5FEYA

Trim32 ring
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
78
Chain Sequence
b'SHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASGVRCPFCSKITRITQLTDNLTVLKIIDTAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase TRIM32
publication title Functional role of TRIM E3 ligase oligomerization and regulation of catalytic activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 16
structure length 78
sequence length 84
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13445 zf-RING_UBOX RING-type zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5feyA00
5EYAF 5KH3A 2LXPC 1CHCA 5B76A 2KIZA 1WEPA 4C9ZA 4ZDTA 4CCGX 2MT5A 4GNGA 4MVTA 4QF3A 5B8DA 1VYXA 1WEUA 4ZQLA 3ZNIA 2IDAA 2MA6A 5LKUA 5H1VA 2LXHC 4BHWA 1T1HA 4X3GA 5KH7A 5LKXA 5FEYA 4AP4A 2F6JA 2C2LA 3N9MA 3ZYQA 3SOUA 1VFYA 3T7LA 4GNEA 2JRJA 4LADB 1X4IA 2Y1NA 4AVXA 2H0DA 1WFKA 1X4JA 5TDWA 3NG2A 2G43A 4P5OB 5H9MA 1Z60A 2YW8A 2ECWA 3O33A 3IHPA 3L1ZB 2VPDA 2H0DB 3O70A 4YC9A 2YSJA 5LKZA 4R8PK 5C13A 2KE1A 3EB6A 4R7EA 1HYIA 2L80A 2MD8C 2CSZA 4S3OB 2M3HA 3N9QA 4YBSA 5FERA 4FJCA 2JMIA 2CKLA 2MIQA 2MUMA 2VPEA 2NAAA 5FB0A 4A4BA 2M1RA 2ECNA 2YU4A 1JM7A 5JG6A 4R2YA 5G0FA 3C5KA 3SHBA 2QIZA 1WEEA 1WEOA 1WENA 5AITA 3O36A 2CKLB 1FP0A 2KREA 1JM7B 3DQVR 2VJFA 4W4UA 2KWJA 4IC2A 1LDJB 4PTBA 2JMDA 5TDRA 3ZPVE 2KWNA 4F52B 2L5UA 2KWOA 2LDRA 2LGKA 4FO9A 2L43A 2M6MA 2XEUA 2VJFB 4QF2A 5B78A 1WEQA 4V3LC 3FL2A 3O35A 4CA1A 4ZUXU 1MM3A 1X4UA 4N4FA 3ASLA 1Z6UA 2G6QA 3L11A 2ECJA 2YSMA 2KU3A 5FB1A 2EODA 2VJEB 5TBNA 3RPGB 3C6WA 2ECGA 4FIPA 1WEWA 3U5PA 2C2VS 4WZ0A 4YAXA 3O37A 1V87A 1WILA 4YATA 1G25A 4V3KC 3KNVA 4XI1A 2KGGA 2HDPA 2MNYA 1XWHA 4BBQA 5H1UA 2YYRA 2FSAA 2M85A 2YUCA 2OXQC 2MNZA 2E6RA 2KYUA 3EB5A 3PUQA 4Q6FA 2ECIA 3RPGC 2PUYA 2AN6A 2YREA 2L0BA 4NN2A 5B79A 2L75A 3MHSA 3GL6A 4I7DA 2VPBA 2VNFA 4UP0A 5B77A 5G05B 3RTRB 1JOCA 3KV6A 3HCTA 1MM2A 3SOXA 4PPEA 5I3LA 1WEMA 2YURA 3DPLR 3KV5A 3I2DA 5B75A 3VK6A 4I7CA 4AUQB 2F42A 5G04B 2JMJA 3ZVYA 4YABA 2LQ6A 4WZ3B 4LKAA 2ECTA 2YQMA 3ZVZB 2HYED 2Y1MA 1RMDA 3O34A 2F6NA 4MSXA 2RSDA 1HYJA 2KR4A 2LGLA 4AYCA 1WE9A 2LRIC 4TKPB 1IYMA 4S3OC 2K17A 3U5OA 4A4CA 3V43A 2LGGA 2VJEA 2RI7A 4FK5A 1E4UA 2YQLA 4AYCB 5D1MB 3PURA 2ZETC 3N9NA 3M63A 3ZPV1 1DVPA 4GB0A 2CT2A 4A0CD 3LQJA 3U5MA 2LGVA 2DX8A 2E6SA 3ZTGA 4YBTA 3T6RA 3L1XA 2PNXA 1LDKC 4UP5A 2K16A 1WESA 2LN0A 2QJ0A 3O7AA 2VPGA 2YHOA 2FUIA 2CSYA 4B7YC 1VD4A 1U6GB 5DINA 4UI9B 3PHDA 3M99A 3U5NA 3LRQA 1WGMA 5TRBA 2EGPA 3MHHA 5AIUA 2BAYA 5J3XA 2K1JA 2QICA 4YBMA 2MD7B 5C11A 1F62A 4O64A 1Z2QA 4LLBA 3LQIA 2YHNA 3KQIA 2KGIA 3GV4A 4N3WA 4IC3A 4L7XA 4LJNA 2FUUA 5LKTA 4B86C 5LCWB 3HCSA 1WEVA 2MA5A 2D8SA 2K4DA 3HTKC 5D1LB 5KH9A 4L58A 3N9PA 3N9LA 4LK9A 2YT5A 1N87A 3SOWA 2KFTA 1ZBDB 4GNDA 2I50A 4YADA 5TABA 2XB1A 2UZGA 4I7BA 2G45A 2VP7A 3QZVA 1BORA 4A49A 2Y43A 4GNFA 1WIMA 1K2FA 2KWKA 3M62A 3N9OA 5H1TA 2LV9A 5DKAA 2ECVA 1FBVA 2EA6A 3HCUA 4WA6A 3LQHA 5D1KB 4WZ2A
chains in the Genus database with same CATH superfamily
5EYAF 5KH3A 2LXPC 1CHCA 5B76A 2KIZA 1WEPA 4C9ZA 4ZDTA 4CCGX 2MT5A 3E2DA 4GNGA 4MVTA 4QF3A 5B8DA 1VYXA 1WEUA 3MDBC 3M7KA 4ZQLA 3ZNIA 2IDAA 2MA6A 5LKUA 5H1VA 2LXHC 4BHWA 3FJUB 1T1HA 4X3GA 5KH7A 5LKXA 5FEYA 4AP4A 3LVQE 2F6JA 2C2LA 3N9MA 3ZYQA 3KDEC 2FFWA 3SOUA 1DCQA 1VFYA 3H7HA 3T7LA 2DSMA 4GNEA 2JRJA 4LADB 1X4IA 2Y1NA 2CSVA 4AVXA 2H0DA 2P57A 2IQJA 1WFKA 2JM3A 1X4JA 5TDWA 1MBMA 3NG2A 2G43A 4P5OB 5H9MA 1Z60A 2YW8A 2FD4A 2ECWA 3O33A 3IHPA 3L1ZB 2VPDA 2H0DB 3O70A 4YC9A 2YSJA 5LKZA 4R8PK 4OGEA 2EGMA 5C13A 2KE1A 3EB6A 4R7EA 1HYIA 2L80A 2MD8C 2CSZA 4S3OB 2M3HA 3N9QA 4YBSA 5FERA 4FJCA 2JMIA 2CKLA 2MIQA 3Q1DA 2MUMA 2VPEA 2NAAA 5FB0A 4A4BA 2M1RA 2ECNA 2YU4A 3FAOA 1JM7A 5JG6A 4R2YA 5G0FA 3C5KA 3SHBA 2QIZA 1WEEA 3DWDA 1WEOA 1WENA 5AITA 3DDTA 3O36A 2CKLB 1FP0A 2CONA 2KREA 1JM7B 3DQVR 2VJFA 4W4UA 2KWJA 4IC2A 1LDJB 4PTBA 3T9KA 2JMDA 5TDRA 2CRWA 3ZPVE 2KWNA 4F52B 2L5UA 2XOYA 2KWOA 4F1PA 2LDRA 2LGKA 2KKYA 4FO9A 2KKXA 2L43A 2M6MA 2XEUA 2VJFB 3O47A 4QF2A 5B78A 1WEQA 4V3LC 3FL2A 3O35A 4CA1A 4ZUXU 1MM3A 1X4UA 4N4FA 3ASLA 1Z6UA 2G6QA 2EXUA 3L11A 2ECJA 2E61A 2YSMA 4Z0RA 2KU3A 5FB1A 2EODA 2VJEB 5TBNA 3PLWA 3RPGB 3C6WA 4FIPA 2ECGA 1WEWA 3U5PA 2C2VS 4WZ0A 5K3QA 4YAXA 3O37A 1V87A 2XOZA 1WILA 4YATA 1G25A 4V3KC 3KNVA 4XI1A 2KGGA 2HDPA 2MNYA 1XWHA 4BBQA 5H1UA 2YYRA 2FSAA 2M85A 2YUCA 2B0OE 2OXQC 2MNZA 2E6RA 2KYUA 3EB5A 3SUBA 3PUQA 4Q6FA 2ECIA 3RPGC 2PUYA 2AN6A 2YREA 3LDYA 3FANA 2L0BA 4NN2A 5B79A 2L75A 3MHSA 3GL6A 4I7DA 2VPBA 3JUEA 2VNFA 4UP0A 5B77A 5G05B 3RTRB 1JOCA 3KV6A 4O62A 3HCTA 1MM2A 3SOXA 4PPEA 5I3LA 1WEMA 2YURA 3DPLR 3KV5A 3I2DA 5B75A 3VK6A 4I7CA 4AUQB 3LVRE 2F42A 5G04B 2JMJA 3ZVYA 4YABA 2LQ6A 4WZ3B 4LKAA 2ECTA 2M13A 2YQMA 3ZVZB 2HYED 4H9DA 2Y1MA 1RMDA 3O34A 2F6NA 2YVRA 4MSXA 2RSDA 1HYJA 2KR4A 2LGLA 4AYCA 1WE9A 2LRIC 3FM8C 4TKPB 1IYMA 4S3OC 2XP0A 2K17A 2RR4A 3U5OA 4A4CA 3V43A 2LGGA 2VJEA 2RI7A 4FK5A 1E4UA 2YQLA 4AYCB 5D1MB 3PURA 3M63A 2ZETC 3N9NA 3ZPV1 1DVPA 2XOCA 4GB0A 2CT2A 4A0CD 4OGCA 3LQJA 3U5MA 2LGVA 2DX8A 2E6SA 4QQ4A 3ZTGA 4YBTA 3T6RA 5SVIB 2L7PA 3L1XA 2PNXA 1LDKC 4UP5A 2K16A 1WESA 2LN0A 2QJ0A 3O7AA 2VPGA 2YHOA 2OWAA 2FUIA 2CSYA 4B7YC 1VD4A 1U6GB 5DINA 4UI9B 2LAUA 3PHDA 3M99A 3U5NA 3LRQA 1WGMA 5TRBA 2MKEA 2EGPA 3MHHA 5AIUA 2BAYA 5J3XA 2K1JA 2QICA 4YBMA 2MD7B 5C11A 1F62A 4O64A 1Z2QA 4LLBA 3LQIA 2YHNA 3KQIA 5SVYA 2KGIA 3FEHA 3GV4A 4N3WA 4IC3A 4L7XA 4LJNA 2FUUA 5LKTA 4B86C 5LCWB 3HCSA 1WEVA 2D8UA 2MA5A 2D8SA 2K4DA 3HTKC 3LJUX 5D1LB 2DJAA 5KH9A 4L58A 3N9PA 3N9LA 4LK9A 2YT5A 1N87A 2CRRA 3SOWA 2KFTA 1ZBDB 4GNDA 2I50A 4YADA 5TABA 2XB1A 2UZGA 4I7BA 2G45A 2VP7A 3QZVA 4Z0OA 1BORA 4A49A 2Y43A 4GNFA 1WIMA 1K2FA 2KWKA 3M62A 3N9OA 5H1TA 2LV9A 5SVIA 5DKAA 2ECVA 1FBVA 2EA6A 3HCUA 2JUNA 4WA6A 3LQHA 5D1KB 5SVXA 4WZ2A
chains in the Genus database with same CATH topology
5EYAF 5KH3A 2LXPC 1CHCA 5B76A 2KIZA 1WEPA 4C9ZA 4ZDTA 4CCGX 2MT5A 4GNGA 4MVTA 4QF3A 5B8DA 1VYXA 1WEUA 4ZQLA 3ZNIA 2IDAA 2MA6A 5LKUA 5H1VA 2LXHC 4BHWA 1T1HA 4X3GA 5KH7A 5LKXA 5FEYA 4AP4A 2F6JA 2C2LA 3N9MA 3ZYQA 3SOUA 1VFYA 3T7LA 4GNEA 2JRJA 4LADB 1X4IA 2Y1NA 4AVXA 2H0DA 1WFKA 1X4JA 5TDWA 3NG2A 2G43A 4P5OB 5H9MA 1Z60A 2YW8A 2ECWA 3O33A 3IHPA 3L1ZB 2VPDA 2H0DB 3O70A 4YC9A 2YSJA 5LKZA 4R8PK 5C13A 2KE1A 3EB6A 4R7EA 1HYIA 2L80A 2MD8C 2CSZA 4S3OB 2M3HA 3N9QA 4YBSA 5FERA 4FJCA 2JMIA 2CKLA 2MIQA 2MUMA 2VPEA 2NAAA 5FB0A 4A4BA 2M1RA 2ECNA 2YU4A 1JM7A 5JG6A 4R2YA 5G0FA 3C5KA 3SHBA 2QIZA 1WEEA 1WEOA 1WENA 5AITA 3O36A 2CKLB 1FP0A 2KREA 1JM7B 3DQVR 2VJFA 4W4UA 2KWJA 4IC2A 1LDJB 4PTBA 2JMDA 5TDRA 3ZPVE 2KWNA 4F52B 2L5UA 2KWOA 2LDRA 2LGKA 4FO9A 2L43A 2M6MA 2XEUA 2VJFB 4QF2A 5B78A 1WEQA 4V3LC 3FL2A 3O35A 4CA1A 4ZUXU 1MM3A 1X4UA 4N4FA 3ASLA 1Z6UA 2G6QA 3L11A 2ECJA 2YSMA 2KU3A 5FB1A 2EODA 2VJEB 5TBNA 3RPGB 3C6WA 2ECGA 4FIPA 1WEWA 3U5PA 2C2VS 4WZ0A 4YAXA 3O37A 1V87A 1WILA 4YATA 1G25A 4V3KC 3KNVA 4XI1A 2KGGA 2HDPA 2MNYA 1XWHA 4BBQA 5H1UA 2YYRA 2FSAA 2M85A 2YUCA 2OXQC 2MNZA 2E6RA 2KYUA 3EB5A 3PUQA 4Q6FA 2ECIA 3RPGC 2PUYA 2AN6A 2YREA 2L0BA 4NN2A 5B79A 2L75A 3MHSA 3GL6A 4I7DA 2VPBA 2VNFA 4UP0A 5B77A 5G05B 3RTRB 1JOCA 3KV6A 3HCTA 1MM2A 3SOXA 4PPEA 5I3LA 1WEMA 2YURA 3DPLR 3KV5A 3I2DA 5B75A 3VK6A 4I7CA 4AUQB 2F42A 5G04B 2JMJA 3ZVYA 4YABA 2LQ6A 4WZ3B 4LKAA 2ECTA 2YQMA 3ZVZB 2HYED 2Y1MA 1RMDA 3O34A 2F6NA 4MSXA 2RSDA 1HYJA 2KR4A 2LGLA 4AYCA 1WE9A 2LRIC 4TKPB 1IYMA 4S3OC 2K17A 3U5OA 4A4CA 3V43A 2LGGA 2VJEA 2RI7A 4FK5A 1E4UA 2YQLA 4AYCB 5D1MB 3PURA 2ZETC 3N9NA 3M63A 3ZPV1 1DVPA 4GB0A 2CT2A 4A0CD 3LQJA 3U5MA 2LGVA 2DX8A 2E6SA 3ZTGA 4YBTA 3T6RA 3L1XA 2PNXA 1LDKC 4UP5A 2K16A 1WESA 2LN0A 2QJ0A 3O7AA 2VPGA 2YHOA 2FUIA 2CSYA 4B7YC 1VD4A 1U6GB 5DINA 4UI9B 3PHDA 3M99A 3U5NA 3LRQA 1WGMA 5TRBA 2EGPA 3MHHA 5AIUA 2BAYA 5J3XA 2K1JA 2QICA 4YBMA 2MD7B 5C11A 1F62A 4O64A 1Z2QA 4LLBA 3LQIA 2YHNA 3KQIA 2KGIA 3GV4A 4N3WA 4IC3A 4L7XA 4LJNA 2FUUA 5LKTA 4B86C 5LCWB 3HCSA 1WEVA 2MA5A 2D8SA 2K4DA 3HTKC 5D1LB 5KH9A 4L58A 3N9PA 3N9LA 4LK9A 2YT5A 1N87A 3SOWA 2KFTA 1ZBDB 4GNDA 2I50A 4YADA 5TABA 2XB1A 2UZGA 4I7BA 2G45A 2VP7A 3QZVA 1BORA 4A49A 2Y43A 4GNFA 1WIMA 1K2FA 2KWKA 3M62A 3N9OA 5H1TA 2LV9A 5DKAA 2ECVA 1FBVA 2EA6A 3HCUA 4WA6A 3LQHA 5D1KB 4WZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EYA F;  5KH3 A;  2LXP C;  1CHC A;  5B76 A;  2KIZ A;  1WEP A;  4C9Z A;  4ZDT A;  4CCG X;  2MT5 A;  4GNG A;  4MVT A;  4QF3 A;  5B8D A;  1VYX A;  1WEU A;  4ZQL A;  3ZNI A;  2IDA A;  2MA6 A;  5LKU A;  5H1V A;  2LXH C;  4BHW A;  1T1H A;  4X3G A;  5KH7 A;  5LKX A;  5FEY A;  4AP4 A;  2F6J A;  2C2L A;  3N9M A;  3ZYQ A;  3SOU A;  1VFY A;  3T7L A;  4GNE A;  2JRJ A;  4LAD B;  1X4I A;  2Y1N A;  4AVX A;  2H0D A;  1WFK A;  1X4J A;  5TDW A;  3NG2 A;  2G43 A;  4P5O B;  5H9M A;  1Z60 A;  2YW8 A;  2ECW A;  3O33 A;  3IHP A;  3L1Z B;  2VPD A;  2H0D B;  3O70 A;  4YC9 A;  2YSJ A;  5LKZ A;  4R8P K;  5C13 A;  2KE1 A;  3EB6 A;  4R7E A;  1HYI A;  2L80 A;  2MD8 C;  2CSZ A;  4S3O B;  2M3H A;  3N9Q A;  4YBS A;  5FER A;  4FJC A;  2JMI A;  2CKL A;  2MIQ A;  2MUM A;  2VPE A;  2NAA A;  5FB0 A;  4A4B A;  2M1R A;  2ECN A;  2YU4 A;  1JM7 A;  5JG6 A;  4R2Y A;  5G0F A;  3C5K A;  3SHB A;  2QIZ A;  1WEE A;  1WEO A;  1WEN A;  5AIT A;  3O36 A;  2CKL B;  1FP0 A;  2KRE A;  1JM7 B;  3DQV R;  2VJF A;  4W4U A;  2KWJ A;  4IC2 A;  1LDJ B;  4PTB A;  2JMD A;  5TDR A;  3ZPV E;  2KWN A;  4F52 B;  2L5U A;  2KWO A;  2LDR A;  2LGK A;  4FO9 A;  2L43 A;  2M6M A;  2XEU A;  2VJF B;  4QF2 A;  5B78 A;  1WEQ A;  4V3L C;  3FL2 A;  3O35 A;  4CA1 A;  4ZUX U;  1MM3 A;  1X4U A;  4N4F A;  3ASL A;  1Z6U A;  2G6Q A;  3L11 A;  2ECJ A;  2YSM A;  2KU3 A;  5FB1 A;  2EOD A;  2VJE B;  5TBN A;  3RPG B;  3C6W A;  2ECG A;  4FIP A;  1WEW A;  3U5P A;  2C2V S;  4WZ0 A;  4YAX A;  3O37 A;  1V87 A;  1WIL A;  4YAT A;  1G25 A;  4V3K C;  3KNV A;  4XI1 A;  2KGG A;  2HDP A;  2MNY A;  1XWH A;  4BBQ A;  5H1U A;  2YYR A;  2FSA A;  2M85 A;  2YUC A;  2OXQ C;  2MNZ A;  2E6R A;  2KYU A;  3EB5 A;  3PUQ A;  4Q6F A;  2ECI A;  3RPG C;  2PUY A;  2AN6 A;  2YRE A;  2L0B A;  4NN2 A;  5B79 A;  2L75 A;  3MHS A;  3GL6 A;  4I7D A;  2VPB A;  2VNF A;  4UP0 A;  5B77 A;  5G05 B;  3RTR B;  1JOC A;  3KV6 A;  3HCT A;  1MM2 A;  3SOX A;  4PPE A;  5I3L A;  1WEM A;  2YUR A;  3DPL R;  3KV5 A;  3I2D A;  5B75 A;  3VK6 A;  4I7C A;  4AUQ B;  2F42 A;  5G04 B;  2JMJ A;  3ZVY A;  4YAB A;  2LQ6 A;  4WZ3 B;  4LKA A;  2ECT A;  2YQM A;  3ZVZ B;  2HYE D;  2Y1M A;  1RMD A;  3O34 A;  2F6N A;  4MSX A;  2RSD A;  1HYJ A;  2KR4 A;  2LGL A;  4AYC A;  1WE9 A;  2LRI C;  4TKP B;  1IYM A;  4S3O C;  2K17 A;  3U5O A;  4A4C A;  3V43 A;  2LGG A;  2VJE A;  2RI7 A;  4FK5 A;  1E4U A;  2YQL A;  4AYC B;  5D1M B;  3PUR A;  2ZET C;  3N9N A;  3M63 A;  3ZPV 1;  1DVP A;  4GB0 A;  2CT2 A;  4A0C D;  3LQJ A;  3U5M A;  2LGV A;  2DX8 A;  2E6S A;  3ZTG A;  4YBT A;  3T6R A;  3L1X A;  2PNX A;  1LDK C;  4UP5 A;  2K16 A;  1WES A;  2LN0 A;  2QJ0 A;  3O7A A;  2VPG A;  2YHO A;  2FUI A;  2CSY A;  4B7Y C;  1VD4 A;  1U6G B;  5DIN A;  4UI9 B;  3PHD A;  3M99 A;  3U5N A;  3LRQ A;  1WGM A;  5TRB A;  2EGP A;  3MHH A;  5AIU A;  2BAY A;  5J3X A;  2K1J A;  2QIC A;  4YBM A;  2MD7 B;  5C11 A;  1F62 A;  4O64 A;  1Z2Q A;  4LLB A;  3LQI A;  2YHN A;  3KQI A;  2KGI A;  3GV4 A;  4N3W A;  4IC3 A;  4L7X A;  4LJN A;  2FUU A;  5LKT A;  4B86 C;  5LCW B;  3HCS A;  1WEV A;  2MA5 A;  2D8S A;  2K4D A;  3HTK C;  5D1L B;  5KH9 A;  4L58 A;  3N9P A;  3N9L A;  4LK9 A;  2YT5 A;  1N87 A;  3SOW A;  2KFT A;  1ZBD B;  4GND A;  2I50 A;  4YAD A;  5TAB A;  2XB1 A;  2UZG A;  4I7B A;  2G45 A;  2VP7 A;  3QZV A;  1BOR A;  4A49 A;  2Y43 A;  4GNF A;  1WIM A;  1K2F A;  2KWK A;  3M62 A;  3N9O A;  5H1T A;  2LV9 A;  5DKA A;  2ECV A;  1FBV A;  2EA6 A;  3HCU A;  4WA6 A;  3LQH A;  5D1K B;  4WZ2 A; 
#chains in the Genus database with same CATH topology
 5EYA F;  5KH3 A;  2LXP C;  1CHC A;  5B76 A;  2KIZ A;  1WEP A;  4C9Z A;  4ZDT A;  4CCG X;  2MT5 A;  3E2D A;  4GNG A;  4MVT A;  4QF3 A;  5B8D A;  1VYX A;  1WEU A;  3MDB C;  3M7K A;  4ZQL A;  3ZNI A;  2IDA A;  2MA6 A;  5LKU A;  5H1V A;  2LXH C;  4BHW A;  3FJU B;  1T1H A;  4X3G A;  5KH7 A;  5LKX A;  5FEY A;  4AP4 A;  3LVQ E;  2F6J A;  2C2L A;  3N9M A;  3ZYQ A;  3KDE C;  2FFW A;  3SOU A;  1DCQ A;  1VFY A;  3H7H A;  3T7L A;  2DSM A;  4GNE A;  2JRJ A;  4LAD B;  1X4I A;  2Y1N A;  2CSV A;  4AVX A;  2H0D A;  2P57 A;  2IQJ A;  1WFK A;  2JM3 A;  1X4J A;  5TDW A;  1MBM A;  3NG2 A;  2G43 A;  4P5O B;  5H9M A;  1Z60 A;  2YW8 A;  2FD4 A;  2ECW A;  3O33 A;  3IHP A;  3L1Z B;  2VPD A;  2H0D B;  3O70 A;  4YC9 A;  2YSJ A;  5LKZ A;  4R8P K;  4OGE A;  2EGM A;  5C13 A;  2KE1 A;  3EB6 A;  4R7E A;  1HYI A;  2L80 A;  2MD8 C;  2CSZ A;  4S3O B;  2M3H A;  3N9Q A;  4YBS A;  5FER A;  4FJC A;  2JMI A;  2CKL A;  2MIQ A;  3Q1D A;  2MUM A;  2VPE A;  2NAA A;  5FB0 A;  4A4B A;  2M1R A;  2ECN A;  2YU4 A;  3FAO A;  1JM7 A;  5JG6 A;  4R2Y A;  5G0F A;  3C5K A;  3SHB A;  2QIZ A;  1WEE A;  3DWD A;  1WEO A;  1WEN A;  5AIT A;  3DDT A;  3O36 A;  2CKL B;  1FP0 A;  2CON A;  2KRE A;  1JM7 B;  3DQV R;  2VJF A;  4W4U A;  2KWJ A;  4IC2 A;  1LDJ B;  4PTB A;  3T9K A;  2JMD A;  5TDR A;  2CRW A;  3ZPV E;  2KWN A;  4F52 B;  2L5U A;  2XOY A;  2KWO A;  4F1P A;  2LDR A;  2LGK A;  2KKY A;  4FO9 A;  2KKX A;  2L43 A;  2M6M A;  2XEU A;  2VJF B;  3O47 A;  4QF2 A;  5B78 A;  1WEQ A;  4V3L C;  3FL2 A;  3O35 A;  4CA1 A;  4ZUX U;  1MM3 A;  1X4U A;  4N4F A;  3ASL A;  1Z6U A;  2G6Q A;  2EXU A;  3L11 A;  2ECJ A;  2E61 A;  2YSM A;  4Z0R A;  2KU3 A;  5FB1 A;  2EOD A;  2VJE B;  5TBN A;  3PLW A;  3RPG B;  3C6W A;  4FIP A;  2ECG A;  1WEW A;  3U5P A;  2C2V S;  4WZ0 A;  5K3Q A;  4YAX A;  3O37 A;  1V87 A;  2XOZ A;  1WIL A;  4YAT A;  1G25 A;  4V3K C;  3KNV A;  4XI1 A;  2KGG A;  2HDP A;  2MNY A;  1XWH A;  4BBQ A;  5H1U A;  2YYR A;  2FSA A;  2M85 A;  2YUC A;  2B0O E;  2OXQ C;  2MNZ A;  2E6R A;  2KYU A;  3EB5 A;  3SUB A;  3PUQ A;  4Q6F A;  2ECI A;  3RPG C;  2PUY A;  2AN6 A;  2YRE A;  3LDY A;  3FAN A;  2L0B A;  4NN2 A;  5B79 A;  2L75 A;  3MHS A;  3GL6 A;  4I7D A;  2VPB A;  3JUE A;  2VNF A;  4UP0 A;  5B77 A;  5G05 B;  3RTR B;  1JOC A;  3KV6 A;  4O62 A;  3HCT A;  1MM2 A;  3SOX A;  4PPE A;  5I3L A;  1WEM A;  2YUR A;  3DPL R;  3KV5 A;  3I2D A;  5B75 A;  3VK6 A;  4I7C A;  4AUQ B;  3LVR E;  2F42 A;  5G04 B;  2JMJ A;  3ZVY A;  4YAB A;  2LQ6 A;  4WZ3 B;  4LKA A;  2ECT A;  2M13 A;  2YQM A;  3ZVZ B;  2HYE D;  4H9D A;  2Y1M A;  1RMD A;  3O34 A;  2F6N A;  2YVR A;  4MSX A;  2RSD A;  1HYJ A;  2KR4 A;  2LGL A;  4AYC A;  1WE9 A;  2LRI C;  3FM8 C;  4TKP B;  1IYM A;  4S3O C;  2XP0 A;  2K17 A;  2RR4 A;  3U5O A;  4A4C A;  3V43 A;  2LGG A;  2VJE A;  2RI7 A;  4FK5 A;  1E4U A;  2YQL A;  4AYC B;  5D1M B;  3PUR A;  3M63 A;  2ZET C;  3N9N A;  3ZPV 1;  1DVP A;  2XOC A;  4GB0 A;  2CT2 A;  4A0C D;  4OGC A;  3LQJ A;  3U5M A;  2LGV A;  2DX8 A;  2E6S A;  4QQ4 A;  3ZTG A;  4YBT A;  3T6R A;  5SVI B;  2L7P A;  3L1X A;  2PNX A;  1LDK C;  4UP5 A;  2K16 A;  1WES A;  2LN0 A;  2QJ0 A;  3O7A A;  2VPG A;  2YHO A;  2OWA A;  2FUI A;  2CSY A;  4B7Y C;  1VD4 A;  1U6G B;  5DIN A;  4UI9 B;  2LAU A;  3PHD A;  3M99 A;  3U5N A;  3LRQ A;  1WGM A;  5TRB A;  2MKE A;  2EGP A;  3MHH A;  5AIU A;  2BAY A;  5J3X A;  2K1J A;  2QIC A;  4YBM A;  2MD7 B;  5C11 A;  1F62 A;  4O64 A;  1Z2Q A;  4LLB A;  3LQI A;  2YHN A;  3KQI A;  5SVY A;  2KGI A;  3FEH A;  3GV4 A;  4N3W A;  4IC3 A;  4L7X A;  4LJN A;  2FUU A;  5LKT A;  4B86 C;  5LCW B;  3HCS A;  1WEV A;  2D8U A;  2MA5 A;  2D8S A;  2K4D A;  3HTK C;  3LJU X;  5D1L B;  2DJA A;  5KH9 A;  4L58 A;  3N9P A;  3N9L A;  4LK9 A;  2YT5 A;  1N87 A;  2CRR A;  3SOW A;  2KFT A;  1ZBD B;  4GND A;  2I50 A;  4YAD A;  5TAB A;  2XB1 A;  2UZG A;  4I7B A;  2G45 A;  2VP7 A;  3QZV A;  4Z0O A;  1BOR A;  4A49 A;  2Y43 A;  4GNF A;  1WIM A;  1K2F A;  2KWK A;  3M62 A;  3N9O A;  5H1T A;  2LV9 A;  5SVI A;  5DKA A;  2ECV A;  1FBV A;  2EA6 A;  3HCU A;  2JUN A;  4WA6 A;  3LQH A;  5D1K B;  5SVX A;  4WZ2 A; 
#chains in the Genus database with same CATH homology
 5EYA F;  5KH3 A;  2LXP C;  1CHC A;  5B76 A;  2KIZ A;  1WEP A;  4C9Z A;  4ZDT A;  4CCG X;  2MT5 A;  4GNG A;  4MVT A;  4QF3 A;  5B8D A;  1VYX A;  1WEU A;  4ZQL A;  3ZNI A;  2IDA A;  2MA6 A;  5LKU A;  5H1V A;  2LXH C;  4BHW A;  1T1H A;  4X3G A;  5KH7 A;  5LKX A;  5FEY A;  4AP4 A;  2F6J A;  2C2L A;  3N9M A;  3ZYQ A;  3SOU A;  1VFY A;  3T7L A;  4GNE A;  2JRJ A;  4LAD B;  1X4I A;  2Y1N A;  4AVX A;  2H0D A;  1WFK A;  1X4J A;  5TDW A;  3NG2 A;  2G43 A;  4P5O B;  5H9M A;  1Z60 A;  2YW8 A;  2ECW A;  3O33 A;  3IHP A;  3L1Z B;  2VPD A;  2H0D B;  3O70 A;  4YC9 A;  2YSJ A;  5LKZ A;  4R8P K;  5C13 A;  2KE1 A;  3EB6 A;  4R7E A;  1HYI A;  2L80 A;  2MD8 C;  2CSZ A;  4S3O B;  2M3H A;  3N9Q A;  4YBS A;  5FER A;  4FJC A;  2JMI A;  2CKL A;  2MIQ A;  2MUM A;  2VPE A;  2NAA A;  5FB0 A;  4A4B A;  2M1R A;  2ECN A;  2YU4 A;  1JM7 A;  5JG6 A;  4R2Y A;  5G0F A;  3C5K A;  3SHB A;  2QIZ A;  1WEE A;  1WEO A;  1WEN A;  5AIT A;  3O36 A;  2CKL B;  1FP0 A;  2KRE A;  1JM7 B;  3DQV R;  2VJF A;  4W4U A;  2KWJ A;  4IC2 A;  1LDJ B;  4PTB A;  2JMD A;  5TDR A;  3ZPV E;  2KWN A;  4F52 B;  2L5U A;  2KWO A;  2LDR A;  2LGK A;  4FO9 A;  2L43 A;  2M6M A;  2XEU A;  2VJF B;  4QF2 A;  5B78 A;  1WEQ A;  4V3L C;  3FL2 A;  3O35 A;  4CA1 A;  4ZUX U;  1MM3 A;  1X4U A;  4N4F A;  3ASL A;  1Z6U A;  2G6Q A;  3L11 A;  2ECJ A;  2YSM A;  2KU3 A;  5FB1 A;  2EOD A;  2VJE B;  5TBN A;  3RPG B;  3C6W A;  2ECG A;  4FIP A;  1WEW A;  3U5P A;  2C2V S;  4WZ0 A;  4YAX A;  3O37 A;  1V87 A;  1WIL A;  4YAT A;  1G25 A;  4V3K C;  3KNV A;  4XI1 A;  2KGG A;  2HDP A;  2MNY A;  1XWH A;  4BBQ A;  5H1U A;  2YYR A;  2FSA A;  2M85 A;  2YUC A;  2OXQ C;  2MNZ A;  2E6R A;  2KYU A;  3EB5 A;  3PUQ A;  4Q6F A;  2ECI A;  3RPG C;  2PUY A;  2AN6 A;  2YRE A;  2L0B A;  4NN2 A;  5B79 A;  2L75 A;  3MHS A;  3GL6 A;  4I7D A;  2VPB A;  2VNF A;  4UP0 A;  5B77 A;  5G05 B;  3RTR B;  1JOC A;  3KV6 A;  3HCT A;  1MM2 A;  3SOX A;  4PPE A;  5I3L A;  1WEM A;  2YUR A;  3DPL R;  3KV5 A;  3I2D A;  5B75 A;  3VK6 A;  4I7C A;  4AUQ B;  2F42 A;  5G04 B;  2JMJ A;  3ZVY A;  4YAB A;  2LQ6 A;  4WZ3 B;  4LKA A;  2ECT A;  2YQM A;  3ZVZ B;  2HYE D;  2Y1M A;  1RMD A;  3O34 A;  2F6N A;  4MSX A;  2RSD A;  1HYJ A;  2KR4 A;  2LGL A;  4AYC A;  1WE9 A;  2LRI C;  4TKP B;  1IYM A;  4S3O C;  2K17 A;  3U5O A;  4A4C A;  3V43 A;  2LGG A;  2VJE A;  2RI7 A;  4FK5 A;  1E4U A;  2YQL A;  4AYC B;  5D1M B;  3PUR A;  2ZET C;  3N9N A;  3M63 A;  3ZPV 1;  1DVP A;  4GB0 A;  2CT2 A;  4A0C D;  3LQJ A;  3U5M A;  2LGV A;  2DX8 A;  2E6S A;  3ZTG A;  4YBT A;  3T6R A;  3L1X A;  2PNX A;  1LDK C;  4UP5 A;  2K16 A;  1WES A;  2LN0 A;  2QJ0 A;  3O7A A;  2VPG A;  2YHO A;  2FUI A;  2CSY A;  4B7Y C;  1VD4 A;  1U6G B;  5DIN A;  4UI9 B;  3PHD A;  3M99 A;  3U5N A;  3LRQ A;  1WGM A;  5TRB A;  2EGP A;  3MHH A;  5AIU A;  2BAY A;  5J3X A;  2K1J A;  2QIC A;  4YBM A;  2MD7 B;  5C11 A;  1F62 A;  4O64 A;  1Z2Q A;  4LLB A;  3LQI A;  2YHN A;  3KQI A;  2KGI A;  3GV4 A;  4N3W A;  4IC3 A;  4L7X A;  4LJN A;  2FUU A;  5LKT A;  4B86 C;  5LCW B;  3HCS A;  1WEV A;  2MA5 A;  2D8S A;  2K4D A;  3HTK C;  5D1L B;  5KH9 A;  4L58 A;  3N9P A;  3N9L A;  4LK9 A;  2YT5 A;  1N87 A;  3SOW A;  2KFT A;  1ZBD B;  4GND A;  2I50 A;  4YAD A;  5TAB A;  2XB1 A;  2UZG A;  4I7B A;  2G45 A;  2VP7 A;  3QZV A;  1BOR A;  4A49 A;  2Y43 A;  4GNF A;  1WIM A;  1K2F A;  2KWK A;  3M62 A;  3N9O A;  5H1T A;  2LV9 A;  5DKA A;  2ECV A;  1FBV A;  2EA6 A;  3HCU A;  4WA6 A;  3LQH A;  5D1K B;  4WZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...