1BORA

Transcription factor pml, a proto-oncoprotein, nmr, 1 representative structure at ph 7.5, 30 c, in the presence of zinc
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
b'EEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION FACTOR PML
molecule tags Transcription regulation
source organism Homo sapiens
publication title The solution structure of the RING finger domain from the acute promyelocytic leukaemia proto-oncoprotein PML.
pubmed rcsb
total genus 4
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1995-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1borA00
4P5OB 1VFYA 2LV9A 4I7BA 2KWJA 5LKUA 4S3OC 5D1LB 2E6RA 2LXPC 5FB0A 2OXQC 1LDKC 2H0DB 4N4FA 4WZ3B 1WFKA 4C9ZA 2M6MA 2EODA 3ASLA 5H1UA 2PUYA 1WGMA 1JOCA 2YQMA 2RI7A 2EGPA 2YQLA 4YAXA 4YC9A 1VYXA 2VJFB 2YUCA 3RTRB 3HCTA 3O35A 3NG2A 2HYED 5D1MB 2F6NA 1WENA 4AYCA 4X3GA 5TBNA 4QF2A 2L80A 3L11A 2L5UA 2UZGA 1WESA 2KWKA 5KH7A 2ECNA 2CKLA 1X4IA 3M63A 3PHDA 5I3LA 4B7YC 5DINA 4R2YA 1WEEA 3HTKC 3O70A 3O37A 2MNZA 3LQJA 5B76A 3L1XA 3LRQA 2ECJA 4WZ2A 4FK5A 2VPEA 2KWOA 3N9PA 2XEUA 1WEPA 4AP4A 2MT5A 4B86C 4XI1A 4GB0A 4LADB 4QF3A 3MHHA 1BORA 3KNVA 3EB5A 3PURA 2KREA 3L1ZB 4LKAA 3T6RA 5KH9A 2YT5A 4R7EA 4YBSA 2M3HA 2VPBA 2JRJA 3RPGB 4A0CD 4W4UA 5AIUA 3N9MA 1JM7B 4L58A 1Z2QA 2LDRA 1U6GB 4UP5A 4MSXA 4ZQLA 1F62A 2CSYA 4I7DA 2G45A 2YU4A 4S3OB 4YBMA 2HDPA 4AYCB 1N87A 2LGKA 5FERA 2FUIA 5C11A 1WILA 2KU3A 3LQIA 5AITA 2VJEA 4N3WA 2KE1A 2C2LA 2JMDA 3ZNIA 2LQ6A 2VJEB 1X4UA 3ZVYA 2ECGA 2F6JA 3ZTGA 5B78A 1WEOA 3SOWA 5H9MA 3HCUA 2QIZA 3I2DA 3MHSA 2YSJA 2Y1NA 2JMJA 2LN0A 3KQIA 1E4UA 1Z60A 2KWNA 1HYJA 3ZYQA 4L7XA 2ECTA 5G05B 1FP0A 2VNFA 1Z6UA 2VPGA 2YSMA 4IC2A 2M85A 2VP7A 2G43A 2D8SA 1WEWA 4WZ0A 4GNGA 4AVXA 2LRIC 2L43A 4BHWA 2MIQA 4FIPA 4NN2A 4Q6FA 2BAYA 2FSAA 2DX8A 5FB1A 2H0DA 2K4DA 2MD7B 4GNFA 4A49A 2LGLA 1RMDA 2MA5A 2ECWA 4MVTA 1K2FA 5B79A 2NAAA 2L75A 2AN6A 1HYIA 4YBTA 3ZVZB 2K1JA 3ZPVE 2KGIA 3GL6A 3EB6A 2KFTA 5TDWA 3U5NA 5LCWB 2K17A 4BBQA 4CCGX 4FJCA 5DKAA 4ZUXU 1LDJB 2CSZA 2YHOA 3U5MA 2CT2A 2KYUA 3N9LA 1WEMA 5LKXA 3QZVA 3SHBA 2YREA 5G0FA 5KH3A 3ZPV1 2EA6A 4PPEA 4YABA 2RSDA 4IC3A 2VPDA 5B8DA 1WIMA 2IDAA 5LKZA 3C6WA 1V87A 1WE9A 3SOUA 3O34A 5LKTA 4TKPB 3SOXA 5B75A 3LQHA 2JMIA 3FL2A 3O33A 4AUQB 5H1VA 2YURA 2XB1A 2ECVA 5JG6A 4R8PK 2VJFA 1WEUA 2E6SA 3O7AA 1X4JA 3N9OA 3KV5A 2F42A 5TDRA 2LGGA 2YW8A 3N9QA 4YADA 1JM7A 2MNYA 5H1TA 1MM2A 2QJ0A 2MA6A 3C5KA 4ZDTA 4A4BA 4LK9A 4FO9A 4CA1A 1DVPA 2C2VS 1G25A 5J3XA 1WEVA 4LLBA 2M1RA 2LGVA 5C13A 5D1KB 5B77A 3V43A 2L0BA 1VD4A 1CHCA 4YATA 2MUMA 1FBVA 1WEQA 4PTBA 1T1HA 3DPLR 2G6QA 5TRBA 2KIZA 2PNXA 4F52B 4LJNA 2FUUA 2YYRA 5EYAF 4V3LC 3M62A 2ECIA 3PUQA 2LXHC 1MM3A 3U5PA 3KV6A 2KR4A 1ZBDB 5G04B 2Y1MA 5FEYA 2K16A 2YHNA 3IHPA 4GNEA 4GNDA 4UP0A 4A4CA 2ZETC 4I7CA 4WA6A 5TABA 1IYMA 3U5OA 2Y43A 3GV4A 3DQVR 3VK6A 3RPGC 4V3KC 2CKLB 3N9NA 3O36A 4UI9B 2QICA 3M99A 4O64A 2KGGA 3HCSA 2I50A 3T7LA 1XWHA 2MD8C
chains in the Genus database with same CATH superfamily
4P5OB 1VFYA 2LV9A 4I7BA 2KWJA 5LKUA 4S3OC 5D1LB 2E6RA 2LXPC 5SVXA 5FB0A 2OXQC 2XOCA 1LDKC 2H0DB 3KDEC 4N4FA 4WZ3B 1WFKA 4C9ZA 2M6MA 2EODA 3ASLA 2FD4A 5H1UA 2PUYA 1WGMA 3FAOA 1JOCA 2YQMA 2RI7A 2EGPA 2YQLA 4YAXA 4YC9A 1VYXA 2VJFB 2YUCA 3RTRB 3HCTA 3O35A 3NG2A 2HYED 5D1MB 2F6NA 1WENA 4AYCA 4X3GA 5TBNA 4QF2A 2L80A 3L11A 2L5UA 2UZGA 1WESA 2KWKA 5KH7A 2ECNA 2IQJA 2CKLA 2CONA 3FJUB 1X4IA 3FEHA 3M63A 2OWAA 3PHDA 5I3LA 4B7YC 5DINA 3LVRE 3LDYA 4R2YA 3SUBA 4O62A 1WEEA 3HTKC 4OGEA 3O70A 3O37A 3JUEA 2MNZA 3LQJA 2E61A 2L7PA 5B76A 3L1XA 2EXUA 3LRQA 2ECJA 4WZ2A 4FK5A 2VPEA 2JUNA 2KWOA 3N9PA 2XEUA 1WEPA 4AP4A 2MT5A 4B86C 4XI1A 4GB0A 4LADB 4QF3A 3MHHA 1BORA 3KNVA 1MBMA 3EB5A 3PURA 2RR4A 2B0OE 2KREA 3L1ZB 4LKAA 3T6RA 5KH9A 4H9DA 2YT5A 4R7EA 4YBSA 2M3HA 2VPBA 2JRJA 3RPGB 4A0CD 5SVIB 4W4UA 5AIUA 3N9MA 1JM7B 4L58A 1Z2QA 2LDRA 1U6GB 4UP5A 4MSXA 4ZQLA 3H7HA 1F62A 2CSYA 4I7DA 2M13A 2G45A 2YU4A 4S3OB 4YBMA 2HDPA 4AYCB 1N87A 2LGKA 5FERA 2FUIA 5C11A 1WILA 2DJAA 2KU3A 3LQIA 5AITA 2VJEA 4N3WA 2KE1A 2C2LA 5SVIA 2JMDA 3ZNIA 2LQ6A 2VJEB 2D8UA 1X4UA 3ZVYA 2ECGA 2F6JA 3ZTGA 5B78A 1WEOA 3SOWA 5H9MA 3HCUA 2QIZA 3I2DA 3MHSA 2YSJA 2Y1NA 2JMJA 2LN0A 3KQIA 1E4UA 2XOZA 3E2DA 1Z60A 2KWNA 1HYJA 2P57A 3ZYQA 4L7XA 2ECTA 5G05B 1FP0A 2VNFA 4QQ4A 1Z6UA 2VPGA 2YSMA 2MKEA 2JM3A 4IC2A 2M85A 2VP7A 2G43A 2D8SA 1WEWA 2FFWA 4WZ0A 4GNGA 4AVXA 2LRIC 2L43A 4BHWA 2MIQA 4FIPA 2XOYA 4NN2A 4Q6FA 2BAYA 2FSAA 2DX8A 5FB1A 3T9KA 2H0DA 2K4DA 2MD7B 4GNFA 5SVYA 4A49A 2LGLA 1RMDA 2MA5A 2ECWA 4MVTA 1K2FA 5B79A 2NAAA 2L75A 2AN6A 1HYIA 4YBTA 3ZVZB 2K1JA 3MDBC 3ZPVE 2KGIA 3GL6A 3EB6A 2KFTA 5TDWA 3U5NA 2DSMA 5LCWB 2K17A 4BBQA 4CCGX 4FJCA 5DKAA 4ZUXU 1LDJB 2CSZA 2YHOA 3U5MA 2CT2A 2KYUA 3N9LA 1WEMA 5LKXA 3QZVA 3SHBA 2YREA 5G0FA 3DWDA 5KH3A 3ZPV1 2EA6A 4PPEA 4YABA 2RSDA 4IC3A 2VPDA 5B8DA 1WIMA 2IDAA 5LKZA 3C6WA 1V87A 3LJUX 1WE9A 3FM8C 3SOUA 3O34A 3PLWA 5LKTA 3DDTA 4TKPB 3SOXA 5B75A 2KKYA 3LQHA 3O47A 2JMIA 3FL2A 3O33A 4AUQB 5H1VA 2YURA 2XB1A 2ECVA 4OGCA 5JG6A 4R8PK 2VJFA 1WEUA 2E6SA 3O7AA 1X4JA 3N9OA 3KV5A 2F42A 5TDRA 2YVRA 2LGGA 2YW8A 3N9QA 2LAUA 4YADA 1JM7A 2MNYA 5H1TA 4F1PA 1MM2A 2QJ0A 2MA6A 3C5KA 4ZDTA 4A4BA 4LK9A 4FO9A 3Q1DA 4CA1A 1DVPA 2C2VS 1G25A 5J3XA 1WEVA 4LLBA 3LVQE 2M1RA 2LGVA 5C13A 2EGMA 5D1KB 5B77A 3V43A 4Z0OA 2L0BA 1VD4A 1CHCA 4YATA 2MUMA 1FBVA 1WEQA 4PTBA 1T1HA 3DPLR 2G6QA 5TRBA 2KIZA 2PNXA 4F52B 4LJNA 2FUUA 2YYRA 1DCQA 5EYAF 4V3LC 3M62A 2ECIA 4Z0RA 3PUQA 2LXHC 1MM3A 3U5PA 3KV6A 2KR4A 1ZBDB 5G04B 2Y1MA 3FANA 5FEYA 2K16A 2YHNA 3IHPA 4GNEA 4GNDA 4UP0A 4A4CA 3M7KA 2ZETC 4I7CA 2KKXA 4WA6A 5K3QA 5TABA 1IYMA 3U5OA 2CRWA 2Y43A 3GV4A 3DQVR 3VK6A 3RPGC 4V3KC 2CKLB 3N9NA 3O36A 4UI9B 2QICA 2XP0A 3M99A 4O64A 2KGGA 3HCSA 2I50A 3T7LA 1XWHA 2CSVA 2MD8C 2CRRA
chains in the Genus database with same CATH topology
4P5OB 1VFYA 2LV9A 4I7BA 2KWJA 5LKUA 4S3OC 5D1LB 2E6RA 2LXPC 5FB0A 2OXQC 1LDKC 2H0DB 4N4FA 4WZ3B 1WFKA 4C9ZA 2M6MA 2EODA 3ASLA 5H1UA 2PUYA 1WGMA 1JOCA 2YQMA 2RI7A 2EGPA 2YQLA 4YAXA 4YC9A 1VYXA 2VJFB 2YUCA 3RTRB 3HCTA 3O35A 3NG2A 2HYED 5D1MB 2F6NA 1WENA 4AYCA 4X3GA 5TBNA 4QF2A 2L80A 3L11A 2L5UA 2UZGA 1WESA 2KWKA 5KH7A 2ECNA 2CKLA 1X4IA 3M63A 3PHDA 5I3LA 4B7YC 5DINA 4R2YA 1WEEA 3HTKC 3O70A 3O37A 2MNZA 3LQJA 5B76A 3L1XA 3LRQA 2ECJA 4WZ2A 4FK5A 2VPEA 2KWOA 3N9PA 2XEUA 1WEPA 4AP4A 2MT5A 4B86C 4XI1A 4GB0A 4LADB 4QF3A 3MHHA 1BORA 3KNVA 3EB5A 3PURA 2KREA 3L1ZB 4LKAA 3T6RA 5KH9A 2YT5A 4R7EA 4YBSA 2M3HA 2VPBA 2JRJA 3RPGB 4A0CD 4W4UA 5AIUA 3N9MA 1JM7B 4L58A 1Z2QA 2LDRA 1U6GB 4UP5A 4MSXA 4ZQLA 1F62A 2CSYA 4I7DA 2G45A 2YU4A 4S3OB 4YBMA 2HDPA 4AYCB 1N87A 2LGKA 5FERA 2FUIA 5C11A 1WILA 2KU3A 3LQIA 5AITA 2VJEA 4N3WA 2KE1A 2C2LA 2JMDA 3ZNIA 2LQ6A 2VJEB 1X4UA 3ZVYA 2ECGA 2F6JA 3ZTGA 5B78A 1WEOA 3SOWA 5H9MA 3HCUA 2QIZA 3I2DA 3MHSA 2YSJA 2Y1NA 2JMJA 2LN0A 3KQIA 1E4UA 1Z60A 2KWNA 1HYJA 3ZYQA 4L7XA 2ECTA 5G05B 1FP0A 2VNFA 1Z6UA 2VPGA 2YSMA 4IC2A 2M85A 2VP7A 2G43A 2D8SA 1WEWA 4WZ0A 4GNGA 4AVXA 2LRIC 2L43A 4BHWA 2MIQA 4FIPA 4NN2A 4Q6FA 2BAYA 2FSAA 2DX8A 5FB1A 2H0DA 2K4DA 2MD7B 4GNFA 4A49A 2LGLA 1RMDA 2MA5A 2ECWA 4MVTA 1K2FA 5B79A 2NAAA 2L75A 2AN6A 1HYIA 4YBTA 3ZVZB 2K1JA 3ZPVE 2KGIA 3GL6A 3EB6A 2KFTA 5TDWA 3U5NA 5LCWB 2K17A 4BBQA 4CCGX 4FJCA 5DKAA 4ZUXU 1LDJB 2CSZA 2YHOA 3U5MA 2CT2A 2KYUA 3N9LA 1WEMA 5LKXA 3QZVA 3SHBA 2YREA 5G0FA 5KH3A 3ZPV1 2EA6A 4PPEA 4YABA 2RSDA 4IC3A 2VPDA 5B8DA 1WIMA 2IDAA 5LKZA 3C6WA 1V87A 1WE9A 3SOUA 3O34A 5LKTA 4TKPB 3SOXA 5B75A 3LQHA 2JMIA 3FL2A 3O33A 4AUQB 5H1VA 2YURA 2XB1A 2ECVA 5JG6A 4R8PK 2VJFA 1WEUA 2E6SA 3O7AA 1X4JA 3N9OA 3KV5A 2F42A 5TDRA 2LGGA 2YW8A 3N9QA 4YADA 1JM7A 2MNYA 5H1TA 1MM2A 2QJ0A 2MA6A 3C5KA 4ZDTA 4A4BA 4LK9A 4FO9A 4CA1A 1DVPA 2C2VS 1G25A 5J3XA 1WEVA 4LLBA 2M1RA 2LGVA 5C13A 5D1KB 5B77A 3V43A 2L0BA 1VD4A 1CHCA 4YATA 2MUMA 1FBVA 1WEQA 4PTBA 1T1HA 3DPLR 2G6QA 5TRBA 2KIZA 2PNXA 4F52B 4LJNA 2FUUA 2YYRA 5EYAF 4V3LC 3M62A 2ECIA 3PUQA 2LXHC 1MM3A 3U5PA 3KV6A 2KR4A 1ZBDB 5G04B 2Y1MA 5FEYA 2K16A 2YHNA 3IHPA 4GNEA 4GNDA 4UP0A 4A4CA 2ZETC 4I7CA 4WA6A 5TABA 1IYMA 3U5OA 2Y43A 3GV4A 3DQVR 3VK6A 3RPGC 4V3KC 2CKLB 3N9NA 3O36A 4UI9B 2QICA 3M99A 4O64A 2KGGA 3HCSA 2I50A 3T7LA 1XWHA 2MD8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5O B;  1VFY A;  2LV9 A;  4I7B A;  2KWJ A;  5LKU A;  4S3O C;  5D1L B;  2E6R A;  2LXP C;  5FB0 A;  2OXQ C;  1LDK C;  2H0D B;  4N4F A;  4WZ3 B;  1WFK A;  4C9Z A;  2M6M A;  2EOD A;  3ASL A;  5H1U A;  2PUY A;  1WGM A;  1JOC A;  2YQM A;  2RI7 A;  2EGP A;  2YQL A;  4YAX A;  4YC9 A;  1VYX A;  2VJF B;  2YUC A;  3RTR B;  3HCT A;  3O35 A;  3NG2 A;  2HYE D;  5D1M B;  2F6N A;  1WEN A;  4AYC A;  4X3G A;  5TBN A;  4QF2 A;  2L80 A;  3L11 A;  2L5U A;  2UZG A;  1WES A;  2KWK A;  5KH7 A;  2ECN A;  2CKL A;  1X4I A;  3M63 A;  3PHD A;  5I3L A;  4B7Y C;  5DIN A;  4R2Y A;  1WEE A;  3HTK C;  3O70 A;  3O37 A;  2MNZ A;  3LQJ A;  5B76 A;  3L1X A;  3LRQ A;  2ECJ A;  4WZ2 A;  4FK5 A;  2VPE A;  2KWO A;  3N9P A;  2XEU A;  1WEP A;  4AP4 A;  2MT5 A;  4B86 C;  4XI1 A;  4GB0 A;  4LAD B;  4QF3 A;  3MHH A;  1BOR A;  3KNV A;  3EB5 A;  3PUR A;  2KRE A;  3L1Z B;  4LKA A;  3T6R A;  5KH9 A;  2YT5 A;  4R7E A;  4YBS A;  2M3H A;  2VPB A;  2JRJ A;  3RPG B;  4A0C D;  4W4U A;  5AIU A;  3N9M A;  1JM7 B;  4L58 A;  1Z2Q A;  2LDR A;  1U6G B;  4UP5 A;  4MSX A;  4ZQL A;  1F62 A;  2CSY A;  4I7D A;  2G45 A;  2YU4 A;  4S3O B;  4YBM A;  2HDP A;  4AYC B;  1N87 A;  2LGK A;  5FER A;  2FUI A;  5C11 A;  1WIL A;  2KU3 A;  3LQI A;  5AIT A;  2VJE A;  4N3W A;  2KE1 A;  2C2L A;  2JMD A;  3ZNI A;  2LQ6 A;  2VJE B;  1X4U A;  3ZVY A;  2ECG A;  2F6J A;  3ZTG A;  5B78 A;  1WEO A;  3SOW A;  5H9M A;  3HCU A;  2QIZ A;  3I2D A;  3MHS A;  2YSJ A;  2Y1N A;  2JMJ A;  2LN0 A;  3KQI A;  1E4U A;  1Z60 A;  2KWN A;  1HYJ A;  3ZYQ A;  4L7X A;  2ECT A;  5G05 B;  1FP0 A;  2VNF A;  1Z6U A;  2VPG A;  2YSM A;  4IC2 A;  2M85 A;  2VP7 A;  2G43 A;  2D8S A;  1WEW A;  4WZ0 A;  4GNG A;  4AVX A;  2LRI C;  2L43 A;  4BHW A;  2MIQ A;  4FIP A;  4NN2 A;  4Q6F A;  2BAY A;  2FSA A;  2DX8 A;  5FB1 A;  2H0D A;  2K4D A;  2MD7 B;  4GNF A;  4A49 A;  2LGL A;  1RMD A;  2MA5 A;  2ECW A;  4MVT A;  1K2F A;  5B79 A;  2NAA A;  2L75 A;  2AN6 A;  1HYI A;  4YBT A;  3ZVZ B;  2K1J A;  3ZPV E;  2KGI A;  3GL6 A;  3EB6 A;  2KFT A;  5TDW A;  3U5N A;  5LCW B;  2K17 A;  4BBQ A;  4CCG X;  4FJC A;  5DKA A;  4ZUX U;  1LDJ B;  2CSZ A;  2YHO A;  3U5M A;  2CT2 A;  2KYU A;  3N9L A;  1WEM A;  5LKX A;  3QZV A;  3SHB A;  2YRE A;  5G0F A;  5KH3 A;  3ZPV 1;  2EA6 A;  4PPE A;  4YAB A;  2RSD A;  4IC3 A;  2VPD A;  5B8D A;  1WIM A;  2IDA A;  5LKZ A;  3C6W A;  1V87 A;  1WE9 A;  3SOU A;  3O34 A;  5LKT A;  4TKP B;  3SOX A;  5B75 A;  3LQH A;  2JMI A;  3FL2 A;  3O33 A;  4AUQ B;  5H1V A;  2YUR A;  2XB1 A;  2ECV A;  5JG6 A;  4R8P K;  2VJF A;  1WEU A;  2E6S A;  3O7A A;  1X4J A;  3N9O A;  3KV5 A;  2F42 A;  5TDR A;  2LGG A;  2YW8 A;  3N9Q A;  4YAD A;  1JM7 A;  2MNY A;  5H1T A;  1MM2 A;  2QJ0 A;  2MA6 A;  3C5K A;  4ZDT A;  4A4B A;  4LK9 A;  4FO9 A;  4CA1 A;  1DVP A;  2C2V S;  1G25 A;  5J3X A;  1WEV A;  4LLB A;  2M1R A;  2LGV A;  5C13 A;  5D1K B;  5B77 A;  3V43 A;  2L0B A;  1VD4 A;  1CHC A;  4YAT A;  2MUM A;  1FBV A;  1WEQ A;  4PTB A;  1T1H A;  3DPL R;  2G6Q A;  5TRB A;  2KIZ A;  2PNX A;  4F52 B;  4LJN A;  2FUU A;  2YYR A;  5EYA F;  4V3L C;  3M62 A;  2ECI A;  3PUQ A;  2LXH C;  1MM3 A;  3U5P A;  3KV6 A;  2KR4 A;  1ZBD B;  5G04 B;  2Y1M A;  5FEY A;  2K16 A;  2YHN A;  3IHP A;  4GNE A;  4GND A;  4UP0 A;  4A4C A;  2ZET C;  4I7C A;  4WA6 A;  5TAB A;  1IYM A;  3U5O A;  2Y43 A;  3GV4 A;  3DQV R;  3VK6 A;  3RPG C;  4V3K C;  2CKL B;  3N9N A;  3O36 A;  4UI9 B;  2QIC A;  3M99 A;  4O64 A;  2KGG A;  3HCS A;  2I50 A;  3T7L A;  1XWH A;  2MD8 C; 
#chains in the Genus database with same CATH topology
 4P5O B;  1VFY A;  2LV9 A;  4I7B A;  2KWJ A;  5LKU A;  4S3O C;  5D1L B;  2E6R A;  2LXP C;  5SVX A;  5FB0 A;  2OXQ C;  2XOC A;  1LDK C;  2H0D B;  3KDE C;  4N4F A;  4WZ3 B;  1WFK A;  4C9Z A;  2M6M A;  2EOD A;  3ASL A;  2FD4 A;  5H1U A;  2PUY A;  1WGM A;  3FAO A;  1JOC A;  2YQM A;  2RI7 A;  2EGP A;  2YQL A;  4YAX A;  4YC9 A;  1VYX A;  2VJF B;  2YUC A;  3RTR B;  3HCT A;  3O35 A;  3NG2 A;  2HYE D;  5D1M B;  2F6N A;  1WEN A;  4AYC A;  4X3G A;  5TBN A;  4QF2 A;  2L80 A;  3L11 A;  2L5U A;  2UZG A;  1WES A;  2KWK A;  5KH7 A;  2ECN A;  2IQJ A;  2CKL A;  2CON A;  3FJU B;  1X4I A;  3FEH A;  3M63 A;  2OWA A;  3PHD A;  5I3L A;  4B7Y C;  5DIN A;  3LVR E;  3LDY A;  4R2Y A;  3SUB A;  4O62 A;  1WEE A;  3HTK C;  4OGE A;  3O70 A;  3O37 A;  3JUE A;  2MNZ A;  3LQJ A;  2E61 A;  2L7P A;  5B76 A;  3L1X A;  2EXU A;  3LRQ A;  2ECJ A;  4WZ2 A;  4FK5 A;  2VPE A;  2JUN A;  2KWO A;  3N9P A;  2XEU A;  1WEP A;  4AP4 A;  2MT5 A;  4B86 C;  4XI1 A;  4GB0 A;  4LAD B;  4QF3 A;  3MHH A;  1BOR A;  3KNV A;  1MBM A;  3EB5 A;  3PUR A;  2RR4 A;  2B0O E;  2KRE A;  3L1Z B;  4LKA A;  3T6R A;  5KH9 A;  4H9D A;  2YT5 A;  4R7E A;  4YBS A;  2M3H A;  2VPB A;  2JRJ A;  3RPG B;  4A0C D;  5SVI B;  4W4U A;  5AIU A;  3N9M A;  1JM7 B;  4L58 A;  1Z2Q A;  2LDR A;  1U6G B;  4UP5 A;  4MSX A;  4ZQL A;  3H7H A;  1F62 A;  2CSY A;  4I7D A;  2M13 A;  2G45 A;  2YU4 A;  4S3O B;  4YBM A;  2HDP A;  4AYC B;  1N87 A;  2LGK A;  5FER A;  2FUI A;  5C11 A;  1WIL A;  2DJA A;  2KU3 A;  3LQI A;  5AIT A;  2VJE A;  4N3W A;  2KE1 A;  2C2L A;  5SVI A;  2JMD A;  3ZNI A;  2LQ6 A;  2VJE B;  2D8U A;  1X4U A;  3ZVY A;  2ECG A;  2F6J A;  3ZTG A;  5B78 A;  1WEO A;  3SOW A;  5H9M A;  3HCU A;  2QIZ A;  3I2D A;  3MHS A;  2YSJ A;  2Y1N A;  2JMJ A;  2LN0 A;  3KQI A;  1E4U A;  2XOZ A;  3E2D A;  1Z60 A;  2KWN A;  1HYJ A;  2P57 A;  3ZYQ A;  4L7X A;  2ECT A;  5G05 B;  1FP0 A;  2VNF A;  4QQ4 A;  1Z6U A;  2VPG A;  2YSM A;  2MKE A;  2JM3 A;  4IC2 A;  2M85 A;  2VP7 A;  2G43 A;  2D8S A;  1WEW A;  2FFW A;  4WZ0 A;  4GNG A;  4AVX A;  2LRI C;  2L43 A;  4BHW A;  2MIQ A;  4FIP A;  2XOY A;  4NN2 A;  4Q6F A;  2BAY A;  2FSA A;  2DX8 A;  5FB1 A;  3T9K A;  2H0D A;  2K4D A;  2MD7 B;  4GNF A;  5SVY A;  4A49 A;  2LGL A;  1RMD A;  2MA5 A;  2ECW A;  4MVT A;  1K2F A;  5B79 A;  2NAA A;  2L75 A;  2AN6 A;  1HYI A;  4YBT A;  3ZVZ B;  2K1J A;  3MDB C;  3ZPV E;  2KGI A;  3GL6 A;  3EB6 A;  2KFT A;  5TDW A;  3U5N A;  2DSM A;  5LCW B;  2K17 A;  4BBQ A;  4CCG X;  4FJC A;  5DKA A;  4ZUX U;  1LDJ B;  2CSZ A;  2YHO A;  3U5M A;  2CT2 A;  2KYU A;  3N9L A;  1WEM A;  5LKX A;  3QZV A;  3SHB A;  2YRE A;  5G0F A;  3DWD A;  5KH3 A;  3ZPV 1;  2EA6 A;  4PPE A;  4YAB A;  2RSD A;  4IC3 A;  2VPD A;  5B8D A;  1WIM A;  2IDA A;  5LKZ A;  3C6W A;  1V87 A;  3LJU X;  1WE9 A;  3FM8 C;  3SOU A;  3O34 A;  3PLW A;  5LKT A;  3DDT A;  4TKP B;  3SOX A;  5B75 A;  2KKY A;  3LQH A;  3O47 A;  2JMI A;  3FL2 A;  3O33 A;  4AUQ B;  5H1V A;  2YUR A;  2XB1 A;  2ECV A;  4OGC A;  5JG6 A;  4R8P K;  2VJF A;  1WEU A;  2E6S A;  3O7A A;  1X4J A;  3N9O A;  3KV5 A;  2F42 A;  5TDR A;  2YVR A;  2LGG A;  2YW8 A;  3N9Q A;  2LAU A;  4YAD A;  1JM7 A;  2MNY A;  5H1T A;  4F1P A;  1MM2 A;  2QJ0 A;  2MA6 A;  3C5K A;  4ZDT A;  4A4B A;  4LK9 A;  4FO9 A;  3Q1D A;  4CA1 A;  1DVP A;  2C2V S;  1G25 A;  5J3X A;  1WEV A;  4LLB A;  3LVQ E;  2M1R A;  2LGV A;  5C13 A;  2EGM A;  5D1K B;  5B77 A;  3V43 A;  4Z0O A;  2L0B A;  1VD4 A;  1CHC A;  4YAT A;  2MUM A;  1FBV A;  1WEQ A;  4PTB A;  1T1H A;  3DPL R;  2G6Q A;  5TRB A;  2KIZ A;  2PNX A;  4F52 B;  4LJN A;  2FUU A;  2YYR A;  1DCQ A;  5EYA F;  4V3L C;  3M62 A;  2ECI A;  4Z0R A;  3PUQ A;  2LXH C;  1MM3 A;  3U5P A;  3KV6 A;  2KR4 A;  1ZBD B;  5G04 B;  2Y1M A;  3FAN A;  5FEY A;  2K16 A;  2YHN A;  3IHP A;  4GNE A;  4GND A;  4UP0 A;  4A4C A;  3M7K A;  2ZET C;  4I7C A;  2KKX A;  4WA6 A;  5K3Q A;  5TAB A;  1IYM A;  3U5O A;  2CRW A;  2Y43 A;  3GV4 A;  3DQV R;  3VK6 A;  3RPG C;  4V3K C;  2CKL B;  3N9N A;  3O36 A;  4UI9 B;  2QIC A;  2XP0 A;  3M99 A;  4O64 A;  2KGG A;  3HCS A;  2I50 A;  3T7L A;  1XWH A;  2CSV A;  2MD8 C;  2CRR A; 
#chains in the Genus database with same CATH homology
 4P5O B;  1VFY A;  2LV9 A;  4I7B A;  2KWJ A;  5LKU A;  4S3O C;  5D1L B;  2E6R A;  2LXP C;  5FB0 A;  2OXQ C;  1LDK C;  2H0D B;  4N4F A;  4WZ3 B;  1WFK A;  4C9Z A;  2M6M A;  2EOD A;  3ASL A;  5H1U A;  2PUY A;  1WGM A;  1JOC A;  2YQM A;  2RI7 A;  2EGP A;  2YQL A;  4YAX A;  4YC9 A;  1VYX A;  2VJF B;  2YUC A;  3RTR B;  3HCT A;  3O35 A;  3NG2 A;  2HYE D;  5D1M B;  2F6N A;  1WEN A;  4AYC A;  4X3G A;  5TBN A;  4QF2 A;  2L80 A;  3L11 A;  2L5U A;  2UZG A;  1WES A;  2KWK A;  5KH7 A;  2ECN A;  2CKL A;  1X4I A;  3M63 A;  3PHD A;  5I3L A;  4B7Y C;  5DIN A;  4R2Y A;  1WEE A;  3HTK C;  3O70 A;  3O37 A;  2MNZ A;  3LQJ A;  5B76 A;  3L1X A;  3LRQ A;  2ECJ A;  4WZ2 A;  4FK5 A;  2VPE A;  2KWO A;  3N9P A;  2XEU A;  1WEP A;  4AP4 A;  2MT5 A;  4B86 C;  4XI1 A;  4GB0 A;  4LAD B;  4QF3 A;  3MHH A;  1BOR A;  3KNV A;  3EB5 A;  3PUR A;  2KRE A;  3L1Z B;  4LKA A;  3T6R A;  5KH9 A;  2YT5 A;  4R7E A;  4YBS A;  2M3H A;  2VPB A;  2JRJ A;  3RPG B;  4A0C D;  4W4U A;  5AIU A;  3N9M A;  1JM7 B;  4L58 A;  1Z2Q A;  2LDR A;  1U6G B;  4UP5 A;  4MSX A;  4ZQL A;  1F62 A;  2CSY A;  4I7D A;  2G45 A;  2YU4 A;  4S3O B;  4YBM A;  2HDP A;  4AYC B;  1N87 A;  2LGK A;  5FER A;  2FUI A;  5C11 A;  1WIL A;  2KU3 A;  3LQI A;  5AIT A;  2VJE A;  4N3W A;  2KE1 A;  2C2L A;  2JMD A;  3ZNI A;  2LQ6 A;  2VJE B;  1X4U A;  3ZVY A;  2ECG A;  2F6J A;  3ZTG A;  5B78 A;  1WEO A;  3SOW A;  5H9M A;  3HCU A;  2QIZ A;  3I2D A;  3MHS A;  2YSJ A;  2Y1N A;  2JMJ A;  2LN0 A;  3KQI A;  1E4U A;  1Z60 A;  2KWN A;  1HYJ A;  3ZYQ A;  4L7X A;  2ECT A;  5G05 B;  1FP0 A;  2VNF A;  1Z6U A;  2VPG A;  2YSM A;  4IC2 A;  2M85 A;  2VP7 A;  2G43 A;  2D8S A;  1WEW A;  4WZ0 A;  4GNG A;  4AVX A;  2LRI C;  2L43 A;  4BHW A;  2MIQ A;  4FIP A;  4NN2 A;  4Q6F A;  2BAY A;  2FSA A;  2DX8 A;  5FB1 A;  2H0D A;  2K4D A;  2MD7 B;  4GNF A;  4A49 A;  2LGL A;  1RMD A;  2MA5 A;  2ECW A;  4MVT A;  1K2F A;  5B79 A;  2NAA A;  2L75 A;  2AN6 A;  1HYI A;  4YBT A;  3ZVZ B;  2K1J A;  3ZPV E;  2KGI A;  3GL6 A;  3EB6 A;  2KFT A;  5TDW A;  3U5N A;  5LCW B;  2K17 A;  4BBQ A;  4CCG X;  4FJC A;  5DKA A;  4ZUX U;  1LDJ B;  2CSZ A;  2YHO A;  3U5M A;  2CT2 A;  2KYU A;  3N9L A;  1WEM A;  5LKX A;  3QZV A;  3SHB A;  2YRE A;  5G0F A;  5KH3 A;  3ZPV 1;  2EA6 A;  4PPE A;  4YAB A;  2RSD A;  4IC3 A;  2VPD A;  5B8D A;  1WIM A;  2IDA A;  5LKZ A;  3C6W A;  1V87 A;  1WE9 A;  3SOU A;  3O34 A;  5LKT A;  4TKP B;  3SOX A;  5B75 A;  3LQH A;  2JMI A;  3FL2 A;  3O33 A;  4AUQ B;  5H1V A;  2YUR A;  2XB1 A;  2ECV A;  5JG6 A;  4R8P K;  2VJF A;  1WEU A;  2E6S A;  3O7A A;  1X4J A;  3N9O A;  3KV5 A;  2F42 A;  5TDR A;  2LGG A;  2YW8 A;  3N9Q A;  4YAD A;  1JM7 A;  2MNY A;  5H1T A;  1MM2 A;  2QJ0 A;  2MA6 A;  3C5K A;  4ZDT A;  4A4B A;  4LK9 A;  4FO9 A;  4CA1 A;  1DVP A;  2C2V S;  1G25 A;  5J3X A;  1WEV A;  4LLB A;  2M1R A;  2LGV A;  5C13 A;  5D1K B;  5B77 A;  3V43 A;  2L0B A;  1VD4 A;  1CHC A;  4YAT A;  2MUM A;  1FBV A;  1WEQ A;  4PTB A;  1T1H A;  3DPL R;  2G6Q A;  5TRB A;  2KIZ A;  2PNX A;  4F52 B;  4LJN A;  2FUU A;  2YYR A;  5EYA F;  4V3L C;  3M62 A;  2ECI A;  3PUQ A;  2LXH C;  1MM3 A;  3U5P A;  3KV6 A;  2KR4 A;  1ZBD B;  5G04 B;  2Y1M A;  5FEY A;  2K16 A;  2YHN A;  3IHP A;  4GNE A;  4GND A;  4UP0 A;  4A4C A;  2ZET C;  4I7C A;  4WA6 A;  5TAB A;  1IYM A;  3U5O A;  2Y43 A;  3GV4 A;  3DQV R;  3VK6 A;  3RPG C;  4V3K C;  2CKL B;  3N9N A;  3O36 A;  4UI9 B;  2QIC A;  3M99 A;  4O64 A;  2KGG A;  3HCS A;  2I50 A;  3T7L A;  1XWH A;  2MD8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...