1BORA

Transcription factor pml, a proto-oncoprotein, nmr, 1 representative structure at ph 7.5, 30 c, in the presence of zinc
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
EEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the RING finger domain from the acute promyelocytic leukaemia proto-oncoprotein PML.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription regulation
molecule keywords TRANSCRIPTION FACTOR PML
total genus 4
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1995-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1borA00
4N3WA 1WIMA 1U6GB 2L0BA 2I50A 3PUQA 2HYED 2KFTA 5KH3A 2CT2A 1HYIA 1WEQA 1Z6UA 1X4IA 4LLBA 2VJFB 2K17A 4FIPA 2MT5A 1WEPA 4YABA 1JM7A 2G43A 2Y1NA 3RPGC 1IYMA 4A4BA 3L1ZB 2IDAA 2KREA 4AP4A 1X4UA 2KU3A 1F62A 2YYRA 1JOCA 2PUYA 2NAAA 2VJFA 3HCUA 2LV9A 2LGKA 1N87A 2AN6A 4WZ0A 2C2VS 2ECTA 5B75A 1K2FA 4I7DA 2K4DA 4MVTA 3L1XA 4MSXA 2MD8C 2YQLA 5D1MB 4UP5A 2EGPA 1HYJA 5FEYA 2ZETC 4ZUXU 2YHOA 3GL6A 3RPGB 3M63A 2L5UA 2VPGA 4A49A 3ZPVE 3O34A 2H0DA 3N9LA 3I2DA 3MHSA 3N9NA 2ECGA 2G45A 2HDPA 3QZVA 5C13A 5TABA 2MA5A 5LKXA 3O37A 4WZ2A 5B78A 3KV6A 3C5KA 4L7XA 3PURA 1WE9A 4C9ZA 5LKZA 2CSZA 4GNGA 1LDJB 5FERA 2LGLA 5D1KB 4GNFA 1WENA 1WEVA 5G04B 4B86C 3SOWA 2ECVA 2K1JA 2MA6A 2YURA 1CHCA 3O35A 3O7AA 4X3GA 4BHWA 2LDRA 2CKLA 2L43A 4AYCA 2VNFA 2K16A 1JM7B 3ZNIA 3PHDA 4FJCA 5G05B 4YAXA 1WEMA 1WGMA 1WEUA 3N9PA 3U5NA 4AUQB 2KYUA 5TDWA 3LQHA 2KIZA 1XWHA 4UI9B 2JMJA 3ZYQA 3ASLA 4IC3A 2VP7A 5LKUA 4TKPB 4CA1A 2MNZA 4NN2A 2F42A 4I7BA 4YADA 1LDKC 2M85A 5H1VA 2LGVA 2EODA 2CSYA 3MHHA 3N9OA 2JRJA 2MNYA 2F6JA 3IHPA 2ECIA 3KQIA 2CKLB 4V3LC 4AYCB 4S3OC 2L80A 1VFYA 5D1LB 5LKTA 2VPBA 4O64A 3ZTGA 2ECWA 1VD4A 5FB0A 5B79A 2KGGA 4QF2A 2YU4A 5DINA 1WEWA 2FUUA 2YREA 1RMDA 2E6RA 4W4UA 2YQMA 4Q6FA 3DPLR 3ZVZB 2DX8A 2BAYA 3O36A 2VPEA 2KR4A 2JMDA 3O33A 2RI7A 3O70A 2KGIA 5AIUA 3M62A 4P5OB 4R2YA 3HTKC 4A4CA 3LRQA 2YUCA 1E4UA 2FUIA 2LGGA 3ZPV1 1BORA 2Y43A 5H1TA 4FK5A 5H1UA 2XEUA 5DKAA 3SOUA 2M1RA 4YBTA 4S3OB 5TRBA 1WILA 4LADB 5G0FA 2QJ0A 3HCSA 4N4FA 2E6SA 2KWKA 4FO9A 3KV5A 2VPDA 2LN0A 4LKAA 4ZDTA 1WFKA 2YW8A 2F6NA 3KNVA 1MM3A 2KWJA 5KH7A 2KWNA 4YBSA 5B8DA 4GNEA 4XI1A 5KH9A 3EB5A 5LCWB 3VK6A 4L58A 2VJEB 3LQIA 3V43A 2YSMA 3RTRB 2KE1A 3U5PA 2G6QA 2YT5A 4GNDA 2VJEA 1X4JA 1DVPA 1WESA 2FSAA 4WZ3B 1G25A 4IC2A 3U5OA 4YC9A 5JG6A 4R8PK 4QF3A 2LXPC 2YSJA 3T6RA 5H9MA 1FP0A 2H0DB 5C11A 2YHNA 2MIQA 3N9MA 3GV4A 2QIZA 5FB1A 3SHBA 3DQVR 1V87A 2MD7B 2MUMA 4PPEA 4A0CD 3ZVYA 2PNXA 4AVXA 1VYXA 5EYAF 2M3HA 4F52B 2QICA 4V3KC 5TDRA 4BBQA 2ECJA 2C2LA 2Y1MA 2OXQC 3L11A 1T1HA 3SOXA 3FL2A 4R7EA 4YBMA 3NG2A 5J3XA 5B76A 1WEEA 2D8SA 3C6WA 1Z60A 4LK9A 1FBVA 3EB6A 1MM2A 3HCTA 3LQJA 2JMIA 3N9QA 4UP0A 3M99A 2LRIC 2XB1A 3U5MA 4GB0A 2RSDA 2EA6A 4B7YC 4LJNA 4WA6A 2KWOA 4CCGX 1Z2QA 5B77A 4PTBA 3T7LA 2LXHC 5AITA 2L75A 2ECNA 4ZQLA 4I7CA 2M6MA 2UZGA 1ZBDB 2LQ6A 5TBNA 5I3LA 4YATA 1WEOA
chains in the Genus database with same CATH superfamily
4N3WA 1WIMA 1U6GB 2L0BA 2I50A 3PUQA 2HYED 2KFTA 5KH3A 2CT2A 1HYIA 1WEQA 3KDEC 1Z6UA 1X4IA 4LLBA 2VJFB 2K17A 4FIPA 2MT5A 1WEPA 4YABA 1JM7A 2G43A 2Y1NA 3RPGC 1IYMA 4A4BA 3L1ZB 2IDAA 2KREA 4AP4A 2EGMA 1X4UA 2KU3A 1F62A 2YYRA 2XOYA 1JOCA 2PUYA 3Q1DA 2NAAA 2VJFA 3HCUA 2LV9A 5SVIB 2LGKA 1N87A 2AN6A 3LDYA 4WZ0A 2C2VS 4OGCA 2ECTA 5B75A 1K2FA 4I7DA 2K4DA 2KKYA 4MVTA 3E2DA 3L1XA 4MSXA 2L7PA 2MD8C 2YQLA 5D1MB 4UP5A 4H9DA 2EGPA 1HYJA 5FEYA 2ZETC 4ZUXU 2YHOA 3PLWA 2M13A 3GL6A 3M63A 4O62A 2L5UA 3RPGB 2VPGA 4A49A 3ZPVE 3O34A 2H0DA 2DSMA 3N9LA 3I2DA 3MHSA 3N9NA 2ECGA 2G45A 2HDPA 3QZVA 5C13A 5TABA 2MA5A 5LKXA 3O37A 4WZ2A 5B78A 3KV6A 3C5KA 4L7XA 3PURA 1WE9A 3MDBC 4C9ZA 2CSZA 5LKZA 4GNGA 1LDJB 5FERA 2LGLA 5D1KB 4GNFA 1WENA 1WEVA 5G04B 4B86C 3SOWA 2ECVA 2K1JA 4Z0RA 2MA6A 2YURA 1CHCA 3O35A 3O7AA 4X3GA 4BHWA 2LDRA 2CKLA 2L43A 4AYCA 2VNFA 2XP0A 3FJUB 2K16A 1JM7B 3ZNIA 3PHDA 4FJCA 5G05B 4YAXA 1WEMA 1WGMA 1WEUA 3N9PA 3U5NA 4AUQB 2KYUA 5TDWA 3LQHA 2KIZA 1XWHA 4UI9B 2MKEA 2OWAA 2JMJA 3ZYQA 3O47A 3ASLA 4IC3A 2VP7A 5LKUA 4TKPB 4CA1A 2MNZA 4NN2A 2F42A 4I7BA 4YADA 1LDKC 2M85A 5H1VA 2LGVA 2EODA 2CSYA 3MHHA 3N9OA 2JRJA 2MNYA 2F6JA 3IHPA 2ECIA 3KQIA 4V3LC 2CKLB 4AYCB 4OGEA 4S3OC 2L80A 1VFYA 5D1LB 5LKTA 2VPBA 4O64A 3ZTGA 5SVXA 2ECWA 1VD4A 5FB0A 5B79A 2KGGA 4QF2A 2YU4A 5DINA 1WEWA 2FUUA 3LJUX 2YREA 2JM3A 1RMDA 2E6RA 4W4UA 2YQMA 4QQ4A 4Q6FA 3DPLR 3ZVZB 2DX8A 2BAYA 3O36A 2VPEA 2KR4A 3LVQE 2JMDA 3O33A 2E61A 2RI7A 2P57A 3O70A 2KGIA 2LAUA 5AIUA 3M62A 4P5OB 4R2YA 3FM8C 3HTKC 4A4CA 3LRQA 2YUCA 1E4UA 2FUIA 2LGGA 3FANA 3ZPV1 1BORA 2IQJA 3LVRE 2Y43A 5H1TA 4FK5A 2FFWA 5H1UA 2XEUA 3FAOA 5DKAA 3SOUA 2M1RA 4YBTA 4S3OB 5TRBA 1WILA 4LADB 5G0FA 2QJ0A 5SVYA 3HCSA 4N4FA 2DJAA 2E6SA 2D8UA 2KWKA 3M7KA 4FO9A 3KV5A 2VPDA 2LN0A 4LKAA 4ZDTA 1WFKA 2YW8A 2F6NA 3KNVA 1MM3A 2KWJA 5KH7A 2KWNA 4YBSA 5B8DA 4GNEA 4XI1A 1MBMA 5K3QA 3H7HA 5KH9A 3EB5A 5LCWB 3VK6A 4L58A 2VJEB 3LQIA 3V43A 2YSMA 3DDTA 3RTRB 2CSVA 2KE1A 3U5PA 2G6QA 2XOCA 2YT5A 4GNDA 2VJEA 1X4JA 1DVPA 3T9KA 1WESA 2FSAA 3JUEA 4WZ3B 1G25A 4IC2A 3U5OA 2XOZA 4YC9A 5JG6A 4R8PK 4QF3A 2LXPC 2YSJA 3T6RA 5H9MA 1FP0A 2H0DB 5C11A 2YHNA 2MIQA 3N9MA 3DWDA 3GV4A 2QIZA 5FB1A 3SHBA 3DQVR 1V87A 2MD7B 2MUMA 4PPEA 4A0CD 3ZVYA 2PNXA 4AVXA 1VYXA 2CONA 5EYAF 2M3HA 4F52B 2QICA 4V3KC 5TDRA 4BBQA 2ECJA 2C2LA 2Y1MA 2RR4A 2OXQC 3L11A 1T1HA 3SOXA 3FL2A 4R7EA 4YBMA 2B0OE 3SUBA 3NG2A 5J3XA 5B76A 1WEEA 4Z0OA 2D8SA 3C6WA 1Z60A 4LK9A 1FBVA 1DCQA 3FEHA 3EB6A 1MM2A 3HCTA 3LQJA 2CRRA 2JMIA 3N9QA 4UP0A 3M99A 2LRIC 2EXUA 2XB1A 3U5MA 4GB0A 2RSDA 2EA6A 4LJNA 4WA6A 4B7YC 2KWOA 4CCGX 2KKXA 1Z2QA 5B77A 4PTBA 3T7LA 2FD4A 2LXHC 5AITA 2L75A 4F1PA 2ECNA 4ZQLA 4I7CA 2M6MA 2UZGA 1ZBDB 2LQ6A 2JUNA 5SVIA 2YVRA 5TBNA 5I3LA 2CRWA 4YATA 1WEOA
chains in the Genus database with same CATH topology
4N3WA 1WIMA 1U6GB 2L0BA 2I50A 3PUQA 2HYED 2KFTA 5KH3A 2CT2A 1HYIA 1WEQA 1Z6UA 1X4IA 4LLBA 2VJFB 2K17A 4FIPA 2MT5A 1WEPA 4YABA 1JM7A 2G43A 2Y1NA 3RPGC 1IYMA 4A4BA 3L1ZB 2IDAA 2KREA 4AP4A 1X4UA 2KU3A 1F62A 2YYRA 1JOCA 2PUYA 2NAAA 2VJFA 3HCUA 2LV9A 2LGKA 1N87A 2AN6A 4WZ0A 2C2VS 2ECTA 5B75A 1K2FA 4I7DA 2K4DA 4MVTA 3L1XA 4MSXA 2MD8C 2YQLA 5D1MB 4UP5A 2EGPA 1HYJA 5FEYA 2ZETC 4ZUXU 2YHOA 3GL6A 3RPGB 3M63A 2L5UA 2VPGA 4A49A 3ZPVE 3O34A 2H0DA 3N9LA 3I2DA 3MHSA 3N9NA 2ECGA 2G45A 2HDPA 3QZVA 5C13A 5TABA 2MA5A 5LKXA 3O37A 4WZ2A 5B78A 3KV6A 3C5KA 4L7XA 3PURA 1WE9A 4C9ZA 5LKZA 2CSZA 4GNGA 1LDJB 5FERA 2LGLA 5D1KB 4GNFA 1WENA 1WEVA 5G04B 4B86C 3SOWA 2ECVA 2K1JA 2MA6A 2YURA 1CHCA 3O35A 3O7AA 4X3GA 4BHWA 2LDRA 2CKLA 2L43A 4AYCA 2VNFA 2K16A 1JM7B 3ZNIA 3PHDA 4FJCA 5G05B 4YAXA 1WEMA 1WGMA 1WEUA 3N9PA 3U5NA 4AUQB 2KYUA 5TDWA 3LQHA 2KIZA 1XWHA 4UI9B 2JMJA 3ZYQA 3ASLA 4IC3A 2VP7A 5LKUA 4TKPB 4CA1A 2MNZA 4NN2A 2F42A 4I7BA 4YADA 1LDKC 2M85A 5H1VA 2LGVA 2EODA 2CSYA 3MHHA 3N9OA 2JRJA 2MNYA 2F6JA 3IHPA 2ECIA 3KQIA 2CKLB 4V3LC 4AYCB 4S3OC 2L80A 1VFYA 5D1LB 5LKTA 2VPBA 4O64A 3ZTGA 2ECWA 1VD4A 5FB0A 5B79A 2KGGA 4QF2A 2YU4A 5DINA 1WEWA 2FUUA 2YREA 1RMDA 2E6RA 4W4UA 2YQMA 4Q6FA 3DPLR 3ZVZB 2DX8A 2BAYA 3O36A 2VPEA 2KR4A 2JMDA 3O33A 2RI7A 3O70A 2KGIA 5AIUA 3M62A 4P5OB 4R2YA 3HTKC 4A4CA 3LRQA 2YUCA 1E4UA 2FUIA 2LGGA 3ZPV1 1BORA 2Y43A 5H1TA 4FK5A 5H1UA 2XEUA 5DKAA 3SOUA 2M1RA 4YBTA 4S3OB 5TRBA 1WILA 4LADB 5G0FA 2QJ0A 3HCSA 4N4FA 2E6SA 2KWKA 4FO9A 3KV5A 2VPDA 2LN0A 4LKAA 4ZDTA 1WFKA 2YW8A 2F6NA 3KNVA 1MM3A 2KWJA 5KH7A 2KWNA 4YBSA 5B8DA 4GNEA 4XI1A 5KH9A 3EB5A 5LCWB 3VK6A 4L58A 2VJEB 3LQIA 3V43A 2YSMA 3RTRB 2KE1A 3U5PA 2G6QA 2YT5A 4GNDA 2VJEA 1X4JA 1DVPA 1WESA 2FSAA 4WZ3B 1G25A 4IC2A 3U5OA 4YC9A 5JG6A 4R8PK 4QF3A 2LXPC 2YSJA 3T6RA 5H9MA 1FP0A 2H0DB 5C11A 2YHNA 2MIQA 3N9MA 3GV4A 2QIZA 5FB1A 3SHBA 3DQVR 1V87A 2MD7B 2MUMA 4PPEA 4A0CD 3ZVYA 2PNXA 4AVXA 1VYXA 5EYAF 2M3HA 4F52B 2QICA 4V3KC 5TDRA 4BBQA 2ECJA 2C2LA 2Y1MA 2OXQC 3L11A 1T1HA 3SOXA 3FL2A 4R7EA 4YBMA 3NG2A 5J3XA 5B76A 1WEEA 2D8SA 3C6WA 1Z60A 4LK9A 1FBVA 3EB6A 1MM2A 3HCTA 3LQJA 2JMIA 3N9QA 4UP0A 3M99A 2LRIC 2XB1A 3U5MA 4GB0A 2RSDA 2EA6A 4B7YC 4LJNA 4WA6A 2KWOA 4CCGX 1Z2QA 5B77A 4PTBA 3T7LA 2LXHC 5AITA 2L75A 2ECNA 4ZQLA 4I7CA 2M6MA 2UZGA 1ZBDB 2LQ6A 5TBNA 5I3LA 4YATA 1WEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N3W A;  1WIM A;  1U6G B;  2L0B A;  2I50 A;  3PUQ A;  2HYE D;  2KFT A;  5KH3 A;  2CT2 A;  1HYI A;  1WEQ A;  1Z6U A;  1X4I A;  4LLB A;  2VJF B;  2K17 A;  4FIP A;  2MT5 A;  1WEP A;  4YAB A;  1JM7 A;  2G43 A;  2Y1N A;  3RPG C;  1IYM A;  4A4B A;  3L1Z B;  2IDA A;  2KRE A;  4AP4 A;  1X4U A;  2KU3 A;  1F62 A;  2YYR A;  1JOC A;  2PUY A;  2NAA A;  2VJF A;  3HCU A;  2LV9 A;  2LGK A;  1N87 A;  2AN6 A;  4WZ0 A;  2C2V S;  2ECT A;  5B75 A;  1K2F A;  4I7D A;  2K4D A;  4MVT A;  3L1X A;  4MSX A;  2MD8 C;  2YQL A;  5D1M B;  4UP5 A;  2EGP A;  1HYJ A;  5FEY A;  2ZET C;  4ZUX U;  2YHO A;  3GL6 A;  3RPG B;  3M63 A;  2L5U A;  2VPG A;  4A49 A;  3ZPV E;  3O34 A;  2H0D A;  3N9L A;  3I2D A;  3MHS A;  3N9N A;  2ECG A;  2G45 A;  2HDP A;  3QZV A;  5C13 A;  5TAB A;  2MA5 A;  5LKX A;  3O37 A;  4WZ2 A;  5B78 A;  3KV6 A;  3C5K A;  4L7X A;  3PUR A;  1WE9 A;  4C9Z A;  5LKZ A;  2CSZ A;  4GNG A;  1LDJ B;  5FER A;  2LGL A;  5D1K B;  4GNF A;  1WEN A;  1WEV A;  5G04 B;  4B86 C;  3SOW A;  2ECV A;  2K1J A;  2MA6 A;  2YUR A;  1CHC A;  3O35 A;  3O7A A;  4X3G A;  4BHW A;  2LDR A;  2CKL A;  2L43 A;  4AYC A;  2VNF A;  2K16 A;  1JM7 B;  3ZNI A;  3PHD A;  4FJC A;  5G05 B;  4YAX A;  1WEM A;  1WGM A;  1WEU A;  3N9P A;  3U5N A;  4AUQ B;  2KYU A;  5TDW A;  3LQH A;  2KIZ A;  1XWH A;  4UI9 B;  2JMJ A;  3ZYQ A;  3ASL A;  4IC3 A;  2VP7 A;  5LKU A;  4TKP B;  4CA1 A;  2MNZ A;  4NN2 A;  2F42 A;  4I7B A;  4YAD A;  1LDK C;  2M85 A;  5H1V A;  2LGV A;  2EOD A;  2CSY A;  3MHH A;  3N9O A;  2JRJ A;  2MNY A;  2F6J A;  3IHP A;  2ECI A;  3KQI A;  2CKL B;  4V3L C;  4AYC B;  4S3O C;  2L80 A;  1VFY A;  5D1L B;  5LKT A;  2VPB A;  4O64 A;  3ZTG A;  2ECW A;  1VD4 A;  5FB0 A;  5B79 A;  2KGG A;  4QF2 A;  2YU4 A;  5DIN A;  1WEW A;  2FUU A;  2YRE A;  1RMD A;  2E6R A;  4W4U A;  2YQM A;  4Q6F A;  3DPL R;  3ZVZ B;  2DX8 A;  2BAY A;  3O36 A;  2VPE A;  2KR4 A;  2JMD A;  3O33 A;  2RI7 A;  3O70 A;  2KGI A;  5AIU A;  3M62 A;  4P5O B;  4R2Y A;  3HTK C;  4A4C A;  3LRQ A;  2YUC A;  1E4U A;  2FUI A;  2LGG A;  3ZPV 1;  1BOR A;  2Y43 A;  5H1T A;  4FK5 A;  5H1U A;  2XEU A;  5DKA A;  3SOU A;  2M1R A;  4YBT A;  4S3O B;  5TRB A;  1WIL A;  4LAD B;  5G0F A;  2QJ0 A;  3HCS A;  4N4F A;  2E6S A;  2KWK A;  4FO9 A;  3KV5 A;  2VPD A;  2LN0 A;  4LKA A;  4ZDT A;  1WFK A;  2YW8 A;  2F6N A;  3KNV A;  1MM3 A;  2KWJ A;  5KH7 A;  2KWN A;  4YBS A;  5B8D A;  4GNE A;  4XI1 A;  5KH9 A;  3EB5 A;  5LCW B;  3VK6 A;  4L58 A;  2VJE B;  3LQI A;  3V43 A;  2YSM A;  3RTR B;  2KE1 A;  3U5P A;  2G6Q A;  2YT5 A;  4GND A;  2VJE A;  1X4J A;  1DVP A;  1WES A;  2FSA A;  4WZ3 B;  1G25 A;  4IC2 A;  3U5O A;  4YC9 A;  5JG6 A;  4R8P K;  4QF3 A;  2LXP C;  2YSJ A;  3T6R A;  5H9M A;  1FP0 A;  2H0D B;  5C11 A;  2YHN A;  2MIQ A;  3N9M A;  3GV4 A;  2QIZ A;  5FB1 A;  3SHB A;  3DQV R;  1V87 A;  2MD7 B;  2MUM A;  4PPE A;  4A0C D;  3ZVY A;  2PNX A;  4AVX A;  1VYX A;  5EYA F;  2M3H A;  4F52 B;  2QIC A;  4V3K C;  5TDR A;  4BBQ A;  2ECJ A;  2C2L A;  2Y1M A;  2OXQ C;  3L11 A;  1T1H A;  3SOX A;  3FL2 A;  4R7E A;  4YBM A;  3NG2 A;  5J3X A;  5B76 A;  1WEE A;  2D8S A;  3C6W A;  1Z60 A;  4LK9 A;  1FBV A;  3EB6 A;  1MM2 A;  3HCT A;  3LQJ A;  2JMI A;  3N9Q A;  4UP0 A;  3M99 A;  2LRI C;  2XB1 A;  3U5M A;  4GB0 A;  2RSD A;  2EA6 A;  4B7Y C;  4LJN A;  4WA6 A;  2KWO A;  4CCG X;  1Z2Q A;  5B77 A;  4PTB A;  3T7L A;  2LXH C;  5AIT A;  2L75 A;  2ECN A;  4ZQL A;  4I7C A;  2M6M A;  2UZG A;  1ZBD B;  2LQ6 A;  5TBN A;  5I3L A;  4YAT A;  1WEO A; 
#chains in the Genus database with same CATH topology
 4N3W A;  1WIM A;  1U6G B;  2L0B A;  2I50 A;  3PUQ A;  2HYE D;  2KFT A;  5KH3 A;  2CT2 A;  1HYI A;  1WEQ A;  3KDE C;  1Z6U A;  1X4I A;  4LLB A;  2VJF B;  2K17 A;  4FIP A;  2MT5 A;  1WEP A;  4YAB A;  1JM7 A;  2G43 A;  2Y1N A;  3RPG C;  1IYM A;  4A4B A;  3L1Z B;  2IDA A;  2KRE A;  4AP4 A;  2EGM A;  1X4U A;  2KU3 A;  1F62 A;  2YYR A;  2XOY A;  1JOC A;  2PUY A;  3Q1D A;  2NAA A;  2VJF A;  3HCU A;  2LV9 A;  5SVI B;  2LGK A;  1N87 A;  2AN6 A;  3LDY A;  4WZ0 A;  2C2V S;  4OGC A;  2ECT A;  5B75 A;  1K2F A;  4I7D A;  2K4D A;  2KKY A;  4MVT A;  3E2D A;  3L1X A;  4MSX A;  2L7P A;  2MD8 C;  2YQL A;  5D1M B;  4UP5 A;  4H9D A;  2EGP A;  1HYJ A;  5FEY A;  2ZET C;  4ZUX U;  2YHO A;  3PLW A;  2M13 A;  3GL6 A;  3M63 A;  4O62 A;  2L5U A;  3RPG B;  2VPG A;  4A49 A;  3ZPV E;  3O34 A;  2H0D A;  2DSM A;  3N9L A;  3I2D A;  3MHS A;  3N9N A;  2ECG A;  2G45 A;  2HDP A;  3QZV A;  5C13 A;  5TAB A;  2MA5 A;  5LKX A;  3O37 A;  4WZ2 A;  5B78 A;  3KV6 A;  3C5K A;  4L7X A;  3PUR A;  1WE9 A;  3MDB C;  4C9Z A;  2CSZ A;  5LKZ A;  4GNG A;  1LDJ B;  5FER A;  2LGL A;  5D1K B;  4GNF A;  1WEN A;  1WEV A;  5G04 B;  4B86 C;  3SOW A;  2ECV A;  2K1J A;  4Z0R A;  2MA6 A;  2YUR A;  1CHC A;  3O35 A;  3O7A A;  4X3G A;  4BHW A;  2LDR A;  2CKL A;  2L43 A;  4AYC A;  2VNF A;  2XP0 A;  3FJU B;  2K16 A;  1JM7 B;  3ZNI A;  3PHD A;  4FJC A;  5G05 B;  4YAX A;  1WEM A;  1WGM A;  1WEU A;  3N9P A;  3U5N A;  4AUQ B;  2KYU A;  5TDW A;  3LQH A;  2KIZ A;  1XWH A;  4UI9 B;  2MKE A;  2OWA A;  2JMJ A;  3ZYQ A;  3O47 A;  3ASL A;  4IC3 A;  2VP7 A;  5LKU A;  4TKP B;  4CA1 A;  2MNZ A;  4NN2 A;  2F42 A;  4I7B A;  4YAD A;  1LDK C;  2M85 A;  5H1V A;  2LGV A;  2EOD A;  2CSY A;  3MHH A;  3N9O A;  2JRJ A;  2MNY A;  2F6J A;  3IHP A;  2ECI A;  3KQI A;  4V3L C;  2CKL B;  4AYC B;  4OGE A;  4S3O C;  2L80 A;  1VFY A;  5D1L B;  5LKT A;  2VPB A;  4O64 A;  3ZTG A;  5SVX A;  2ECW A;  1VD4 A;  5FB0 A;  5B79 A;  2KGG A;  4QF2 A;  2YU4 A;  5DIN A;  1WEW A;  2FUU A;  3LJU X;  2YRE A;  2JM3 A;  1RMD A;  2E6R A;  4W4U A;  2YQM A;  4QQ4 A;  4Q6F A;  3DPL R;  3ZVZ B;  2DX8 A;  2BAY A;  3O36 A;  2VPE A;  2KR4 A;  3LVQ E;  2JMD A;  3O33 A;  2E61 A;  2RI7 A;  2P57 A;  3O70 A;  2KGI A;  2LAU A;  5AIU A;  3M62 A;  4P5O B;  4R2Y A;  3FM8 C;  3HTK C;  4A4C A;  3LRQ A;  2YUC A;  1E4U A;  2FUI A;  2LGG A;  3FAN A;  3ZPV 1;  1BOR A;  2IQJ A;  3LVR E;  2Y43 A;  5H1T A;  4FK5 A;  2FFW A;  5H1U A;  2XEU A;  3FAO A;  5DKA A;  3SOU A;  2M1R A;  4YBT A;  4S3O B;  5TRB A;  1WIL A;  4LAD B;  5G0F A;  2QJ0 A;  5SVY A;  3HCS A;  4N4F A;  2DJA A;  2E6S A;  2D8U A;  2KWK A;  3M7K A;  4FO9 A;  3KV5 A;  2VPD A;  2LN0 A;  4LKA A;  4ZDT A;  1WFK A;  2YW8 A;  2F6N A;  3KNV A;  1MM3 A;  2KWJ A;  5KH7 A;  2KWN A;  4YBS A;  5B8D A;  4GNE A;  4XI1 A;  1MBM A;  5K3Q A;  3H7H A;  5KH9 A;  3EB5 A;  5LCW B;  3VK6 A;  4L58 A;  2VJE B;  3LQI A;  3V43 A;  2YSM A;  3DDT A;  3RTR B;  2CSV A;  2KE1 A;  3U5P A;  2G6Q A;  2XOC A;  2YT5 A;  4GND A;  2VJE A;  1X4J A;  1DVP A;  3T9K A;  1WES A;  2FSA A;  3JUE A;  4WZ3 B;  1G25 A;  4IC2 A;  3U5O A;  2XOZ A;  4YC9 A;  5JG6 A;  4R8P K;  4QF3 A;  2LXP C;  2YSJ A;  3T6R A;  5H9M A;  1FP0 A;  2H0D B;  5C11 A;  2YHN A;  2MIQ A;  3N9M A;  3DWD A;  3GV4 A;  2QIZ A;  5FB1 A;  3SHB A;  3DQV R;  1V87 A;  2MD7 B;  2MUM A;  4PPE A;  4A0C D;  3ZVY A;  2PNX A;  4AVX A;  1VYX A;  2CON A;  5EYA F;  2M3H A;  4F52 B;  2QIC A;  4V3K C;  5TDR A;  4BBQ A;  2ECJ A;  2C2L A;  2Y1M A;  2RR4 A;  2OXQ C;  3L11 A;  1T1H A;  3SOX A;  3FL2 A;  4R7E A;  4YBM A;  2B0O E;  3SUB A;  3NG2 A;  5J3X A;  5B76 A;  1WEE A;  4Z0O A;  2D8S A;  3C6W A;  1Z60 A;  4LK9 A;  1FBV A;  1DCQ A;  3FEH A;  3EB6 A;  1MM2 A;  3HCT A;  3LQJ A;  2CRR A;  2JMI A;  3N9Q A;  4UP0 A;  3M99 A;  2LRI C;  2EXU A;  2XB1 A;  3U5M A;  4GB0 A;  2RSD A;  2EA6 A;  4LJN A;  4WA6 A;  4B7Y C;  2KWO A;  4CCG X;  2KKX A;  1Z2Q A;  5B77 A;  4PTB A;  3T7L A;  2FD4 A;  2LXH C;  5AIT A;  2L75 A;  4F1P A;  2ECN A;  4ZQL A;  4I7C A;  2M6M A;  2UZG A;  1ZBD B;  2LQ6 A;  2JUN A;  5SVI A;  2YVR A;  5TBN A;  5I3L A;  2CRW A;  4YAT A;  1WEO A; 
#chains in the Genus database with same CATH homology
 4N3W A;  1WIM A;  1U6G B;  2L0B A;  2I50 A;  3PUQ A;  2HYE D;  2KFT A;  5KH3 A;  2CT2 A;  1HYI A;  1WEQ A;  1Z6U A;  1X4I A;  4LLB A;  2VJF B;  2K17 A;  4FIP A;  2MT5 A;  1WEP A;  4YAB A;  1JM7 A;  2G43 A;  2Y1N A;  3RPG C;  1IYM A;  4A4B A;  3L1Z B;  2IDA A;  2KRE A;  4AP4 A;  1X4U A;  2KU3 A;  1F62 A;  2YYR A;  1JOC A;  2PUY A;  2NAA A;  2VJF A;  3HCU A;  2LV9 A;  2LGK A;  1N87 A;  2AN6 A;  4WZ0 A;  2C2V S;  2ECT A;  5B75 A;  1K2F A;  4I7D A;  2K4D A;  4MVT A;  3L1X A;  4MSX A;  2MD8 C;  2YQL A;  5D1M B;  4UP5 A;  2EGP A;  1HYJ A;  5FEY A;  2ZET C;  4ZUX U;  2YHO A;  3GL6 A;  3RPG B;  3M63 A;  2L5U A;  2VPG A;  4A49 A;  3ZPV E;  3O34 A;  2H0D A;  3N9L A;  3I2D A;  3MHS A;  3N9N A;  2ECG A;  2G45 A;  2HDP A;  3QZV A;  5C13 A;  5TAB A;  2MA5 A;  5LKX A;  3O37 A;  4WZ2 A;  5B78 A;  3KV6 A;  3C5K A;  4L7X A;  3PUR A;  1WE9 A;  4C9Z A;  5LKZ A;  2CSZ A;  4GNG A;  1LDJ B;  5FER A;  2LGL A;  5D1K B;  4GNF A;  1WEN A;  1WEV A;  5G04 B;  4B86 C;  3SOW A;  2ECV A;  2K1J A;  2MA6 A;  2YUR A;  1CHC A;  3O35 A;  3O7A A;  4X3G A;  4BHW A;  2LDR A;  2CKL A;  2L43 A;  4AYC A;  2VNF A;  2K16 A;  1JM7 B;  3ZNI A;  3PHD A;  4FJC A;  5G05 B;  4YAX A;  1WEM A;  1WGM A;  1WEU A;  3N9P A;  3U5N A;  4AUQ B;  2KYU A;  5TDW A;  3LQH A;  2KIZ A;  1XWH A;  4UI9 B;  2JMJ A;  3ZYQ A;  3ASL A;  4IC3 A;  2VP7 A;  5LKU A;  4TKP B;  4CA1 A;  2MNZ A;  4NN2 A;  2F42 A;  4I7B A;  4YAD A;  1LDK C;  2M85 A;  5H1V A;  2LGV A;  2EOD A;  2CSY A;  3MHH A;  3N9O A;  2JRJ A;  2MNY A;  2F6J A;  3IHP A;  2ECI A;  3KQI A;  2CKL B;  4V3L C;  4AYC B;  4S3O C;  2L80 A;  1VFY A;  5D1L B;  5LKT A;  2VPB A;  4O64 A;  3ZTG A;  2ECW A;  1VD4 A;  5FB0 A;  5B79 A;  2KGG A;  4QF2 A;  2YU4 A;  5DIN A;  1WEW A;  2FUU A;  2YRE A;  1RMD A;  2E6R A;  4W4U A;  2YQM A;  4Q6F A;  3DPL R;  3ZVZ B;  2DX8 A;  2BAY A;  3O36 A;  2VPE A;  2KR4 A;  2JMD A;  3O33 A;  2RI7 A;  3O70 A;  2KGI A;  5AIU A;  3M62 A;  4P5O B;  4R2Y A;  3HTK C;  4A4C A;  3LRQ A;  2YUC A;  1E4U A;  2FUI A;  2LGG A;  3ZPV 1;  1BOR A;  2Y43 A;  5H1T A;  4FK5 A;  5H1U A;  2XEU A;  5DKA A;  3SOU A;  2M1R A;  4YBT A;  4S3O B;  5TRB A;  1WIL A;  4LAD B;  5G0F A;  2QJ0 A;  3HCS A;  4N4F A;  2E6S A;  2KWK A;  4FO9 A;  3KV5 A;  2VPD A;  2LN0 A;  4LKA A;  4ZDT A;  1WFK A;  2YW8 A;  2F6N A;  3KNV A;  1MM3 A;  2KWJ A;  5KH7 A;  2KWN A;  4YBS A;  5B8D A;  4GNE A;  4XI1 A;  5KH9 A;  3EB5 A;  5LCW B;  3VK6 A;  4L58 A;  2VJE B;  3LQI A;  3V43 A;  2YSM A;  3RTR B;  2KE1 A;  3U5P A;  2G6Q A;  2YT5 A;  4GND A;  2VJE A;  1X4J A;  1DVP A;  1WES A;  2FSA A;  4WZ3 B;  1G25 A;  4IC2 A;  3U5O A;  4YC9 A;  5JG6 A;  4R8P K;  4QF3 A;  2LXP C;  2YSJ A;  3T6R A;  5H9M A;  1FP0 A;  2H0D B;  5C11 A;  2YHN A;  2MIQ A;  3N9M A;  3GV4 A;  2QIZ A;  5FB1 A;  3SHB A;  3DQV R;  1V87 A;  2MD7 B;  2MUM A;  4PPE A;  4A0C D;  3ZVY A;  2PNX A;  4AVX A;  1VYX A;  5EYA F;  2M3H A;  4F52 B;  2QIC A;  4V3K C;  5TDR A;  4BBQ A;  2ECJ A;  2C2L A;  2Y1M A;  2OXQ C;  3L11 A;  1T1H A;  3SOX A;  3FL2 A;  4R7E A;  4YBM A;  3NG2 A;  5J3X A;  5B76 A;  1WEE A;  2D8S A;  3C6W A;  1Z60 A;  4LK9 A;  1FBV A;  3EB6 A;  1MM2 A;  3HCT A;  3LQJ A;  2JMI A;  3N9Q A;  4UP0 A;  3M99 A;  2LRI C;  2XB1 A;  3U5M A;  4GB0 A;  2RSD A;  2EA6 A;  4B7Y C;  4LJN A;  4WA6 A;  2KWO A;  4CCG X;  1Z2Q A;  5B77 A;  4PTB A;  3T7L A;  2LXH C;  5AIT A;  2L75 A;  2ECN A;  4ZQL A;  4I7C A;  2M6M A;  2UZG A;  1ZBD B;  2LQ6 A;  5TBN A;  5I3L A;  4YAT A;  1WEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...