3ZDZB

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 111
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3zdzB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3zdzB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3zdzB03
4IXDA 3FCSB 1PD1A 1T6BY 1LFAA 1M2OA 4CNBA 1L5GB 2NUPB 4M76B 4MMXB 3IJEB 3BN3A 5HJ2A 5E6SB 3EGXA 4O3UB 4O02A 4HQOA 3PPXA 4WK2B 3QA3E 4WK0B 5KYYB 5E6RB 1T0PA 3EOBI 1FE8A 1M1XA 3EH1A 5E6UA 4F1JA 4NENB 1RRKA 1JEQA 1PD0A 1QCYA 4C2BA 3F74A 3V4VB 4HQNA 4WFQA 3FCUB 3HXQA 1YUKA 3NVQA 1JEQB 4NEHB 4WK4B 4IGIA 5BV8A 4FX5A 2XWBF 2NUTA 3ZDYB 3ZE1B 3NIFB 4XW2A 2VDMB 4DMUB 4O3TB 1ZOOA 2XWJI 1SHTX 3PPWA 2NUTB 1MQ8B 3K72B 5KYUB 2I6QA 3TXAA 1QC5B 2VDOB 2VDNB 1OLZA 5E6UB 2O7NA 4F1KA 2B2XA 3ZE0B 2QTVA 1IJBA 4BJ3A 5KYWB 5KYUA 1U8CA 3ZDXB 1SSLA 1IJKA 1SHYB 1BHQ1 2VC2B 4Z7NB 1IDN1 1M1UA 2NVOA 1DZIA 1SHUX 1L5GA 1PCXA 2NUPA 5E6RA 3EG9A 3V4PB 3VI4B 1M1XB 4O02B 1XDGA 3GXBA 3TCXB 4PN7A 4MMZA 4UM9D 2IUEA 3TVYA 2VDLB 3AL9A 3VI3B 1RS0A 4HQLA 3T3PB 1MQ9A 3K72A 1U0OC 5KYXB 3EOAI 1JEYB 1MF7A 5KYNA 1RD4A 2VDKB 4A0QA 3K71A 1ZONA 2XGGA 4UM8B 3PPYA 1AOXA 1TYEB 4NENA 3HI6A 2UZYB 4JX0A 4UM9B 3RAGA 1N3YA 1RTKA 4MMXA 4FWWA 3T3MB 1XUOA 1XDDA 1AO3A 4CN9A 3Q3GE 4G1MB 1BHO1 4HQKA 1IDOA 3ZDZB 2I6SA 3F78A 1SQ0A 3EGDA 2WINI 4Z7QB 3BQNB 1JV2B 3OKWA 3EFOA 4MMZB 1MJNA 1MQAA 2VDRB 4MMYB 3K6SB 1N9ZA 5KYWA 4G1EA 1JEYA 4Z7OB 1M10A 2WW8A 1M2VB 1ZOPA 5HGJA 5KYYA 2X5NA 5ES4B 4C29A 3AL8A 4CN8A 3OL2A 4G1EB 1FNSA 3EGXB 1OAKA 2P26A 5E6SA 3OKYB 2I91A 3ZE2B 4HQFA 2VDQB 2ODPA 4G1MA 3N2NA 5KYXA 3AL8B 1PT6A 2ADFA 2M32A 1AUQA 4JDUA 3FCSA 1MHPA 3PPVA 3M6FA 2VDPB 2ICAA 3ZQKA 1ATZA 1U0NA 3EFOB 1CK4A 1UEXC 3OL2B 4MMYA 3IJEA 3K6SA 1U8CB 1YVRA 3EGDB 3IBSA 3NIGB 5LN1A 3HXOA 1JV2A 4WJKB 3NIDB 4IHKA 1M2VA 3BQMB 4K3JB 2P28A 2ODQA 3AFCA 1NA5A 1Q0PA 3EG9B 3EH2A 5HDBB 3E2MA 1QC5A 4C2AA 3K71B 1JLMA 4GZ8A 1V7PC 1YVPA 1CQPA 1DGQA 3TW0A
chains in the Genus database with same CATH superfamily
2O5YL 1F4YL 2WMPA 2I22A 2NM0A 3INYA 2DQGL 1O77A 1QYDA 4ZVPA 3US0A 2HADA 3O75A 3N44F 1LVUA 4MVJG 5T4FA 2H16A 3S55A 3V0VA 4I2XA 5CH5A 2ORED 1EHLL 5I1GL 4DLKA 4CUJA 1CJTC 1QO3B 1IBZA 5IW1A 4G8JA 4Y2DB 4NVRA 3TOVA 2BBWA 5AB9A 2OMTA 3QZWA 3A22A 2IGLA 3JVFC 1NXPA 3MLXL 3I9GH 4UTCA 1IAOA 2ZXBA 1J07A 3IPBA 2CNWD 4QXAA 3L4XA 1TQSA 4PY2A 3VC3A 1GNQA 3T9DA 3UXEA 4D3CL 2X2IA 1BWPA 2B9VA 1TAHA 3ASVA 1F6BA 3OJEA 4NP4H 2PUCA 4MCIA 2NY7H 4XBMA 4N3AA 1ST2A 4ZMTA 2FIKB 4MAUH 2DPXA 3Q9PA 2MOGA 1TKCA 3ENQA 3BTOA 2AJVL 2RHRA 1JU3A 1ZLVH 5HCNA 4LVOA 1NC4A 3BD6A 5FA3B 3A06A 4DQAA 3ACBA 4NZNA 5T7BA 2OYLA 3LV8A 4BVFA 2EYRA 3ZLVA 1V37A 1AHNA 3DQPA 3Q40A 4S1QL 2VL5A 4KDWA 5IV2B 1R19A 3UYRH 3ZIAA 1Q20A 4KFUA 3L3KA 5IBLD 1WA5A 2JAXA 3WBFA 2V7QD 5DLPA 3AZPA 2NYYC 3QWQB 2A88A 2OGUA 1XEXA 4P4KC 2FPPB 1CX9B 3NRCA 4G5OA 1RCTE 3O6FB 3D48R 4HZLB 4TL5A 1N59A 4DCJA 3W0WA 4JCLA 4HKJA 1DGQA 1WYJA 4G4IA 4OG2A 1CFMA 2H7WA 2P49B 3NSDA 2ZQYA 3MQ2A 3AGVA 3WRXC 3DP9A 2WF8A 5J5VA 3AFOA 5KTSA 2FMXA 3OAZH 1VE3A 5D1XB 4U2CA 1T3HA 3URMA 3VKVA 3IUNA 4FJ2A 1NRXA 2XWBF 2VLKD 5AKVA 3UKDA 4KC3B 3ITNA 4R05A 2XVZA 2XCOA 2QUKA 2V5VA 3IULA 4RZIA 2WI8A 5AVQB 1RK7A 4OAWA 4DP1X 4QUGA 5I8KL 4JJEA 4RWYL 2CRYA 3KZNA 1ZH2A 5LDSA 4F37F 3GPIA 3VXRD 3LS5H 4YQEA 3EXLA 2W6CX 4MGXA 2QADB 1Z6XA 4QQ8A 2X12A 4JM2D 5I16A 1XH2A 1TZAA 2VQ1B 4NUMA 2P5SA 5IMBA 4U5QA 3K71A 1XO8A 1U0QA 2DBJA 2VO8A 3MZ0A 4FJ1A 3QX3A 3I50L 3TUIC 1FFNA 1T8RA 2DF3A 4IRJC 2YWZA 1E2BA 2JGKA 3IETB 4HUXB 1GJUA 4KH1A 4B3TB 2HC9A 1YEEH 3KPLA 3N43F 3U1SL 4YAQB 3MJ4A 3BUDA 5HDLA 1D3AA 3KWWB 5KOHA 2J30A 1MUJB 2J09A 4HEJA 2OGZA 2QQEA 4K87A 5FKPA 3BJMA 4WOJA 4AVIA 2UZAA 1RQNA 2ARJA 2KZKA 4Q52A 1QORA 1WSWA 3IMWA 2VJ8A 4JO2L 2WAOA 1TO5A 1GVIA 2KERA 1XGUB 2QZSA 4S24A 3TS1A 4RVBA 5L4MA 1M57B 2HN7A 5BO1H 4LL9A 5AKYA 1JAHA 4FQXB 4FE3A 5HF5A 4WY8A 5C0NC 3CLEH 2PUTA 5LQUA 4XX5A 4N8CH 4RISH 3I09A 1FNFA 3BWUC 3QUYD 1OWMA 2X4PB 3FPSA 2HG0A 4XI5C 2Y5EA 1QG3A 4WJG3 5J4YA 5DUJA 4LW8A 3VQ1C 3QWNA 1DG9A 2ODTX 2XWSA 3MJ9H 5EY5B 1YE5A 4Z9XA 2BKVA 3OLXA 1W4BA 5TF1L 5IAKA 3A6CL 3DHEA 4BDTA 3W77A 4HFWB 4KG7A 4HDIB 2F1IA 1KJ3L 3AF1A 2BWJA 3B1YA 4NPCA 4WHDA 5KJ7E 1P4IH 1DSFL 5FA4B 4XVCA 3A5VA 1JG3A 4N8SA 2Q8BH 2DTSA 1XCQA 8LDHA 4XUCA 4NPHA 2GAJA 2CNDA 1WVIA 4FI3F 1R0YA 2BI8A 2FH8A 5GJWC 1J0CA 1Q12A 1SO8A 3L7KA 2VHCA 3PJNA 4IKPA 3MSPA 5J5CA 2HVJB 4Z7AA 3UPDA 3TT1L 3SKYA 1JXGA 5L7WA 4UNIA 2FQDA 1KF0A 1F4XL 5KDLA 4XMKL 1D7CA 1TJ4A 3EZYA 5D4JA 4A3SA 2E4AA 4QQKA 4QRIA 2Z7YA 1NIPA 4Z3TA 1X9RA 3TQIA 3BPCA 1YY9D 2GAAA 3D6HA 2WP8J 4PJXF 4GW5B 4QNPE 3QDJB 1MCNA 1A0QH 1EU1A 3DCNA 2AV7A 5H35B 1WKVA 2A9NL 5IBQA 4QJIA 3RTBA 3DE5X 1EUCA 2HAEA 3EBOA 1DQZA 5DMXA 3FTYA 2H2PD 9MHTA 1JGEB 9PCYA 4FG6D 3RGGA 3UGTA 2KMWA 2I4MA 3UHAA 2AXEA 1SOAA 1CS6A 3AVWA 5HFAA 2WHPB 2YKKA 4TMFA 3ETJA 3G9UA 3LC0A 5DR5H 2Y22A 2CR3A 2KZWA 3HG5A 4GKZA 3FNQA 2VXUL 3C3XA 3MLVL 4P5DA 1PR2A 2EXYC 4YSPA 4ITVA 2ZWNA 4PRNB 1U9CA 4K9PA 3VFMB 4DGVH 2ECPA 1OX6A 2Y2VA 4EIWA 3GSQB 2R25B 3OAUH 5B4TA 1Z18A 1A1OB 1Q7TA 2YDXA 2CXNA 2J5BA 2PBLA 2OI9C 3FVTA 1KFKB 5LZ7A 1D2EA 1J8VA 5B2ZA 2A5YB 3PL1A 2RGRA 2G60H 3EBGA 4JG0H 1IHYA 3WICA 43C9A 4Z54A 1XCPA 3DXAB 4ZQKA 5C0CE 1JG6A 1XEAA 1EFPB 2Q3EA 4N9WA 1YY9C 2N7AA 3BM5A 3KXPA 2X9LA 1FSFA 1KFEB 1KYIA 2D3TA 3ND8A 4XH2A 1CFTB 3V7AG 3H0EA 2ZCKH 5FGBC 4OKNA 2WUWE 2IF7A 4S2SB 4KI0A 1X7YB 1ACMA 2CBGA 1XF9A 4PRHE 2W81C 1MABA 4HDIA 1CDBA 2QEJA 4CC4C 3WLAA 4X8OA 4PRLA 2QR5A 2HPTA 3B2VL 2E7DA 5FWRA 4BZ1L 3EGEA 1JCVA 1WCBA 2AC4A 4ZQTA 1CLCA 4XGZA 1FVEB 4IRZH 1CJCA 4AM0Q 4ZREA 3L45A 4OFBA 2EDXA 3FU8A 5ABPA 4NMMA 4AZTA 2VJNA 6GPBA 4UUAA 1G7QB 4GR9A 4E4TA 4IF4A 1XQ1A 1GH7A 4KYVA 2B25A 5K3DA 3TX4A 4K71B 3C6YA 4TMXA 1UM4L 4QEGA 4P35A 4LGCA 4MUEA 4S1SL 3MCWA 2IZOA 4P4UA 2ZT7A 3GRPA 2XFXB 4WLEA 1NIBA 2I76A 2IDCA 5BJTA 2I1VB 5JW3H 2YD0A 3GLTA 3KCPB 1U5AA 2XWDA 4ZPTB 2XUWA 3B9KC 3QEUB 4U6VH 3CPEA 3MREA 4YDIL 1AXRA 1II4E 1ZGJA 3A1DA 3RASA 1RXIA 3L1OH 2R0ZH 1QUEA 4P8QA 2ZBQA 2QW8A 2H9IA 5JJ5A 3GLHE 4JM2A 3SZUA 2VMDA 3LN4B 4I2NA 1CDIA 1K8IA 2PCFA 1RKXA 3EO9H 4DIDA 1S3RA 1PJSA 2PKCA 4DV3B 1W36C 2Y8EA 5IKXA 2JJTC 1XVIA 1URPA 4J8QA 1KN4H 2OBBA 1PIFA 4BE6A 4JKWA 1E9FA 3DX6B 2EJVA 3L9XA 1ODSA 2E75C 5LWYH 5CX1B 2B0SH 1K7CA 1IN4A 3J7TA 1RQ7A 1A64A 4ZPXA 4TTAA 4JDTL 4CU5A 1DVFC 1JUFB 4KVCH 4D97A 5AW7B 1SKYB 1HZZC 1I32A 4MDHA 1BKYA 1PJ4A 3BOVA 4DHWA 1KIPA 5IQ7L 4EAAA 3V9EA 4I9HA 1DAOA 1QX4A 4HB2A 1B74A 4ZXPA 2LKDA 4QMEA 5F7MC 5BQ3A 3DWGA 5HRUA 2E4UA 5DJDA 2NY3B 1WU7A 3O2WL 3THSA 2UXTA 4A8HA 3TLXA 3PPEA 1F48A 3GJ4A 4KO1S 2R1VB 1N0XH 4HZAA 5CEZL 3EO1B 3N2GA 2CVHA 4OHBA 3WXVL 3VA6A 1E5LA 1HDEA 4OB6A 4QXMA 2YMXH 1C0PA 1D2RA 3NBNA 1R00A 2Z5GA 4YXWD 5CU5A 2NP7A 4GDFA 4F4FA 4HWNA 3OGCA 3EO0B 4QUOA 4TVSa 4PGMA 1EE2A 1MRFH 4E7OA 4GAYA 3KMDA 4G63A 1ZEAL 4EK9A 3UZEA 1IAKA 3N42B 3V3KA 2RQEA 5K3FA 7REQB 1I9JL 3RF6A 4A8JB 3SHVA 4IKEA 4P23A 4R8VA 3BA1A 4EDHA 3FB5B 3BSYA 3K8ZA 5B5SA 3PHAA 1VLHA 3EH5B 3PGKA 4NSNA 3ZNQA 1JNNL 3V8VA 5CVUA 4PSDA 5M2QA 5I6OA 1N64L 1GS7A 1SOMA 3WSVA 4E9YA 1TZCA 4Q7EA 1NKOA 4M9QA 4YC2B 1YMMD 3IN2A 1G9MC 3IP7A 2ESVA 3APFA 5IBRA 1RJ9B 1MOQA 2VWPA 4YAFA 3LZ6A 1JWLA 4JRXE 1W91A 3A6FA 4CVUA 4JR9L 1JLLA 5JJKA 2OG2A 4LSUH 1TCMA 4ZV7A 5AM2A 2NYUA 2KDYA 1DMSA 3ZJAA 2VTFA 4B4KA 4M56A 1AZLA 2O5ZH 2FHCA 4G7YL 3NAMA 4M8LA 2OEPA 5D6DA 4R96B 5EEGA 4LASL 1D5WA 3T4XA 4JKPH 4KZCA 3UIZA 4FGSA 1LP9A 2FLWA 5EUOB 1T1SA 2Y4NA 2BSSB 3V48A 4PCAA 1IDN1 2CBXA 2PGJA 3WMWA 5HKOA 4L05A 2XDAA 3CM0A 2I67A 5T4BA 1CS0B 3TJHC 5T1DH 3HRZC 2X58A 5BP7A 1J0ZA 3L0IB 4U9UA 3L4VA 2B8TA 3AHDA 5A6SA 3BTUA 5A7GA 3WMGA 2X42A 1IHUA 1T26A 2XMPA 4GRLD 4ORGA 3AM8C 2R39A 2FKNA 2LW7A 4TSBH 1GEEA 5FWXB 4GG6B 4AJKA 1Y6KR 2FX8L 4Q02A 4IEFB 4LFHG 3Q2OA 4DMKA 4UQDA 4FBLA 3R7FA 4UAOC 1XLVA 1SUFA 4CQLB 1F12A 2YYSA 1TL7C 1PFOA 4QO1A 3FHQA 3P77A 1H5QA 1FNSA 3LXCA 3VI4E 1YAIA 1G84A 1K5DA 2W6OA 4TVBA 3FTWA 2B30A 4Y2RA 2NQDA 2EDFA 5F7ZA 4MW4A 3CFJB 4D0DB 3QHTC 4GSRA 4IEIA 1SZDA 1WWBX 3P73B 2IYEA 1G2PA 4IMLA 3PHIA 3DYPA 3VD5A 2BIHA 4MAYB 1KC5H 3GZNB 5C8YA 4XP1L 4JM4H 3SBPA 4L3ED 3UBFA 3ZGZA 2ENJA 1J48A 4V1CB 2N4IA 4KJQD 3HR5A 4G6KH 2H2SC 1ZD9A 3HYCA 3KR0A 2OK8A 5DVMA 3PWJB 4WOKA 4EB0A 1B0GA 4ETYA 4IGIA 1TA0A 4PRIE 1PNTA 5FBVB 2E3VA 4GAJL 2XWJI 4YV2A 1DEEA 5KVFE 3SC6A 1JP7A 1AA9A 3D8SA 4WQOA 4QRRB 4DETA 1CFNB 4GMGA 3LECA 3NAQA 3MAJA 3E4CA 4NH0A 2PX3A 3BZFB 3QI9D 3RVXC 4WZBA 2LQRA 1LSOA 3E8UH 3GQBB 3GUHA 3IEAA 1GA4A 3B9PA 3SU8A 3Q6FA 1EEHA 3CSYA 4JX9A 4IRJB 2ZB8A 5KTMA 1QOZA 1JVKA 1FMFA 3PX3A 5DN6A 4EI0A 4FTVE 4TNWF 3RHZA 5TE7L 2XA2A 3BVWA 2WUVA 4R9VA 3BXOA 1VIYA 1IL0A 3MCLH 1OKKA 3WNKA 3SKOB 1IIIA 4RQAA 1QF6A 4NBUA 1WWKA 4OU5A 2H1HA 3AWIA 1CDGA 3NRQA 1ULVA 1GU1A 3VR4A 1KVSA 1GTVA 3QFHA 5EJAA 1IXZA 2MPAH 3WGUB 2XT6A 1Y7IA 1EFRA 1XD1A 4XXWA 4ZG1A 4ZANA 3RWMB 1F7UA 4P23C 1WR8A 1Q94A 4WUKH 4KGLA 4Z9AA 5HHVH 3ROTA 1BA2A 5HGHB 1JDCA 2C8VA 3AEYA 3LS4L 3GMIA 1QCYA 2NP6A 4UBKA 3TN0C 2C1PB 3QUBA 4YI5A 4Q3DA 3OEHD 1B6RA 2A7XA 1FTQA 3SZKC 3GINA 2ZIFA 5CBAB 1IBCA 1W52X 1NMXA 1X1AA 3WNJA 2TMYA 5EJ5A 2SNIE 3VQ2C 1PQPA 2HL6A 5CLHA 3DRQA 1Y3AA 2ZONA 1SQGA 2PH7A 4E6EA 3UADA 4AV0A 4BS9A 1M1XB 1XDGA 2NIPA 3PC8C 3WB9A 3E1SA 5TH2B 3INRA 3THWA 1TJXA 5AVVB 1XZ0A 4PGEB 3HKBB 4LPCA 2O3SA 3KTAB 2AC2A 3KR3L 1N5JA 4JASB 5HK9A 1FG2B 3IEPA 1BXXA 5JXAL 3G9AB 4EHHA 2E49A 3MRDA 1MG3C 1CQIA 4C4KO 2P9GA 4GUPA 4N65A 4Q7JB 1B23P 1ZV5A 4Y16D 3F01A 1OXTA 3ROOB 4B7XA 3VPCA 1QRSA 5EP2A 4QXUH 3RGVB 3Q7JA 2PW2B 3TFWA 1BXRA 3N8IA 1ZM9A 1GDDA 5BSWA 3MGGA 1RJYB 3ZU8A 3OKEB 3T1QA 4YLBA 1OH8A 3LX6A 1YEFH 3KH4A 4MDIA 3NFYA 1XF3B 5G0VA 1XP5A 3TO2A 3R0JA 1PRYA 4NQED 2W98A 3LN5B 3GJFH 2YRWA 1TQTA 5C86A 2FDCA 3FBWA 4MI9A 1G20E 5ICSA 4F24A 3MKGA 5IDYA 2C2MA 4OAPA 5T1LA 1VL1A 2NY1D 2WZCA 3HYSA 4RCYA 3HI6L 2ONZA 1Q6YA 1BFOA 4JHBA 4XCFL 1EANA 1UC6A 1ZLUH 1AX9A 3PPWA 4JFDE 4UM5A 3C09B 1KMIY 3F6CA 4BLQA 3RB7A 2W9EL 4DCMA 2X4OA 1GKYA 1CF4A 3FPEA 3I3OA 2NSHA 2FXVA 4BC0A 1SCAA 4RMRA 3D85B 5G4LA 5KW9L 3MV01 3N1PC 3CUPB 1PR4A 3PXGA 3WRYC 4X41A 1M2NA 1EFXD 4TVPL 1VPVA 3JQ6A 1JZTA 3L4JA 4AN4A 1J10A 2V6JA 4GLOA 3F7QA 1EI9A 1KJ2A 2JFQA 4A68A 2O5XL 1WFOA 4IDGA 4I0PD 4NOKA 1RIVL 3HN5A 1I5EA 4LOUD 2Z8XA 3FXIC 1CU4H 2WM8A 3IH5A 5AB2A 5JPIA 1VKXA 3AR3A 1XLWA 4OM0H 3B6EA 5DM70 4Y9CA 4HF5L 1XLTA 3VMNA 2REQA 3BGFB 1VPTA 4PJCA 1IB0A 3WD5H 2VBFA 1VSQA 3ECBA 3CJQA 3CZ5A 1CQWA 1ERNA 1QFWM 1ANKA 4JI0B 5HY9B 3UMJA 2V9ZA 1A2QA 3UYRL 5HM8A 2PZFA 1A6ZA 2CJWB 3C97A 1S0UA 4XOIA 3CVVA 3FTUA 1HPLA 4YLYA 2GGSA 1US8B 3ZE7A 1KTRL 2HJVA 3V7WA 1XV5A 4L9DA 4ZO6A 1FL6A 2QX9A 1UXMA 2APTA 2EERA 4NS4A 4EIUA 1CUVA 1V8HA 2GFIA 1NW5A 1P29A 4CE6A 4I46A 2ZYRA 3PEWA 5L3VA 2BEKA 3G9XA 1BE8A 4W7HA 1Z13A 1EDQA 5BR8B 1X6NA 3MCYA 1XIWC 4FQXD 3B1KA 1FYVA 3T3GA 2OQJA 4WNSA 5B38A 3V0IA 3DMRA 3ZK8A 4HH4A 2HB0A 5IREA 2Q5FA 5DGTA 2GXUA 1SBSH 2O3TA 3NHKA 4AQEB 3DF9A 1IEBB 3ICWA 2EKJA 3TMKA 5JOPE 1IGTA 1I8KA 1E6OL 1T6ZA 3GJZA 1NCWH 3QFCA 4WBSA 3NDZE 5I8KH 1PGNA 1CBJA 2QR0B 4TULL 1NJ5A 4BY9E 4DDTA 1YEJH 1K97A 1JWUA 3BGMB 3J07A 3KEDA 3QHFL 4O1MA 4GOND 4C01A 4AMKL 5HHOD 1ETB1 3RSQA 2IRWA 4Z49A 3ABOB 1FLRH 3WNLA 1SA0B 4NAJA 4NFBA 3BAFA 2P6UA 4TSFA 2OK0H 1XF3A 1K3TA 4GC9A 4JDEA 3MB5A 3ZI7A 3BJIC 3T4UA 1OPOA 1E0AA 4OD1H 5JHDA 4P3KA 4LCUB 1KBKA 4TQPA 4YCJA 4Y0NA 4BQQA 1WBBA 3ASOB 1IUZA 4E5UA 2FWOA 1P3JA 2C31A 1FZOB 3KAJA 1I7QB 3LHIA 2XPGB 3MRJA 2Y1EA 4AYGA 3S3SA 4HO1X 3GQFA 3F4BA 3AVOA 3PFKA 4I08A 4JDPA 7MHTA 1LDEA 3UIEA 1XA4A 5E9JA 1RKVA 3D31A 4LHWA 5FGRA 3TGLA 3QVUA 3NWBA 2P44B 4X6BA 1YUBA 5H7XA 1NVDA 1KIQB 2G30A 1U1CA 1Y0BA 1IUPA 3RSHA 5CLFA 1NF2A 3VR4H 3UZVA 3QJFB 4W9LC 2G1JA 2MQ0A 4BGLA 3FYIB 4MA1C 3JT0A 3DOSB 3PJEA 2CKNA 5DX1A 1UFGA 3CZSA 3V79C 3GI1A 4UM7A 3DTVB 3NC1C 4MB1A 1RZGB 1RKRA 4BWWA 4KH2A 4BGEA 3OLGA 2W65A 2Z31C 1ZSDB 3UJ3X 1ZVSB 4FLHA 3UDWA 4A6YH 3DOOA 3T9FA 5E2VH 2A3TA 2GTWB 3DE3X 3Q5DA 3N50A 1O57A 4EYOA 3A4VA 4XFJA 4EYSA 4DJJA 3A3PA 3RBSA 2AEIT 2VR6A 4JOCA 3W8RA 3RARA 5AVXB 5HHME 4LEBA 3V0EA 1TNDA 4G5GA 1SB9A 4LEEA 4HPJB 3QCUH 3ZRFC 5ITZB 4FC6A 3AEQB 2Y1KA 4X4MA 4RZUA 1YOVA 1JEEA 3QWFA 2GKGA 2YPKB 1DT3A 1UL1X 1WIPA 2CXGA 1OTXA 2DWEA 1JWAB 3SDAA 3KQNA 2GPJA 4RJTA 1JJVA 2P8JA 3DTVA 5LCXA 3IPCA 5A2LH 2PYEA 1WAPA 3LQKA 2A0UA 3CLTD 1N2EA 4EW2A 1RR6A 2AA3A 5ABZA 4UATA 4MW5A 1X80A 4M0FA 1XCTB 4XKJA 2D54A 4KN6A 2GT9B 1PT9A 2ZOWA 4M8NE 1TETH 3WFIA 5E8DL 1ZPUA 3U7AA 1O1YA 3CVXA 2AE1A 2ZUDA 1JPTL 3RTQA 2R5NA 1S9WB 3FMIA 2NCMA 1U0OC 4JB2A 3COVA 2ECOA 2FJFA 2H3XC 3CXUA 4QTTB 3B8SA 4IKKA 4Y4KA 1FE8H 2B2NA 3KXLA 5LMCA 2VLJD 1U63A 5FC9A 3S3BB 1ENYA 1TM1E 4R6UA 4BZXA 5DZPA 4Z9YA 5EQDA 4I4CA 2QQ0A 2IXAA 1Z0JA 1E5QA 1LPSA 4UQLA 3PNRB 2VLJA 1SQFA 2QX6A 1DL7L 2Q3BA 3RFCA 1K3IA 1VF5C 3PFHA 3FJTA 1V10A 1O0CA 3O3EA 4MEBA 1Z56C 3KVDD 4L4TD 2WVHA 2R85A 2GFBB 3ZY6A 4AZVA 2OCBA 1B88A 1SBCA 2DKSA 5J4LA 1P4LA 3RSLA 5TEWA 1N3NB 3WFCL 2G60L 3TJHD 1WA0X 5FJIA 3FSEA 3WRYA 1CXEA 5ETJA 4N1EA 3QNMA 3CN1A 4IBZA 1QFWL 1JGDB 1E5BA 4PLZA 3DMFA 3MJFA 1I7ZB 1EUDB 4MKIA 2BNQE 2ZTMA 1MH5B 2D5BA 5JU6A 2P68A 2C8JA 4TT3A 2WAAA 3QFSA 1HORA 4LKCA 3TPFA 3R5TA 1PJRA 1VIMA 4WCDA 3NIFB 1J88A 3QI9B 3FROA 4E2OA 2QQNL 3OCYA 1MAAA 4TTPA 5B4VA 4ZDHA 2NTFA 1DTWA 3HH8A 1DHKA 3KLQA 1NR5A 1T2XA 3E23A 3V4OA 5ELMA 3FO0H 1XGZA 3AB7A 4A39A 1KJQA 3PYLA 1MAVA 5KNBA 3JQQA 4JEMA 4MNHB 4X7MA 3JAWA 5JS7A 2WD7A 1C16B 4H0LC 4Z7QF 3H75A 1GGMA 3U7QB 2VTBB 2HHCA 2GK0B 3RBXA 5EMHA 4N5UA 5ITVA 3ZKNC 3PFIA 1US8A 1JEAA 4S1SH 5D7JB 1Z88A 3B37A 4C5BA 3B1TA 4HS8H 4N2NA 4EB8A 4F20A 1S2LA 1JN6B 1MCFA 2JELL 2I7CA 1NC2D 1IXYA 2C7UA 1EWQA 1OAKL 4WAFA 4UIKH 2WQSA 1AUQA 1TW2A 3AXHA 1NCIA 4NMHA 1QOQB 2R0ZL 2BRRL 3ML8A 3MUNA 4HZ1A 3DAHA 1NXSA 3ZV7A 3U0VA 2MCPL 5JAHA 1A1OA 4WUVA 2PWDA 1MO5A 1T1RA 2Y0CA 1UOQA 1PG5A 4G81A 5TPZA 2FB4H 4AY0A 3A04A 4DCOA 1RXLA 3ZJ5A 1I8TA 3QEMA 1RAFA 4PRNA 4M5ZL 1IE4A 5IW6A 1M34A 4XSGA 5TE6L 3FGZA 1Z63A 4XPBL 4BEIA 3PRYA 3DROA 1UQRA 2B1RA 2VLKB 2XIQA 3CFBA 1PF7E 2DUMA 4XMPH 2E5WA 1JFFB 4LCEA 2A67A 2AMJA 5LWYL 4F7DA 1J9TA 3DJSA 1X8JA 1DT5A 2WK1A 2ZAIA 1G59A 1IAKB 4ENUA 1PG7L 1XGQA 1H4QA 1P4JA 4OCLC 3RG2A 3WTVA 5EIOA 3STYA 1T3ZA 5BOZG 1IZKA 1UEIA 1PR6A 3CZ9A 2UZXB 3FN3A 1U7OA 4W63A 2PVPA 1JFHA 4JP8A 3KJ6H 4YC2C 1XF4B 5GGVY 5GRVL 4YH6A 5HDQH 1JHDA 5CEFA 3BVNB 3QLUA 5F7JA 3HACA 1XTZA 3FW6A 1WSAA 1M7XA 1TJHH 5JFTA 1BD2D 5FBHA 1UBSB 3WGLA 3LGSA 3MTJA 5C5CA 4RV5A 4HQ6A 1GGBL 3TZ6A 1A8UA 1HH4A 3GIVB 1TO2E 1UXWB 3VFWA 5FHRA 1IH8A 3DS8A 2XFGB 4G65A 3RI5K 5IOPA 4NOMA 2HLHA 1L9XA 1OOEA 4CN8A 4A2EA 1CU1A 2WV7A 1OAKA 4KWIA 3QV1A 2CUIA 5HXMA 3NBYC 3DHVA 3MBWA 2ZUQB 4HALA 3IXAB 3ULSB 3EFOB 2B1AH 3J7AC 1PJ8A 3RFTA 4P3XA 2X14A 2IOYA 1N0LA 3FUIA 4G85A 3KS0J 4NRZA 1SEPA 1AQMA 4JBLA 2WHVA 1OT5A 3W81A 1BWWA 5CU7A 1QPKA 3BREA 4BM7A 4YSTA 3L41A 4ZXBA 1Z5HA 5HJEA 1H0KA 1TJ3A 1WKBA 1X3DA 1X5LA 1VRCA 1A2YB 1W16A 5HDBF 2WZ6A 3MCKB 5DWPA 2ENPA 3ZLUA 1II0A 2NVBA 4BZ1A 2NUTA 1K66A 5EIFA 1RQGA 2BY3A 2PWYA 4U7DA 3HCVB 4CCYA 4O58H 2VA9A 3FLAA 5L9DL 1NHWA 1M56B 2VKWA 1S5IL 2VK8A 4Q3CA 1XSOA 1IOVA 3QQ5A 2JI1A 3OQ6A 2N56A 1W88A 3AG6A 3P4OB 4YL4A 1S7WB 1WVGA 5AKIA 5JD6A 5DQ9B 5ERXA 2WQ7A 3FD8A 2G5PA 3EUWA 2JEYA 4JN1H 3REQA 3CN0A 2CRMA 4MS1B 1VZ3A 3Q3JB 1G6OA 3GSVA 3MACL 1HI9A 4EJFA 3MFGB 2GBTA 1S9XB 1MTZA 4JL1A 3CH7A 2ARJB 1L4IA 5IZ7A 5ALXA 1TCCA 1YZUA 3IMEA 3CZUB 1AV7A 3INGA 1JT2A 4LXHA 5JW4M 4P5EA 1N6RA 2H45A 4X71A 2DH3A 1Q44A 4Q89A 2APWA 4Q1BA 4I14A 3MLYH 3MIIA 4JS7A 2EKQA 3FTXA 3NJJA 1NR1A 4I48B 1HQYE 4RMJA 1WHOA 5FPIA 5FOBB 4R4BB 1OT1A 3VE0A 2QYSA 4YRAA 1CL7I 3OJWA 3WLLA 3M3PA 4MR9A 1TLMA 3C8DA 4A63A 4H6PA 5EWJB 5FUQA 1OZAA 1MJJB 3WO0A 2KMLA 5JJIA 3WLIA 1SAYA 4JHAH 1ZT7A 5EIVA 4RLHA 4Q9CA 2OCIA 1JHZA 4Y2UA 3U6XS 4L51A 2GF2A 1U3YA 4ARUA 4IRUB 4ACTA 3AJAA 1KN2H 3LKOB 3E1ZA 1Q83A 3K2KA 4RYLA 5D96B 2FW7A 2JIRA 1PNOA 2H1OA 5E6UB 1U28A 4CEHA 1F90L 3OLIA 4CF4A 1D4ZA 5KWJA 3L3OB 4JZNB 4NQSA 4OZHA 4D43A 4WJ5B 4YZWA 2FPKA 5BUPA 2XLLA 3SBDA 1XCWA 2RFXB 3UA4A 1WLYA 1FRGH 3PDIA 2JARA 5J9PB 2ZSWB 5DS2A 2V1UA 3K70D 2MINB 4NBZB 4RWHA 4ZI7F 4BNXA 2FEPA 4KHXH 3FT4A 1TMQA 4B9EA 1QMUA 2A0WA 2PS3A 3MRCA 2HWUA 5LXTB 2J87A 2DLCX 3RK4A 4EPYA 2CLEB 1DKPA 2OAAA 1Z5GA 2CM6A 4ISVB 4Q97A 3CRNA 3EUUA 4NKDA 2HT3D 3GSOA 4IIJB 1Z0UA 2DQHH 5C1MB 1RK0B 3WCYA 3ESNA 6PAZA 1LBEA 3FETA 4Z3DA 2NUBA 3HRHA 4KP7A 2CVFA 1FNAA 4WRLA 1UXJA 1QP8A 5SWZB 3AQXA 5C31A 3D3JA 3QKRB 2V3DA 1OARH 5TE7H 1LDSA 1WFNA 1AS7A 5AK6A 5AVUB 1O94A 1DXYA 2ZSUA 5F0PB 3FR8A 4O2AA 1J00A 1OXBB 2VZ3A 2HSGA 2L0XA 4URKA 3GNQA 3RBZA 4HFUL 3RVOA 1ZRUA 4UPDA 2SHKA 4NM8L 3FX2A 4QUEA 4MASA 3N28A 1ZVMA 5J89A 4KK3A 3QEOA 5JNWA 4HWSA 3WYDA 5JO0A 3KW8A 4QPDA 4JPKL 5EZJB 2XUQA 1P7QA 1TKWB 1YR1A 3LB6C 2VJMA 2OYRA 1N7ML 3N74A 2J9YB 1SHUX 2DQIH 1JTEA 2I5YH 2WF6A 4Z7UE 4K81B 4L3WA 2XV6B 1BVKA 4YXKL 3LJKA 3NJ8A 1RFGE 2Y6SC 3I6KB 4U3XA 4HIEB 1KUMA 1LNUA 1BEXA 1SUBA 1TJ5A 3H9QA 3I0ZA 5B7MA 3V4ZA 4XX0A 4HUWA 3FDWA 3MTRA 3IGFA 4IZHA 5IM4F 3NEEA 4PJ7E 3UTTE 2IE0A 2CN1A 4MKXA 4YHMH 3FDZA 4ZRDA 1XJ5A 2ZYVX 5HHQA 5ISZD 5F88B 4MS4B 2CYAA 2WXJA 1Q15A 1BA9A 2VBIA 3C6BA 4DLAA 2CUMA 1PAZA 1E1CB 4I0PA 2GESA 4ZNEE 2GEVA 4JN2A 5CD9A 1VI2A 1DQLL 1QSFE 4JFOB 1GKIA 1AKJB 1U3NA 5P8WA 2WF9A 1BECA 1ASPA 4D4LA 2E9GA 3WS3A 4K3EH 2ASVA 1Z06A 1BX2A 3MYJA 5M5BA 4JWKA 2UWEE 4E5PA 3PDGA 2EIJB 3S8GB 3BMXA 2XADA 2AXJA 4FFPA 5ES3A 3P52A 1Q1BA 4LF4B 3B6MA 3CN7A 1YJDL 4IRSC 3EF4A 3ZVKA 3QRBA 5ANME 2YYZA 3BH0A 4ANWA 3SQNA 4OFIA 2YPLA 3LFHA 4GWLA 3NT0A 2G4CA 2M6RA 1LVEA 4OLXH 4F2HA 1V39A 5KSBF 4O51A 2ROXA 2BHSA 5ELLA 3QKIA 4L73A 4Y0VA 3RHWF 4DADA 3D8TA 4XPTH 3BDXA 3PUYA 2IWHA 4MHTA 5JSKA 5DWDA 4H3VA 4PRAA 3HKCB 1A9RA 3VI4B 3UYPB 2P9TA 1CN4A 2WTBA 2V37A 1V2HE 3LC1O 4O4JB 2QQGA 5AVQA 2QADC 1OHHA 3F6YA 1UM8A 5E5UB 4J1NA 4OCZA 1SC9A 4MQXC 5ADUS 4I85A 2PQ0A 3OBAA 3OQBA 1JKFA 5D6CA 1OHHD 1TVKB 4JFDD 5KW9H 5F7AA 3TCNA 2HT4C 1R5IA 3AACA 3OC0A 1DBWA 1FFGA 4OXNA 3SGJC 2WO3B 2IVZA 3AGPA 4YP9A 2AG0A 5KKNB 4J3NA 4IS3A 3W9EA 1XHHA 2P7IA 3JYHA 5KZMB 1SCQA 4K7PH 4QRRE 2H1VA 3TO4B 3FGNA 2HFEB 1ZK0A 5J5EA 1I1RA 3KEGA 4I9XA 4KVNL 3O38A 4JFED 1LRJA 5AW0B 3FXAA 3FQRB 4GBXB 5DE3A 1A4KA 3VH4A 4PJ9B 2ZXWB 2HMWA 2YWEA 1RAGA 4CN4A 5I4CA 3E27A 4UHHA 1K5NB 3GP8A 2J45A 2WSPA 1A9EA 5GIRA 3WN5B 1Z2CA 1C8PA 4R7VA 4FE9A 2VUOA 2JCCF 4KX5A 3G6JB 3A0RB 4LV5B 4CC1A 1OC2A 2OHFA 3MRGB 3KYIB 3L95A 3T1TA 3N55A 3ANSA 4BGDA 4UFPA 4DV4B 4Q9IA 3WIDA 2Q9CA 2R56H 4HX2A 4I6JA 3PNOA 3VOSA 3AI7A 1P84J 4A7SA 3KNZA 1AP2A 1DQSA 3L1VA 1IJFA 3LGAA 1Z16A 2Z35A 3T9BA 4G0UA 1KEPA 3AEKB 5I6XC 3HAEB 4ZXBB 2RK4A 1PJZA 1U1GA 4RAOA 2ADMA 3EY9A 3TM4A 3C5CA 5HBBA 3LY8A 4MI1A 4ZVOA 3BWUF 4NN5B 3TR5A 3ZR6A 1ODKA 4U3CA 4X62B 4R7NB 2JFXA 3E7WA 4S1DC 1NVBA 3NO4A 3HZVA 2A7QA 4XH9B 4YSAA 1IU1A 3ECWA 1L7AA 6TAAA 3V46A 1AN9A 4C58B 4EI5A 3N43B 3QHFH 4J3SA 5IUCA 1YHNA 1KLGB 3STUA 2X4SB 3L95B 1M1YE 3DWIA 1UDAA 4AO8A 3WIFA 1RI2A 5BUQA 1YZGA 2X4RA 1FW6A 4DXDA 1I3VA 3VDBA 3P4XA 3C14C 4J4PC 4DL9A 1BVLB 3NK4A 4TT3D 3VD3A 4GOSA 4H26B 1K08A 1GQOA 4ALMA 4M43H 5CHEA 1XTSA 4HUCA 1Z8HA 1E9QA 1PEAA 5K69A 3CUWA 1OOAA 1ZA3B 5EEVA 3U1BA 1C5DB 3QUCA 1ZLXA 2CUAA 5C0EB 3CZLA 2C5BA 4BH7B 1NJSA 4DCUA 3ZHCA 2EAUA 1JGLH 2BN4A 2PS1A 3ETCA 1KL7A 2FZVA 2R8RA 4E2YA 3LXBA 5SWZD 5KN5B 3I76A 4LCCA 3W5NA 3A31A 1G3RA 1UAYA 2PUAA 2DQJL 4Y4FC 5BCAA 3HSKA 1B8OA 3IMFA 1Y18A 2O06A 1NX6A 5JXWA 4FFVD 2D4DA 5F1KC 3L79A 3D8HA 1Z8NA 1CE6A 4OH7A 2N1BA 4IMRA 3M6FA 1L9MA 2C3XA 2YH2A 1U8CB 3EGDB 2YWJA 3ZGVA 5BS0E 4C6HA 2WJIA 1KSFX 5D86A 2J33A 4PJHA 4GY4A 3M1CA 1TT6A 4KDRA 4OQEA 3B2DC 3BI9X 1GAFL 2A9KA 1F0YA 1DG1G 1YFLA 2AJZB 1EFQA 2ORWA 1N5DA 1JYFA 1FH2A 4CGZA 3KLLA 1X5AA 4P93A 3QOYA 2P9BA 4G8FB 1Z3GH 1E3DA 2I7VA 3HBFA 2AEFA 4M88A 2WIDA 1UWKA 4BMCA 2PZMA 1R3IL 3SYPA 4ZSOA 2AFIB 2F74B 3SE3A 2ZXQA 3L6FA 4FEGA 4M86A 5HQ3B 3BUBA 3FQNB 3DTTA 3GFRA 1ZBDA 4N0FA 1WXWA 1ILWA 3JTTA 3QYAA 3FLMA 5F7EH 2XCSB 1ULBA 4P4KA 3WS3B 2OPHA 3K9LA 3NANA 4JVWA 4LC0A 2VOTA 2APBA 1D09A 4IDOA 3HLAB 4KMQA 1A1NA 5DVKA 3RPIA 4HS9A 5K9KA 3UJCA 2UY7B 4JODA 4CMJA 5L8JB 3LVBA 1A6AB 1DUZB 2C2OA 3W0WD 4BKPA 4CLXA 2VNIA 5EC1A 5C0BA 5HGXA 1ZLUK 4J12A 4M9RA 4JCWA 3PYMA 3WOHA 2RGGA 4DAGH 4ZAFA 5EJEA 5I5IA 2CNZA 3T65B 2FD6L 2VDRH 1I10A 3LHFA 4XGQA 1A6WH 2ZYUX 4LG1A 2WUBL 3SD2A 3U30B 4NERA 1B2WL 1YU9A 1PZSA 2XZAH 1DRJA 1GZQB 4C7KA 2QVXX 3WDIA 4EELA 2OMVA 1A3LL 2HLEB 3I83A 4NPJA 4LSPH 4YJZL 3FMGA 1C5BL 3ULSA 4I5DA 4DTCA 4TOYL 3RVSA 4CEIA 3HKEB 1S3GA 2NZIA 3W4KA 4R7XA 5GONB 1Q9KA 3A9WA 1BW9B 3DBXA 1R1CA 1J8SA 2EVWX 4O2CB 3MTIA 1DANU 2PPEA 3U2IA 3OT4A 1J39A 3UENA 2LAAA 3RWOA 3O21A 4H0CA 2V8OA 3QKRA 1E2NA 5E5MA 2XWBB 3TTXA 4W6YB 1NPYA 1P33A 1AVTA 4MV6A 1ZVKA 3QU4A 4B4UA 5GJCA 3FFWA 1AFVH 2Q7YB 5D1QA 2Y9PB 3HPLA 3NR2A 3H9HB 4LSVH 4LCCB 3OR7B 2BDUA 4A38A 4RK1A 2OAGA 4YXHH 4S3MA 4PJ8D 3RURA 1B6UA 4YMIA 2K70A 2IP2A 1WDMA 2O2IA 1A7OL 1JGVH 3R0IA 1JMYA 4C1NA 4QTZA 3IFOB 2VTKA 3VPHA 1IJEA 4C8XA 1GGCL 5AVXA 5TV2A 1TTQB 2WNHA 4I5EA 5D93B 4JSRA 2YJ4A 1CUOA 4GXVL 4J75A 2P2LA 2BGIA 3QVSA 2CO4A 1XQVA 3EJTA 3UMCA 2WHXA 2V4MA 3R0NA 2FZCA 2IDFA 1NC4B 1SIBE 5L3QA 3LQ4A 5DI8B 1JZDC 4ZW6A 2PAAA 3MUGB 3A27A 2J20A 3WMXA 3ZU4A 5BMVA 2FIKA 2WT4A 3WHLA 2Z91A 2MHAB 4FNAA 1Z6TA 2ZVDA 1WRBA 2GPYA 3VMOA 1TITA 3Q9QA 4DLWA 5JY1A 3OQVA 3WIOA 2ATXA 3T4PA 5F1OA 3CFEA 1J24A 2OORC 2HRQA 5BQ7B 5FNVB 1BVNT 2VNKA 4J7AA 4NDMB 3N1FC 4UMDA 2AOTA 4G8DA 2GYYA 4IICA 1OFUX 1DOZA 4L3CB 3VGGA 1AO3A 1CLUA 5B7PA 3T65A 4JPWH 1YFKA 3DUFA 1TFPA 2WB1A 3CUSA 3G9ZA 1QFZA 4YPVA 3TBYB 2HU8A 1QB7A 3AETB 1FP1D 4LCUA 1MW8X 1A6AA 1HHHB 1Q0UA 2HWZL 1D5ZA 3NCTA 1TQWA 2YEZA 3FBKA 1X3LA 2JBHA 3MWGA 3S8WA 1WW2A 4PREB 5E8EA 1J9CT 2R2BA 2B82A 4O4IF 4RAUA 4FMDB 3P32A 4C7JA 4RC9A 4BQBA 3WE6B 1UBFA 3IFLH 3C87A 1KMQA 2XKSA 3EBIA 3DONA 1TJGL 5BV7H 4FD0A 5T5FL 2AFHE 3OKDB 2AEWA 2X7LA 5ALNA 3EZ8A 1ZTMA 2ZATA 3FQNA 1DMRA 4Q6WA 4J16A 1IIRA 5A0FA 5BR7A 4ROTA 1ZAYA 5I17A 4YAQA 4NCKA 3VU3A 4C03A 5FYJH 2J55A 4O63O 2C4FU 1U36A 5K0LA 4KXQA 1NDMA 2TSAA 4TMZA 1IGIH 2EZ0D 3VGPA 4UJ3A 3N2YA 4MRMA 1HYBA 2BNQA 1B3RA 3GLQA 1HX7A 3TZBA 3FHAA 3EIXA 4PNEA 5GOTA 5KJ4A 4KGDA 5F12A 2IFTA 1PGPA 5J2UB 2V0AA 5DC2A 2VJDA 1KYTA 1MHTA 4NQVA 2FK9A 5F89A 5KU7A 1P45A 3FT9A 4GP8B 1YQTA 4H17A 4UBDC 2CNNA 3BPLB 5I3ZA 5CDFA 3RIXA 1MJ7L 4PJHB 1ZE3C 4HN2A 2DQMA 2QV0A 1B76A 3F4LA 4WKZB 3I37X 4AYID 2VSOA 1KCSL 3IEMA 1MAKA 3SDAC 4GMSL 3FH0A 1XZDA 1ILSA 3RPBA 3BXEA 3B43A 3GGOA 3LTVA 3L5KA 3RVBA 3VW3L 2JCXA 3JARA 3L0SA 2ITFA 1QRUA 2IPNA 3DSNA 4IJ3B 3CJTA 5D1QC 2L3BA 3VXQB 3L7IA 4P4NA 3V8OA 1E2IA 2GBFA 3HSYA 3VKHA 3RJTA 4NWIA 3ZZQA 3PQ7A 5A2JH 5IJVA 3O8OB 3W05A 5F7LB 2YPKA 3WHE0 1GPLA 3FL7A 3SX0A 3D3QA 2ZX8A 3I6LE 3NVQA 4MUBA 1I8LA 5KNDA 3GFGA 4HEPG 2XA3A 2F17A 1R4MB 4AY5A 3BPNC 3H0TA 4QOEA 1OXUA 1NBVL 2IS1A 2H2WA 2V7HB 4A67A 1YRHA 4HHEA 1MO6A 2IU3A 1SSLA 2DEUA 3ZJ4A 3QZLA 3MLSH 3L3GB 1MGOA 3QK7A 1UCTA 2MU1A 4TL6A 4MQLA 2J9GA 3RL2A 1E9BA 1F00I 5AAWC 3L1UA 4DABA 3UHOA 3PREA 4D3CH 3TXYA 3O94A 3DDNA 4B7LA 2AITA 4PG2A 4DLBA 1YBVA 3ESMA 1KIRA 5FX2A 2C8NA 5T4EA 2C4WA 3SJUA 1R16A 1QG6A 3CGTA 3QX8A 3FN9A 2J3IA 4M7PA 5AKGA 1L5YA 1SLUA 1UASA 3W7AA 5C9ZA 3ECUA 4X8XA 3A67L 3F05A 1UXHA 4C0JA 1A7BA 3EEOA 2PUEA 3O3AB 5E4EB 3TZKA 1VL2A 2W2NA 3CWGA 3RVWD 3BWXA 1JHXA 3TEJA 2VF4X 1ZE3H 1ACJA 1ZC4A 2IV3A 1UM9B 5AXCA 2NG1A 1BX0A 1ZNWA 1CUZA 4YMUA 3TI7A 3K4DA 4B6SA 1QK3A 4HLCA 4R4ND 1KTLA 4U1JA 4O2BA 4CMEA 1WFUA 5AW9B 1QBMH 4YFDB 5DK3A 1WAAA 1ONBA 2FR4B 1X5JA 2ITEA 5DHYB 4Y5XC 4ODUB 3EDOA 2HA4A 5JSFA 3S2ZA 1CO1A 1W8DA 1SM3L 4NQTA 2ZG3A 3QK0A 4Q5IA 1IWOA 1JGDA 2QMOA 3TKAA 2HFFA 2PWFA 3BFOA 2F3UA 1TIKA 2NLJB 3HMXH 1MQKH 1SN0A 3KPSE 5J7CC 4IG9A 1EDOA 4QHUA 1ZHHA 1F9EA 4MAYD 3GLHB 1XIWD 1TZJA 4DSNA 5AVSB 4OQTH 1U2DC 3LIZH 4KK5D 1YS7A 2HEIA 4E5DA 1BN6A 1N7MH 2B5VA 5H3LA 2GO7A 3M88A 4YNYB 3C3MA 3GWGA 2FATH 4FCWA 1LO3H 2HHJA 1JSYA 3DZCA 2HFKA 2KYIA 4B9JA 1H9BA 5B38B 3GR6A 1P2VA 3F12B 1QYWA 3MTDA 2P4AB 4PTZA 4E5XA 2ICAA 3NVDA 5HVHB 3OT1B 5GV8A 2E87A 2R4UA 5FUYA 5BUGA 3RWFB 1FFHA 4HEQA 3TQTA 2Z3FA 4K05A 3MDJA 1C7FA 1NVAA 4F2MA 3C3EA 1PDWA 1BE6A 4QOSA 5B3AA 7FABL 1VB3A 4W6XB 4LJ9A 2F8LA 3WGQA 1Q90A 4L9LC 2V7WA 3OKNB 4K3EL 1Q8MA 5AVRB 5CR8A 2EW1A 3QEKA 4GO6B 1HEZA 5EBMB 3ED1A 2VYNA 1E3WB 2E85A 4TUJA 1QSFD 3I9AA 1V9CA 2EGGA 1WF3A 3RFZA 1ESEA 5FTKA 5REQB 4JGIA 1H8EA 1NJ1A 2ZPAA 2XKAA 3PGCB 3LZFL 3WQQA 3K4ZA 4JUTA 3L2LA 3DB1A 1P77A 2EG5A 4KRFA 5FFNA 5DFVC 3IAXA 1SVKA 4XR9A 4Z5XA 4HJ0D 1BIIB 2H1RA 4OQYA 1P7ZA 4JEUA 1S2GA 3A6CH 3RC3A 1A97A 3QWOA 3UTZB 1HNXB 4CQNA 2YBDA 1LDPH 4C3OB 4LKXB 4G5FA 1XR8B 4JY5H 5A4IS 5FL3A 3VUFA 1OKEA 4GXNA 2QN7A 2PTGA 4OZIB 1KO7A 3NHJA 3G0HA 5AVYB 4LSWA 2Q29A 1QUNA 4E36A 1Q9LA 4W9HC 4CADA 2KJQA 1QE5A 4IBVA 2XW6A 5BRQA 4OK3A 1JBJA 4MHOA 1Y1SA 3QG1A 1ZH0A 3P2EA 1JZQA 1WTGT 4KDFA 3HHPA 4AIZB 1B2RA 5T1LB 4G9FE 5F7HA 3NYQA 4EQ3A 1V7MH 2OXFA 1J0IA 1BEYH 4GYJA 1IQWL 5E2WH 3G2JA 4RRPM 1TSRA 3D25A 2VP6A 2A5JA 4ZCLA 2OXHB 3CEHA 1IHOA 3OP1A 4YP7A 1JTTA 1Z0AA 3QRLA 1UA7A 3RRZA 4YR6B 1VTKA 4C6RA 1KJ2L 4Y0AA 4PWKA 4ZJYA 4L4VE 3TG8A 1Q16A 1P53A 2JKTM 1OM3L 4IM7A 4TV8A 2UZIH 3SCMB 3GGSA 1P0MA 1BFDA 3PHQA 2O7NA 2B1IA 3ZOKA 2W70A 4FI7A 4OLEA 2HF9A 1KGUA 3UFXA 3SYRA 1N6QL 4CM9D 5AVJA 1AYOA 3LEYH 4ZT6A 4G6FB 2ICWI 4NDAA 2JIMA 4DV6B 2IMNA 2LWIA 3D18B 4YPJA 1GHFH 4OLWH 4MWFA 1EQUA 4M89A 3VXRA 5ALJA 5KAPA 3JQGA 3QIBC 3AM8A 3L1EA 4R8KA 4UTBH 4DYDA 5DS8A 2GD6A 4B81A 4XB8A 1MCCA 2Q1XA 4ZMOA 2VPIA 2PUVA 4FDMA 5L8KB 3HFGA 4UTVA 1KCRH 1AURA 1S9VA 1C9DB 4OLHA 3EC7A 3M6UA 1Y7HA 3V6OC 3IKJA 2JGFA 4WBNA 5ES4B 2Y25A 4G0MA 3GJ0A 2AJDA 2VABA 1KPGA 1X7XB 2C7VA 1N32B 1ACYH 1WV7T 5A7HA 5ENDA 4OU3A 3H7BB 3FUVA 5DJCA 4QDJA 3HZKB 4IUDS 4NM4L 1Q9LB 1WXGA 3K4AA 4IJVA 2AUNA 2J3KA 2J5QA 5LB4A 2YNMC 4PZCA 3R3ZA 4QXOA 3FT4B 3NATA 5AUNB 3MQFA 1E4XH 2WN3A 3W3AD 2FWIA 3ZDBA 3SPVB 1NOAA 1J1OH 4K3UA 3LCYA 5AW3A 4G80A 1IFHL 1UG9A 3OE5A 3PNPA 5D72H 2PCPA 2W07B 1MFNA 4PTLA 5EIAA 2GSIA 2VDMB 2QKIC 3VX0A 5GPBA 4TKVA 3CLUC 2CVOA 2K0RA 2OKMA 1K4KA 1HHKB 3SJ7A 4CCWA 3LY7A 3O2VL 3JQBA 1LEIA 4J03A 4MLCA 1T04B 1ISIA 1PSDA 1D9XA 3MRFA 1N6VA 3H9SD 5KUTA 3U3RA 1MQ9A 3DSNB 1U8ZA 1G3MA 3ZMNA 3UT5A 5JW5B 4J7CA 5M04A 4JEIA 5FK9A 1EJBA 3DKVA 2OXTA 3FCTA 5IKEA 1R9MA 4HLZH 4ND6A 4L8CA 1U3GA 3B9KA 4MDJA 5I9LA 2REQB 3W9UA 1AYRA 4HJTA 3LH2L 4CU6A 4XN4A 2IL1A 4RTNA 1IB5A 2GMWA 4XXDB 4U6VL 1ZPDA 1WP4A 5L4FA 4JI2B 2DD8H 4NV1A 2G07A 2JGIA 4HAKA 1OGSA 5EO9B 4X7TB 4WNQB 3U4IA 3OOJA 3BQMB 5ADPH 1EXDA 5JEDA 2COUA 3ARDA 3S1AA 3AI1A 1QG2A 2VPXA 4DWOA 5FX3A 2SEBA 3QHZL 3EO9L 3KKMA 4LJAA 5F7XA 2V74B 4L9RA 4HUKB 1O7DE 4CM8A 1KXTB 3EODA 3HVKA 2XITA 3N70A 3KQVA 3F3KA 5KVDE 3NT4A 4ZEMA 2KBFA 4DG9A 4NC2B 4TUKH 5JMTA 3WYAA 5T8IA 1DVFA 4LL1A 1Y4UA 1M9NA 5AVSA 4Q4LA 4N3TA 5KJRH 4FQ7A 2AJ8A 1A47A 2ZB3A 1A7QH 2VR4A 3VHXB 2EL7A 4HQ0A 4MUMA 1M05B 4YRLA 3SO5A 2ZPTX 1Y89A 1M67A 3K6FA 3T7RA 2EJTA 2VDMH 1DLFH 3E2PA 3QG5A 2OPCA 2IDSA 4HT1L 4K4KA 3SE9H 2CLFB 3ZR4B 4CWAA 1QRRA 2VHJA 3OFSA 5HEKA 3G5ZA 2IHVA 3INUH 4ER5A 4JKMA 2XVAA 1MO2A 5I74B 2FRDA 2QG6A 2I6UA 2PA0A 3BFQG 4CN9A 1J2EA 1JQLB 2XUOA 3AQIA 1HOXA 5C8JA 5JNYA 4ON9A 3SJVE 1VP3A 3FWNA 2E8YA 2OE2A 3AB3A 3TB6A 3ENEA 4MVJP 4LYFA 4MVYA 4ZS7H 3LDFA 4X4ZA 5C70A 1BEUB 2WO2B 3SCMC 4M93C 2ZRKA 3RS8A 3KETA 5HIJA 1AIZA 4WV1B 1BEZA 1UWFA 4QX6A 1AXEA 1V25A 4DRXA 3DOJA 4QG3A 4MB6A 1P19A 1M5UA 3I53A 4DCTA 2WTOA 3OKFA 5J4HA 1AO7E 3S2GA 5GRJH 2I1WA 4FYJA 1U8PA 1EEYB 2PO5A 1I4OA 3QJUB 4NIMA 2Y5TA 4LVNA 2BNUB 3X12B 3KYDB 3P9RA 5FL7A 3FYEB 5CJBA 4DH2A 1NYQA 1LZLA 4R26H 4NS0A 2GT1A 5GRWA 3RK1A 3VWKD 4LRNH 2GSDA 1BMFD 4NP6A 2HFJA 4BB6A 4D81A 4IHJB 4LMBA 3O8BA 5AM4A 3S6JA 3H42L 2YC4C 3WIBA 3CVDA 1RI8A 1UACL 2Z7UA 4PHXA 3L3GA 1GIGH 1JRHI 3IV6A 5E6IC 4NP9A 4CMGA 2V3CC 3MX0A 2A94A 3BWCA 2O6FA 3CEPB 3V0HA 2H6OA 2J43A 1W44A 2Q8QA 3M83A 2APXA 2WTRB 3FOWA 2C4FT 4RZXA 2XC8A 3WGMA 5C7XH 2XYQA 4JKPL 1OZ0A 4CETA 1EFDN 4MJ5B 4TS6A 1ZI9A 2OORA 2WLMA 1KGCE 3EVAA 4IGFA 4TPRL 4PS7A 5D8DA 1KFCB 1NVWQ 5FW8A 4Q3OA 3ZLJA 4YBQD 5T1DL 1RYZA 5T3XH 3IVKB 1DWOA 1GJIA 4AJVA 4Q93A 3HC3L 3RB8A 1WPRA 1ZU4A 1T03H 3GJQA 1H65A 3QSGA 3TL3A 3OL2A 3HCDA 3RM3A 4P7KA 2IMMA 1A5FL 2DPHA 3CX5J 4EUEA 2ETWA 4OLAA 2PPAA 5AOVA 3WGYA 2BZ7A 4JOQA 4G82A 2MSPA 5JQGA 2CR6A 5IFJA 2C9PA 1Z5ZA 2VAWA 1VEOA 3FZNA 2PP9A 2BC4B 5CIQA 5C0GA 4YE0A 3VXUA 4P0PB 1P2DA 1OVMA 2IDJA 5CDHA 4MP3A 3CNLA 1JALA 3IS3A 5AMXA 1L9QA 5THQA 3T7AA 4CEIB 3G13A 5CA0B 4P4TA 5BRJA 2Y1AA 2CHNA 3BP6A 4ZEVA 4FU0A 4KSYA 1J8RA 3FMGH 3ETHA 3RANA 3USCS 2PD3A 4IK7A 3UFXB 3BMWA 4AQ8C 3V7NA 5LNEA 4FBGA 1T9BA 1Z6GA 1SIUA 4JFFE 4CVWA 3QKTA 3NABL 3GA0A 4AUNA 2GCIA 3U7HB 1SOXA 4Q9BA 1DWQA 3GEWB 2Q45A 4YRGA 1O7DC 4L29A 1B42A 4DARA 3E4DA 4JSTA 5AOBA 2BHFA 4M6AA 5L4JA 3ALXA 2A9CA 4IYRA 1XFAA 5IM4A 1ESMA 1UM5L 2Y7QB 3L5IA 3FZEA 5LBUA 4K9LA 1XAHA 3KSBC 4HPYH 3RVKA 3CXHK 4W9JC 2ZK7A 12E8H 3PDWA 5GJTL 5IUNC 2V5TA 2XD4A 2GWRA 1QG4A 3VH3A 3DVNA 2YRZA 1QIGA 3OKMA 2OV4A 2J5XA 1EVUA 1P2FA 3KWLA 2VR5A 3LO5A 5G4MA 4JYZA 4XX1A 1JWSA 1MVYA 3MG9A 3VMPA 3CSSA 3AFCA 2FW9A 1Q0RA 3TS8A 1CGXA 5C09D 3N1GC 1JDDA 3FUHA 1AMYA 4PJGF 4BFLA 1XAJA 3GM8A 3W6NA 4PSPA 1JZ4A 5A06A 4N9QA 2WHYA 4MEAA 5DXAA 5D7EA 2WZDA 1AGBA 5F7OA 2PKEA 2IFGA 4XBGA 5F1NA 3QXHA 1T4WA 1QWSA 3RVUC 2NDGA 2UAGA 3I1JA 1FNGB 5T6BA 1CUEA 4FEAA 4P86A 3AV3A 4IIQC 5KJCA 1AZBA 3QRWA 4BAUA 4ZCTA 3EF3A 4UYQA 3PYXA 5CNJA 4JBIA 4DQKA 5FBLB 5JW5A 5KQGA 4REOA 1IC5L 4M5TA 2FA9A 2VBGA 2OXIA 4H25A 2VQUA 1RJ9A 3MROA 4US2R 3IDMB 4R2KA 4L23A 5K20A 4ZQFA 1PE0A 1YMHA 2VQ6A 1A8ZA 2REXB 5AM1A 1BDIA 4R9RA 4XWGA 5AZUA 3PGVA 1B8NA 2XN9A 5IIEA 5LOVA 1WA1X 2PSEA 4KO2S 4L0ZA 4P83A 4K40A 2OL3L 3OLDA 3N86A 2BAGA 1ZTXL 3KR3H 2QRGA 3KIPA 2P46B 5CH8A 1KV3A 1NMQA 4WHYG 2XTMA 3JXAA 4BP9A 5H4GA 4QY8A 2O8BA 4LHUD 2SCUA 3I74A 1KXHA 4XEHA 4B5ZA 1H8SA 3ZCSA 2DQZA 5TF4A 4QOGA 4UFNA 4E2FA 4NX2A 4TL8A 1XTBA 3RAPR 1BZOA 4MS8C 4YYEA 1YUKA 1WAAE 3BIWA 4CVXA 1Z4OA 2AQRA 5T3ZD 5CWSB 3EXEA 1KI7A 2A9OA 3QJFA 4KOBA 1S9VB 5FW7A 1MIOA 4N1AA 2Q7NA 4OMDA 1IJBA 3RVUD 4N8UA 1WZ1L 1GSAA 3IT1A 4KWTA 3JRWA 1BZQK 5DQJB 2VYND 3OZAA 1LBHA 2OBLA 1CFSB 3WLHA 2AZ4A 1CD1B 1TLTA 2ACVA 3V52L 1X9GA 3T3PB 2K6ZA 4ZC1A 3MJVA 2Z1DA 4P58A 2V9CA 4IMKA 1LD3A 3PAVA 3AZOA 4AXWA 2I26N 1NBZA 1GGJA 4YDRA 4Z1MD 2GWHA 4UPEA 2W2KA 2CBQA 4XLTA 1K92A 1NBIA 4MMYB 1HESA 1NMSA 2BUCA 5IB5A 1WZAA 4ONGH 3REWA 4HFWA 1EDZA 4XYBA 4HQFA 2E7ZA 4AZ0A 3TKYA 4EI6B 2BJVA 2G1UA 3BYYA 4M8QB 4JFHD 4E2XA 2R0LL 4OSUL 3GMDA 3GDWA 3Q5YA 4A2HA 2F5BL 4R1PA 2EFGA 3T9CA 4E1VA 3I5XA 2C99A 4ZFZB 3OHPA 2ZJFA 4M1MA 2WY3B 3B9BA 3JQBC 4Z9FA 1O6TA 1CUFA 2QJDA 2QRVB 3J80A 1NFDE 2QSVA 4XVSL 1G7HB 4XVRA 5E3JA 3C43A 1IC0A 4R1UA 3DSRA 2DV6A 5CG2A 3OJMB 5EUBA 2IS6A 1VI5A 2JKLA 221PA 4FR0A 4DWWA 2HVKB 1X5MA 3C75A 1V41E 4K73A 4K3JL 3LOPA 2EYTA 3DTXB 4QLWA 3L6FB 3MNMA 2YXBA 3O8XA 3BVDB 5GP1A 1OV6A 3RS9A 1Q22A 3LQAL 2XMDA 1MABB 2FQXA 3QIBA 1SOKA 5DEFB 5E9AA 1EX6A 3QBTB 1HE5A 5E2UL 1GL3A 3HBGA 2XCUA 3D2BA 4UM8B 4FQLH 3DPSA 3ILYA 3AROA 4L4UA 3WYBA 4XSVA 3E9RA 4AKEA 5EEYA 3PFCA 4G9EA 2EARA 4WUUD 3QYNA 4EO7A 4APQA 2WHRA 2ZRPA 4WLFA 3WBBA 1Y1LA 4LY6A 4CLRB 2HOQA 4PYQA 3MRHB 3G6WA 1HILB 4MDRA 1WXIA 1U81A 1S8NA 3SBWA 3LY9A 1A3ZA 3QPWA 1TPYA 4FS3A 4FYKA 2Z4RA 3HO8A 4D98A 1M2VA 4AH2B 4LXIA 1FYEA 4IBWA 1RL1A 2GK3A 4G5QA 2XAUA 4CBPA 3AFHA 4LDNA 3EGWA 2PWEA 1E7VA 3A37A 3LUKA 5CPFA 2PMDA 2P3YA 4DPMA 3QRGL 2NYRA 3T7JA 5FO2A 1QQ5A 2P2NA 2JGLA 3ARGD 4KNUA 1NUUA 1TQBC 2Z92A 5HTOA 4WEBL 1E3EA 1AANA 3VPAA 1R0XA 1YIOA 3DMDA 4KBPA 4O3FA 4YHKL 2OC4A 4JY4B 4WWNA 4PLWA 1ASOA 1GJWA 4U6YA 3BPCB 1N2ZA 4KRPB 2QR3A 2YZ7A 4JI5B 3RSSA 4L37B 4AX8A 1I8LC 4RANA 2Y06L 3ACDA 3O6LH 4HWBL 3NASA 3IAM1 4RQQB 2DQDH 2PABA 1L6RA 5JD5A 3DWEX 5IQ9B 1N6IA 4PJ9D 4XWGL 3TO2B 2V6IA 1OKKD 1O03A 4DUPA 3MBXH 4MDIB 1NC4D 1E2KA 2I6GA 3UC2A 1HK7A 4LRWA 2E86A 2F3RA 4PYIA 3ARBC 1DL5A 1LBSA 2EDQA 1UFOA 3QIAA 1NZDA 3CZAA 4L4TA 3AY0A 4YZFF 4X6YA 1BXRB 5JQ6L 1AXTH 5TNXA 3B8YA 2N7SA 4LLVA 3ZTEA 4ZT5A 4J0IA 5EWLA 4N47A 5L6YH 1AGCB 5EORL 3RNQB 1Z47A 1QTNA 3ZHSA 1JP5A 4K94L 2QSZA 2A83A 2IWKA 4WW2A 2WIIB 3L0ZA 3SBXA 5TF0A 3I04A 5EIIG 1PLJA 2ZQ5A 3V0VB 3RJQB 5K7SA 1LW6E 3MRBA 4UV4H 5JW6A 4BIIA 4XHQA 4OQTA 3C7KA 3GSNA 1NGXA 5EIIA 3OZIA 4GAGL 1RPQA 4OIIL 1XKTA 2HJSA 2W6JA 5D1NA 1Z5LA 1FQJA 5KBLA 5C4MA 3KZOA 2GTZB 2HSJA 3I01M 3WN5C 4RISL 2BFNA 1BJ1H 2WJ6A 4ALKA 5B3JE 1YO6A 4XVJH 4MA3A 2F7QA 3A26A 1BEYL 3OJVC 1R74A 3EHBC 3PXLA 4QAWA 1GYVA 3IUEA 1NCAL 4XIYA 1EAPB 1B93A 2DQFB 4E5SA 1SC1A 4OCNC 4J3XA 5AAMA 3CSDA 3GPDG 3NSCA 4HD9A 2FRDC 3S36H 1UD5A 3ZYZA 3VVWA 3W5UA 3OIYA 5I7FA 4MINA 1SXHA 1OANA 1RK0A 3QIUC 3QPVA 5TK2A 1BDBA 3NHAA 1A7PL 3QE2A 2BDNL 4YX2H 4Z7UB 1H23A 2H2AA 2SICE 4NUGH 5LYJF 2IXQA 2CO7A 3KS0H 3WDLA 4RF3A 5CYPA 3Q0IA 4CRWB 4Y2JA 3VJ6B 5D7BA 4V1CI 1ZUHA 5EIBC 3HNPA 1G1YA 2IW3A 5EMYA 3N58A 3G68A 4JHLA 1W5BA 4F5EA 2M1ZA 1EGHA 3MWLA 4LXXA 2PFSA 2QG9A 3TJEH 5K0ZA 2O59A 4XXWC 4GQ9L 3U6BA 3Q1SH 2XN2A 4FQPA 4IFBA 2WBWB 3GHBH 4PGAA 2JPDA 1SWWA 1SHWA 3PV6A 1UMDB 1P6QA 2GC7C 3IAUA 1R3HB 2VISB 1ENOA 2OZ4L 1E9PB 4LY0A 3DVFA 4PLHA 1AR1C 4QGTA 2ECQA 5EZ6B 4RIHA 4KBGA 3AIIA 2ADGB 5K0FA 4HQOA 5EZOL 1CW2B 2VPZA 1MXFA 3JWPA 3VTAA 3RYIA 3HS0A 1BMGA 2DIJA 3DR3A 3TVMC 1CZNA 5GRUL 3MI6A 4P5MB 1M6VA 3PSAA 4WFQA 4PO1A 4MB2A 4ZAVA 5D4QA 2OECA 2XXCB 4V0NA 4Y5XB 1T0BA 2VDPL 4YMSA 1SVZA 3B8HA 3D0RA 4AFNA 5JARA 1MJJA 2AJXL 2IYTA 3D6FA 2RG7A 2ZS8A 1GUAA 3REVA 1IK6A 2GNAA 2ZYSA 4Q1DA 3W56A 4JBNA 2PS0A 3UJTH 4BVAA 4C06A 1QLJA 2XCMC 2C1OB 2F62A 2OR7A 2VQEB 3N75A 5D7LA 3NTUA 1WNTA 1FNCA 4PB9L 2WIAA 3K4HA 1NW6A 4HG4K 4GRMB 1S02A 2AD5A 3O2VH 2J56A 2OLDA 1PVOA 5EE0A 4DMHA 2Y72A 5GZNC 5F7YC 3MRQB 1SKMA 3F5SA 4ZX4A 2ZSBA 1BDYA 4NUQA 4RMNA 1JEYA 2GC4C 3QDGB 2WNGA 1NI5A 4A2LA 4Y2OA 2OQRA 1NDGB 4X7EC 4B3FX 3M82A 4IBYA 1MKYA 3OQIA 2NNXA 3OOYA 4Y5VC 1QHQA 1HJCA 2QF7A 1G7HA 1EHLH 3IBSA 2FVYA 3M34A 5AUMB 4FMCF 2L04A 4QKQA 3LH2H 1HHIB 3CBRA 2J88H 3MA7A 4KTGA 1QGUB 1AZTA 5C0RL 1TQUA 4R6XA 3STHA 4YRCA 1IEQA 2DQUH 5SYMA 4EPRA 1O6SA 5B39G 1R3KB 3E1GA 2WAHA 2BZDA 4TXJA 2JAUA 3ZTDC 3IILA 5HUQA 3PVSA 3AVYA 3MN1A 2UX6A 4XW2A 5EZLA 4AULA 4BZ1H 4J0GA 2MFNA 3T5BA 2CHVA 3D87B 1J5OL 3RD5A 4R2MA 1DB3A 4D7BA 3MHZA 5K1JA 4Z7JA 1SMDA 3DUSB 2W2KB 4FG2A 1N70A 4QYOB 1GTFA 2P2CA 2H9GA 4FDLA 4HD8A 3ZHRA 3VYOA 2HXYA 3ESYA 4OBEA 4MMZA 3EIWA 1HRDA 1P18A 1UT5A 2F9BT 4IO0A 1P7QB 3C6EA 3BMNB 5JS2A 4RD2A 1PG7H 3DMMA 4XSHA 4QHKJ 3RFUA 1AG0A 1OYWA 4JB8A 4TKLA 4DKEL 4NENA 5F9MA 3S5LA 5JVDB 2IA5A 5C0OE 1WSDA 3FOAA 1W0WB 1YASA 2OD7A 4WEMB 5I19L 4UKDA 2VH5H 5DLQC 1VCMA 3PAZA 3BICA 1T80A 4YWHA 3KEQA 4PJ5B 1UPTA 3EXEB 4D5GA 4XQEA 4DO5A 3ZNNA 5TFSH 3KCQA 5HDQA 3EVZA 5KVDL 1J6UA 4YUEH 1OLOA 1Z0SA 1JYWA 4PS4H 1T25A 5I5GA 3ZOZA 5EZYB 1BD3A 1UADA 2Q6IA 1DXHA 4ISVA 4DR5B 3PWSA 4EO9A 1J1XH 1FL5A 2QU7A 4W9CC 1DADA 3ML1A 5DK0A 2YR0A 4HAIA 1JDVA 5FBQB 1HXYB 1UWVA 3TRFA 5F9OH 2ZJYA 4POZD 4LC9A 3NZHH 4KVCL 1OCZB 2A73B 1AG6A 2OJ1A 4MARA 1ZA3A 4ZFGH 1T4MA 2HHAA 4W7IA 3IMUA 5ESQB 1GNRA 3ZBPA 3LRMA 1L3IA 4UANA 1ULUA 5EN3A 4FGLA 3V4VA 1X94A 2Q5HA 1OF0A 2OXGB 4IOSA 2AZXA 1ID8A 3V1TC 4A92A 1UWYA 1UHVA 1X19A 3D6JA 3O3UN 2W6MA 2JV6A 4DQ0A 2WB7A 4CEHB 4ZEOA 3O4RA 3ZHBA 2FXIA 4DB4A 4CTNA 3P2DA 2JI3A 1H0SA 1QDUA 1U0RA 2QUAA 5DZLA 5B1SA 2Y3AA 2AOUA 4HZUB 1E8DA 2I6TA 2JB9A 3SDBA 2Y1FA 3PP4L 1AR1B 1GNVA 1VM6A 3U44B 1UACH 2O5NA 2JMRA 4AJEA 5T41A 1FUEA 5C35A 1HEJC 3SKXA 1RUML 4P4KD 1E0SA 4YRTA 4LEOB 1Y1UA 4B17A 3D0AA 3JYOA 2PXCA 5C6WH 5T1JA 2IEZA 3WTCA 1YN6A 4N8CL 2JJ1A 4M0UA 4G7SB 2CHZA 4DCQA 4QATA 3CZEA 3C5HA 5F6IC 4M9PA 1VJGA 4M0LA 3ZPDA 3WK8A 3M17A 1NASA 2JB6B 3RTEA 1K72A 3PQ4A 1RP1A 4FXLA 1A22B 1AGCA 2B3IA 3GDGA 1MFVA 5JATA 3ZZNA 1OZUA 2H2HA 4B82A 2V5AA 1L1EA 3W3BA 5F33A 1OROA 1DRKA 1W6WA 3KX2A 4C56B 3DQZA 3ET9F 2JFUA 2HO4A 5B6PA 2KBGA 1DUZA 1FJ2A 1P5ZB 3U3ZA 3BJRA 3EVNA 2YGPA 5BS0B 4IDJL 5JZ7D 4F27A 2CO6B 3JQ9A 1MW0A 4GVLA 1LDMA 3FMFA 3I75A 4N0UA 1CF1A 2HN7B 1A1MB 4IGKA 2F3SA 4JKKA 4HAZA 1W0JD 1NR7A 1CBVL 2ALWA 2FIRT 2GJRA 4GECA 1WOMA 2O0JA 3HE3A 3DSFH 1R8SA 1U2GC 2F55A 2X2PA 2ODBA 3BMOA 2LVCA 5FLXA 1RC8A 2V2WA 1JVNA 3SNHA 5CD5D 1RK1A 3QBVA 1ECJA 1CLVA 2ZYGA 1N0LB 1CPUA 3BD8A 3IUPA 4X1IB 2FYTA 3FPCA 1U94A 3U7YL 2ZULA 1E64A 3GFQA 4MB0A 1C9EA 3GD5A 4DCSA 1C3VA 3GLGB 2IIVA 5CFAA 4J3TA 1IBRA 4FE4A 4HPYL 4IQ8A 4N1HB 4QTIH 3H11B 1SEBB 2OGWA 1CEQA 4EY5A 5GJTH 2YFQA 1OQAA 4ZZ0A 4CIWA 5IT4A 3MXOA 2B0JA 4IMJB 4XDYA 5AK3A 4IDCA 4HUNB 3S8MA 5FUOL 1YJ5A 3UF0A 4B6ZA 2NZ8A 1NOKA 5ISZB 4OFZA 4ND8B 4JM2F 3UYPA 5A4DA 4YQXL 4HFJA 1DCKA 2ERYA 4WINA 1DBJL 1OARL 3WTSA 4OHVA 4JEHA 3HL4A 4RA3A 5E9DB 1KOFA 4N2LA 3F0TA 1VCOA 4QO8A 4JBYA 3QBTA 4ND5A 2G1PA 2AGJH 4FQ1H 1V4NA 2R2HA 2JIXA 3GSNL 2WANA 4IM8A 3RC1A 1TZMA 3FFTA 2GAZA 1RUKH 4G80B 1SUDA 3L0CA 1Q17A 2HDNB 4C87A 4JX0A 2HH9A 5TE9A 2HK8A 4KTYA 5J1TC 2ZCKL 4HVTA 1E58A 2EDTA 4WTQA 3HN6A 3HWSA 3QWHA 1QCDA 3M2TA 2DLFL 4MQ4A 2NT3A 2QG4A 2C1XA 4X54A 1U2ZA 3L82B 5FLYA 2JHPA 1ZOPA 3FPXA 2IEYA 4XIFA 3TSOA 2GR9A 3R0ZA 3N40F 4XBEH 2I91A 5EIXA 1AI1L 4NOFA 1KO4A 4KFRA 4DZTA 1NUTA 4KKCC 3GRFA 4FDAA 1GZPB 2VUUA 4PRZA 1W0WA 4FG0A 3WHIA 1YS4A 2WA2A 1XQ9A 1DKLA 5F3BB 3HKZA 1P5VA 1YQQA 4D26A 4GKKB 3WGZA 4DKJA 4IBQA 4FHZA 1GA2A 2WNSA 3BTSA 3WMSA 5DDHA 1GG9A 3LQMA 1BMFA 3ZNPA 4EHAA 1WC7A 4IIYA 1FYTB 3RS4A 4C6TB 1H19A 5ICFA 2CXOA 1N75A 1ADFA 1SURA 1JAEA 2XLCA 3EOBA 2H1PL 3I3EA 2IU6A 2ZYAA 4PYKA 2OCYC 3LXAA 2FRVA 1I1CA 1I1FB 1ZV2A 3L6OO 4UAUA 3NJMA 1G8KA 4C4SA 4J0HA 3A24A 4PWFA 4KIJA 3ZHFA 1QUPA 4LT7A 3MIZA 1NFKA 1CF9A 2VDLB 3IPFA 3J8F7 4XC1L 1MT0A 1Y37A 1T13A 3AFGA 2IIQA 2C26A 5JR3A 1JXKA 3ZXAC 3ZZMA 1YI0A 4Z0NA 4WKGA 1F11A 3TEYA 2ZYWX 3C4JA 5JSZA 3DK2A 5ENZA 1EUDA 1M05A 4WX2B 4P31A 2V3FA 3BN3B 2DQYA 4A0FA 2QN1A 1KWGA 1H6UA 4KHTH 4CU8A 3ZZUA 1MH1A 1XHLA 3ZE0E 1Y6RA 4PMEA 4D8PB 2MMGA 2DQCH 1W85B 2D03L 5EOCJ 4MX7A 3DVAB 2LVBA 4P2RD 3AWDA 2IX9A 3KPNB 5JOPD 3MRIA 3LTEA 1XR8A 2H8PA 1BZ7B 4PBSA 5H2BA 2X4LA 3G0GA 2QD2A 4IINA 2AW3A 1N0XL 1M33A 4ZT3A 1QW9A 3KLNA 3ORQA 4LZNA 2HF8A 1INDH 4YHPB 2WMDA 2YPVA 3Q88A 1HZJA 3CISA 4KHPB 1MHEA 3W2EA 3DL2A 4OSUH 3H2QA 2ID8A 4R8WH 2VZVA 2YUXA 2VT0A 1D7AA 3QULB 1WCV1 3KTDA 2JJWA 2P5WD 1RHHA 3NZ8A 2NRDA 3H6AA 5JIPA 1T3GA 1QQDA 5AK0A 1U1IA 2NNRA 3G2QA 4I5GA 1PQYA 2G36A 3TH3T 3LRHA 1F1JA 2JLAA 1DBAL 4RMBA 2BINA 2RSLA 2CLSA 2N0SA 3VOTA 1V6SA 3SGDI 1YJCA 2DWCA 3HDQA 1QLEL 1ZHFA 1DO8A 3H3PL 2A8YA 1I4LD 3IKVA 5AVRA 2PR9A 1R9NA 1RE0A 1I1AB 3OZVA 2F3QA 3KSZO 3CVCA 1S4MA 1BBJA 1R3HA 2DJ4A 3WDHA 3CQQA 1ADCA 2IEBA 4TUYA 3VKUA 4WCYH 1UDXA 3PI6A 3W06A 3JX9A 4FMCB 1W75A 2EKPA 2YPVH 3MTAA 2P9ZA 1EJ0A 2EADA 3QEQD 3HP7A 4ZKDA 1W36D 6REQB 5D70L 4E68A 3VFNB 1E30A 4BFCA 3V1MA 1QE3A 3LF2A 3AVEA 3A70A 1A8JH 4PJCF 2LIVA 1OXSC 2E1RA 5DA4A 4J16C 5IUKC 3OPMA 4LASH 1SN5A 2MSLA 4M7JH 3QPBA 2DM2A 2AUMA 2QJFA 1UOKA 4RD3A 1GVNB 2PWZA 1PZAA 1CDZA 3H5LA 1XVAA 1Y3DE 3UTDA 2XQYG 1DZ3A 4QRSA 4F4UA 3Q8MA 3BGDA 1QKZH 3CVUA 2QTGA 4X5WB 1Q84A 5ANMA 5B3JC 5ECDA 3A1WA 3T3OA 1CFVL 1DIGA 3JQDA 3BN9C 3W8NA 1F3LA 1GC1H 4AENA 3DOHA 2R1TA 3CVYA 3TUJC 2WABA 2XXAA 2UU9B 5FI5A 4HFRA 3FUKA 1U21A 2O2GA 1JJIA 1L5HA 2R0WH 2IHJA 2PR4L 5F5XA 3GS0A 1G21E 1MV8A 2F48A 2TSBA 3AKCA 2FW0A 1AZZC 5I5JA 1WICA 2ZVJA 4R9UC 5IQNA 3FA2A 5GIPE 3EDFA 5C3MA 2DYSB 1E6OH 4DDUA 4LRUA 4D9CA 4XNYL 5CCKL 2YZMA 1OXVA 3A4YA 3HA7A 1S7UB 3OBBA 3EXJA 2LD4A 1I2AA 3CF4G 5CT8A 5COAA 4P07A 4TULH 4ZRNA 1DC4A 1TYAE 4JT8A 3AL8A 2Y06H 4Y5YB 1CYGA 3ET4A 1FO0A 5C0BD 3QUZC 4G6KL 2BMKA 2JF1A 1UJ4A 1VDMA 2IHUA 4WA8A 4RK6A 3CVHH 1E1RD 1UVQA 5FQNA 1KJWA 3AB8A 2FEMA 1JZ8A 3FTQA 3IGAB 2AVDA 2IF2A 4F96A 3MXWH 3B89A 3DPDA 1RUQH 4NECA 3Q5TA 3MINA 5T3YA 3ULUE 2PXHA 1N3LA 3EZGA 4LRSB 2RHWA 3D7LA 4CV0A 4ONFH 1WCIB 3BEDA 5L6LB 4NYLA 1MRDL 3BKCH 1OGYA 1ZU5A 4OJTA 1JTPA 4A6YB 2M83A 4YVUA 1QC5B 1IAIM 2V17H 4JJHA 4EABA 2OHVA 4JEGB 3B7SA 3KPPB 5FO0A 5GZOA 2JGDB 1UUFA 1KZYA 1HKFA 3G5XB 4CJ0A 4QLRA 1JZHA 1ZHLA 3F7LA 3H0TB 2CDFB 4PX2A 1AD0B 1X1RA 4BGVA 1BYUA 1RWKA 3QNYB 4H1LA 4XQGA 4OYRA 3UT6A 1AXIB 1DBBL 1RYFA 4DKFL 3LOQA 3ILVA 4PQEA 3V6FA 4EFKA 1IGCL 4QJ3A 2FBJL 2JG3A 5MENE 4JZJA 4PNHA 1D2OA 3SDCC 3S34H 3NYKA 5IHZA 3C5ZC 2OFWA 4PBRA 4TUYB 5KTOA 1YR7A 1Q0XH 1T83C 2YS4A 3QX9A 5EMKA 2QAGC 3AMLA 3GUVA 2E46A 2ZIDA 4FVTA 1HE4A 4R5TA 2K3TA 1OWLA 2NY0C 4QU5A 3ULVD 4KI5F 1BQLL 1GLVA 3W5BA 2G9NA 3LEXB 4Y2VA 3ATAA 2XCIA 4G8EA 2TRHA 3HNTL 2CBOA 4XBGB 5F1NB 2G71A 1RYDA 3K2IA 3BZEA 3ZZLA 1P4BL 5JJBA 3O45A 2NZJA 1J0HA 4RLFA 3JXEA 3E3AA 2FX5A 4C2BA 3ZE9A 3OT1A 4M8IA 3PAUA 4PONA 5I1DB 1KERA 3ZDYB 3ZLBA 1JFRA 5FFOA 4G0XA 1O8CA 1LP9F 5A1TA 4N2AA