1BORA

Transcription factor pml, a proto-oncoprotein, nmr, 1 representative structure at ph 7.5, 30 c, in the presence of zinc
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
b'EEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION FACTOR PML
publication title The solution structure of the RING finger domain from the acute promyelocytic leukaemia proto-oncoprotein PML.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 4
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1995-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1borA00
1WESA 2EA6A 2C2VS 1IYMA 2MT5A 3EB5A 4B7YC 1U6GB 2YU4A 4YATA 2G45A 4WA6A 4AYCB 3KQIA 4LK9A 2BAYA 2YSJA 2VPDA 1Z6UA 2ECGA 5H1VA 5LKZA 2K16A 3N9MA 5FERA 2HYED 2QIZA 3KV6A 2CKLB 3DQVR 2HDPA 4A49A 2ECWA 3I2DA 2YUCA 1RMDA 2LXHC 2LQ6A 2M3HA 3LQIA 3SOUA 2K4DA 5LCWB 4FIPA 3O70A 4P5OB 2VNFA 4UI9B 2MNZA 4NN2A 1JM7B 2M1RA 2YSMA 3SOWA 3N9OA 2K1JA 4ZQLA 2YHNA 2CSZA 1DVPA 4F52B 2CSYA 5FEYA 4S3OB 3ASLA 2YREA 4FK5A 1F62A 1XWHA 3ZPV1 2OXQC 3HCTA 4Q6FA 4R7EA 3U5OA 2EGPA 3U5PA 3DPLR 4LKAA 2L80A 1WFKA 4MVTA 3L1XA 2VPBA 2VJFA 2KFTA 1WGMA 2Y1MA 4AUQB 5B78A 2ZETC 2F42A 4BHWA 1MM3A 3MHHA 5TRBA 1T1HA 5B77A 3RTRB 4O64A 1WEPA 5EYAF 2ECIA 4LADB 4S3OC 5DKAA 4LJNA 1WEWA 2AN6A 2VPEA 3NG2A 5TBNA 1WEVA 1HYIA 3L1ZB 5H1TA 5LKXA 2E6SA 1JOCA 5B76A 2LRIC 4LLBA 1WEMA 3ZVYA 2KU3A 4AP4A 3QZVA 1VFYA 5D1MB 1CHCA 5G05B 3MHSA 4YBSA 1WEQA 3O7AA 3N9NA 4XI1A 3PUQA 2KYUA 3T7LA 3C5KA 1VD4A 3EB6A 5H1UA 3VK6A 4TKPB 4FO9A 5C13A 2EODA 5KH9A 2VJFB 2F6JA 2YURA 4B86C 1WIMA 3KNVA 2IDAA 4PTBA 2LGGA 5FB1A 4A0CD 2KIZA 4I7DA 1V87A 2LV9A 4L7XA 1X4IA 1WE9A 2YHOA 1BORA 3KV5A 4ZDTA 5TDRA 2XB1A 4CA1A 2KGGA 2QICA 5G0FA 3GV4A 5G04B 2MNYA 4GB0A 4QF2A 5D1KB 2LDRA 4PPEA 2L5UA 2PNXA 2JRJA 3PHDA 2LGKA 3LQHA 4WZ2A 3SOXA 3HCUA 2K17A 4QF3A 5B8DA 5TABA 2C2LA 3GL6A 1WEOA 4R2YA 1E4UA 5FB0A 2YW8A 3ZPVE 4I7CA 3O34A 2KGIA 3O37A 5AITA 2KWNA 2ECJA 1WENA 4AVXA 1WEEA 4A4BA 2VJEA 4BBQA 5LKUA 4YBMA 4UP0A 2I50A 2L0BA 5DINA 4MSXA 4GNFA 2XEUA 2L75A 3ZVZB 3C6WA 2YQLA 4A4CA 1X4UA 4WZ0A 4V3KC 1G25A 2UZGA 1Z60A 2VP7A 2ECVA 4WZ3B 5D1LB 2E6RA 2G43A 1Z2QA 5TDWA 3FL2A 2KWOA 1FP0A 3M63A 3T6RA 3SHBA 3O33A 2LN0A 3N9PA 2ECNA 5KH3A 2LXPC 3ZYQA 4CCGX 2FUUA 5B79A 3LRQA 3ZTGA 4YAXA 4GNEA 1LDJB 2LGLA 3HCSA 2VJEB 2CT2A 4GNDA 2FUIA 3O35A 2KWJA 2YT5A 5LKTA 1WILA 3M62A 4N4FA 2MUMA 1K2FA 2JMIA 2F6NA 2NAAA 2Y1NA 2DX8A 3M99A 2PUYA 2MD7B 2KE1A 1LDKC 2RI7A 4L58A 2MIQA 3RPGB 4W4UA 3U5MA 2Y43A 3O36A 1N87A 5B75A 1HYJA 4C9ZA 2KR4A 2JMDA 4I7BA 2LGVA 2KREA 2M6MA 2H0DA 3IHPA 2MA6A 5JG6A 2QJ0A 4YBTA 4R8PK 2VPGA 1X4JA 3U5NA 2D8SA 3V43A 4AYCA 3N9LA 3N9QA 3L11A 1MM2A 2JMJA 2KWKA 4IC2A 4YABA 4GNGA 5AIUA 2YQMA 4YADA 4FJCA 3LQJA 3ZNIA 2L43A 2CKLA 4X3GA 2MD8C 4ZUXU 3RPGC 3PURA 5KH7A 2YYRA 5J3XA 2M85A 2MA5A 2G6QA 4V3LC 1WEUA 4N3WA 1FBVA 3HTKC 5H9MA 1JM7A 5C11A 4YC9A 4UP5A 5I3LA 4IC3A 2FSAA 2ECTA 1ZBDB 1VYXA 2RSDA 2H0DB
chains in the Genus database with same CATH superfamily
1WESA 2EA6A 2C2VS 1IYMA 2MT5A 3EB5A 4B7YC 1U6GB 2YU4A 4YATA 2G45A 4WA6A 4AYCB 3KQIA 4LK9A 2BAYA 2YSJA 2VPDA 3FJUB 1Z6UA 2ECGA 3E2DA 5H1VA 5LKZA 2K16A 3N9MA 5FERA 3MDBC 2FFWA 2HYED 2QIZA 4O62A 4OGEA 3KV6A 2CKLB 3DQVR 2HDPA 4A49A 2ECWA 3I2DA 2CRWA 2YUCA 1RMDA 2LXHC 2LQ6A 2M3HA 3LQIA 3PLWA 3SOUA 2K4DA 2LAUA 5LCWB 4FIPA 3O70A 4P5OB 4F1PA 3SUBA 2VNFA 4UI9B 2MNZA 4NN2A 1JM7B 2M1RA 2YSMA 3SOWA 3N9OA 2K1JA 4ZQLA 2YHNA 3LJUX 2CSZA 2CSVA 1DVPA 4F52B 3FANA 3O47A 2CSYA 5FEYA 4S3OB 3ASLA 1DCQA 2JUNA 2YREA 4FK5A 1F62A 1XWHA 3ZPV1 5SVXA 2OXQC 3HCTA 4Q6FA 4R7EA 3U5OA 3M7KA 2EGPA 3U5PA 3DPLR 4LKAA 2L80A 3LVQE 1WFKA 4MVTA 3L1XA 2VPBA 2VJFA 2KFTA 1WGMA 2Y1MA 4AUQB 2YVRA 5B78A 2ZETC 2F42A 4BHWA 1MM3A 3MHHA 5TRBA 1T1HA 5B77A 3RTRB 4O64A 1WEPA 5EYAF 2ECIA 4LADB 4S3OC 5DKAA 4LJNA 1WEWA 2AN6A 2B0OE 2VPEA 2DJAA 4H9DA 3NG2A 5TBNA 1WEVA 1HYIA 3L1ZB 5H1TA 5LKXA 2E6SA 1JOCA 5B76A 2LRIC 4LLBA 1WEMA 3FEHA 3ZVYA 2MKEA 2KU3A 2L7PA 4AP4A 3QZVA 1VFYA 5D1MB 1CHCA 5G05B 3MHSA 4YBSA 1WEQA 3O7AA 3N9NA 2IQJA 4XI1A 3PUQA 2KYUA 3T9KA 3T7LA 2EXUA 3C5KA 1VD4A 3H7HA 3EB6A 5H1UA 2RR4A 3VK6A 4TKPB 4FO9A 5C13A 2EODA 5KH9A 2VJFB 2F6JA 2YURA 4B86C 1WIMA 3KNVA 2IDAA 4PTBA 4Z0RA 2LGGA 5FB1A 4A0CD 2KIZA 4I7DA 1V87A 2LV9A 4L7XA 1X4IA 1WE9A 3Q1DA 2YHOA 2M13A 1BORA 3KV5A 2D8UA 4ZDTA 2CONA 5TDRA 2XB1A 4CA1A 3KDEC 2KGGA 2QICA 5SVYA 5G0FA 3GV4A 5G04B 2MNYA 4GB0A 4QF2A 5D1KB 2LDRA 4PPEA 2L5UA 2PNXA 2JRJA 3PHDA 2KKXA 2LGKA 5SVIA 3LQHA 4WZ2A 2FD4A 2XOCA 3HCUA 3SOXA 2K17A 4QF3A 5B8DA 5TABA 2C2LA 3GL6A 1WEOA 4Z0OA 4R2YA 3DDTA 1E4UA 1MBMA 5FB0A 2YW8A 3ZPVE 4I7CA 3O34A 2KGIA 3O37A 5AITA 2KWNA 2ECJA 1WENA 4AVXA 1WEEA 4A4BA 2VJEA 4BBQA 5LKUA 4YBMA 2OWAA 4UP0A 2I50A 2L0BA 5DINA 4MSXA 4GNFA 2XEUA 2L75A 3ZVZB 3C6WA 4QQ4A 3LVRE 2YQLA 4A4CA 1X4UA 4OGCA 4WZ0A 4V3KC 1G25A 2UZGA 2XOZA 1Z60A 2VP7A 2ECVA 4WZ3B 3JUEA 5D1LB 2E6RA 2G43A 1Z2QA 5TDWA 3FL2A 2KWOA 5SVIB 1FP0A 3M63A 2XP0A 3T6RA 3SHBA 3O33A 2LN0A 3N9PA 2ECNA 5KH3A 2LXPC 3ZYQA 4CCGX 2FUUA 5B79A 3LRQA 3ZTGA 4YAXA 4GNEA 1LDJB 2LGLA 3HCSA 2VJEB 2CT2A 4GNDA 2FUIA 2KWJA 3O35A 2CRRA 2YT5A 5LKTA 1WILA 3M62A 5K3QA 4N4FA 2MUMA 1K2FA 2JMIA 2F6NA 2NAAA 2Y1NA 2DX8A 3M99A 2P57A 2PUYA 2MD7B 2KE1A 1LDKC 2RI7A 4L58A 2MIQA 3RPGB 4W4UA 3U5MA 2Y43A 3O36A 2XOYA 1N87A 5B75A 1HYJA 2KKYA 4C9ZA 2KR4A 2JMDA 4I7BA 2LGVA 2KREA 2M6MA 2H0DA 3IHPA 2MA6A 5JG6A 2QJ0A 4YBTA 4R8PK 2VPGA 1X4JA 3U5NA 2D8SA 3V43A 4AYCA 3N9LA 3N9QA 3DWDA 3FM8C 3L11A 1MM2A 2JMJA 3LDYA 2KWKA 4IC2A 4YABA 4GNGA 5AIUA 2YQMA 4YADA 4FJCA 3LQJA 3ZNIA 2L43A 2CKLA 4X3GA 2MD8C 4ZUXU 3RPGC 3PURA 5KH7A 2DSMA 3FAOA 2YYRA 5J3XA 2EGMA 2M85A 2MA5A 2G6QA 1WEUA 4V3LC 2E61A 4N3WA 1FBVA 2JM3A 3HTKC 5H9MA 1JM7A 5C11A 4YC9A 4UP5A 5I3LA 4IC3A 2FSAA 2ECTA 1ZBDB 1VYXA 2RSDA 2H0DB
chains in the Genus database with same CATH topology
1WESA 2EA6A 2C2VS 1IYMA 2MT5A 3EB5A 4B7YC 1U6GB 2YU4A 4YATA 2G45A 4WA6A 4AYCB 3KQIA 4LK9A 2BAYA 2YSJA 2VPDA 1Z6UA 2ECGA 5H1VA 5LKZA 2K16A 3N9MA 5FERA 2HYED 2QIZA 3KV6A 2CKLB 3DQVR 2HDPA 4A49A 2ECWA 3I2DA 2YUCA 1RMDA 2LXHC 2LQ6A 2M3HA 3LQIA 3SOUA 2K4DA 5LCWB 4FIPA 3O70A 4P5OB 2VNFA 4UI9B 2MNZA 4NN2A 1JM7B 2M1RA 2YSMA 3SOWA 3N9OA 2K1JA 4ZQLA 2YHNA 2CSZA 1DVPA 4F52B 2CSYA 5FEYA 4S3OB 3ASLA 2YREA 4FK5A 1F62A 1XWHA 3ZPV1 2OXQC 3HCTA 4Q6FA 4R7EA 3U5OA 2EGPA 3U5PA 3DPLR 4LKAA 2L80A 1WFKA 4MVTA 3L1XA 2VPBA 2VJFA 2KFTA 1WGMA 2Y1MA 4AUQB 5B78A 2ZETC 2F42A 4BHWA 1MM3A 3MHHA 5TRBA 1T1HA 5B77A 3RTRB 4O64A 1WEPA 5EYAF 2ECIA 4LADB 4S3OC 5DKAA 4LJNA 1WEWA 2AN6A 2VPEA 3NG2A 5TBNA 1WEVA 1HYIA 3L1ZB 5H1TA 5LKXA 2E6SA 1JOCA 5B76A 2LRIC 4LLBA 1WEMA 3ZVYA 2KU3A 4AP4A 3QZVA 1VFYA 5D1MB 1CHCA 5G05B 3MHSA 4YBSA 1WEQA 3O7AA 3N9NA 4XI1A 3PUQA 2KYUA 3T7LA 3C5KA 1VD4A 3EB6A 5H1UA 3VK6A 4TKPB 4FO9A 5C13A 2EODA 5KH9A 2VJFB 2F6JA 2YURA 4B86C 1WIMA 3KNVA 2IDAA 4PTBA 2LGGA 5FB1A 4A0CD 2KIZA 4I7DA 1V87A 2LV9A 4L7XA 1X4IA 1WE9A 2YHOA 1BORA 3KV5A 4ZDTA 5TDRA 2XB1A 4CA1A 2KGGA 2QICA 5G0FA 3GV4A 5G04B 2MNYA 4GB0A 4QF2A 5D1KB 2LDRA 4PPEA 2L5UA 2PNXA 2JRJA 3PHDA 2LGKA 3LQHA 4WZ2A 3SOXA 3HCUA 2K17A 4QF3A 5B8DA 5TABA 2C2LA 3GL6A 1WEOA 4R2YA 1E4UA 5FB0A 2YW8A 3ZPVE 4I7CA 3O34A 2KGIA 3O37A 5AITA 2KWNA 2ECJA 1WENA 4AVXA 1WEEA 4A4BA 2VJEA 4BBQA 5LKUA 4YBMA 4UP0A 2I50A 2L0BA 5DINA 4MSXA 4GNFA 2XEUA 2L75A 3ZVZB 3C6WA 2YQLA 4A4CA 1X4UA 4WZ0A 4V3KC 1G25A 2UZGA 1Z60A 2VP7A 2ECVA 4WZ3B 5D1LB 2E6RA 2G43A 1Z2QA 5TDWA 3FL2A 2KWOA 1FP0A 3M63A 3T6RA 3SHBA 3O33A 2LN0A 3N9PA 2ECNA 5KH3A 2LXPC 3ZYQA 4CCGX 2FUUA 5B79A 3LRQA 3ZTGA 4YAXA 4GNEA 1LDJB 2LGLA 3HCSA 2VJEB 2CT2A 4GNDA 2FUIA 3O35A 2KWJA 2YT5A 5LKTA 1WILA 3M62A 4N4FA 2MUMA 1K2FA 2JMIA 2F6NA 2NAAA 2Y1NA 2DX8A 3M99A 2PUYA 2MD7B 2KE1A 1LDKC 2RI7A 4L58A 2MIQA 3RPGB 4W4UA 3U5MA 2Y43A 3O36A 1N87A 5B75A 1HYJA 4C9ZA 2KR4A 2JMDA 4I7BA 2LGVA 2KREA 2M6MA 2H0DA 3IHPA 2MA6A 5JG6A 2QJ0A 4YBTA 4R8PK 2VPGA 1X4JA 3U5NA 2D8SA 3V43A 4AYCA 3N9LA 3N9QA 3L11A 1MM2A 2JMJA 2KWKA 4IC2A 4YABA 4GNGA 5AIUA 2YQMA 4YADA 4FJCA 3LQJA 3ZNIA 2L43A 2CKLA 4X3GA 2MD8C 4ZUXU 3RPGC 3PURA 5KH7A 2YYRA 5J3XA 2M85A 2MA5A 2G6QA 4V3LC 1WEUA 4N3WA 1FBVA 3HTKC 5H9MA 1JM7A 5C11A 4YC9A 4UP5A 5I3LA 4IC3A 2FSAA 2ECTA 1ZBDB 1VYXA 2RSDA 2H0DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WES A;  2EA6 A;  2C2V S;  1IYM A;  2MT5 A;  3EB5 A;  4B7Y C;  1U6G B;  2YU4 A;  4YAT A;  2G45 A;  4WA6 A;  4AYC B;  3KQI A;  4LK9 A;  2BAY A;  2YSJ A;  2VPD A;  1Z6U A;  2ECG A;  5H1V A;  5LKZ A;  2K16 A;  3N9M A;  5FER A;  2HYE D;  2QIZ A;  3KV6 A;  2CKL B;  3DQV R;  2HDP A;  4A49 A;  2ECW A;  3I2D A;  2YUC A;  1RMD A;  2LXH C;  2LQ6 A;  2M3H A;  3LQI A;  3SOU A;  2K4D A;  5LCW B;  4FIP A;  3O70 A;  4P5O B;  2VNF A;  4UI9 B;  2MNZ A;  4NN2 A;  1JM7 B;  2M1R A;  2YSM A;  3SOW A;  3N9O A;  2K1J A;  4ZQL A;  2YHN A;  2CSZ A;  1DVP A;  4F52 B;  2CSY A;  5FEY A;  4S3O B;  3ASL A;  2YRE A;  4FK5 A;  1F62 A;  1XWH A;  3ZPV 1;  2OXQ C;  3HCT A;  4Q6F A;  4R7E A;  3U5O A;  2EGP A;  3U5P A;  3DPL R;  4LKA A;  2L80 A;  1WFK A;  4MVT A;  3L1X A;  2VPB A;  2VJF A;  2KFT A;  1WGM A;  2Y1M A;  4AUQ B;  5B78 A;  2ZET C;  2F42 A;  4BHW A;  1MM3 A;  3MHH A;  5TRB A;  1T1H A;  5B77 A;  3RTR B;  4O64 A;  1WEP A;  5EYA F;  2ECI A;  4LAD B;  4S3O C;  5DKA A;  4LJN A;  1WEW A;  2AN6 A;  2VPE A;  3NG2 A;  5TBN A;  1WEV A;  1HYI A;  3L1Z B;  5H1T A;  5LKX A;  2E6S A;  1JOC A;  5B76 A;  2LRI C;  4LLB A;  1WEM A;  3ZVY A;  2KU3 A;  4AP4 A;  3QZV A;  1VFY A;  5D1M B;  1CHC A;  5G05 B;  3MHS A;  4YBS A;  1WEQ A;  3O7A A;  3N9N A;  4XI1 A;  3PUQ A;  2KYU A;  3T7L A;  3C5K A;  1VD4 A;  3EB6 A;  5H1U A;  3VK6 A;  4TKP B;  4FO9 A;  5C13 A;  2EOD A;  5KH9 A;  2VJF B;  2F6J A;  2YUR A;  4B86 C;  1WIM A;  3KNV A;  2IDA A;  4PTB A;  2LGG A;  5FB1 A;  4A0C D;  2KIZ A;  4I7D A;  1V87 A;  2LV9 A;  4L7X A;  1X4I A;  1WE9 A;  2YHO A;  1BOR A;  3KV5 A;  4ZDT A;  5TDR A;  2XB1 A;  4CA1 A;  2KGG A;  2QIC A;  5G0F A;  3GV4 A;  5G04 B;  2MNY A;  4GB0 A;  4QF2 A;  5D1K B;  2LDR A;  4PPE A;  2L5U A;  2PNX A;  2JRJ A;  3PHD A;  2LGK A;  3LQH A;  4WZ2 A;  3SOX A;  3HCU A;  2K17 A;  4QF3 A;  5B8D A;  5TAB A;  2C2L A;  3GL6 A;  1WEO A;  4R2Y A;  1E4U A;  5FB0 A;  2YW8 A;  3ZPV E;  4I7C A;  3O34 A;  2KGI A;  3O37 A;  5AIT A;  2KWN A;  2ECJ A;  1WEN A;  4AVX A;  1WEE A;  4A4B A;  2VJE A;  4BBQ A;  5LKU A;  4YBM A;  4UP0 A;  2I50 A;  2L0B A;  5DIN A;  4MSX A;  4GNF A;  2XEU A;  2L75 A;  3ZVZ B;  3C6W A;  2YQL A;  4A4C A;  1X4U A;  4WZ0 A;  4V3K C;  1G25 A;  2UZG A;  1Z60 A;  2VP7 A;  2ECV A;  4WZ3 B;  5D1L B;  2E6R A;  2G43 A;  1Z2Q A;  5TDW A;  3FL2 A;  2KWO A;  1FP0 A;  3M63 A;  3T6R A;  3SHB A;  3O33 A;  2LN0 A;  3N9P A;  2ECN A;  5KH3 A;  2LXP C;  3ZYQ A;  4CCG X;  2FUU A;  5B79 A;  3LRQ A;  3ZTG A;  4YAX A;  4GNE A;  1LDJ B;  2LGL A;  3HCS A;  2VJE B;  2CT2 A;  4GND A;  2FUI A;  3O35 A;  2KWJ A;  2YT5 A;  5LKT A;  1WIL A;  3M62 A;  4N4F A;  2MUM A;  1K2F A;  2JMI A;  2F6N A;  2NAA A;  2Y1N A;  2DX8 A;  3M99 A;  2PUY A;  2MD7 B;  2KE1 A;  1LDK C;  2RI7 A;  4L58 A;  2MIQ A;  3RPG B;  4W4U A;  3U5M A;  2Y43 A;  3O36 A;  1N87 A;  5B75 A;  1HYJ A;  4C9Z A;  2KR4 A;  2JMD A;  4I7B A;  2LGV A;  2KRE A;  2M6M A;  2H0D A;  3IHP A;  2MA6 A;  5JG6 A;  2QJ0 A;  4YBT A;  4R8P K;  2VPG A;  1X4J A;  3U5N A;  2D8S A;  3V43 A;  4AYC A;  3N9L A;  3N9Q A;  3L11 A;  1MM2 A;  2JMJ A;  2KWK A;  4IC2 A;  4YAB A;  4GNG A;  5AIU A;  2YQM A;  4YAD A;  4FJC A;  3LQJ A;  3ZNI A;  2L43 A;  2CKL A;  4X3G A;  2MD8 C;  4ZUX U;  3RPG C;  3PUR A;  5KH7 A;  2YYR A;  5J3X A;  2M85 A;  2MA5 A;  2G6Q A;  4V3L C;  1WEU A;  4N3W A;  1FBV A;  3HTK C;  5H9M A;  1JM7 A;  5C11 A;  4YC9 A;  4UP5 A;  5I3L A;  4IC3 A;  2FSA A;  2ECT A;  1ZBD B;  1VYX A;  2RSD A;  2H0D B; 
#chains in the Genus database with same CATH topology
 1WES A;  2EA6 A;  2C2V S;  1IYM A;  2MT5 A;  3EB5 A;  4B7Y C;  1U6G B;  2YU4 A;  4YAT A;  2G45 A;  4WA6 A;  4AYC B;  3KQI A;  4LK9 A;  2BAY A;  2YSJ A;  2VPD A;  3FJU B;  1Z6U A;  2ECG A;  3E2D A;  5H1V A;  5LKZ A;  2K16 A;  3N9M A;  5FER A;  3MDB C;  2FFW A;  2HYE D;  2QIZ A;  4O62 A;  4OGE A;  3KV6 A;  2CKL B;  3DQV R;  2HDP A;  4A49 A;  2ECW A;  3I2D A;  2CRW A;  2YUC A;  1RMD A;  2LXH C;  2LQ6 A;  2M3H A;  3LQI A;  3PLW A;  3SOU A;  2K4D A;  2LAU A;  5LCW B;  4FIP A;  3O70 A;  4P5O B;  4F1P A;  3SUB A;  2VNF A;  4UI9 B;  2MNZ A;  4NN2 A;  1JM7 B;  2M1R A;  2YSM A;  3SOW A;  3N9O A;  2K1J A;  4ZQL A;  2YHN A;  3LJU X;  2CSZ A;  2CSV A;  1DVP A;  4F52 B;  3FAN A;  3O47 A;  2CSY A;  5FEY A;  4S3O B;  3ASL A;  1DCQ A;  2JUN A;  2YRE A;  4FK5 A;  1F62 A;  1XWH A;  3ZPV 1;  5SVX A;  2OXQ C;  3HCT A;  4Q6F A;  4R7E A;  3U5O A;  3M7K A;  2EGP A;  3U5P A;  3DPL R;  4LKA A;  2L80 A;  3LVQ E;  1WFK A;  4MVT A;  3L1X A;  2VPB A;  2VJF A;  2KFT A;  1WGM A;  2Y1M A;  4AUQ B;  2YVR A;  5B78 A;  2ZET C;  2F42 A;  4BHW A;  1MM3 A;  3MHH A;  5TRB A;  1T1H A;  5B77 A;  3RTR B;  4O64 A;  1WEP A;  5EYA F;  2ECI A;  4LAD B;  4S3O C;  5DKA A;  4LJN A;  1WEW A;  2AN6 A;  2B0O E;  2VPE A;  2DJA A;  4H9D A;  3NG2 A;  5TBN A;  1WEV A;  1HYI A;  3L1Z B;  5H1T A;  5LKX A;  2E6S A;  1JOC A;  5B76 A;  2LRI C;  4LLB A;  1WEM A;  3FEH A;  3ZVY A;  2MKE A;  2KU3 A;  2L7P A;  4AP4 A;  3QZV A;  1VFY A;  5D1M B;  1CHC A;  5G05 B;  3MHS A;  4YBS A;  1WEQ A;  3O7A A;  3N9N A;  2IQJ A;  4XI1 A;  3PUQ A;  2KYU A;  3T9K A;  3T7L A;  2EXU A;  3C5K A;  1VD4 A;  3H7H A;  3EB6 A;  5H1U A;  2RR4 A;  3VK6 A;  4TKP B;  4FO9 A;  5C13 A;  2EOD A;  5KH9 A;  2VJF B;  2F6J A;  2YUR A;  4B86 C;  1WIM A;  3KNV A;  2IDA A;  4PTB A;  4Z0R A;  2LGG A;  5FB1 A;  4A0C D;  2KIZ A;  4I7D A;  1V87 A;  2LV9 A;  4L7X A;  1X4I A;  1WE9 A;  3Q1D A;  2YHO A;  2M13 A;  1BOR A;  3KV5 A;  2D8U A;  4ZDT A;  2CON A;  5TDR A;  2XB1 A;  4CA1 A;  3KDE C;  2KGG A;  2QIC A;  5SVY A;  5G0F A;  3GV4 A;  5G04 B;  2MNY A;  4GB0 A;  4QF2 A;  5D1K B;  2LDR A;  4PPE A;  2L5U A;  2PNX A;  2JRJ A;  3PHD A;  2KKX A;  2LGK A;  5SVI A;  3LQH A;  4WZ2 A;  2FD4 A;  2XOC A;  3HCU A;  3SOX A;  2K17 A;  4QF3 A;  5B8D A;  5TAB A;  2C2L A;  3GL6 A;  1WEO A;  4Z0O A;  4R2Y A;  3DDT A;  1E4U A;  1MBM A;  5FB0 A;  2YW8 A;  3ZPV E;  4I7C A;  3O34 A;  2KGI A;  3O37 A;  5AIT A;  2KWN A;  2ECJ A;  1WEN A;  4AVX A;  1WEE A;  4A4B A;  2VJE A;  4BBQ A;  5LKU A;  4YBM A;  2OWA A;  4UP0 A;  2I50 A;  2L0B A;  5DIN A;  4MSX A;  4GNF A;  2XEU A;  2L75 A;  3ZVZ B;  3C6W A;  4QQ4 A;  3LVR E;  2YQL A;  4A4C A;  1X4U A;  4OGC A;  4WZ0 A;  4V3K C;  1G25 A;  2UZG A;  2XOZ A;  1Z60 A;  2VP7 A;  2ECV A;  4WZ3 B;  3JUE A;  5D1L B;  2E6R A;  2G43 A;  1Z2Q A;  5TDW A;  3FL2 A;  2KWO A;  5SVI B;  1FP0 A;  3M63 A;  2XP0 A;  3T6R A;  3SHB A;  3O33 A;  2LN0 A;  3N9P A;  2ECN A;  5KH3 A;  2LXP C;  3ZYQ A;  4CCG X;  2FUU A;  5B79 A;  3LRQ A;  3ZTG A;  4YAX A;  4GNE A;  1LDJ B;  2LGL A;  3HCS A;  2VJE B;  2CT2 A;  4GND A;  2FUI A;  2KWJ A;  3O35 A;  2CRR A;  2YT5 A;  5LKT A;  1WIL A;  3M62 A;  5K3Q A;  4N4F A;  2MUM A;  1K2F A;  2JMI A;  2F6N A;  2NAA A;  2Y1N A;  2DX8 A;  3M99 A;  2P57 A;  2PUY A;  2MD7 B;  2KE1 A;  1LDK C;  2RI7 A;  4L58 A;  2MIQ A;  3RPG B;  4W4U A;  3U5M A;  2Y43 A;  3O36 A;  2XOY A;  1N87 A;  5B75 A;  1HYJ A;  2KKY A;  4C9Z A;  2KR4 A;  2JMD A;  4I7B A;  2LGV A;  2KRE A;  2M6M A;  2H0D A;  3IHP A;  2MA6 A;  5JG6 A;  2QJ0 A;  4YBT A;  4R8P K;  2VPG A;  1X4J A;  3U5N A;  2D8S A;  3V43 A;  4AYC A;  3N9L A;  3N9Q A;  3DWD A;  3FM8 C;  3L11 A;  1MM2 A;  2JMJ A;  3LDY A;  2KWK A;  4IC2 A;  4YAB A;  4GNG A;  5AIU A;  2YQM A;  4YAD A;  4FJC A;  3LQJ A;  3ZNI A;  2L43 A;  2CKL A;  4X3G A;  2MD8 C;  4ZUX U;  3RPG C;  3PUR A;  5KH7 A;  2DSM A;  3FAO A;  2YYR A;  5J3X A;  2EGM A;  2M85 A;  2MA5 A;  2G6Q A;  1WEU A;  4V3L C;  2E61 A;  4N3W A;  1FBV A;  2JM3 A;  3HTK C;  5H9M A;  1JM7 A;  5C11 A;  4YC9 A;  4UP5 A;  5I3L A;  4IC3 A;  2FSA A;  2ECT A;  1ZBD B;  1VYX A;  2RSD A;  2H0D B; 
#chains in the Genus database with same CATH homology
 1WES A;  2EA6 A;  2C2V S;  1IYM A;  2MT5 A;  3EB5 A;  4B7Y C;  1U6G B;  2YU4 A;  4YAT A;  2G45 A;  4WA6 A;  4AYC B;  3KQI A;  4LK9 A;  2BAY A;  2YSJ A;  2VPD A;  1Z6U A;  2ECG A;  5H1V A;  5LKZ A;  2K16 A;  3N9M A;  5FER A;  2HYE D;  2QIZ A;  3KV6 A;  2CKL B;  3DQV R;  2HDP A;  4A49 A;  2ECW A;  3I2D A;  2YUC A;  1RMD A;  2LXH C;  2LQ6 A;  2M3H A;  3LQI A;  3SOU A;  2K4D A;  5LCW B;  4FIP A;  3O70 A;  4P5O B;  2VNF A;  4UI9 B;  2MNZ A;  4NN2 A;  1JM7 B;  2M1R A;  2YSM A;  3SOW A;  3N9O A;  2K1J A;  4ZQL A;  2YHN A;  2CSZ A;  1DVP A;  4F52 B;  2CSY A;  5FEY A;  4S3O B;  3ASL A;  2YRE A;  4FK5 A;  1F62 A;  1XWH A;  3ZPV 1;  2OXQ C;  3HCT A;  4Q6F A;  4R7E A;  3U5O A;  2EGP A;  3U5P A;  3DPL R;  4LKA A;  2L80 A;  1WFK A;  4MVT A;  3L1X A;  2VPB A;  2VJF A;  2KFT A;  1WGM A;  2Y1M A;  4AUQ B;  5B78 A;  2ZET C;  2F42 A;  4BHW A;  1MM3 A;  3MHH A;  5TRB A;  1T1H A;  5B77 A;  3RTR B;  4O64 A;  1WEP A;  5EYA F;  2ECI A;  4LAD B;  4S3O C;  5DKA A;  4LJN A;  1WEW A;  2AN6 A;  2VPE A;  3NG2 A;  5TBN A;  1WEV A;  1HYI A;  3L1Z B;  5H1T A;  5LKX A;  2E6S A;  1JOC A;  5B76 A;  2LRI C;  4LLB A;  1WEM A;  3ZVY A;  2KU3 A;  4AP4 A;  3QZV A;  1VFY A;  5D1M B;  1CHC A;  5G05 B;  3MHS A;  4YBS A;  1WEQ A;  3O7A A;  3N9N A;  4XI1 A;  3PUQ A;  2KYU A;  3T7L A;  3C5K A;  1VD4 A;  3EB6 A;  5H1U A;  3VK6 A;  4TKP B;  4FO9 A;  5C13 A;  2EOD A;  5KH9 A;  2VJF B;  2F6J A;  2YUR A;  4B86 C;  1WIM A;  3KNV A;  2IDA A;  4PTB A;  2LGG A;  5FB1 A;  4A0C D;  2KIZ A;  4I7D A;  1V87 A;  2LV9 A;  4L7X A;  1X4I A;  1WE9 A;  2YHO A;  1BOR A;  3KV5 A;  4ZDT A;  5TDR A;  2XB1 A;  4CA1 A;  2KGG A;  2QIC A;  5G0F A;  3GV4 A;  5G04 B;  2MNY A;  4GB0 A;  4QF2 A;  5D1K B;  2LDR A;  4PPE A;  2L5U A;  2PNX A;  2JRJ A;  3PHD A;  2LGK A;  3LQH A;  4WZ2 A;  3SOX A;  3HCU A;  2K17 A;  4QF3 A;  5B8D A;  5TAB A;  2C2L A;  3GL6 A;  1WEO A;  4R2Y A;  1E4U A;  5FB0 A;  2YW8 A;  3ZPV E;  4I7C A;  3O34 A;  2KGI A;  3O37 A;  5AIT A;  2KWN A;  2ECJ A;  1WEN A;  4AVX A;  1WEE A;  4A4B A;  2VJE A;  4BBQ A;  5LKU A;  4YBM A;  4UP0 A;  2I50 A;  2L0B A;  5DIN A;  4MSX A;  4GNF A;  2XEU A;  2L75 A;  3ZVZ B;  3C6W A;  2YQL A;  4A4C A;  1X4U A;  4WZ0 A;  4V3K C;  1G25 A;  2UZG A;  1Z60 A;  2VP7 A;  2ECV A;  4WZ3 B;  5D1L B;  2E6R A;  2G43 A;  1Z2Q A;  5TDW A;  3FL2 A;  2KWO A;  1FP0 A;  3M63 A;  3T6R A;  3SHB A;  3O33 A;  2LN0 A;  3N9P A;  2ECN A;  5KH3 A;  2LXP C;  3ZYQ A;  4CCG X;  2FUU A;  5B79 A;  3LRQ A;  3ZTG A;  4YAX A;  4GNE A;  1LDJ B;  2LGL A;  3HCS A;  2VJE B;  2CT2 A;  4GND A;  2FUI A;  3O35 A;  2KWJ A;  2YT5 A;  5LKT A;  1WIL A;  3M62 A;  4N4F A;  2MUM A;  1K2F A;  2JMI A;  2F6N A;  2NAA A;  2Y1N A;  2DX8 A;  3M99 A;  2PUY A;  2MD7 B;  2KE1 A;  1LDK C;  2RI7 A;  4L58 A;  2MIQ A;  3RPG B;  4W4U A;  3U5M A;  2Y43 A;  3O36 A;  1N87 A;  5B75 A;  1HYJ A;  4C9Z A;  2KR4 A;  2JMD A;  4I7B A;  2LGV A;  2KRE A;  2M6M A;  2H0D A;  3IHP A;  2MA6 A;  5JG6 A;  2QJ0 A;  4YBT A;  4R8P K;  2VPG A;  1X4J A;  3U5N A;  2D8S A;  3V43 A;  4AYC A;  3N9L A;  3N9Q A;  3L11 A;  1MM2 A;  2JMJ A;  2KWK A;  4IC2 A;  4YAB A;  4GNG A;  5AIU A;  2YQM A;  4YAD A;  4FJC A;  3LQJ A;  3ZNI A;  2L43 A;  2CKL A;  4X3G A;  2MD8 C;  4ZUX U;  3RPG C;  3PUR A;  5KH7 A;  2YYR A;  5J3X A;  2M85 A;  2MA5 A;  2G6Q A;  4V3L C;  1WEU A;  4N3W A;  1FBV A;  3HTK C;  5H9M A;  1JM7 A;  5C11 A;  4YC9 A;  4UP5 A;  5I3L A;  4IC3 A;  2FSA A;  2ECT A;  1ZBD B;  1VYX A;  2RSD A;  2H0D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...