1BORA

Transcription factor pml, a proto-oncoprotein, nmr, 1 representative structure at ph 7.5, 30 c, in the presence of zinc
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
EEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the RING finger domain from the acute promyelocytic leukaemia proto-oncoprotein PML.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription regulation
molecule keywords TRANSCRIPTION FACTOR PML
total genus 4
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1995-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1borA00
2VJEA 4F52B 1ZBDB 2YUCA 2E6SA 5LKXA 2I50A 2OXQC 1FP0A 2F42A 1K2FA 5TABA 2EGPA 4CA1A 2AN6A 2VJFB 2ECTA 2M85A 3N9OA 4R2YA 5JG6A 3EB5A 2F6JA 5J3XA 3SOWA 4W4UA 2FUIA 5LKZA 5H1UA 2EA6A 2LN0A 5DINA 3O33A 2KU3A 1JM7B 5H1TA 2EODA 4X3GA 3L1ZB 2FSAA 5LKUA 3GV4A 3O7AA 2HYED 3DQVR 2RSDA 2ECGA 3RTRB 1RMDA 5B77A 3T7LA 3ZTGA 3GL6A 4PTBA 2VPBA 2LGKA 4N4FA 2F6NA 4YABA 2G45A 2CT2A 1E4UA 3O35A 1Z2QA 4FIPA 4YATA 3L11A 2MA5A 1V87A 3KV5A 4XI1A 2CKLA 2L80A 2KYUA 3HCUA 4NN2A 2KWJA 4L7XA 4YBMA 3C6WA 1X4UA 2LGLA 1WIMA 1MM3A 3N9PA 2YW8A 5B76A 4V3LC 1T1HA 2M1RA 3KQIA 4AVXA 2KFTA 2YQLA 3LQIA 3ZYQA 3ZPVE 3QZVA 3HCSA 2ECVA 1N87A 5TBNA 5D1KB 2YU4A 2YURA 2KGIA 4GNGA 5TDWA 5I3LA 4LJNA 3VK6A 2ZETC 4N3WA 2CKLB 3M99A 2MD8C 1IYMA 4WZ0A 2KREA 4CCGX 2G6QA 3PUQA 2QIZA 2RI7A 3SHBA 3O70A 2Y1MA 2ECIA 4FO9A 2QICA 2NAAA 3U5MA 1MM2A 1VYXA 4FK5A 3N9LA 4AP4A 1X4JA 5TRBA 5B78A 2BAYA 3SOUA 5B8DA 2L75A 2MNYA 4Q6FA 4FJCA 1FBVA 2VPEA 3C5KA 2KIZA 2VNFA 3PURA 1CHCA 1WGMA 2VJFA 2H0DA 2IDAA 2Y1NA 2MNZA 4LLBA 1WFKA 3RPGB 2H0DB 2CSYA 1WEEA 2YSMA 1WE9A 3U5PA 1JOCA 3T6RA 2KWKA 4LKAA 2QJ0A 3N9MA 4S3OB 2ECWA 1WEMA 2JMIA 4LADB 2JMJA 5FB1A 4TKPB 2L0BA 5DKAA 4O64A 1DVPA 5AIUA 5KH7A 1Z60A 2JMDA 2KE1A 2VPGA 5AITA 5G0FA 3M62A 3N9QA 1WEQA 1WEUA 1HYJA 4UI9B 4AYCA 4YBTA 2LXPC 4ZUXU 5EYAF 5FERA 2M6MA 4GNEA 2VP7A 4GNFA 2ECNA 1WEWA 4I7BA 3V43A 1X4IA 2PUYA 2LXHC 2VJEB 3LQHA 2CSZA 1WESA 2M3HA 4AUQB 4YADA 4GB0A 1JM7A 4WA6A 5KH9A 2K16A 1HYIA 5LKTA 2XB1A 2K17A 4MVTA 5B79A 2YT5A 3HCTA 4A0CD 3KV6A 4A4CA 4P5OB 5B75A 4YC9A 4ZDTA 4YAXA 3U5NA 4IC3A 2MD7B 3ZNIA 4QF3A 3O37A 5H1VA 2JRJA 1U6GB 3M63A 5FEYA 2YREA 1WEPA 3MHSA 4GNDA 4ZQLA 2LV9A 2C2VS 4C9ZA 5D1LB 3ZVYA 1VD4A 3MHHA 2G43A 3SOXA 4A4BA 3FL2A 4R8PK 3KNVA 4B7YC 4UP0A 1LDJB 3N9NA 1VFYA 1LDKC 2D8SA 3O36A 2KWOA 1XWHA 1WILA 2YHOA 4BBQA 2ECJA 2YSJA 4I7CA 1F62A 5KH3A 2Y43A 3EB6A 3ASLA 2DX8A 5LCWB 1BORA 2LGVA 2LRIC 3NG2A 2YHNA 2E6RA 4IC2A 5FB0A 4MSXA 1WEVA 2YYRA 3LQJA 4LK9A 2HDPA 1WENA 5TDRA 5G04B 4B86C 3O34A 4R7EA 4I7DA 3ZVZB 2L5UA 1WEOA 2MT5A 2KGGA 4QF2A 2PNXA 2YQMA 5D1MB 2KR4A 4WZ3B 2KWNA 4AYCB 4S3OC 2XEUA 4PPEA 2VPDA 2UZGA 2K1JA 3DPLR 3LRQA 2LQ6A 4UP5A 5G05B 2K4DA 1G25A 2MIQA 2MUMA 5C13A 4A49A 2L43A 2LDRA 4WZ2A 5H9MA 3RPGC 4YBSA 3U5OA 2C2LA 3I2DA 2LGGA 4BHWA 4L58A 5C11A 3HTKC 3PHDA 3ZPV1 4V3KC 2MA6A 1Z6UA 3IHPA 3L1XA 2FUUA
chains in the Genus database with same CATH superfamily
2VJEA 4O62A 4F52B 1ZBDB 2YUCA 3LVQE 3DWDA 2E6SA 2XOZA 5LKXA 2I50A 2OXQC 1FP0A 2F42A 1K2FA 5TABA 2EGPA 4CA1A 2AN6A 2VJFB 2ECTA 2M85A 3N9OA 4R2YA 5JG6A 3EB5A 2F6JA 5J3XA 3SOWA 3FANA 4W4UA 2FUIA 5LKZA 5H1UA 2EA6A 2LN0A 3DDTA 5DINA 5SVYA 3FM8C 3O33A 2KU3A 2P57A 2CRRA 1JM7B 5H1TA 2EODA 4X3GA 3L1ZB 2FSAA 3FAOA 2YVRA 3GV4A 3O7AA 2HYED 3DQVR 5LKUA 2RSDA 2RR4A 2ECGA 3RTRB 1RMDA 5B77A 2JM3A 3JUEA 3T7LA 3ZTGA 3GL6A 3Q1DA 4PTBA 2VPBA 2LGKA 4N4FA 2F6NA 4YABA 2G45A 2CT2A 1E4UA 3O35A 1Z2QA 4FIPA 4YATA 3L11A 2MA5A 1V87A 3KV5A 4XI1A 2CKLA 2L80A 2KYUA 3HCUA 4NN2A 2KWJA 4L7XA 4YBMA 2FFWA 3C6WA 1X4UA 2LGLA 1WIMA 2KKYA 1MM3A 2XOYA 3N9PA 2YW8A 5B76A 4V3LC 1T1HA 4OGEA 2M1RA 3KQIA 4AVXA 2KFTA 3O47A 2YQLA 3LQIA 3ZYQA 3QZVA 3ZPVE 3HCSA 2ECVA 1N87A 5TBNA 5D1KB 2YU4A 2YURA 2KGIA 4GNGA 5TDWA 5I3LA 4LJNA 5SVIA 3VK6A 2ZETC 4N3WA 2CKLB 2CSVA 2L7PA 3M99A 2MD8C 1IYMA 4WZ0A 2KREA 4CCGX 2G6QA 3PUQA 2QIZA 2RI7A 3SHBA 5SVIB 3LDYA 3O70A 2Y1MA 2ECIA 4FO9A 3H7HA 3FEHA 2QICA 2NAAA 3U5MA 1MM2A 1VYXA 4FK5A 3N9LA 4AP4A 1X4JA 5TRBA 5B78A 2BAYA 3SOUA 5B8DA 2L75A 2MNYA 4Q6FA 4FJCA 1FBVA 2B0OE 2VPEA 3C5KA 2KIZA 2DSMA 2VNFA 3PURA 1CHCA 1WGMA 2VJFA 2H0DA 2IDAA 2Y1NA 2EXUA 2MNZA 4LLBA 1WFKA 3E2DA 3MDBC 3RPGB 2H0DB 2CSYA 1WEEA 2YSMA 1WE9A 2XP0A 3U5PA 1JOCA 3T6RA 2KWKA 4LKAA 2QJ0A 3N9MA 4S3OB 2ECWA 1WEMA 3M7KA 2JMIA 4LADB 2JMJA 5FB1A 4TKPB 2XOCA 2L0BA 5DKAA 5SVXA 4O64A 1DVPA 5AIUA 3SUBA 5KH7A 1Z60A 2JMDA 2KE1A 2VPGA 5AITA 5G0FA 3M62A 3N9QA 1WEQA 1WEUA 2MKEA 1HYJA 1DCQA 4UI9B 4AYCA 2DJAA 4YBTA 2LXPC 4ZUXU 5EYAF 5FERA 3PLWA 2M6MA 4Z0OA 4GNEA 2VP7A 4GNFA 2ECNA 1WEWA 4I7BA 1MBMA 3V43A 5K3QA 4QQ4A 2CONA 1X4IA 2PUYA 2LXHC 2VJEB 3LQHA 3T9KA 2CSZA 1WESA 2M3HA 4AUQB 4YADA 4GB0A 1JM7A 4WA6A 5KH9A 2K16A 1HYIA 5LKTA 2XB1A 2K17A 4MVTA 5B79A 2YT5A 3HCTA 4A0CD 3KV6A 4A4CA 4P5OB 5B75A 4YC9A 4ZDTA 4YAXA 3U5NA 4IC3A 2MD7B 3ZNIA 4QF3A 3O37A 5H1VA 2JRJA 1U6GB 3M63A 4OGCA 5FEYA 2YREA 4H9DA 1WEPA 3MHSA 4GNDA 4ZQLA 2LV9A 2C2VS 4C9ZA 2D8UA 5D1LB 3ZVYA 1VD4A 3MHHA 2G43A 3SOXA 4A4BA 3FL2A 4R8PK 3KNVA 4B7YC 3LJUX 2CRWA 4UP0A 1LDJB 3N9NA 1VFYA 1LDKC 2D8SA 3O36A 4Z0RA 2KWOA 1XWHA 1WILA 2YHOA 4F1PA 4BBQA 2ECJA 2YSJA 2M13A 4I7CA 1F62A 5KH3A 2Y43A 3EB6A 3ASLA 2DX8A 5LCWB 2OWAA 1BORA 2LGVA 2LRIC 3NG2A 2YHNA 2E6RA 2LAUA 4IC2A 5FB0A 4MSXA 1WEVA 2JUNA 2YYRA 3LQJA 4LK9A 2HDPA 3KDEC 1WENA 5TDRA 5G04B 4B86C 3O34A 4R7EA 4I7DA 3ZVZB 2L5UA 1WEOA 2MT5A 2E61A 2KGGA 4QF2A 2PNXA 2YQMA 5D1MB 2KR4A 4WZ3B 2KWNA 4AYCB 2IQJA 4S3OC 2XEUA 4PPEA 2VPDA 2UZGA 2K1JA 3DPLR 3LRQA 2FD4A 2KKXA 2LQ6A 4UP5A 5G05B 2K4DA 3FJUB 1G25A 2MIQA 2MUMA 5C13A 4A49A 2L43A 2LDRA 4WZ2A 2EGMA 5H9MA 3RPGC 3LVRE 4YBSA 3U5OA 2C2LA 3I2DA 2LGGA 4BHWA 4L58A 5C11A 3HTKC 3PHDA 3ZPV1 4V3KC 2MA6A 1Z6UA 3IHPA 3L1XA 2FUUA
chains in the Genus database with same CATH topology
2VJEA 4F52B 1ZBDB 2YUCA 2E6SA 5LKXA 2I50A 2OXQC 1FP0A 2F42A 1K2FA 5TABA 2EGPA 4CA1A 2AN6A 2VJFB 2ECTA 2M85A 3N9OA 4R2YA 5JG6A 3EB5A 2F6JA 5J3XA 3SOWA 4W4UA 2FUIA 5LKZA 5H1UA 2EA6A 2LN0A 5DINA 3O33A 2KU3A 1JM7B 5H1TA 2EODA 4X3GA 3L1ZB 2FSAA 5LKUA 3GV4A 3O7AA 2HYED 3DQVR 2RSDA 2ECGA 3RTRB 1RMDA 5B77A 3T7LA 3ZTGA 3GL6A 4PTBA 2VPBA 2LGKA 4N4FA 2F6NA 4YABA 2G45A 2CT2A 1E4UA 3O35A 1Z2QA 4FIPA 4YATA 3L11A 2MA5A 1V87A 3KV5A 4XI1A 2CKLA 2L80A 2KYUA 3HCUA 4NN2A 2KWJA 4L7XA 4YBMA 3C6WA 1X4UA 2LGLA 1WIMA 1MM3A 3N9PA 2YW8A 5B76A 4V3LC 1T1HA 2M1RA 3KQIA 4AVXA 2KFTA 2YQLA 3LQIA 3ZYQA 3ZPVE 3QZVA 3HCSA 2ECVA 1N87A 5TBNA 5D1KB 2YU4A 2YURA 2KGIA 4GNGA 5TDWA 5I3LA 4LJNA 3VK6A 2ZETC 4N3WA 2CKLB 3M99A 2MD8C 1IYMA 4WZ0A 2KREA 4CCGX 2G6QA 3PUQA 2QIZA 2RI7A 3SHBA 3O70A 2Y1MA 2ECIA 4FO9A 2QICA 2NAAA 3U5MA 1MM2A 1VYXA 4FK5A 3N9LA 4AP4A 1X4JA 5TRBA 5B78A 2BAYA 3SOUA 5B8DA 2L75A 2MNYA 4Q6FA 4FJCA 1FBVA 2VPEA 3C5KA 2KIZA 2VNFA 3PURA 1CHCA 1WGMA 2VJFA 2H0DA 2IDAA 2Y1NA 2MNZA 4LLBA 1WFKA 3RPGB 2H0DB 2CSYA 1WEEA 2YSMA 1WE9A 3U5PA 1JOCA 3T6RA 2KWKA 4LKAA 2QJ0A 3N9MA 4S3OB 2ECWA 1WEMA 2JMIA 4LADB 2JMJA 5FB1A 4TKPB 2L0BA 5DKAA 4O64A 1DVPA 5AIUA 5KH7A 1Z60A 2JMDA 2KE1A 2VPGA 5AITA 5G0FA 3M62A 3N9QA 1WEQA 1WEUA 1HYJA 4UI9B 4AYCA 4YBTA 2LXPC 4ZUXU 5EYAF 5FERA 2M6MA 4GNEA 2VP7A 4GNFA 2ECNA 1WEWA 4I7BA 3V43A 1X4IA 2PUYA 2LXHC 2VJEB 3LQHA 2CSZA 1WESA 2M3HA 4AUQB 4YADA 4GB0A 1JM7A 4WA6A 5KH9A 2K16A 1HYIA 5LKTA 2XB1A 2K17A 4MVTA 5B79A 2YT5A 3HCTA 4A0CD 3KV6A 4A4CA 4P5OB 5B75A 4YC9A 4ZDTA 4YAXA 3U5NA 4IC3A 2MD7B 3ZNIA 4QF3A 3O37A 5H1VA 2JRJA 1U6GB 3M63A 5FEYA 2YREA 1WEPA 3MHSA 4GNDA 4ZQLA 2LV9A 2C2VS 4C9ZA 5D1LB 3ZVYA 1VD4A 3MHHA 2G43A 3SOXA 4A4BA 3FL2A 4R8PK 3KNVA 4B7YC 4UP0A 1LDJB 3N9NA 1VFYA 1LDKC 2D8SA 3O36A 2KWOA 1XWHA 1WILA 2YHOA 4BBQA 2ECJA 2YSJA 4I7CA 1F62A 5KH3A 2Y43A 3EB6A 3ASLA 2DX8A 5LCWB 1BORA 2LGVA 2LRIC 3NG2A 2YHNA 2E6RA 4IC2A 5FB0A 4MSXA 1WEVA 2YYRA 3LQJA 4LK9A 2HDPA 1WENA 5TDRA 5G04B 4B86C 3O34A 4R7EA 4I7DA 3ZVZB 2L5UA 1WEOA 2MT5A 2KGGA 4QF2A 2PNXA 2YQMA 5D1MB 2KR4A 4WZ3B 2KWNA 4AYCB 4S3OC 2XEUA 4PPEA 2VPDA 2UZGA 2K1JA 3DPLR 3LRQA 2LQ6A 4UP5A 5G05B 2K4DA 1G25A 2MIQA 2MUMA 5C13A 4A49A 2L43A 2LDRA 4WZ2A 5H9MA 3RPGC 4YBSA 3U5OA 2C2LA 3I2DA 2LGGA 4BHWA 4L58A 5C11A 3HTKC 3PHDA 3ZPV1 4V3KC 2MA6A 1Z6UA 3IHPA 3L1XA 2FUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJE A;  4F52 B;  1ZBD B;  2YUC A;  2E6S A;  5LKX A;  2I50 A;  2OXQ C;  1FP0 A;  2F42 A;  1K2F A;  5TAB A;  2EGP A;  4CA1 A;  2AN6 A;  2VJF B;  2ECT A;  2M85 A;  3N9O A;  4R2Y A;  5JG6 A;  3EB5 A;  2F6J A;  5J3X A;  3SOW A;  4W4U A;  2FUI A;  5LKZ A;  5H1U A;  2EA6 A;  2LN0 A;  5DIN A;  3O33 A;  2KU3 A;  1JM7 B;  5H1T A;  2EOD A;  4X3G A;  3L1Z B;  2FSA A;  5LKU A;  3GV4 A;  3O7A A;  2HYE D;  3DQV R;  2RSD A;  2ECG A;  3RTR B;  1RMD A;  5B77 A;  3T7L A;  3ZTG A;  3GL6 A;  4PTB A;  2VPB A;  2LGK A;  4N4F A;  2F6N A;  4YAB A;  2G45 A;  2CT2 A;  1E4U A;  3O35 A;  1Z2Q A;  4FIP A;  4YAT A;  3L11 A;  2MA5 A;  1V87 A;  3KV5 A;  4XI1 A;  2CKL A;  2L80 A;  2KYU A;  3HCU A;  4NN2 A;  2KWJ A;  4L7X A;  4YBM A;  3C6W A;  1X4U A;  2LGL A;  1WIM A;  1MM3 A;  3N9P A;  2YW8 A;  5B76 A;  4V3L C;  1T1H A;  2M1R A;  3KQI A;  4AVX A;  2KFT A;  2YQL A;  3LQI A;  3ZYQ A;  3ZPV E;  3QZV A;  3HCS A;  2ECV A;  1N87 A;  5TBN A;  5D1K B;  2YU4 A;  2YUR A;  2KGI A;  4GNG A;  5TDW A;  5I3L A;  4LJN A;  3VK6 A;  2ZET C;  4N3W A;  2CKL B;  3M99 A;  2MD8 C;  1IYM A;  4WZ0 A;  2KRE A;  4CCG X;  2G6Q A;  3PUQ A;  2QIZ A;  2RI7 A;  3SHB A;  3O70 A;  2Y1M A;  2ECI A;  4FO9 A;  2QIC A;  2NAA A;  3U5M A;  1MM2 A;  1VYX A;  4FK5 A;  3N9L A;  4AP4 A;  1X4J A;  5TRB A;  5B78 A;  2BAY A;  3SOU A;  5B8D A;  2L75 A;  2MNY A;  4Q6F A;  4FJC A;  1FBV A;  2VPE A;  3C5K A;  2KIZ A;  2VNF A;  3PUR A;  1CHC A;  1WGM A;  2VJF A;  2H0D A;  2IDA A;  2Y1N A;  2MNZ A;  4LLB A;  1WFK A;  3RPG B;  2H0D B;  2CSY A;  1WEE A;  2YSM A;  1WE9 A;  3U5P A;  1JOC A;  3T6R A;  2KWK A;  4LKA A;  2QJ0 A;  3N9M A;  4S3O B;  2ECW A;  1WEM A;  2JMI A;  4LAD B;  2JMJ A;  5FB1 A;  4TKP B;  2L0B A;  5DKA A;  4O64 A;  1DVP A;  5AIU A;  5KH7 A;  1Z60 A;  2JMD A;  2KE1 A;  2VPG A;  5AIT A;  5G0F A;  3M62 A;  3N9Q A;  1WEQ A;  1WEU A;  1HYJ A;  4UI9 B;  4AYC A;  4YBT A;  2LXP C;  4ZUX U;  5EYA F;  5FER A;  2M6M A;  4GNE A;  2VP7 A;  4GNF A;  2ECN A;  1WEW A;  4I7B A;  3V43 A;  1X4I A;  2PUY A;  2LXH C;  2VJE B;  3LQH A;  2CSZ A;  1WES A;  2M3H A;  4AUQ B;  4YAD A;  4GB0 A;  1JM7 A;  4WA6 A;  5KH9 A;  2K16 A;  1HYI A;  5LKT A;  2XB1 A;  2K17 A;  4MVT A;  5B79 A;  2YT5 A;  3HCT A;  4A0C D;  3KV6 A;  4A4C A;  4P5O B;  5B75 A;  4YC9 A;  4ZDT A;  4YAX A;  3U5N A;  4IC3 A;  2MD7 B;  3ZNI A;  4QF3 A;  3O37 A;  5H1V A;  2JRJ A;  1U6G B;  3M63 A;  5FEY A;  2YRE A;  1WEP A;  3MHS A;  4GND A;  4ZQL A;  2LV9 A;  2C2V S;  4C9Z A;  5D1L B;  3ZVY A;  1VD4 A;  3MHH A;  2G43 A;  3SOX A;  4A4B A;  3FL2 A;  4R8P K;  3KNV A;  4B7Y C;  4UP0 A;  1LDJ B;  3N9N A;  1VFY A;  1LDK C;  2D8S A;  3O36 A;  2KWO A;  1XWH A;  1WIL A;  2YHO A;  4BBQ A;  2ECJ A;  2YSJ A;  4I7C A;  1F62 A;  5KH3 A;  2Y43 A;  3EB6 A;  3ASL A;  2DX8 A;  5LCW B;  1BOR A;  2LGV A;  2LRI C;  3NG2 A;  2YHN A;  2E6R A;  4IC2 A;  5FB0 A;  4MSX A;  1WEV A;  2YYR A;  3LQJ A;  4LK9 A;  2HDP A;  1WEN A;  5TDR A;  5G04 B;  4B86 C;  3O34 A;  4R7E A;  4I7D A;  3ZVZ B;  2L5U A;  1WEO A;  2MT5 A;  2KGG A;  4QF2 A;  2PNX A;  2YQM A;  5D1M B;  2KR4 A;  4WZ3 B;  2KWN A;  4AYC B;  4S3O C;  2XEU A;  4PPE A;  2VPD A;  2UZG A;  2K1J A;  3DPL R;  3LRQ A;  2LQ6 A;  4UP5 A;  5G05 B;  2K4D A;  1G25 A;  2MIQ A;  2MUM A;  5C13 A;  4A49 A;  2L43 A;  2LDR A;  4WZ2 A;  5H9M A;  3RPG C;  4YBS A;  3U5O A;  2C2L A;  3I2D A;  2LGG A;  4BHW A;  4L58 A;  5C11 A;  3HTK C;  3PHD A;  3ZPV 1;  4V3K C;  2MA6 A;  1Z6U A;  3IHP A;  3L1X A;  2FUU A; 
#chains in the Genus database with same CATH topology
 2VJE A;  4O62 A;  4F52 B;  1ZBD B;  2YUC A;  3LVQ E;  3DWD A;  2E6S A;  2XOZ A;  5LKX A;  2I50 A;  2OXQ C;  1FP0 A;  2F42 A;  1K2F A;  5TAB A;  2EGP A;  4CA1 A;  2AN6 A;  2VJF B;  2ECT A;  2M85 A;  3N9O A;  4R2Y A;  5JG6 A;  3EB5 A;  2F6J A;  5J3X A;  3SOW A;  3FAN A;  4W4U A;  2FUI A;  5LKZ A;  5H1U A;  2EA6 A;  2LN0 A;  3DDT A;  5DIN A;  5SVY A;  3FM8 C;  3O33 A;  2KU3 A;  2P57 A;  2CRR A;  1JM7 B;  5H1T A;  2EOD A;  4X3G A;  3L1Z B;  2FSA A;  3FAO A;  2YVR A;  3GV4 A;  3O7A A;  2HYE D;  3DQV R;  5LKU A;  2RSD A;  2RR4 A;  2ECG A;  3RTR B;  1RMD A;  5B77 A;  2JM3 A;  3JUE A;  3T7L A;  3ZTG A;  3GL6 A;  3Q1D A;  4PTB A;  2VPB A;  2LGK A;  4N4F A;  2F6N A;  4YAB A;  2G45 A;  2CT2 A;  1E4U A;  3O35 A;  1Z2Q A;  4FIP A;  4YAT A;  3L11 A;  2MA5 A;  1V87 A;  3KV5 A;  4XI1 A;  2CKL A;  2L80 A;  2KYU A;  3HCU A;  4NN2 A;  2KWJ A;  4L7X A;  4YBM A;  2FFW A;  3C6W A;  1X4U A;  2LGL A;  1WIM A;  2KKY A;  1MM3 A;  2XOY A;  3N9P A;  2YW8 A;  5B76 A;  4V3L C;  1T1H A;  4OGE A;  2M1R A;  3KQI A;  4AVX A;  2KFT A;  3O47 A;  2YQL A;  3LQI A;  3ZYQ A;  3QZV A;  3ZPV E;  3HCS A;  2ECV A;  1N87 A;  5TBN A;  5D1K B;  2YU4 A;  2YUR A;  2KGI A;  4GNG A;  5TDW A;  5I3L A;  4LJN A;  5SVI A;  3VK6 A;  2ZET C;  4N3W A;  2CKL B;  2CSV A;  2L7P A;  3M99 A;  2MD8 C;  1IYM A;  4WZ0 A;  2KRE A;  4CCG X;  2G6Q A;  3PUQ A;  2QIZ A;  2RI7 A;  3SHB A;  5SVI B;  3LDY A;  3O70 A;  2Y1M A;  2ECI A;  4FO9 A;  3H7H A;  3FEH A;  2QIC A;  2NAA A;  3U5M A;  1MM2 A;  1VYX A;  4FK5 A;  3N9L A;  4AP4 A;  1X4J A;  5TRB A;  5B78 A;  2BAY A;  3SOU A;  5B8D A;  2L75 A;  2MNY A;  4Q6F A;  4FJC A;  1FBV A;  2B0O E;  2VPE A;  3C5K A;  2KIZ A;  2DSM A;  2VNF A;  3PUR A;  1CHC A;  1WGM A;  2VJF A;  2H0D A;  2IDA A;  2Y1N A;  2EXU A;  2MNZ A;  4LLB A;  1WFK A;  3E2D A;  3MDB C;  3RPG B;  2H0D B;  2CSY A;  1WEE A;  2YSM A;  1WE9 A;  2XP0 A;  3U5P A;  1JOC A;  3T6R A;  2KWK A;  4LKA A;  2QJ0 A;  3N9M A;  4S3O B;  2ECW A;  1WEM A;  3M7K A;  2JMI A;  4LAD B;  2JMJ A;  5FB1 A;  4TKP B;  2XOC A;  2L0B A;  5DKA A;  5SVX A;  4O64 A;  1DVP A;  5AIU A;  3SUB A;  5KH7 A;  1Z60 A;  2JMD A;  2KE1 A;  2VPG A;  5AIT A;  5G0F A;  3M62 A;  3N9Q A;  1WEQ A;  1WEU A;  2MKE A;  1HYJ A;  1DCQ A;  4UI9 B;  4AYC A;  2DJA A;  4YBT A;  2LXP C;  4ZUX U;  5EYA F;  5FER A;  3PLW A;  2M6M A;  4Z0O A;  4GNE A;  2VP7 A;  4GNF A;  2ECN A;  1WEW A;  4I7B A;  1MBM A;  3V43 A;  5K3Q A;  4QQ4 A;  2CON A;  1X4I A;  2PUY A;  2LXH C;  2VJE B;  3LQH A;  3T9K A;  2CSZ A;  1WES A;  2M3H A;  4AUQ B;  4YAD A;  4GB0 A;  1JM7 A;  4WA6 A;  5KH9 A;  2K16 A;  1HYI A;  5LKT A;  2XB1 A;  2K17 A;  4MVT A;  5B79 A;  2YT5 A;  3HCT A;  4A0C D;  3KV6 A;  4A4C A;  4P5O B;  5B75 A;  4YC9 A;  4ZDT A;  4YAX A;  3U5N A;  4IC3 A;  2MD7 B;  3ZNI A;  4QF3 A;  3O37 A;  5H1V A;  2JRJ A;  1U6G B;  3M63 A;  4OGC A;  5FEY A;  2YRE A;  4H9D A;  1WEP A;  3MHS A;  4GND A;  4ZQL A;  2LV9 A;  2C2V S;  4C9Z A;  2D8U A;  5D1L B;  3ZVY A;  1VD4 A;  3MHH A;  2G43 A;  3SOX A;  4A4B A;  3FL2 A;  4R8P K;  3KNV A;  4B7Y C;  3LJU X;  2CRW A;  4UP0 A;  1LDJ B;  3N9N A;  1VFY A;  1LDK C;  2D8S A;  3O36 A;  4Z0R A;  2KWO A;  1XWH A;  1WIL A;  2YHO A;  4F1P A;  4BBQ A;  2ECJ A;  2YSJ A;  2M13 A;  4I7C A;  1F62 A;  5KH3 A;  2Y43 A;  3EB6 A;  3ASL A;  2DX8 A;  5LCW B;  2OWA A;  1BOR A;  2LGV A;  2LRI C;  3NG2 A;  2YHN A;  2E6R A;  2LAU A;  4IC2 A;  5FB0 A;  4MSX A;  1WEV A;  2JUN A;  2YYR A;  3LQJ A;  4LK9 A;  2HDP A;  3KDE C;  1WEN A;  5TDR A;  5G04 B;  4B86 C;  3O34 A;  4R7E A;  4I7D A;  3ZVZ B;  2L5U A;  1WEO A;  2MT5 A;  2E61 A;  2KGG A;  4QF2 A;  2PNX A;  2YQM A;  5D1M B;  2KR4 A;  4WZ3 B;  2KWN A;  4AYC B;  2IQJ A;  4S3O C;  2XEU A;  4PPE A;  2VPD A;  2UZG A;  2K1J A;  3DPL R;  3LRQ A;  2FD4 A;  2KKX A;  2LQ6 A;  4UP5 A;  5G05 B;  2K4D A;  3FJU B;  1G25 A;  2MIQ A;  2MUM A;  5C13 A;  4A49 A;  2L43 A;  2LDR A;  4WZ2 A;  2EGM A;  5H9M A;  3RPG C;  3LVR E;  4YBS A;  3U5O A;  2C2L A;  3I2D A;  2LGG A;  4BHW A;  4L58 A;  5C11 A;  3HTK C;  3PHD A;  3ZPV 1;  4V3K C;  2MA6 A;  1Z6U A;  3IHP A;  3L1X A;  2FUU A; 
#chains in the Genus database with same CATH homology
 2VJE A;  4F52 B;  1ZBD B;  2YUC A;  2E6S A;  5LKX A;  2I50 A;  2OXQ C;  1FP0 A;  2F42 A;  1K2F A;  5TAB A;  2EGP A;  4CA1 A;  2AN6 A;  2VJF B;  2ECT A;  2M85 A;  3N9O A;  4R2Y A;  5JG6 A;  3EB5 A;  2F6J A;  5J3X A;  3SOW A;  4W4U A;  2FUI A;  5LKZ A;  5H1U A;  2EA6 A;  2LN0 A;  5DIN A;  3O33 A;  2KU3 A;  1JM7 B;  5H1T A;  2EOD A;  4X3G A;  3L1Z B;  2FSA A;  5LKU A;  3GV4 A;  3O7A A;  2HYE D;  3DQV R;  2RSD A;  2ECG A;  3RTR B;  1RMD A;  5B77 A;  3T7L A;  3ZTG A;  3GL6 A;  4PTB A;  2VPB A;  2LGK A;  4N4F A;  2F6N A;  4YAB A;  2G45 A;  2CT2 A;  1E4U A;  3O35 A;  1Z2Q A;  4FIP A;  4YAT A;  3L11 A;  2MA5 A;  1V87 A;  3KV5 A;  4XI1 A;  2CKL A;  2L80 A;  2KYU A;  3HCU A;  4NN2 A;  2KWJ A;  4L7X A;  4YBM A;  3C6W A;  1X4U A;  2LGL A;  1WIM A;  1MM3 A;  3N9P A;  2YW8 A;  5B76 A;  4V3L C;  1T1H A;  2M1R A;  3KQI A;  4AVX A;  2KFT A;  2YQL A;  3LQI A;  3ZYQ A;  3ZPV E;  3QZV A;  3HCS A;  2ECV A;  1N87 A;  5TBN A;  5D1K B;  2YU4 A;  2YUR A;  2KGI A;  4GNG A;  5TDW A;  5I3L A;  4LJN A;  3VK6 A;  2ZET C;  4N3W A;  2CKL B;  3M99 A;  2MD8 C;  1IYM A;  4WZ0 A;  2KRE A;  4CCG X;  2G6Q A;  3PUQ A;  2QIZ A;  2RI7 A;  3SHB A;  3O70 A;  2Y1M A;  2ECI A;  4FO9 A;  2QIC A;  2NAA A;  3U5M A;  1MM2 A;  1VYX A;  4FK5 A;  3N9L A;  4AP4 A;  1X4J A;  5TRB A;  5B78 A;  2BAY A;  3SOU A;  5B8D A;  2L75 A;  2MNY A;  4Q6F A;  4FJC A;  1FBV A;  2VPE A;  3C5K A;  2KIZ A;  2VNF A;  3PUR A;  1CHC A;  1WGM A;  2VJF A;  2H0D A;  2IDA A;  2Y1N A;  2MNZ A;  4LLB A;  1WFK A;  3RPG B;  2H0D B;  2CSY A;  1WEE A;  2YSM A;  1WE9 A;  3U5P A;  1JOC A;  3T6R A;  2KWK A;  4LKA A;  2QJ0 A;  3N9M A;  4S3O B;  2ECW A;  1WEM A;  2JMI A;  4LAD B;  2JMJ A;  5FB1 A;  4TKP B;  2L0B A;  5DKA A;  4O64 A;  1DVP A;  5AIU A;  5KH7 A;  1Z60 A;  2JMD A;  2KE1 A;  2VPG A;  5AIT A;  5G0F A;  3M62 A;  3N9Q A;  1WEQ A;  1WEU A;  1HYJ A;  4UI9 B;  4AYC A;  4YBT A;  2LXP C;  4ZUX U;  5EYA F;  5FER A;  2M6M A;  4GNE A;  2VP7 A;  4GNF A;  2ECN A;  1WEW A;  4I7B A;  3V43 A;  1X4I A;  2PUY A;  2LXH C;  2VJE B;  3LQH A;  2CSZ A;  1WES A;  2M3H A;  4AUQ B;  4YAD A;  4GB0 A;  1JM7 A;  4WA6 A;  5KH9 A;  2K16 A;  1HYI A;  5LKT A;  2XB1 A;  2K17 A;  4MVT A;  5B79 A;  2YT5 A;  3HCT A;  4A0C D;  3KV6 A;  4A4C A;  4P5O B;  5B75 A;  4YC9 A;  4ZDT A;  4YAX A;  3U5N A;  4IC3 A;  2MD7 B;  3ZNI A;  4QF3 A;  3O37 A;  5H1V A;  2JRJ A;  1U6G B;  3M63 A;  5FEY A;  2YRE A;  1WEP A;  3MHS A;  4GND A;  4ZQL A;  2LV9 A;  2C2V S;  4C9Z A;  5D1L B;  3ZVY A;  1VD4 A;  3MHH A;  2G43 A;  3SOX A;  4A4B A;  3FL2 A;  4R8P K;  3KNV A;  4B7Y C;  4UP0 A;  1LDJ B;  3N9N A;  1VFY A;  1LDK C;  2D8S A;  3O36 A;  2KWO A;  1XWH A;  1WIL A;  2YHO A;  4BBQ A;  2ECJ A;  2YSJ A;  4I7C A;  1F62 A;  5KH3 A;  2Y43 A;  3EB6 A;  3ASL A;  2DX8 A;  5LCW B;  1BOR A;  2LGV A;  2LRI C;  3NG2 A;  2YHN A;  2E6R A;  4IC2 A;  5FB0 A;  4MSX A;  1WEV A;  2YYR A;  3LQJ A;  4LK9 A;  2HDP A;  1WEN A;  5TDR A;  5G04 B;  4B86 C;  3O34 A;  4R7E A;  4I7D A;  3ZVZ B;  2L5U A;  1WEO A;  2MT5 A;  2KGG A;  4QF2 A;  2PNX A;  2YQM A;  5D1M B;  2KR4 A;  4WZ3 B;  2KWN A;  4AYC B;  4S3O C;  2XEU A;  4PPE A;  2VPD A;  2UZG A;  2K1J A;  3DPL R;  3LRQ A;  2LQ6 A;  4UP5 A;  5G05 B;  2K4D A;  1G25 A;  2MIQ A;  2MUM A;  5C13 A;  4A49 A;  2L43 A;  2LDR A;  4WZ2 A;  5H9M A;  3RPG C;  4YBS A;  3U5O A;  2C2L A;  3I2D A;  2LGG A;  4BHW A;  4L58 A;  5C11 A;  3HTK C;  3PHD A;  3ZPV 1;  4V3K C;  2MA6 A;  1Z6U A;  3IHP A;  3L1X A;  2FUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...