1BORA

Transcription factor pml, a proto-oncoprotein, nmr, 1 representative structure at ph 7.5, 30 c, in the presence of zinc
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
EEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION FACTOR PML
publication title The solution structure of the RING finger domain from the acute promyelocytic leukaemia proto-oncoprotein PML.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 4
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1995-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1borA00
4MSXA 2VJEB 3LRQA 4R2YA 4GNDA 4A49A 3ZVZB 4L7XA 1WFKA 4V3LC 2K17A 5G04B 2F6JA 4CA1A 1HYJA 2Y1NA 2YQMA 3N9LA 4F52B 1X4JA 3QZVA 2VPEA 2G45A 3LQJA 5TDRA 3PUQA 2Y43A 1HYIA 3EB5A 3L1XA 2EODA 5TABA 3RPGB 2K1JA 3O33A 3VK6A 1VYXA 5G0FA 5B77A 4I7CA 1BORA 3ZTGA 5DINA 1CHCA 4B7YC 1WEWA 5B79A 3ZYQA 2BAYA 5LKUA 4MVTA 2LXHC 4GNFA 2OXQC 1LDJB 1WEOA 3U5NA 1G25A 2FSAA 2JMDA 3HCSA 2LQ6A 2YHOA 2QICA 4UP5A 2YQLA 4LKAA 2H0DB 2VJFA 2KWOA 2E6SA 4R8PK 2KWNA 4V3KC 1JM7A 1WENA 4QF3A 3LQHA 2YYRA 2JRJA 3O37A 5AITA 2CT2A 5C13A 3GL6A 4A4CA 1E4UA 4XI1A 1IYMA 1K2FA 4WZ0A 4R7EA 5G05B 4C9ZA 2PUYA 1F62A 2LXPC 2CKLA 1Z6UA 5D1LB 2CSYA 2ECJA 3DQVR 2MNYA 5D1KB 2DX8A 5LKTA 3RPGC 1WEUA 4ZDTA 1RMDA 2KWKA 3O36A 2PNXA 1DVPA 3SOWA 3U5PA 4AVXA 1FP0A 1X4IA 1JOCA 4Q6FA 4WA6A 4YATA 2LV9A 5B78A 1FBVA 4YBTA 4L58A 2YW8A 2VP7A 3HCTA 3KQIA 2MD7B 4X3GA 2HYED 5H9MA 5FB0A 2LGGA 2FUIA 2VJEA 3O35A 2D8SA 2ECTA 2KGGA 2LGVA 1WEEA 2UZGA 5H1UA 2VPDA 2LDRA 2MNZA 1X4UA 4FK5A 4S3OC 2F6NA 2ECNA 3ZPVE 5FEYA 1Z60A 3O34A 5LCWB 4B86C 4AYCB 4ZUXU 3C5KA 3DPLR 3ASLA 2MUMA 2L5UA 2I50A 2ECVA 2RSDA 2HDPA 5TDWA 1LDKC 4FJCA 4I7BA 4N4FA 3U5OA 4GB0A 2LGKA 5TRBA 5KH3A 2KR4A 5C11A 1WESA 3PHDA 4P5OB 3SOXA 2L0BA 3MHSA 3L1ZB 5B76A 4PTBA 2H0DA 2EA6A 2QJ0A 2K16A 2KE1A 2AN6A 2F42A 2JMJA 4QF2A 4O64A 3HCUA 3GV4A 5I3LA 5KH7A 2EGPA 4LK9A 1WE9A 3MHHA 4YAXA 4YADA 4A4BA 2MIQA 5EYAF 2RI7A 2L80A 2KFTA 2M85A 4CCGX 3NG2A 3LQIA 2MD8C 3KV6A 3N9MA 5B75A 3O7AA 2LGLA 2LN0A 2YSJA 2IDAA 5H1VA 2M3HA 4LJNA 3N9PA 2VPBA 3HTKC 3KNVA 2ECWA 4ZQLA 2MA6A 2FUUA 5TBNA 3U5MA 4W4UA 2MT5A 4LLBA 3ZNIA 2KU3A 4LADB 2LRIC 2ZETC 5DKAA 4YBSA 2KYUA 2M1RA 2M6MA 3C6WA 3O70A 2CSZA 3IHPA 2VNFA 3FL2A 2ECIA 3I2DA 2C2LA 4TKPB 2KGIA 4PPEA 1V87A 1WEPA 3ZPV1 2VPGA 2XEUA 4IC3A 3KV5A 4GNGA 5KH9A 4FIPA 2G6QA 3N9QA 2YREA 1WEMA 2YSMA 4NN2A 4AYCA 5H1TA 1WILA 5LKXA 3M62A 4GNEA 1MM2A 1WEQA 3M63A 2MA5A 2YHNA 2VJFB 2JMIA 3M99A 4AP4A 5FB1A 3SHBA 2L75A 4YC9A 2YUCA 2KWJA 3N9OA 4N3WA 1T1HA 1JM7B 4BHWA 4I7DA 3T6RA 5D1MB 2YURA 2L43A 1WEVA 2YT5A 2QIZA 1XWHA 5JG6A 2C2VS 2CKLB 2XB1A 5FERA 1VFYA 2KREA 3ZVYA 1N87A 4UI9B 4IC2A 4YBMA 4WZ3B 1WIMA 5J3XA 2G43A 4S3OB 5AIUA 3V43A 5B8DA 2K4DA 3SOUA 1VD4A 1ZBDB 3T7LA 4YABA 4AUQB 1U6GB 3EB6A 4BBQA 5LKZA 4UP0A 2Y1MA 1Z2QA 4A0CD 2E6RA 3L11A 3N9NA 2KIZA 3PURA 2NAAA 3RTRB 2YU4A 4WZ2A 1WGMA 2ECGA 1MM3A 4FO9A
chains in the Genus database with same CATH superfamily
4MSXA 2VJEB 3Q1DA 3LRQA 2CRRA 4R2YA 2RR4A 1MBMA 4GNDA 4A49A 3ZVZB 4L7XA 1WFKA 4Z0OA 4V3LC 2K17A 5G04B 2F6JA 4CA1A 3FANA 1HYJA 2Y1NA 2YQMA 3N9LA 4F52B 4H9DA 1X4JA 2JUNA 3QZVA 2FD4A 2G45A 2VPEA 2OWAA 3LQJA 5TDRA 3PUQA 2Y43A 1HYIA 3EB5A 3L1XA 5SVIB 2EODA 5TABA 3RPGB 2K1JA 3O33A 2JM3A 3VK6A 1VYXA 5G0FA 5B77A 4I7CA 1BORA 3ZTGA 5DINA 1CHCA 4B7YC 1WEWA 5B79A 4OGCA 3ZYQA 2BAYA 5LKUA 4MVTA 2LXHC 4GNFA 2DSMA 2OXQC 1LDJB 1WEOA 5K3QA 3U5NA 1G25A 2FSAA 2JMDA 3HCSA 2LQ6A 2YHOA 2QICA 4UP5A 2YQLA 2P57A 4LKAA 2H0DB 2VJFA 2KWOA 4Z0RA 2E6SA 4R8PK 2KWNA 4V3KC 1JM7A 1WENA 4QF3A 3LQHA 2YYRA 2JRJA 3O37A 5AITA 2CT2A 3DDTA 3FAOA 5C13A 3GL6A 4A4CA 1E4UA 4XI1A 1IYMA 2EXUA 1K2FA 4WZ0A 4R7EA 3LVQE 5G05B 4C9ZA 2PUYA 1F62A 2LXPC 1DCQA 1Z6UA 2CKLA 5D1LB 2CSYA 2ECJA 3DQVR 2MNYA 5D1KB 2DX8A 5LKTA 3RPGC 1WEUA 4ZDTA 1RMDA 2KWKA 3O36A 2PNXA 1DVPA 3SOWA 3U5PA 3FM8C 4AVXA 1FP0A 3JUEA 1X4IA 1JOCA 2M13A 4Q6FA 4WA6A 4YATA 2LV9A 5B78A 3FJUB 4F1PA 1FBVA 4YBTA 4L58A 2YW8A 4OGEA 2VP7A 3HCTA 3KQIA 2MD7B 4X3GA 2HYED 5H9MA 5FB0A 2LGGA 2FUIA 2VJEA 3O35A 3PLWA 2D8SA 2ECTA 2KGGA 2LGVA 1WEEA 2UZGA 5H1UA 2VPDA 2LDRA 2MNZA 1X4UA 2LAUA 5SVXA 4FK5A 4S3OC 2F6NA 2ECNA 3ZPVE 5FEYA 1Z60A 3O34A 5LCWB 4B86C 4AYCB 4ZUXU 3C5KA 3DPLR 3ASLA 2MUMA 2L5UA 2I50A 2ECVA 5SVIA 2RSDA 2HDPA 5TDWA 1LDKC 4FJCA 4I7BA 4N4FA 3U5OA 5SVYA 4GB0A 2LGKA 5TRBA 5KH3A 2KKXA 2KR4A 5C11A 2XP0A 1WESA 2IQJA 2MKEA 3PHDA 4P5OB 3SOXA 2L0BA 3O47A 3MHSA 3L1ZB 5B76A 4PTBA 2H0DA 3E2DA 2EA6A 2QJ0A 2K16A 3FEHA 2KE1A 2AN6A 2F42A 2JMJA 4QF2A 4O64A 3HCUA 3GV4A 5I3LA 2FFWA 3M7KA 5KH7A 2EGPA 4LK9A 1WE9A 3MHHA 2B0OE 4YAXA 4YADA 4A4BA 2MIQA 5EYAF 2RI7A 2L80A 2KFTA 2M85A 4CCGX 3NG2A 3LQIA 2MD8C 3KV6A 3N9MA 2D8UA 2XOCA 5B75A 3O7AA 2LGLA 2LN0A 2E61A 2YSJA 2IDAA 4O62A 5H1VA 2M3HA 4LJNA 3N9PA 2VPBA 3HTKC 3KNVA 2ECWA 4ZQLA 2MA6A 3LDYA 2FUUA 4QQ4A 5TBNA 3U5MA 4W4UA 2MT5A 4LLBA 3ZNIA 2KU3A 4LADB 2EGMA 2LRIC 2ZETC 5DKAA 2DJAA 4YBSA 2KYUA 2M1RA 2M6MA 3C6WA 3O70A 2CSZA 2CRWA 3IHPA 3DWDA 2VNFA 2XOZA 3FL2A 2ECIA 3I2DA 2C2LA 4TKPB 2KGIA 4PPEA 1V87A 1WEPA 2KKYA 3ZPV1 2VPGA 2XEUA 4IC3A 3KV5A 3KDEC 4GNGA 5KH9A 4FIPA 2G6QA 3N9QA 2YREA 1WEMA 2YSMA 4NN2A 4AYCA 5H1TA 1WILA 5LKXA 3M62A 4GNEA 1MM2A 2L7PA 1WEQA 3M63A 2MA5A 2YHNA 2VJFB 2JMIA 3M99A 4AP4A 5FB1A 3SHBA 2L75A 4YC9A 2YUCA 2KWJA 3N9OA 4N3WA 1T1HA 1JM7B 4BHWA 4I7DA 3T6RA 5D1MB 2CSVA 2YURA 2L43A 1WEVA 2YT5A 3LJUX 2QIZA 1XWHA 5JG6A 2C2VS 2CKLB 2XB1A 5FERA 1VFYA 2KREA 3ZVYA 1N87A 4UI9B 3LVRE 4IC2A 4YBMA 4WZ3B 1WIMA 5J3XA 2G43A 4S3OB 2XOYA 3T9KA 3SUBA 5AIUA 3V43A 5B8DA 3H7HA 2K4DA 3SOUA 1VD4A 1ZBDB 3T7LA 4YABA 4AUQB 1U6GB 3EB6A 4BBQA 5LKZA 4UP0A 2Y1MA 1Z2QA 4A0CD 2E6RA 3L11A 3N9NA 2KIZA 3PURA 2NAAA 3RTRB 2YU4A 2CONA 3MDBC 4WZ2A 1WGMA 2ECGA 1MM3A 4FO9A 2YVRA
chains in the Genus database with same CATH topology
4MSXA 2VJEB 3LRQA 4R2YA 4GNDA 4A49A 3ZVZB 4L7XA 1WFKA 4V3LC 2K17A 5G04B 2F6JA 4CA1A 1HYJA 2Y1NA 2YQMA 3N9LA 4F52B 1X4JA 3QZVA 2VPEA 2G45A 3LQJA 5TDRA 3PUQA 2Y43A 1HYIA 3EB5A 3L1XA 2EODA 5TABA 3RPGB 2K1JA 3O33A 3VK6A 1VYXA 5G0FA 5B77A 4I7CA 1BORA 3ZTGA 5DINA 1CHCA 4B7YC 1WEWA 5B79A 3ZYQA 2BAYA 5LKUA 4MVTA 2LXHC 4GNFA 2OXQC 1LDJB 1WEOA 3U5NA 1G25A 2FSAA 2JMDA 3HCSA 2LQ6A 2YHOA 2QICA 4UP5A 2YQLA 4LKAA 2H0DB 2VJFA 2KWOA 2E6SA 4R8PK 2KWNA 4V3KC 1JM7A 1WENA 4QF3A 3LQHA 2YYRA 2JRJA 3O37A 5AITA 2CT2A 5C13A 3GL6A 4A4CA 1E4UA 4XI1A 1IYMA 1K2FA 4WZ0A 4R7EA 5G05B 4C9ZA 2PUYA 1F62A 2LXPC 2CKLA 1Z6UA 5D1LB 2CSYA 2ECJA 3DQVR 2MNYA 5D1KB 2DX8A 5LKTA 3RPGC 1WEUA 4ZDTA 1RMDA 2KWKA 3O36A 2PNXA 1DVPA 3SOWA 3U5PA 4AVXA 1FP0A 1X4IA 1JOCA 4Q6FA 4WA6A 4YATA 2LV9A 5B78A 1FBVA 4YBTA 4L58A 2YW8A 2VP7A 3HCTA 3KQIA 2MD7B 4X3GA 2HYED 5H9MA 5FB0A 2LGGA 2FUIA 2VJEA 3O35A 2D8SA 2ECTA 2KGGA 2LGVA 1WEEA 2UZGA 5H1UA 2VPDA 2LDRA 2MNZA 1X4UA 4FK5A 4S3OC 2F6NA 2ECNA 3ZPVE 5FEYA 1Z60A 3O34A 5LCWB 4B86C 4AYCB 4ZUXU 3C5KA 3DPLR 3ASLA 2MUMA 2L5UA 2I50A 2ECVA 2RSDA 2HDPA 5TDWA 1LDKC 4FJCA 4I7BA 4N4FA 3U5OA 4GB0A 2LGKA 5TRBA 5KH3A 2KR4A 5C11A 1WESA 3PHDA 4P5OB 3SOXA 2L0BA 3MHSA 3L1ZB 5B76A 4PTBA 2H0DA 2EA6A 2QJ0A 2K16A 2KE1A 2AN6A 2F42A 2JMJA 4QF2A 4O64A 3HCUA 3GV4A 5I3LA 5KH7A 2EGPA 4LK9A 1WE9A 3MHHA 4YAXA 4YADA 4A4BA 2MIQA 5EYAF 2RI7A 2L80A 2KFTA 2M85A 4CCGX 3NG2A 3LQIA 2MD8C 3KV6A 3N9MA 5B75A 3O7AA 2LGLA 2LN0A 2YSJA 2IDAA 5H1VA 2M3HA 4LJNA 3N9PA 2VPBA 3HTKC 3KNVA 2ECWA 4ZQLA 2MA6A 2FUUA 5TBNA 3U5MA 4W4UA 2MT5A 4LLBA 3ZNIA 2KU3A 4LADB 2LRIC 2ZETC 5DKAA 4YBSA 2KYUA 2M1RA 2M6MA 3C6WA 3O70A 2CSZA 3IHPA 2VNFA 3FL2A 2ECIA 3I2DA 2C2LA 4TKPB 2KGIA 4PPEA 1V87A 1WEPA 3ZPV1 2VPGA 2XEUA 4IC3A 3KV5A 4GNGA 5KH9A 4FIPA 2G6QA 3N9QA 2YREA 1WEMA 2YSMA 4NN2A 4AYCA 5H1TA 1WILA 5LKXA 3M62A 4GNEA 1MM2A 1WEQA 3M63A 2MA5A 2YHNA 2VJFB 2JMIA 3M99A 4AP4A 5FB1A 3SHBA 2L75A 4YC9A 2YUCA 2KWJA 3N9OA 4N3WA 1T1HA 1JM7B 4BHWA 4I7DA 3T6RA 5D1MB 2YURA 2L43A 1WEVA 2YT5A 2QIZA 1XWHA 5JG6A 2C2VS 2CKLB 2XB1A 5FERA 1VFYA 2KREA 3ZVYA 1N87A 4UI9B 4IC2A 4YBMA 4WZ3B 1WIMA 5J3XA 2G43A 4S3OB 5AIUA 3V43A 5B8DA 2K4DA 3SOUA 1VD4A 1ZBDB 3T7LA 4YABA 4AUQB 1U6GB 3EB6A 4BBQA 5LKZA 4UP0A 2Y1MA 1Z2QA 4A0CD 2E6RA 3L11A 3N9NA 2KIZA 3PURA 2NAAA 3RTRB 2YU4A 4WZ2A 1WGMA 2ECGA 1MM3A 4FO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSX A;  2VJE B;  3LRQ A;  4R2Y A;  4GND A;  4A49 A;  3ZVZ B;  4L7X A;  1WFK A;  4V3L C;  2K17 A;  5G04 B;  2F6J A;  4CA1 A;  1HYJ A;  2Y1N A;  2YQM A;  3N9L A;  4F52 B;  1X4J A;  3QZV A;  2VPE A;  2G45 A;  3LQJ A;  5TDR A;  3PUQ A;  2Y43 A;  1HYI A;  3EB5 A;  3L1X A;  2EOD A;  5TAB A;  3RPG B;  2K1J A;  3O33 A;  3VK6 A;  1VYX A;  5G0F A;  5B77 A;  4I7C A;  1BOR A;  3ZTG A;  5DIN A;  1CHC A;  4B7Y C;  1WEW A;  5B79 A;  3ZYQ A;  2BAY A;  5LKU A;  4MVT A;  2LXH C;  4GNF A;  2OXQ C;  1LDJ B;  1WEO A;  3U5N A;  1G25 A;  2FSA A;  2JMD A;  3HCS A;  2LQ6 A;  2YHO A;  2QIC A;  4UP5 A;  2YQL A;  4LKA A;  2H0D B;  2VJF A;  2KWO A;  2E6S A;  4R8P K;  2KWN A;  4V3K C;  1JM7 A;  1WEN A;  4QF3 A;  3LQH A;  2YYR A;  2JRJ A;  3O37 A;  5AIT A;  2CT2 A;  5C13 A;  3GL6 A;  4A4C A;  1E4U A;  4XI1 A;  1IYM A;  1K2F A;  4WZ0 A;  4R7E A;  5G05 B;  4C9Z A;  2PUY A;  1F62 A;  2LXP C;  2CKL A;  1Z6U A;  5D1L B;  2CSY A;  2ECJ A;  3DQV R;  2MNY A;  5D1K B;  2DX8 A;  5LKT A;  3RPG C;  1WEU A;  4ZDT A;  1RMD A;  2KWK A;  3O36 A;  2PNX A;  1DVP A;  3SOW A;  3U5P A;  4AVX A;  1FP0 A;  1X4I A;  1JOC A;  4Q6F A;  4WA6 A;  4YAT A;  2LV9 A;  5B78 A;  1FBV A;  4YBT A;  4L58 A;  2YW8 A;  2VP7 A;  3HCT A;  3KQI A;  2MD7 B;  4X3G A;  2HYE D;  5H9M A;  5FB0 A;  2LGG A;  2FUI A;  2VJE A;  3O35 A;  2D8S A;  2ECT A;  2KGG A;  2LGV A;  1WEE A;  2UZG A;  5H1U A;  2VPD A;  2LDR A;  2MNZ A;  1X4U A;  4FK5 A;  4S3O C;  2F6N A;  2ECN A;  3ZPV E;  5FEY A;  1Z60 A;  3O34 A;  5LCW B;  4B86 C;  4AYC B;  4ZUX U;  3C5K A;  3DPL R;  3ASL A;  2MUM A;  2L5U A;  2I50 A;  2ECV A;  2RSD A;  2HDP A;  5TDW A;  1LDK C;  4FJC A;  4I7B A;  4N4F A;  3U5O A;  4GB0 A;  2LGK A;  5TRB A;  5KH3 A;  2KR4 A;  5C11 A;  1WES A;  3PHD A;  4P5O B;  3SOX A;  2L0B A;  3MHS A;  3L1Z B;  5B76 A;  4PTB A;  2H0D A;  2EA6 A;  2QJ0 A;  2K16 A;  2KE1 A;  2AN6 A;  2F42 A;  2JMJ A;  4QF2 A;  4O64 A;  3HCU A;  3GV4 A;  5I3L A;  5KH7 A;  2EGP A;  4LK9 A;  1WE9 A;  3MHH A;  4YAX A;  4YAD A;  4A4B A;  2MIQ A;  5EYA F;  2RI7 A;  2L80 A;  2KFT A;  2M85 A;  4CCG X;  3NG2 A;  3LQI A;  2MD8 C;  3KV6 A;  3N9M A;  5B75 A;  3O7A A;  2LGL A;  2LN0 A;  2YSJ A;  2IDA A;  5H1V A;  2M3H A;  4LJN A;  3N9P A;  2VPB A;  3HTK C;  3KNV A;  2ECW A;  4ZQL A;  2MA6 A;  2FUU A;  5TBN A;  3U5M A;  4W4U A;  2MT5 A;  4LLB A;  3ZNI A;  2KU3 A;  4LAD B;  2LRI C;  2ZET C;  5DKA A;  4YBS A;  2KYU A;  2M1R A;  2M6M A;  3C6W A;  3O70 A;  2CSZ A;  3IHP A;  2VNF A;  3FL2 A;  2ECI A;  3I2D A;  2C2L A;  4TKP B;  2KGI A;  4PPE A;  1V87 A;  1WEP A;  3ZPV 1;  2VPG A;  2XEU A;  4IC3 A;  3KV5 A;  4GNG A;  5KH9 A;  4FIP A;  2G6Q A;  3N9Q A;  2YRE A;  1WEM A;  2YSM A;  4NN2 A;  4AYC A;  5H1T A;  1WIL A;  5LKX A;  3M62 A;  4GNE A;  1MM2 A;  1WEQ A;  3M63 A;  2MA5 A;  2YHN A;  2VJF B;  2JMI A;  3M99 A;  4AP4 A;  5FB1 A;  3SHB A;  2L75 A;  4YC9 A;  2YUC A;  2KWJ A;  3N9O A;  4N3W A;  1T1H A;  1JM7 B;  4BHW A;  4I7D A;  3T6R A;  5D1M B;  2YUR A;  2L43 A;  1WEV A;  2YT5 A;  2QIZ A;  1XWH A;  5JG6 A;  2C2V S;  2CKL B;  2XB1 A;  5FER A;  1VFY A;  2KRE A;  3ZVY A;  1N87 A;  4UI9 B;  4IC2 A;  4YBM A;  4WZ3 B;  1WIM A;  5J3X A;  2G43 A;  4S3O B;  5AIU A;  3V43 A;  5B8D A;  2K4D A;  3SOU A;  1VD4 A;  1ZBD B;  3T7L A;  4YAB A;  4AUQ B;  1U6G B;  3EB6 A;  4BBQ A;  5LKZ A;  4UP0 A;  2Y1M A;  1Z2Q A;  4A0C D;  2E6R A;  3L11 A;  3N9N A;  2KIZ A;  3PUR A;  2NAA A;  3RTR B;  2YU4 A;  4WZ2 A;  1WGM A;  2ECG A;  1MM3 A;  4FO9 A; 
#chains in the Genus database with same CATH topology
 4MSX A;  2VJE B;  3Q1D A;  3LRQ A;  2CRR A;  4R2Y A;  2RR4 A;  1MBM A;  4GND A;  4A49 A;  3ZVZ B;  4L7X A;  1WFK A;  4Z0O A;  4V3L C;  2K17 A;  5G04 B;  2F6J A;  4CA1 A;  3FAN A;  1HYJ A;  2Y1N A;  2YQM A;  3N9L A;  4F52 B;  4H9D A;  1X4J A;  2JUN A;  3QZV A;  2FD4 A;  2G45 A;  2VPE A;  2OWA A;  3LQJ A;  5TDR A;  3PUQ A;  2Y43 A;  1HYI A;  3EB5 A;  3L1X A;  5SVI B;  2EOD A;  5TAB A;  3RPG B;  2K1J A;  3O33 A;  2JM3 A;  3VK6 A;  1VYX A;  5G0F A;  5B77 A;  4I7C A;  1BOR A;  3ZTG A;  5DIN A;  1CHC A;  4B7Y C;  1WEW A;  5B79 A;  4OGC A;  3ZYQ A;  2BAY A;  5LKU A;  4MVT A;  2LXH C;  4GNF A;  2DSM A;  2OXQ C;  1LDJ B;  1WEO A;  5K3Q A;  3U5N A;  1G25 A;  2FSA A;  2JMD A;  3HCS A;  2LQ6 A;  2YHO A;  2QIC A;  4UP5 A;  2YQL A;  2P57 A;  4LKA A;  2H0D B;  2VJF A;  2KWO A;  4Z0R A;  2E6S A;  4R8P K;  2KWN A;  4V3K C;  1JM7 A;  1WEN A;  4QF3 A;  3LQH A;  2YYR A;  2JRJ A;  3O37 A;  5AIT A;  2CT2 A;  3DDT A;  3FAO A;  5C13 A;  3GL6 A;  4A4C A;  1E4U A;  4XI1 A;  1IYM A;  2EXU A;  1K2F A;  4WZ0 A;  4R7E A;  3LVQ E;  5G05 B;  4C9Z A;  2PUY A;  1F62 A;  2LXP C;  1DCQ A;  1Z6U A;  2CKL A;  5D1L B;  2CSY A;  2ECJ A;  3DQV R;  2MNY A;  5D1K B;  2DX8 A;  5LKT A;  3RPG C;  1WEU A;  4ZDT A;  1RMD A;  2KWK A;  3O36 A;  2PNX A;  1DVP A;  3SOW A;  3U5P A;  3FM8 C;  4AVX A;  1FP0 A;  3JUE A;  1X4I A;  1JOC A;  2M13 A;  4Q6F A;  4WA6 A;  4YAT A;  2LV9 A;  5B78 A;  3FJU B;  4F1P A;  1FBV A;  4YBT A;  4L58 A;  2YW8 A;  4OGE A;  2VP7 A;  3HCT A;  3KQI A;  2MD7 B;  4X3G A;  2HYE D;  5H9M A;  5FB0 A;  2LGG A;  2FUI A;  2VJE A;  3O35 A;  3PLW A;  2D8S A;  2ECT A;  2KGG A;  2LGV A;  1WEE A;  2UZG A;  5H1U A;  2VPD A;  2LDR A;  2MNZ A;  1X4U A;  2LAU A;  5SVX A;  4FK5 A;  4S3O C;  2F6N A;  2ECN A;  3ZPV E;  5FEY A;  1Z60 A;  3O34 A;  5LCW B;  4B86 C;  4AYC B;  4ZUX U;  3C5K A;  3DPL R;  3ASL A;  2MUM A;  2L5U A;  2I50 A;  2ECV A;  5SVI A;  2RSD A;  2HDP A;  5TDW A;  1LDK C;  4FJC A;  4I7B A;  4N4F A;  3U5O A;  5SVY A;  4GB0 A;  2LGK A;  5TRB A;  5KH3 A;  2KKX A;  2KR4 A;  5C11 A;  2XP0 A;  1WES A;  2IQJ A;  2MKE A;  3PHD A;  4P5O B;  3SOX A;  2L0B A;  3O47 A;  3MHS A;  3L1Z B;  5B76 A;  4PTB A;  2H0D A;  3E2D A;  2EA6 A;  2QJ0 A;  2K16 A;  3FEH A;  2KE1 A;  2AN6 A;  2F42 A;  2JMJ A;  4QF2 A;  4O64 A;  3HCU A;  3GV4 A;  5I3L A;  2FFW A;  3M7K A;  5KH7 A;  2EGP A;  4LK9 A;  1WE9 A;  3MHH A;  2B0O E;  4YAX A;  4YAD A;  4A4B A;  2MIQ A;  5EYA F;  2RI7 A;  2L80 A;  2KFT A;  2M85 A;  4CCG X;  3NG2 A;  3LQI A;  2MD8 C;  3KV6 A;  3N9M A;  2D8U A;  2XOC A;  5B75 A;  3O7A A;  2LGL A;  2LN0 A;  2E61 A;  2YSJ A;  2IDA A;  4O62 A;  5H1V A;  2M3H A;  4LJN A;  3N9P A;  2VPB A;  3HTK C;  3KNV A;  2ECW A;  4ZQL A;  2MA6 A;  3LDY A;  2FUU A;  4QQ4 A;  5TBN A;  3U5M A;  4W4U A;  2MT5 A;  4LLB A;  3ZNI A;  2KU3 A;  4LAD B;  2EGM A;  2LRI C;  2ZET C;  5DKA A;  2DJA A;  4YBS A;  2KYU A;  2M1R A;  2M6M A;  3C6W A;  3O70 A;  2CSZ A;  2CRW A;  3IHP A;  3DWD A;  2VNF A;  2XOZ A;  3FL2 A;  2ECI A;  3I2D A;  2C2L A;  4TKP B;  2KGI A;  4PPE A;  1V87 A;  1WEP A;  2KKY A;  3ZPV 1;  2VPG A;  2XEU A;  4IC3 A;  3KV5 A;  3KDE C;  4GNG A;  5KH9 A;  4FIP A;  2G6Q A;  3N9Q A;  2YRE A;  1WEM A;  2YSM A;  4NN2 A;  4AYC A;  5H1T A;  1WIL A;  5LKX A;  3M62 A;  4GNE A;  1MM2 A;  2L7P A;  1WEQ A;  3M63 A;  2MA5 A;  2YHN A;  2VJF B;  2JMI A;  3M99 A;  4AP4 A;  5FB1 A;  3SHB A;  2L75 A;  4YC9 A;  2YUC A;  2KWJ A;  3N9O A;  4N3W A;  1T1H A;  1JM7 B;  4BHW A;  4I7D A;  3T6R A;  5D1M B;  2CSV A;  2YUR A;  2L43 A;  1WEV A;  2YT5 A;  3LJU X;  2QIZ A;  1XWH A;  5JG6 A;  2C2V S;  2CKL B;  2XB1 A;  5FER A;  1VFY A;  2KRE A;  3ZVY A;  1N87 A;  4UI9 B;  3LVR E;  4IC2 A;  4YBM A;  4WZ3 B;  1WIM A;  5J3X A;  2G43 A;  4S3O B;  2XOY A;  3T9K A;  3SUB A;  5AIU A;  3V43 A;  5B8D A;  3H7H A;  2K4D A;  3SOU A;  1VD4 A;  1ZBD B;  3T7L A;  4YAB A;  4AUQ B;  1U6G B;  3EB6 A;  4BBQ A;  5LKZ A;  4UP0 A;  2Y1M A;  1Z2Q A;  4A0C D;  2E6R A;  3L11 A;  3N9N A;  2KIZ A;  3PUR A;  2NAA A;  3RTR B;  2YU4 A;  2CON A;  3MDB C;  4WZ2 A;  1WGM A;  2ECG A;  1MM3 A;  4FO9 A;  2YVR A; 
#chains in the Genus database with same CATH homology
 4MSX A;  2VJE B;  3LRQ A;  4R2Y A;  4GND A;  4A49 A;  3ZVZ B;  4L7X A;  1WFK A;  4V3L C;  2K17 A;  5G04 B;  2F6J A;  4CA1 A;  1HYJ A;  2Y1N A;  2YQM A;  3N9L A;  4F52 B;  1X4J A;  3QZV A;  2VPE A;  2G45 A;  3LQJ A;  5TDR A;  3PUQ A;  2Y43 A;  1HYI A;  3EB5 A;  3L1X A;  2EOD A;  5TAB A;  3RPG B;  2K1J A;  3O33 A;  3VK6 A;  1VYX A;  5G0F A;  5B77 A;  4I7C A;  1BOR A;  3ZTG A;  5DIN A;  1CHC A;  4B7Y C;  1WEW A;  5B79 A;  3ZYQ A;  2BAY A;  5LKU A;  4MVT A;  2LXH C;  4GNF A;  2OXQ C;  1LDJ B;  1WEO A;  3U5N A;  1G25 A;  2FSA A;  2JMD A;  3HCS A;  2LQ6 A;  2YHO A;  2QIC A;  4UP5 A;  2YQL A;  4LKA A;  2H0D B;  2VJF A;  2KWO A;  2E6S A;  4R8P K;  2KWN A;  4V3K C;  1JM7 A;  1WEN A;  4QF3 A;  3LQH A;  2YYR A;  2JRJ A;  3O37 A;  5AIT A;  2CT2 A;  5C13 A;  3GL6 A;  4A4C A;  1E4U A;  4XI1 A;  1IYM A;  1K2F A;  4WZ0 A;  4R7E A;  5G05 B;  4C9Z A;  2PUY A;  1F62 A;  2LXP C;  2CKL A;  1Z6U A;  5D1L B;  2CSY A;  2ECJ A;  3DQV R;  2MNY A;  5D1K B;  2DX8 A;  5LKT A;  3RPG C;  1WEU A;  4ZDT A;  1RMD A;  2KWK A;  3O36 A;  2PNX A;  1DVP A;  3SOW A;  3U5P A;  4AVX A;  1FP0 A;  1X4I A;  1JOC A;  4Q6F A;  4WA6 A;  4YAT A;  2LV9 A;  5B78 A;  1FBV A;  4YBT A;  4L58 A;  2YW8 A;  2VP7 A;  3HCT A;  3KQI A;  2MD7 B;  4X3G A;  2HYE D;  5H9M A;  5FB0 A;  2LGG A;  2FUI A;  2VJE A;  3O35 A;  2D8S A;  2ECT A;  2KGG A;  2LGV A;  1WEE A;  2UZG A;  5H1U A;  2VPD A;  2LDR A;  2MNZ A;  1X4U A;  4FK5 A;  4S3O C;  2F6N A;  2ECN A;  3ZPV E;  5FEY A;  1Z60 A;  3O34 A;  5LCW B;  4B86 C;  4AYC B;  4ZUX U;  3C5K A;  3DPL R;  3ASL A;  2MUM A;  2L5U A;  2I50 A;  2ECV A;  2RSD A;  2HDP A;  5TDW A;  1LDK C;  4FJC A;  4I7B A;  4N4F A;  3U5O A;  4GB0 A;  2LGK A;  5TRB A;  5KH3 A;  2KR4 A;  5C11 A;  1WES A;  3PHD A;  4P5O B;  3SOX A;  2L0B A;  3MHS A;  3L1Z B;  5B76 A;  4PTB A;  2H0D A;  2EA6 A;  2QJ0 A;  2K16 A;  2KE1 A;  2AN6 A;  2F42 A;  2JMJ A;  4QF2 A;  4O64 A;  3HCU A;  3GV4 A;  5I3L A;  5KH7 A;  2EGP A;  4LK9 A;  1WE9 A;  3MHH A;  4YAX A;  4YAD A;  4A4B A;  2MIQ A;  5EYA F;  2RI7 A;  2L80 A;  2KFT A;  2M85 A;  4CCG X;  3NG2 A;  3LQI A;  2MD8 C;  3KV6 A;  3N9M A;  5B75 A;  3O7A A;  2LGL A;  2LN0 A;  2YSJ A;  2IDA A;  5H1V A;  2M3H A;  4LJN A;  3N9P A;  2VPB A;  3HTK C;  3KNV A;  2ECW A;  4ZQL A;  2MA6 A;  2FUU A;  5TBN A;  3U5M A;  4W4U A;  2MT5 A;  4LLB A;  3ZNI A;  2KU3 A;  4LAD B;  2LRI C;  2ZET C;  5DKA A;  4YBS A;  2KYU A;  2M1R A;  2M6M A;  3C6W A;  3O70 A;  2CSZ A;  3IHP A;  2VNF A;  3FL2 A;  2ECI A;  3I2D A;  2C2L A;  4TKP B;  2KGI A;  4PPE A;  1V87 A;  1WEP A;  3ZPV 1;  2VPG A;  2XEU A;  4IC3 A;  3KV5 A;  4GNG A;  5KH9 A;  4FIP A;  2G6Q A;  3N9Q A;  2YRE A;  1WEM A;  2YSM A;  4NN2 A;  4AYC A;  5H1T A;  1WIL A;  5LKX A;  3M62 A;  4GNE A;  1MM2 A;  1WEQ A;  3M63 A;  2MA5 A;  2YHN A;  2VJF B;  2JMI A;  3M99 A;  4AP4 A;  5FB1 A;  3SHB A;  2L75 A;  4YC9 A;  2YUC A;  2KWJ A;  3N9O A;  4N3W A;  1T1H A;  1JM7 B;  4BHW A;  4I7D A;  3T6R A;  5D1M B;  2YUR A;  2L43 A;  1WEV A;  2YT5 A;  2QIZ A;  1XWH A;  5JG6 A;  2C2V S;  2CKL B;  2XB1 A;  5FER A;  1VFY A;  2KRE A;  3ZVY A;  1N87 A;  4UI9 B;  4IC2 A;  4YBM A;  4WZ3 B;  1WIM A;  5J3X A;  2G43 A;  4S3O B;  5AIU A;  3V43 A;  5B8D A;  2K4D A;  3SOU A;  1VD4 A;  1ZBD B;  3T7L A;  4YAB A;  4AUQ B;  1U6G B;  3EB6 A;  4BBQ A;  5LKZ A;  4UP0 A;  2Y1M A;  1Z2Q A;  4A0C D;  2E6R A;  3L11 A;  3N9N A;  2KIZ A;  3PUR A;  2NAA A;  3RTR B;  2YU4 A;  4WZ2 A;  1WGM A;  2ECG A;  1MM3 A;  4FO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...