA 5GZNA 4LDPA 3IKLA 4F8LA 5FYKU 3S5LA 3QQPA 1X1QA 2OVBA 3WFZA 5EA2A 3LNEA 2HT2D 4AROA 5F52A 3BTUA 2NO6A 3M1AA 1LKZA 5HHXL 3QU7A 4OTXL 1KU0A 3L8DA 3NA9H 3LV8A 3DK0A 1NMZA 1Q1QA 1CJCA 1E5ZA 5DF1A 1UTDA 1L9RA 1P6UA 3O3AA 4LVUA 4RY2A 3RVRA 1CFSA 3NN8A 4FULA 1ZJ6A 5TFSL 1LBEA 2WF9A 1RD4A 3DM5A 4ZI7F 4B8WA 3IA7A 3QIVA 2Y7MA 4TXVB 1SB9A 2XSKA 2I71A 3SYRA 1PEAA 4B9IA 1XFAA 4QQNA 3CZQA 5HS4A 3PD7A 2BNRD 3D0VA 1N18A 3MA0A 5CYGA 2EUVA 4KRFA 1KN2L 1FJXA 1SKBA 2J07A 1R6AA 4LMAA 3IJRA 2V7HA 3H3BC 2G0TA 3IESA 1DT3A 3RWHA 3MUZ1 4N6RB 2W93A 2ZX8A 1JGTA 1EK6A 2HKAA 4NLHA 1MCLA 4ODTL 3LYUA 4JZNA 5ES4B 5HOQA 3BUTA 3ESBA 2X1OA 1R37A 1XL6A 4OFWA 4PJAF 3W5SA 1P4HA 3NJXA 3HA0A 1IEHA 1HYBA 2IDFA 1G0XA 3VFUB 1I4LD 1M1YB 3VGPA 2V03A 3GNSA 2K4MA 3HLYA 2JHPA 1TIKA 4KK4A 4OA5A 5A43C 3UYPA 1G17A 1C9SA 1L5VA 1FC1A 4N7BA 2BJWA 1H66A 4I55B 1YPZE 4KKCD 1CWUA 1TQDA 1OWMA 4ZT1A 1FYEA 5FUVA 2ARJA 3OJDA 2Y6VA 2Q50A 2ZRGA 4IEFA 4BWWA 1MA3A 3BZEA 4FSXA 4N28A 4DA4A 1XGTB 1EZUA 4HF5L 5AP9A 4X9FA 2PKCA 1SD5A 3RWOA 1MN4A 4GW3A 4CU5A 1VRSA 3ZR5A 1AKJD 4PJEB 1ZGJA 4RSHA 1NHGA 3WKPA 5BW8A 2I3GA 2YVKA 2CT8A 5L6LB 4WU7B 2MCG1 1D07A 1KE1A 3BVDB 2IMMA 1HMPA 3K0WA 4RVFA 3VG0H 3GK8L 1CY0A 1WHTA 1AGRA 1V8BA 2HDWA 3A9CA 4DIEA 4GKKB 5GVRA 1MVUB 4F2HA 1LQBC 3EYOA 4Y4KC 2H4XA 1PYGA 4PRHD 4GLOA 1T89A 1ULVA 1SDYA 4AKTA 2WKSA 2AMVA 1HDOA 4CA4A 3C12A 2VYVD 4ZS6C 1MT0A 3DETC 5DASA 3AG3B 2GO1A 5TEWA 3NJ8A 1FH2A 2K4WA 1XDBA 2NV0A 1DX9A 3T52A 2VR9A 5TR9A 4C6HA 5J1SB 4FYVA 3A6OA 3VXMA 4XSHA 3ALWA 3ZLVA 4LCVA 3FZUD 2XV0A 3KB1A 1KIFA 2IS2A 4BRWA 1XZLA 4X4YA 1KELL 3VE0B 4JFYA 2KLHA 3T5AA 3LBYA 2ZXQA 5A1AA 4C56E 3BL6A 5CK5A 4URWR 3FOLA 1CF4A 2PYED 3FJOA 3AETB 4H7IA 3TXYA 2BP5M 1V8OA 1SUIA 2XVLA 3CS3A 2HWZL 2IALA 1E7MA 2E7HA 2QZ9A 1PAZA 5J43A 4BFOA 5C8YF 2DPXA 1K92A 4QTIL 2IDMA 4YMSA 1CK4A 3K09A 3GD7A 5EIFA 4M6AA 1RMQA 1GEGA 4G81A 4CFZA 3VSEA 2OR9H 4RHTA 4E13A 5BN3A 1NPDA 2HM7A 3SP1A 3LLUA 3ZDZF 3C8KB 3KSUA 5KWYC 4R98A 1UH5A 4GI2A 4Y9SA 1ISMA 1S02A 1MCCA 1V96A 3WL9B 3G1WA 4GH5A 1EX0A 1MENA 3VAAA 1I7SB 4PSDA 4S10A 3TBSB 5E70A 3MUNA 4M1GH 2PH3A 1Y63A 5K2OA 1DT5A 5HBGA 1MJNA 2A9FA 3H2ZA 1GWNA 2APBA 5K7SA 1Z63A 1KDJA 4HKXA 3E3QC 1ADBA 1EK2A 1WZUA 4KR6A 4I13B 1P1FA 2J6WA 5E2UL 4JQVC 4GI5A 1BCSB 3PPEA 2J9GA 4JPKH 1BKYA 1QO9A 3ON5A 2A9NL 4HUQA 4UE2A 1YYML 2H3NA 3EKCA 1GAFL 3TGLA 4LSMA 1XCTA 5LQNA 5DZPA 2CCWA 3OLIA 2J3QA 1X7ZB 1YYMH 1L5NA 4B95C 3OPUA 1ZH2A 4KPYA 5J2UF 4BZ2L 2JI3A 4HXBH 1UF9A 3KZOA 5J6HA 3QCVL 2F9FA 4GLLA 3ZD7A 2VMEA 1DO0A 1XTPA 2YHGA 4JRFA 3EOTH 3CUTA 4UU1A 2FZ3B 3ZXAC 3A9RA 3CCCA 1SU4A 3FBKA 3L6RA 1UQSA 2P5YA 3ZW8A 3PUWA 3QEQA 4QYOA 5KYUB 1ORSA 3Q9QA 4KO5A 1KC3A 2QELA 3NHZA 5T57A 3ZLTA 3I8OA 5I1EH 5B1BB 5EWJB 3LH5A 2OQJB 1PLGH 1NVTA 1VB9A 4DV0B 1CY4A 2FZWA 3M4XA 5A0VA 4K2AA 5BWNA 4QYSA 4TRNA 1QYDA 1NKRA 4NM4L 4GHWA 4UTAA 3JQFC 3FQWB 3EVZA 3QIAA 3HE3A 3LHSA 2J41A 5KJ4A 5B58T 4CKCA 1MOQA 4BPBA 5GGVH 2CXXA 5IP5A 3U9SA 2CXTA 3QUBA 1W4AA 1QQBA 2CZGA 5COBA 2L3BA 4FBMA 2O2HA 4JFDA 4BLSA 2CG9X 2BZ7A 4CM1A 1NXOA 3ZHYA 1Q91A 3DZHA 2DMRA 5HKAA 1EAPA 2VYFA 3HLTA 5THQA 3V4VL 1EGQA 3X2FA 2BWDA 1PZHA 3ZYOA 4DP1X 4WI0A 4X50A 5FO9A 4BNXA 1MIMH 3OGCA 3HVRA 2BSED 3C09C 3C6LB 5G4MA 2GEVA 3BPLB 1OPRA 1NMAL 4MP8A 1ADQL 3MJ8A 4N76A 1ZKAA 4MRMA 1MCIA 7MHTA 5ENWB 2ESVD 2CLIB 1R8JA 1BVKB 4K6MA 3BWCA 3KXIA 1L5HB 2CMGA 3B6ZA 4W5JA 4OFDA 1P31A 3VAEA 2AQNA 3AL3A 3BILA 4N7MA 5HVFB 1DTSA 3SC3A 1QC5A 4OLVH 4PTUA 3D3KA 3HKBB 3PI7A 1OF2A 1G8MA 4JYCA 2ID4A 5HKLA 1S89A 3SYOA 4TSAH 15C8H 1Q1PA 3LUFA 5L7YA 2Y2WA 2Q2EB 1TU3A 4P3YA 4OJCA 3A4LA 3LPDA 3M6AA 1AXSB 3O92A 3VU9B 2CNLA 3OSVA 1SA0A 1H4VB 1YRLA 4B2IA 4RH1A 5F9WB 1R9MA 5DN9A 1Z36A 5LD2C 1OCZB 2EERA 3DI3B 3L02A 1LEKB 1QSFB 1T8PA 3QXHA 4OAWB 1KV3A 1DWUA 1YI1A 3MRDB 1E4JA 5DZLA 2CLLB 4EBFA 1WTCA 3AVWA 3VOBA 2GSMB 4MITA 4PBTA 3QIBD 4DLVA 1TG8A 2ENSA 2PL5A 1L5QA 1N0WA 1T03L 4M60A 1KY2A 5CN3A 4PHTA 4P4KD 1AC0A 3HTXA 1KBBA 1IUZA 4EI5D 2B61A 4CNIB 2R27A 5KBNC 2Z7WA 3H4HA 3DXAA 4I6JA 1AGYA 4IHOB 1IGJB 2FWOB 4K8OA 3MT9A 2BGLA 1K6MA 4NQXA 3M5DA 2FZKA 5JAQA 1O0SA 5C4MA 1KQGA 2F43A 3C6LD 2X53A 1VE9A 3F01A 4JP5A 4NWTH 3TTTA 2OGTA 4DSOA 4UQ2B 5LJIA 1X8LA 1RPUA 4Z7UA 1MEEA 2JA2A 3GLHA 3UTSD 1RWWA 3LKPB 5T1DL 1WU7A 2VE6B 3STUA 1WFIA 1I8IA 4KBGA 3S5JA 3HPJB 3AMKA 2HPHA 3Q0IA 1DVQA 3N2EA 4OYYA 4AIRA 2G30A 3WTVA 4OQNA 1YKFA 5AM3A 3LZ6A 3TNNB 5IWLA 4RDIA 3HUJB 3W0WD 1PX2A 1VL8A 2Q3DA 4TYPA 1E5BA 3ROLA 4OCWL 4C6TB 3DUHA 1YJDC 2CCJA 4C14A 5D7LA 1W19A 2XUFA 3WLQA 2C96A 1BFOA 1JSZA 3D48R 3JT0A 1XZKA 4RAUB 1CZ8L 4E12A 1PT7A 2V4UA 5TQJA 2MHAA 5B6JA 1RU3A 3ANTA 4TMXA 3DRTB 3F5DA 3A6LA 2XRAL 3SJ7A 3HN2A 3LRPA 3HXMA 3WSQH 1F12A 3BGSA 1L9KA 5FO1A 4V1CB 1HXMB 2HUHA 3QNFA 1HQKA 3KS9A 4JB0A 2K6WA 1OWWA 4IXTA 4AEIL 2X41A 1GCAA 1MLBA 3TUJC 4B0OA 4OJTA 1ZAKA 1MNQA 2QUHA 3QPXH 4P3PA 2PUCA 5HUJA 5DVZA 2AJYH 3O4JA 3H1PA 3TFKD 3GRVA 3RKSA 3DWFA 2D1TA 3TA3A 4AZSA 5FEMA 2QKIC 4Z4IA 2OQIA 5FUWA 3VFMA 4FONA 5BV7A 3AXTA 3RB5A 4AJWA 4H7KA 3WNKA 1M34A 4EPSA 5KWSA 3MTGA 1P0PA 4PJ8B 5TF4A 4RIHA 4GGOA 5T3YA 1F5NA 3WO1A 3E3NA 3L49A 1Z66A 1YJBA 5B1YA 3L3IB 3T1VA 2BF7A 1TQ6A 2GYWA 4XVCA 3N40F 1Q92A 3ZMEA 2BFDA 3DARA 3WB0A 1E7SA 5FKJA 3ARPA 5GONF 2EH8L 4QHLA 5D70L 1VE7A 3WWYA 1K4CB 3KR1A 3W6UA 5FLKA 4J43A 2ZAYA 4YDJB 1VLQA 1XTSA 3AZOA 4HEHA 2OGZA 3LU1A 1WCBA 4Y19B 4HQRA 3PABB 1OZUA 3EFEA 1AJEA 5DQDH 2JHFA 2IZOA 4G4SO 2VKWA 5FPQA 1TTUA 1YOVB 4I19A 4PYGA 3HPLB 2WHQA 4B40A 4MICA 3SKOB 4HH1A 4WOKA 3WA6A 3KGUA 1MCJA 2RSLA 4JO3H 1YQXA 2V54A 3NEEA 1D6EB 2H2IA 5FF6A 5ESVA 2W65A 1H0KA 4GOKA 3FLMA 4WKGA 3S2ZA 4EYGA 5AOMA 3EGIA 2IEBA 2B08A 3WBJA 5HX7A 3FFTA 4N5IX 3W0WB 5CT8A 1HZHH 1FUUA 1XR3A 2D31B 4BAZA 1FUNA 1PDWA 4BMOB 3QF4B 1HNNA 2J46A 4RBNA 4J3SA 2V9RA 5D6CB 4B27A 1SVNA 4U3XA 4IILA 3MQ4A 2W0KA 2ZTHA 5HTOA 3EG9A 1PTJC 4YROA 3BK7A 1P7HL 3SDDB 1F4AA 5I66B 3R76A 1TJXA 4DKAA 1UMKA 2PFGA 3VKHA 2ZUYA 1WC7B 3R7NA 1XK6A 4ZEMA 4Z5RA 2JL1A 3ZW3A 4HF7A 3ZEAA 3RU9A 4ZTBA 4RTKA 3OQVA 2AZTA 3ULUL 2IAMC 1BW9B 3H18A 2I6SA 2W1NA 1S8DA 2CO7B 1RBZA 4J1QA 5HYSB 3W1EA 4EIWA 3IMGA 1FMTA 2DECA 1NKOA 4PGCA 1GPNA 2ZCJA 1GZPB 3TR0A 1CDUA 1JXOA 1X7XA 3L5KA 2ZREA 4UQEA 3KAJA 1XZMA 3OAUH 4EUEA 2JTDA 3AOGA 4W1PA 2WNIA 5KAPA 4O2EA 1NJSA 1Z75A 1DIAA 5A1JA 3ZWMA 5EP2A 3H2IA 4WU5B 3KM2A 4RGNC 5AKVA 1GCYA 2G3YA 2OUIA 4P57B 2CNOA 2TRSB 3LT2A 2DFNA 3AACA 4H1HA 2C8JA 2EXTA 2R0KH 1RVFL 4DPBX 2W6ID 5LR6A 3RNQB 2RHTA 2DM4A 4B53A 4JI5B 1LDPH 4ASUA 2AK4A 4GRWE 4Y9CA 3BF7A 3QNYA 3LRSA 1TZIA 4J3TA 5DDHA 5JFOA 4N3NA 1ESMA 5IB3A 2B1JA 2PMWB 3VD2A 4QHYA 2K7ZA 3ZXUB 1E2LA 3O4LA 3EDCA 3DBXA 2P9ZA 2GUOA 5D7JD 1B4LA 4ZVOA 2EVIA 2OLEA 4NCAA 2O6HA 1TJ3A 3VRIB 4OV6F 2NNAA 4ZW7A 4LZNA 4PJCB 4R7ZA 1SRRA 4PLFA 1KEGH 3TTUA 3BQUD 1YONA 4UZSA 5TMBA 2ORYA 3TZVC 3EYVA 2MOVA 1ZJBA 3P69A 1A4XA 4XB3A 3NDZE 5C0GA 4PQYA 3SKMB 3B2PA 4F8JA 4JI8B 1E27B 2MPAH 3LHDA 4LHUB 2X3UA 1XTQA 3A6PC 4LVNB 1KTCA 5HF6A 3I6IA 3KJIA 3OVUB 1QOPB 4XBPB 2UYOA 4GEIA 5F9OL 1BXUA 1LPOA 2HSIA 3DXYA 3SE4A 4DRYA 4OA8A 2GXSA 2HADA 4J3JA 1R5WB 4PJGA 3MJ4A 4PANA 3EIHA 5LFAA 1MCKA 3H8NA 4TVSa 3KWUA 4HQQH 4BO7A 1SDDA 5FQOA 1LSOA 2XYHA 3X2QB 2PL1A 1JWUA 2YHSA 1LS6A 4BLQA 1OAZH 4NZ8A 3A1DA 3DUUA 2FHBA 2RI6A 4ZOLF 2AC0A 3WFEH 3KPRD 3DWEX 2W91A 3PKZA 3ESAA 1K4DA 1HI9A 2Y0BA 3A32A 4QLAA 4U2KA 5H4HA 4EHIA 4QR7A 4UTBL 1BMTA 3M6VA 3T4AA 1LRKA 4YHNA 4YHLL 1P8JA 1U95A 2X5KO 3F47A 1X8XA 5LOVA 1HE7A 3D7PA 4J0CA 1SUCA 4F37K 4X66B 1CRLA 3QGVA 2KB0A 3QBDA 3LUJA 5IM7A 2ZITA 3G5TA 1ZWKA 1NIBA 1FLRL 3IBGA 1KOAA 2H7CA 3UWDA 1AS0A 3U7WH 4GSQA 1E8DA 2QE7D 5GGXA 4M1ZA 4AITA 3LUKA 3H2KA 4YP1A 3MOBL 3DZDA 4RFEA 1TJNA 4D0SA 5F9MA 4P98A 2GF9A 1JDPA 1OGJA 1DVFA 1L7DA 5JD5A 3EFFB 4JPVH 3LQYA 3UG6A 1PS3A 3EFDL 3UMVA 4QRAA 1NBIA 2DHRA 2VHXA 2NADA 1IKNA 1M05B 1BCIA 4APXB 3L2NA 1AYRA 3AIKA 4FDLA 1J12A 3W56A 2HMYB 5D2LA 4A68A 3WTSA 4M88A 1IC7L 3F8SA 2Q7OE 2VTVA 5IMOA 2QZPA 4LN1A 2LUOA 4Y4FA 4Y6RA 4MQEA 3U40A 1VGKB 2ENPA 3CZ5A 1NRWA 4KXZI 2R2HA 1FXUA 3ZNNA 4HIXH 2WXRA 2HMIC 2FK9A 4L3ED 1FNBA 5C0CA 4Q7LA 2VHUA 2XU9A 1U5BB 3ET5A 3CZJA 3IMRA 3AVTA 1YV9A 2XVXA 4FILA 3HDYA 2GJ9A 3JV4B 1DRWA 2F7OA 5HHME 3CMMA 3RUHA 16PKA 3PWPE 1ILUA 1JR2A 5GZ3A 1WW3A 1RHRA 3PK0A 2WJYA 3T0DA 2AXGA 4FQHB 1OB0A 5DHTA 4HKBB 3A2NA 2DQYA 4OCLC 5TE7L 3BMOB 1KPUA 3KXFB 2ATPB 4PJBA 2O19A 4EX7A 4UTRA 4C56B 2Z4QB 4LCYA 1CL7L 1EX7A 3AUKA 4K9SA 1E2UA 3HBGA 1B15A 5MEPA 4POUB 3TDKA 1JAIA 2A59A 3KJNA 4TWAA 4NNXB 3G9TA 1JH8A 1BA3A 4B97A 3L04A 5IN5A 4MUAA 5HGAB 1ZD2P 2VDNB 4Z23A 3PUVA 3O0RL 3HACA 5F5NA 4HXEB 4OJKA 4PAQA 2ERJB 5EMMA 5ALIA 3GSNB 2NNWB 4EX6A 3DPSA 5F7OA 4RMBA 1O9HA 5KJFA 5GSRB 1FC0A 4U9IS 4NQCA 3TYGL 4MW4A 2P48B 4E5SA 3OCYA 5TGBA 1H3VA 4A8JC 3P54A 4TYWA 1Z5LB 2RE8A 4CE6A 3G04B 1P8AA 3FSWA 1X7WA 1J5OH 4PIRF 4RD1A 3KVQA 3CPSA 5B38A 2ZXUA 1XH3A 3VTMA 4IAOA 1JNLL 4XZUA 4TUYA 1RD6A 4V02A 3HP1A 4B0MB 3VNYA 3BUQA 3OIFA 2H1VA 3HXOA 4AXXA 4AWXA 3H04A 2PH7A 4JVUA 1QJCA 3HAEB 5JZ7D 4Q4AA 3H0CA 4HRXA 2CLCX 1TZ2A 5ACLA 3FB7A 4K7PL 3H87A 2JSFA 2AQTA 4N8VB 2OMZA 3R5TA 4GL4A 1LZKA 4N2HA 3M8KA 3SM3A 2BSCA 5EC1A 1S9VB 2G3NA 3CXDL 1V05A 3HIZA 4OB8A 1UZUA 3OAWA 4XJTA 3QVTA 1C0PA 1A4JA 4JDVB 3A14A 3QARA 1S5HB 2WT9A 2HVKB 1JZGA 1R6BX 3J7TA 3JT2A 1P7KA 5EE9A 1C5DB 1GGCL 3RANA 4QOKE 1G5TA 3RAFC 2NDGA 2DBQA 3LJ3A 4D8WA 3O93A 1VA4A 2VJBA 3SKVA 1UM6H 3MBXH 4ND6A 2QSCH 3FU0A 3UPRA 1AACA 4KQGA 3KB2A 4GI6A 3USCS 4MA7H 5FCSH 2XTJB 3HY6A 4HW6A 3L95A 5C46F 4ABWA 4PGDB 4OBSA 5CFLA 3HMQA 1GZDA 1H65A 4FEEA 4E46A 1TZMA 2GSIB 5KX5F 5AM5A 1XO1A 5G0WA 2PU7A 3PYCA 1S9YA 2FBJL 4OAPA 2IBZY 1ACYL 4M1EA 3W4KA 5A2AA 2F4NA 5DGIA 4RTLA 1KLGA 4PAMA 1J22A 5H16A 3BT0A 1FTSA 4X5LA 1V5WA 4L8SB 5M29A 4EUHA 3BM5A 2FYYB 4Q5IA 1ZHBB 4PCAA 4EJ2A 4JSRA 2JXMA 1U8LB 5BSWA 1DJLA 1FQJA 3EAFA 1Q0ZA 2XADA 1Y4ZA 1Q7CA 1SVZA 3ZHXA 4L8CB 4HWOA 1SJEA 1XGRB 5DISB 4NN5B 3R7DA 5T5FA 3RX9A 4ARZB 4FBGA 3PGLA 2PO6C 1U3YA 1G6Q1 3E05A 1IXZA 1EG2A 5CH3A 2GTQA 1DQPA 2NXYB 2RGRA 3H4VA 3R0VA 1ZBQA 1FNEB 2ZKYA 5I24A 3FB5A 3CSUA 4YQZA 4LVOB 3QZWG 5SYMA 1S9DA 1Q3HA 4YCSA 1N7JA 2ZJOA 1B88A 4M5YH 1MRFH 2DF3A 2OE2A 2VPIA 2AI1A 3CX8A 1NGYB 1WUHS 2P2LA 1W0VA 1WFMA 2DWDB 1A2YA 3AVUA 5LCVA 1AR1B 4NQCD 4HK0A 5HKOA 2I07B 1CRWG 4CWAA 4OCZA 4LPTA 3I4CA 3B3IB 4L4VD 3VXPB 1KF9B 1U3JA 1BF5A 3L6OO 5C08E 1SPXA 1J0YA 4BJ5A 3RHZA 5D01A 2ICWB 2B39A 1XF9A 1J5XA 2FPPA 2AOWA 5DMGD 2JIMA 2WV7A 3CVHH 1E2VA 3OCZA 5I6LA 3ZZMA 3I6YA 1EAMA 1OCWL 1UZ8A 1J8HA 2CO2A 3IFSA 4QDGA 3RPIA 4MIEA 3D51A 2H6UA 5JYCA 5KNLA 1FFSA 1VIDA 4P3CL 1I7LA 2HP4A 1FE8A 1KSRA 4JLBA 3QOFA 1KP3A 4HWEL 4WGKA 4NJ9H 2RB8A 1RABA 4GRWH 3H8WA 3FSVA 3KL0A 1RIIA 4U7SA 3EJRA 3FZGA 3ZY4A 4LKXA 4TVBA 3MBKA 3SO3B 1IBYA 5J89A 2C77A 1E6OL 4WO4C 3RNKA 3F71A 3RVWC 4LLMB 1XMXA 5T7BA 1FP4B 3WWCA 5LU9A 4QOHA 3D4CA 1JDZA 1RYZA 1M71B 2QQ0A 2XGGA 1P4BH 2WAHA 2WLMA 4IDNA 3LK7A 4NYIR 4PGJA 3BMQB 4N47A 3FQ2A 5DJZB 1H3FA 1PGJA 2H63A 1ETHA 1H4QA 1DJWA 2ZW9A 3FK3A 3AG2B 2P3LA 3V2HA 1HEZA 1KJIA 4HDQB 4Y67A 1DOZA 5ELMA 3SJVA 3UMCA 4P5TC 2A5GA 3AY3A 3L8GA 1KFJB 4AL8H 3UJIL 3IIIA 5EHFA 4FN4A 1GCUA 2ZOLA 3F00A 4O2FB 5AKKA 5LMUB 2NO9A 5LM3A 2AVNA 1I1AD 2Q2NA 4I14A 4R0LA 1MDTA 3HR8A 3BXGA 4F1SA 1CJTC 1L4KA 5INTA 4XXWC 1NUTA 2X6AA 2BSTB 3DXAD 1PR2A 3W7AA 4EM6A 4PI0A 1EEHA 1I1AA 1H5QA 1AKNA 4KMQA 2QRNA 4PJCF 4AY5A 4BL5A 3R6WA 3MIZA 5C35A 2XBMA 1OP3K 1J1PL 3WRXC 2IF0A 3S88H 4YWGH 5CGYD 4MQTB 3RYCA 4PW3A 4P22A 5E03A 1OGIA 3EXG1 4N2KA 2UAGA 2OBFA 2QSCL 1MRDH 5A2KH 2ZX5A 1PX8A 4Q4DA 4JMLA 2AQRA 4ZYKB 3R3ZA 1IVYA 1GGCH 5FBZA 1IU9A 4LRXA 5BOSB 3WHE0 3SBRA 4CIVA 1H0SA 2LGJA 1AXIB 3IQZA 4ZZ3A 5FI1B 3WDHA 2IPUK 2JKNA 2WW8A 3ZDDA 5F72S 3MACH 4BS9A 2FF5A 3GEEA 1EP1B 2HBYA 2EYSB 3OJEA 2J7LA 4J3WA 1G1AA 4BMVA 2HHHB 2CJWB 2P9TA 3LH2L 4IYKA 4OV5B 5A7FA 1Q1ZA 2VHWA 3ZTDC 5C2BH 2GK6A 1S2OA 1AGEA 5BV0A 5LXTA 3ARDA 4JO2L 3DEZA 4DFIA 2DHCA 3CX7A 4BGEA 2A35A 3OO0A 2PU5A 4EAAA 3NSCA 2ZBEA 4BWYA 2OENG 3WJJC 1S2IA 5FBQB 3WGJA 2GCNA 5EU5B 1W4BA 1EUDA 4MV8A 1UD3A 2WPDA 4HNGA 1C9KA 3L3HA 4LCCB 4GMHA 1YZLA 3CQ9A 4UOZA 4B48A 1OREA 3FYSA 3LCCA 1I5EA 5TD4A 1Q95A 3UTTE 2QL7A 2FR4A 2HA5A 4Y4FC 3NPMA 2HJLB 3LPMA 5FADA 4K07A 1MH1A 5JVDF 1CYWA 3VXNB 3MCUA 4JFPB 4QRPD 3LY8A 1OAUL 4GAYB 3MWYW 1E2ZA 4AX4A 3QUZB 1UCBL 4ZYYA 1BDHA 3NACL 2HLFC 1USUA 4PHFA 2O5NA 2D5LA 3L16A 3ELUA 3ZE0F 2AFHB 5CLQA 1M7XA 2VQEB 1NT4A 4KI0A 1ONQA 2UWEE 2D0PB 1L7VC 1W30A 2R0QC 3SE0A 3VXOA 1C50A 2GOYA 5CK4A 4HETA 5JHDE 4KXQA 2NUAA 4WHYG 3UZVA 5CVDA 4FGUA 1GYPA 5JLJA 1N9GB 1U3NA 1TD1A 2C9VA 1KYWA 2OHHA 4LRNL 4LNAA 4MNGE 2PV0A 1WQVT 5J1AB 2EP8A 2OUKA 3C7KA 2D59A 4QUIA 1FZKA 3JVFC 5E2WH 3CIFA 3BWSA 3B5TA 2ZNWA 1M2GA 4KROC 1WICA 1OZFA 3OR6A 3Q3GA 5C0JB 2TSAA 1SD2A 2DEYX 3QIWD 2ZCKH 4IJQA 4R5TA 5CLZA 4O9HL 4LUCA 1HILA 3CT6A 3QOWA 1PX4A 3GJEB 2P8PA 1SZPA 4NQSB 2OO5C 2QRLA 3L1KA 4IU2A 3GBVA 5EQDA 2GETA 4L0YA 2FLKA 5LBSH 1VJ0A 4F7WA 1KH3A 5DI9A 1NC1A 4ALAL 3GMRA 2I4OA 5GGSB 2YS6A 1DAGA 1CDIA 3UZQB 1R75A 2IYFA 3AEXA 4H6WA 2VZUA 2VJKA 3TNFA 3UW1A 1R8YA 1KCLA 4BKMA 4RISH 3CF6R 4I4NA 4ODXB 4ZOLA 3L3JB 2XOTA 1NBEA 1DEAA 1VA9A 2WKOA 2VZ0A 4YT4A 3C5VA 2WNXA 2PXYD 5A3RA 1SVMA 1IC7H 1I6LA 3L7BA 1M6VA 1KY6A 4KVNL 1Y6NR 1NAMA 3UMRA 2PEZA 5C0EB 1JDJA 3T2OA 4B85A 5T3UA 3W2TA 4JO1H 3V0IA 3DF9A 4G63A 2A84A 1E8MA 2YK1L 1FUKA 5AOLA 1EFHA 4NQEE 3MVSA 3IU4H 1CQWA 4AI6A 2DD8L 4DYVA 3RKPA 4E5VA 5D3MB 4UV7H 1NUFA 2FG7C 2RH8A 3NI2A 3G5LA 3AOEA 5IVOA 1NLDH 1NMCC 4DTIA 3IBSA 4DZ8A 1QHOA 3UCFA 3BWAB 3AUWB 4WD3A 1Q7GA 3GRZA 2CKBA 1UC9A 1HY3A 4OQEA 1I7ZA 1FHNA 2IZ5A 3ZPDA 1P84J 2HREA 4XXDB 4HIHB 4K5PA 2E7LC 1E60A 1Y42X 3M3DA 4DCJA 2FYVA 3DZBA 4DGIL 5CLTA 3EH5B 1IWBB 1RZGA 1BX2A 4WW2A 1ACXA 4M54A 1YZVA 2JANA 1A6TA 4NKMA 1JAYA 4QQRA 4K3DL 1MREH 4A6YH 1DLFL 4KIWA 3D1MC 3N9GL 1OAZL 2W6PA 4V2CB 3LYLA 2EKSA 1WMFA 3FIUA 2CD7A 3SKJL 2GJAA 1IQDA 1PRYA 1WPXA 2C4KA 5DHUA 4TQEH 4RQQA 3KQYA 5AL8A 1GU7A 2HRLA 3DOSB 2OAEA 4CF7A 3T3DA 4KOCA 2JQAA 4M8RA 1HYEA 1G60A 3P20A 1UBNA 2QUJA 3WIAA 1I7RB 1JU4A 5DMIL 4GSXA 1AE6H 1AKJB 1C16A 3C3DA 5DCYA 4U3JB 5A02A 3BXZA 5HP5A 4ZYLA 5CEZD 3IJHA 1UGKA 4XJSA 4IIQC 4DIMA 2DZEA 3WBFA 4ZQKA 1QYXA 5IKCB 1YS6A 3IEAA 1E4HA 4G65A 3JYQA 3F85A 3TNJA 1YCFA 3TW4A 2X8BA 5TE9A 2O8EB 3RSCA 3HUUA 3N39C 2O6DA 2GHWB 5LQBH 4ABUA 3PGJA 4DNQA 3K9HA 4Y19D 3VTZA 4RMVA 2C0CA 1H3GA 1T2AA 1TF7A 3UEOA 3OEYA 4LCUB 3GJ3A 4MA7L 3N0WA 3T3HA 3U3OA 4RV4A 2G6BA 2Y4OA 5A5EA 3NYQA 4QRSA 3QG1A 2EVGA 3PCXA 4BVJA 3A58B 4X6XA 1NMEA 4FJ2A 5ALCH 2I62A 1OFUA 2ZSFA 2R0WL 4D80A 4P9HC 3LEYL 3QEQE 3SOPA 1HQRB 1ZM9A 1GMIA 2QMUA 3VFPA 2ZWYA 3X44A 4HWBL 3UG3A 4FYIA 1CXHA 5AYVA 1R4ZA 2Q5OA 2QN9A 3ESNA 2DHDA 1XTZA 4FWTA 4FXTA 3T7EA 3HVJA 1E9CA 1QCDA 5ECDA 3S29A 1ED3A 3ULVH 3N06B 5EZOH 1XXFC 3WGGA 3COOA 2P5UA 1NR1A 4RNRA 5DX1A 1EK3A 1R3IH 4M4PA 2O3RA 4BP1A 5TPWH 3WIHH 3I6MA 3TQCA 3AUFA 2ZIWB 1VPOL 5EEZA 1TYEB 1FPQA 1JWMA 2DM3A 4J4HA 5H94A 1QZTA 1CI3M 2QR0B 1IMHC 2OJEB 4HJGA 3Q6GH 3T3MB 1YVUA 2GHIA 3V5DA 4B2LA 4FLEA 1YHPA 5E1DA 4MSWA 5JPNA 3HCOA 1TXGA 1CGUA 4UNIA 4HH8A 4M43H 2ADFL 3GLIB 3SN6A 3FX2A 2DWYA 3CNEA 1EJ8A 4S1PA 4HYTB 4FWIB 1JNLH 3C08H 4PJDB 5EIIB 2GN9A 3H3PL 3VRJA 1SYSB 3BH8A 1SQ2N 3DXXA 4NOFA 2UXVA 4WECA 3QJQB 4NQUA 4D2IA 1JK9B 1G5FA 3K3PA 4ZJUA 2PP9A 3NHWA 2MTAA 4YRKA 3CFDB 5EUBA 1KQPA 3LN4B 4B87A 4Z7OB 2GBVA 4BDTA 2O2JA 1P2DA 3D8NA 3OKLB 5ID0B 4KQ3H 4YO0A 1I7TA 1Y5IA 4TNEA 2C9QA 2JFGA 1T1YB 4GYJA 3D6MA 1G9XA 4EEKA 2V59A 1XGKA 5BUGA 4J1TC 4N2GA 1YYLH 3CO5A 1DVUA 2FQDA 1JHLL 5IHWA 3MRXA 4CKVX 4MYWB 5DRWA 3X1MA 4CN9A 3FTWA 3U09A 3QPVA 3NG1A 2F1JA 3CURA 4MW5A 4UU9B 3FF7A 5F3FA 1EJ2A 4KFSA 3B43A 1VKRA 4ZBJA 3HRZC 4L8GA 2R8RA 2JC3A 1XGUB 1Z5VA 2WNGA 1T5WB 1KI4A 4Y2DA 4B31A 2QUBA 1ZVNA 2R1XA 1JG7A 3ED5A 1PIFA 2PUBA 4CPDA 2ZYDA 2Z7YA 3VGFA 4IQ0A 5GADl 2R7KA 4EKDA 4HUNB 3QKSB 1A9TA 1EWVA 2A83B 1RLWA 1VG8A 4L4SA 2H1IA 3KVVA 3GLVA 3VHQA 2AT1A 3DOOA 3V8OA 4OM1H 3CF0A 3O9WB 4IBYA 3L43A 2OMBA 2FHCA 2MIIA 1A04A 4BBWA 5J2TF 3KSBC 3LW8A 3IHLA 1YJ5A 5C2JB 4G42B 1K5GA 1R6DA 4LHYA 2W80C 4ND1A 1U2HA 4J7AA 4QU9A 3AFCA 5KUKA 3HYLA 2O0LA 3LY9A 3OKDB 2J32A 4XMPL 4R01A 5AVXB 2HHJA 3C5JB 1J33A 4TT3A 3FYUC 2WZ6A 1RLTA 4G6AD 3WN5B 4RX4A 1DUVG 1AKWA 3FTDA 2H0PA 3KAQA 3P9IA 4TTIA 5I9IA 2J3IA 3QWBA 3ZLUA 4LHQB 3AI1A 3VO0A 3SPVA 3K31A 2HRCA 4F4UA 1XV8A 1PWXA 5B3SB 2YUXA 2HX8A 1LBSA 1FDSA 4WTZA 5LQUA 2BSRA 1I2ZA 5FHQA 1MWOA 3WRWA 2BOCA 9ABPA 2VM4A 1NM5C 3CRQA 2REBA 1NE2A 2WUDA 4O02H 5MEOA 4M86A 3CUYA 3R7FA 4G7YH 4U1NB 1V6CA 3BT2H 3W79A 1E9SA 3ELYA 3J81A 5DYFA 1GZHC 1FS5A 1W36C 2C00A 5J63A 4XUDA 2X13A 1YG9A 5TJHA 4JVPA 3N8DA 5ISZE 5E94A 1FLAA 2YXWA 2O5ZL 1IJKA 2Z1PA 5C8ZA 5JYEA 4KI5D 3DOFA 5GJTL 2XA8L 1T2FA 1T0MB 3DDWA 4AWBA 4Z54A 3MT0A 3PE4A 3WP1B 4XFDA 1X7YA 1NLBH 1K5PA 5J5AA 1FL3A 3D0KA 1WGOA 1BIIA 5AG8A 1NIDA 2JQZA 1W6UA 3NWOA 1TZAA 1W0KA 2ES4A 4X8JA 4FCCA 1CBVH 3QXGA 2O8CB 2VLJE 3COVA 3D2UD 2JGDB 2NPIA 1ZS9A 1ZH4A 5L6YL 3H53A 5L7WA 1R66A 2BKVA 1TR7A 5EWIL 5E6IA 1TQTA 1J87A 3BAIA 3EBAA 3UBTA 4YRBA 1WSWA 2VRAA 4D4LA 3T1HB 4R3NA 4DV1B 3T7JA 4KYVA 3R6DA 1XCBA 4QRBA 5CCHE 2EDMA 2BRUA 4KX8A 1FFNB 1ZMBA 3WQBA 4EAEA 5JYDA 5HGHB 1EBBA 1EHXA 1VLHA 1SCQA 1H6EA 4R31A 4JBWA 2W6CX 4CKEA 2O7RA 3ZDYB 5LGKA 3HEMA 1FVHA 4PCUA 3DTUB 3F8WA 4W6YB 1OQAA 4AEFA 4G2AA 4F2EA 3UH1A 1JGLH 2CFTA 3AF5A 2B8WA 3FQNA 3UBXB 2F90A 4B83A 1KC1A 3ULVD 4GP8B 1G94A 4I5GA 4NRZB 3UROR 3H05A 3AM8A 1JK8A 3GFUA 3ADBA 3GRBA 5DJAA 1NAMH 2J67A 3C8DA 4YEEA 4K6GA 3GJ4A 2UY6A 3M9XA 4ER6A 2QROA 4I18B 4A3SA 2VEOA 1GIGL 1U7HA 1E9PA 2XB2A 3ZVLA 1OX4A 4LRIC 4Y8VA 4DIXA 1N2XA 2OO3A 4FLQA 5E4EC 4A1FA 2XZOA 1ORQA 4PJHA 1BM7A 3ARGC 1N78A 2JI1A 3IRUA 2J73A 1Q20A 4NR0A 5HJ7A 1KGWA 1ZRHA 2KMWA 1HNWB 1ADGA 4HKJB 1JNNH 2CD9A 5EHIA 4TXHA 1F3DH 1V5JA 3F65A 4LOJA 3LHKA 3GLHE 3G0CA 3CNHA 5JO0A 1ZEAL 3Q3GE 1UZAA 2XDYA 1P45A 2MSPA 2PYDA 1EE9A 12E8L 3PRKE 4DKTA 1F17A 3ROFA 2WBJB 2JCXA 3CRRA 4NULA 4DGYL 4WTZG 3NHSA 5FGCB 3RHFA 3FBTA 1SUBA 3CFUA 3HV0A 5JSKA 1U6IA 1UBHS 4YH1A 3GEIA 2H1LM 2FEDD 4GQRA 3S8YA 3GLAA 1NCAH 3JBG7 4M1DL 1EFPA 1KYDA