5FEYA

Trim32 ring
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
78
Chain Sequence
SHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASGVRCPFCSKITRITQLTDNLTVLKIIDTAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase TRIM32
publication title Functional role of TRIM E3 ligase oligomerization and regulation of catalytic activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 16
structure length 78
sequence length 84
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13445 zf-RING_UBOX RING-type zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5feyA00
2ECGA 4CCGX 2QJ0A 4MSXA 4N4FA 5LKZA 3SOUA 4WZ0A 5FEYA 2VNFA 3N9NA 1WEMA 2ECTA 2M1RA 5H1TA 5B76A 2MUMA 4V3LC 4ZQLA 5G04B 5KH3A 2VJEA 3ZVYA 3KV5A 4BBQA 1LDKC 4YAXA 4A49A 1WEOA 3KV6A 2RI7A 5J3XA 2MA5A 2KFTA 2YQLA 4L7XA 3N9OA 3DPLR 4NN2A 3ZPV1 4UP0A 5AITA 4AP4A 2JRJA 3LQJA 3HCUA 2ECVA 3MHSA 4LKAA 4UI9B 2E6RA 3U5NA 4N3WA 4PTBA 3U5PA 4GNDA 3PHDA 2VJFA 2NAAA 2XEUA 1VD4A 2YSJA 2ZETC 4A0CD 2LQ6A 2FSAA 2CT2A 2L0BA 3GV4A 4B7YC 3EB5A 4I7CA 4ZDTA 5TBNA 3RTRB 2C2VS 2LXHC 5C11A 3ZPVE 2JMIA 4L58A 3SOXA 4R2YA 2MD8C 2JMJA 3GL6A 1DVPA 2Y43A 2EODA 4X3GA 3O7AA 1WEVA 3HCSA 4F52B 1BORA 4FK5A 5LKTA 4YADA 4YABA 2M6MA 2MNYA 2LN0A 3QZVA 2FUIA 2KR4A 4GNGA 4GNEA 2ECWA 2LV9A 2YUCA 4AUQB 2K1JA 5DKAA 2CSZA 1ZBDB 2F6NA 3T7LA 4FO9A 4LADB 4QF3A 1MM3A 2IDAA 1X4UA 2QIZA 5G05B 1FP0A 3N9MA 1E4UA 2PNXA 3C6WA 5JG6A 3PUQA 4MVTA 1WEQA 5TRBA 3N9QA 5H1VA 2K4DA 4I7DA 1RMDA 1LDJB 2F6JA 1XWHA 4XI1A 2YT5A 2EGPA 2MT5A 5D1KB 5FB0A 3EB6A 2CKLB 2I50A 2HDPA 2DX8A 2YSMA 3LRQA 5AIUA 2M85A 1IYMA 5DINA 3SOWA 4IC2A 4GB0A 2YREA 3HCTA 2ECIA 5G0FA 1WEEA 4I7BA 2YQMA 4QF2A 2D8SA 2L75A 2LRIC 2C2LA 5B78A 4YATA 3O33A 3M99A 1HYIA 2YU4A 4A4BA 2YW8A 2G6QA 4S3OC 2YURA 4FJCA 2KWNA 2KGIA 4IC3A 4YC9A 1JM7B 2VPEA 4UP5A 2L5UA 3L1ZB 2H0DB 1WEUA 2FUUA 2LGKA 1CHCA 3IHPA 3KQIA 4YBSA 1WGMA 2CSYA 2MIQA 2KE1A 1WENA 5D1MB 4AYCB 1WESA 2RSDA 4A4CA 4GNFA 3RPGB 5LKXA 1WILA 2KWKA 1WEPA 4TKPB 4O64A 1X4JA 4B86C 5B75A 3DQVR 2K16A 3T6RA 3RPGC 4YBTA 4CA1A 4WA6A 4BHWA 2BAYA 4ZUXU 5KH7A 2K17A 4Q6FA 3U5OA 3O37A 2KYUA 4YBMA 3FL2A 3U5MA 2YHNA 3KNVA 2MNZA 4C9ZA 2E6SA 3N9PA 2QICA 1JOCA 2UZGA 1VYXA 4PPEA 4WZ2A 5H9MA 2PUYA 1T1HA 1MM2A 2JMDA 3ZVZB 2VJEB 2VPGA 3O34A 2L43A 4AVXA 3N9LA 5B77A 1U6GB 5TABA 5FERA 3C5KA 3L11A 2F42A 4W4UA 3ZYQA 3PURA 2KWJA 2LXPC 2OXQC 3SHBA 4LLBA 2KREA 1V87A 2CKLA 4LK9A 4P5OB 4FIPA 1N87A 4S3OB 2YYRA 3NG2A 1Z6UA 4LJNA 2AN6A 2LGVA 5I3LA 1FBVA 3O70A 2Y1NA 2Y1MA 2KGGA 3VK6A 2KWOA 5LKUA 2YHOA 1Z2QA 5D1LB 2VJFB 5LCWB 4R7EA 3I2DA 5C13A 2KIZA 3O36A 4R8PK 1JM7A 1WFKA 3ASLA 2G43A 1WE9A 3M63A 3LQIA 2VPBA 2LGLA 5TDRA 2H0DA 3ZTGA 2L80A 3LQHA 1WIMA 2VPDA 1K2FA 2XB1A 3V43A 2MD7B 4V3KC 4AYCA 2LDRA 2MA6A 5H1UA 2ECNA 3HTKC 4WZ3B 3MHHA 2KU3A 3L1XA 1Z60A 3O35A 5B79A 2M3HA 5KH9A 2LGGA 1G25A 3M62A 1X4IA 1F62A 1VFYA 1HYJA 5EYAF 2VP7A 2HYED 5B8DA 5FB1A 2G45A 2ECJA 5TDWA 3ZNIA 2EA6A 1WEWA
chains in the Genus database with same CATH superfamily
2ECGA 4CCGX 2QJ0A 4MSXA 4N4FA 5LKZA 3SOUA 4WZ0A 5FEYA 2VNFA 3N9NA 1WEMA 2ECTA 2M1RA 5H1TA 5B76A 2B0OE 2MUMA 4V3LC 4ZQLA 5G04B 5KH3A 2XOZA 2VJEA 3ZVYA 3KV5A 4BBQA 1LDKC 4YAXA 4A49A 1WEOA 3KV6A 2RI7A 1MBMA 3FEHA 5J3XA 2MA5A 4Z0OA 4QQ4A 2KFTA 2YQLA 2XP0A 4L7XA 3N9OA 3DPLR 4NN2A 3ZPV1 4UP0A 3FM8C 5AITA 4AP4A 2JRJA 2MKEA 3LQJA 4OGCA 3HCUA 2ECVA 3MHSA 4LKAA 4UI9B 2E6RA 3Q1DA 3U5NA 4N3WA 4PTBA 3MDBC 3U5PA 4GNDA 3PHDA 2VJFA 2NAAA 3KDEC 2XEUA 1VD4A 2YSJA 2ZETC 4A0CD 2LQ6A 2FSAA 2CT2A 2L0BA 3GV4A 4B7YC 3EB5A 2P57A 4I7CA 4ZDTA 5TBNA 3RTRB 2C2VS 2LXHC 5C11A 3ZPVE 2JMIA 4L58A 3SOXA 4R2YA 2MD8C 2JMJA 3GL6A 1DVPA 2Y43A 2EODA 4X3GA 3O7AA 1WEVA 3HCSA 4F52B 1BORA 4FK5A 3DDTA 5LKTA 4YADA 4YABA 2M6MA 2MNYA 2LN0A 3QZVA 2FUIA 2EGMA 2KR4A 4GNGA 4GNEA 2ECWA 2LV9A 2YUCA 3E2DA 4AUQB 2K1JA 5DKAA 2CSZA 1ZBDB 2F6NA 3T7LA 4FO9A 4LADB 4QF3A 3O47A 1MM3A 2IDAA 1X4UA 2QIZA 5G05B 1FP0A 3N9MA 1DCQA 1E4UA 2PNXA 3C6WA 5JG6A 3PUQA 4MVTA 1WEQA 5TRBA 3N9QA 5SVIB 5H1VA 2K4DA 4I7DA 1RMDA 1LDJB 2F6JA 1XWHA 4XI1A 2YT5A 2EGPA 2CRWA 2MT5A 5D1KB 5FB0A 4Z0RA 3EB6A 2EXUA 2CKLB 3H7HA 2I50A 2HDPA 2DX8A 2YSMA 3LRQA 5AIUA 2M85A 5SVYA 1IYMA 5DINA 3SOWA 4IC2A 4GB0A 2YREA 2DSMA 2CRRA 3HCTA 2ECIA 5G0FA 1WEEA 4I7BA 2YQMA 4QF2A 2D8SA 2L75A 2LRIC 2C2LA 5B78A 4YATA 3LJUX 3O33A 3M99A 1HYIA 3PLWA 2YU4A 2E61A 3T9KA 4A4BA 2YW8A 2G6QA 2FD4A 4S3OC 2YURA 2YVRA 2CSVA 4FJCA 2KWNA 2KGIA 4IC3A 2M13A 4YC9A 1JM7B 2VPEA 4F1PA 2D8UA 4UP5A 2L5UA 3L1ZB 2H0DB 1WEUA 2FUUA 2LGKA 1CHCA 3IHPA 3KQIA 4YBSA 1WGMA 2CSYA 2OWAA 2MIQA 2KE1A 1WENA 5D1MB 4AYCB 1WESA 2RSDA 3DWDA 4A4CA 4GNFA 3RPGB 5LKXA 1WILA 2KWKA 1WEPA 4TKPB 4O64A 1X4JA 4B86C 5B75A 3DQVR 2K16A 3T6RA 3RPGC 4YBTA 4CA1A 4WA6A 4BHWA 2BAYA 3FAOA 4ZUXU 5KH7A 2K17A 4Q6FA 3U5OA 3JUEA 3FANA 3O37A 2CONA 2KKXA 2KYUA 4YBMA 3LDYA 3FL2A 3U5MA 2RR4A 2YHNA 3LVRE 3KNVA 2MNZA 4C9ZA 2E6SA 3N9PA 2QICA 1JOCA 2UZGA 2JUNA 1VYXA 4PPEA 4WZ2A 5H9MA 2PUYA 1T1HA 1MM2A 2JMDA 3ZVZB 2VJEB 2VPGA 3O34A 2L43A 3LVQE 5SVIA 4AVXA 3N9LA 5B77A 1U6GB 5TABA 5FERA 3C5KA 3L11A 2F42A 4W4UA 3ZYQA 3PURA 2KWJA 2LXPC 2OXQC 3SHBA 4LLBA 2KREA 1V87A 2CKLA 4LK9A 4P5OB 4FIPA 1N87A 2XOYA 4S3OB 2YYRA 3NG2A 1Z6UA 4LJNA 2AN6A 2LGVA 2FFWA 5I3LA 1FBVA 2L7PA 3O70A 2Y1NA 3M7KA 2Y1MA 2KGGA 3VK6A 3FJUB 2KWOA 5LKUA 5K3QA 2YHOA 1Z2QA 5D1LB 2VJFB 5LCWB 4R7EA 3I2DA 5C13A 2KIZA 3O36A 4R8PK 2XOCA 3SUBA 1JM7A 1WFKA 3ASLA 2G43A 2DJAA 1WE9A 2LAUA 3M63A 3LQIA 2VPBA 2LGLA 5TDRA 2H0DA 3ZTGA 2L80A 3LQHA 1WIMA 2VPDA 1K2FA 2IQJA 2XB1A 2MD7B 4V3KC 5SVXA 3V43A 4AYCA 4H9DA 2LDRA 2MA6A 2JM3A 4O62A 5H1UA 4OGEA 2ECNA 3HTKC 4WZ3B 3MHHA 2KU3A 3L1XA 1Z60A 3O35A 5B79A 2M3HA 5KH9A 2LGGA 1G25A 3M62A 1X4IA 1F62A 1VFYA 1HYJA 5EYAF 2KKYA 2VP7A 2HYED 5B8DA 5FB1A 2G45A 2ECJA 5TDWA 3ZNIA 2EA6A 1WEWA
chains in the Genus database with same CATH topology
2ECGA 4CCGX 2QJ0A 4MSXA 4N4FA 5LKZA 3SOUA 4WZ0A 5FEYA 2VNFA 3N9NA 1WEMA 2ECTA 2M1RA 5H1TA 5B76A 2MUMA 4V3LC 4ZQLA 5G04B 5KH3A 2VJEA 3ZVYA 3KV5A 4BBQA 1LDKC 4YAXA 4A49A 1WEOA 3KV6A 2RI7A 5J3XA 2MA5A 2KFTA 2YQLA 4L7XA 3N9OA 3DPLR 4NN2A 3ZPV1 4UP0A 5AITA 4AP4A 2JRJA 3LQJA 3HCUA 2ECVA 3MHSA 4LKAA 4UI9B 2E6RA 3U5NA 4N3WA 4PTBA 3U5PA 4GNDA 3PHDA 2VJFA 2NAAA 2XEUA 1VD4A 2YSJA 2ZETC 4A0CD 2LQ6A 2FSAA 2CT2A 2L0BA 3GV4A 4B7YC 3EB5A 4I7CA 4ZDTA 5TBNA 3RTRB 2C2VS 2LXHC 5C11A 3ZPVE 2JMIA 4L58A 3SOXA 4R2YA 2MD8C 2JMJA 3GL6A 1DVPA 2Y43A 2EODA 4X3GA 3O7AA 1WEVA 3HCSA 4F52B 1BORA 4FK5A 5LKTA 4YADA 4YABA 2M6MA 2MNYA 2LN0A 3QZVA 2FUIA 2KR4A 4GNGA 4GNEA 2ECWA 2LV9A 2YUCA 4AUQB 2K1JA 5DKAA 2CSZA 1ZBDB 2F6NA 3T7LA 4FO9A 4LADB 4QF3A 1MM3A 2IDAA 1X4UA 2QIZA 5G05B 1FP0A 3N9MA 1E4UA 2PNXA 3C6WA 5JG6A 3PUQA 4MVTA 1WEQA 5TRBA 3N9QA 5H1VA 2K4DA 4I7DA 1RMDA 1LDJB 2F6JA 1XWHA 4XI1A 2YT5A 2EGPA 2MT5A 5D1KB 5FB0A 3EB6A 2CKLB 2I50A 2HDPA 2DX8A 2YSMA 3LRQA 5AIUA 2M85A 1IYMA 5DINA 3SOWA 4IC2A 4GB0A 2YREA 3HCTA 2ECIA 5G0FA 1WEEA 4I7BA 2YQMA 4QF2A 2D8SA 2L75A 2LRIC 2C2LA 5B78A 4YATA 3O33A 3M99A 1HYIA 2YU4A 4A4BA 2YW8A 2G6QA 4S3OC 2YURA 4FJCA 2KWNA 2KGIA 4IC3A 4YC9A 1JM7B 2VPEA 4UP5A 2L5UA 3L1ZB 2H0DB 1WEUA 2FUUA 2LGKA 1CHCA 3IHPA 3KQIA 4YBSA 1WGMA 2CSYA 2MIQA 2KE1A 1WENA 5D1MB 4AYCB 1WESA 2RSDA 4A4CA 4GNFA 3RPGB 5LKXA 1WILA 2KWKA 1WEPA 4TKPB 4O64A 1X4JA 4B86C 5B75A 3DQVR 2K16A 3T6RA 3RPGC 4YBTA 4CA1A 4WA6A 4BHWA 2BAYA 4ZUXU 5KH7A 2K17A 4Q6FA 3U5OA 3O37A 2KYUA 4YBMA 3FL2A 3U5MA 2YHNA 3KNVA 2MNZA 4C9ZA 2E6SA 3N9PA 2QICA 1JOCA 2UZGA 1VYXA 4PPEA 4WZ2A 5H9MA 2PUYA 1T1HA 1MM2A 2JMDA 3ZVZB 2VJEB 2VPGA 3O34A 2L43A 4AVXA 3N9LA 5B77A 1U6GB 5TABA 5FERA 3C5KA 3L11A 2F42A 4W4UA 3ZYQA 3PURA 2KWJA 2LXPC 2OXQC 3SHBA 4LLBA 2KREA 1V87A 2CKLA 4LK9A 4P5OB 4FIPA 1N87A 4S3OB 2YYRA 3NG2A 1Z6UA 4LJNA 2AN6A 2LGVA 5I3LA 1FBVA 3O70A 2Y1NA 2Y1MA 2KGGA 3VK6A 2KWOA 5LKUA 2YHOA 1Z2QA 5D1LB 2VJFB 5LCWB 4R7EA 3I2DA 5C13A 2KIZA 3O36A 4R8PK 1JM7A 1WFKA 3ASLA 2G43A 1WE9A 3M63A 3LQIA 2VPBA 2LGLA 5TDRA 2H0DA 3ZTGA 2L80A 3LQHA 1WIMA 2VPDA 1K2FA 2XB1A 3V43A 2MD7B 4V3KC 4AYCA 2LDRA 2MA6A 5H1UA 2ECNA 3HTKC 4WZ3B 3MHHA 2KU3A 3L1XA 1Z60A 3O35A 5B79A 2M3HA 5KH9A 2LGGA 1G25A 3M62A 1X4IA 1F62A 1VFYA 1HYJA 5EYAF 2VP7A 2HYED 5B8DA 5FB1A 2G45A 2ECJA 5TDWA 3ZNIA 2EA6A 1WEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECG A;  4CCG X;  2QJ0 A;  4MSX A;  4N4F A;  5LKZ A;  3SOU A;  4WZ0 A;  5FEY A;  2VNF A;  3N9N A;  1WEM A;  2ECT A;  2M1R A;  5H1T A;  5B76 A;  2MUM A;  4V3L C;  4ZQL A;  5G04 B;  5KH3 A;  2VJE A;  3ZVY A;  3KV5 A;  4BBQ A;  1LDK C;  4YAX A;  4A49 A;  1WEO A;  3KV6 A;  2RI7 A;  5J3X A;  2MA5 A;  2KFT A;  2YQL A;  4L7X A;  3N9O A;  3DPL R;  4NN2 A;  3ZPV 1;  4UP0 A;  5AIT A;  4AP4 A;  2JRJ A;  3LQJ A;  3HCU A;  2ECV A;  3MHS A;  4LKA A;  4UI9 B;  2E6R A;  3U5N A;  4N3W A;  4PTB A;  3U5P A;  4GND A;  3PHD A;  2VJF A;  2NAA A;  2XEU A;  1VD4 A;  2YSJ A;  2ZET C;  4A0C D;  2LQ6 A;  2FSA A;  2CT2 A;  2L0B A;  3GV4 A;  4B7Y C;  3EB5 A;  4I7C A;  4ZDT A;  5TBN A;  3RTR B;  2C2V S;  2LXH C;  5C11 A;  3ZPV E;  2JMI A;  4L58 A;  3SOX A;  4R2Y A;  2MD8 C;  2JMJ A;  3GL6 A;  1DVP A;  2Y43 A;  2EOD A;  4X3G A;  3O7A A;  1WEV A;  3HCS A;  4F52 B;  1BOR A;  4FK5 A;  5LKT A;  4YAD A;  4YAB A;  2M6M A;  2MNY A;  2LN0 A;  3QZV A;  2FUI A;  2KR4 A;  4GNG A;  4GNE A;  2ECW A;  2LV9 A;  2YUC A;  4AUQ B;  2K1J A;  5DKA A;  2CSZ A;  1ZBD B;  2F6N A;  3T7L A;  4FO9 A;  4LAD B;  4QF3 A;  1MM3 A;  2IDA A;  1X4U A;  2QIZ A;  5G05 B;  1FP0 A;  3N9M A;  1E4U A;  2PNX A;  3C6W A;  5JG6 A;  3PUQ A;  4MVT A;  1WEQ A;  5TRB A;  3N9Q A;  5H1V A;  2K4D A;  4I7D A;  1RMD A;  1LDJ B;  2F6J A;  1XWH A;  4XI1 A;  2YT5 A;  2EGP A;  2MT5 A;  5D1K B;  5FB0 A;  3EB6 A;  2CKL B;  2I50 A;  2HDP A;  2DX8 A;  2YSM A;  3LRQ A;  5AIU A;  2M85 A;  1IYM A;  5DIN A;  3SOW A;  4IC2 A;  4GB0 A;  2YRE A;  3HCT A;  2ECI A;  5G0F A;  1WEE A;  4I7B A;  2YQM A;  4QF2 A;  2D8S A;  2L75 A;  2LRI C;  2C2L A;  5B78 A;  4YAT A;  3O33 A;  3M99 A;  1HYI A;  2YU4 A;  4A4B A;  2YW8 A;  2G6Q A;  4S3O C;  2YUR A;  4FJC A;  2KWN A;  2KGI A;  4IC3 A;  4YC9 A;  1JM7 B;  2VPE A;  4UP5 A;  2L5U A;  3L1Z B;  2H0D B;  1WEU A;  2FUU A;  2LGK A;  1CHC A;  3IHP A;  3KQI A;  4YBS A;  1WGM A;  2CSY A;  2MIQ A;  2KE1 A;  1WEN A;  5D1M B;  4AYC B;  1WES A;  2RSD A;  4A4C A;  4GNF A;  3RPG B;  5LKX A;  1WIL A;  2KWK A;  1WEP A;  4TKP B;  4O64 A;  1X4J A;  4B86 C;  5B75 A;  3DQV R;  2K16 A;  3T6R A;  3RPG C;  4YBT A;  4CA1 A;  4WA6 A;  4BHW A;  2BAY A;  4ZUX U;  5KH7 A;  2K17 A;  4Q6F A;  3U5O A;  3O37 A;  2KYU A;  4YBM A;  3FL2 A;  3U5M A;  2YHN A;  3KNV A;  2MNZ A;  4C9Z A;  2E6S A;  3N9P A;  2QIC A;  1JOC A;  2UZG A;  1VYX A;  4PPE A;  4WZ2 A;  5H9M A;  2PUY A;  1T1H A;  1MM2 A;  2JMD A;  3ZVZ B;  2VJE B;  2VPG A;  3O34 A;  2L43 A;  4AVX A;  3N9L A;  5B77 A;  1U6G B;  5TAB A;  5FER A;  3C5K A;  3L11 A;  2F42 A;  4W4U A;  3ZYQ A;  3PUR A;  2KWJ A;  2LXP C;  2OXQ C;  3SHB A;  4LLB A;  2KRE A;  1V87 A;  2CKL A;  4LK9 A;  4P5O B;  4FIP A;  1N87 A;  4S3O B;  2YYR A;  3NG2 A;  1Z6U A;  4LJN A;  2AN6 A;  2LGV A;  5I3L A;  1FBV A;  3O70 A;  2Y1N A;  2Y1M A;  2KGG A;  3VK6 A;  2KWO A;  5LKU A;  2YHO A;  1Z2Q A;  5D1L B;  2VJF B;  5LCW B;  4R7E A;  3I2D A;  5C13 A;  2KIZ A;  3O36 A;  4R8P K;  1JM7 A;  1WFK A;  3ASL A;  2G43 A;  1WE9 A;  3M63 A;  3LQI A;  2VPB A;  2LGL A;  5TDR A;  2H0D A;  3ZTG A;  2L80 A;  3LQH A;  1WIM A;  2VPD A;  1K2F A;  2XB1 A;  3V43 A;  2MD7 B;  4V3K C;  4AYC A;  2LDR A;  2MA6 A;  5H1U A;  2ECN A;  3HTK C;  4WZ3 B;  3MHH A;  2KU3 A;  3L1X A;  1Z60 A;  3O35 A;  5B79 A;  2M3H A;  5KH9 A;  2LGG A;  1G25 A;  3M62 A;  1X4I A;  1F62 A;  1VFY A;  1HYJ A;  5EYA F;  2VP7 A;  2HYE D;  5B8D A;  5FB1 A;  2G45 A;  2ECJ A;  5TDW A;  3ZNI A;  2EA6 A;  1WEW A; 
#chains in the Genus database with same CATH topology
 2ECG A;  4CCG X;  2QJ0 A;  4MSX A;  4N4F A;  5LKZ A;  3SOU A;  4WZ0 A;  5FEY A;  2VNF A;  3N9N A;  1WEM A;  2ECT A;  2M1R A;  5H1T A;  5B76 A;  2B0O E;  2MUM A;  4V3L C;  4ZQL A;  5G04 B;  5KH3 A;  2XOZ A;  2VJE A;  3ZVY A;  3KV5 A;  4BBQ A;  1LDK C;  4YAX A;  4A49 A;  1WEO A;  3KV6 A;  2RI7 A;  1MBM A;  3FEH A;  5J3X A;  2MA5 A;  4Z0O A;  4QQ4 A;  2KFT A;  2YQL A;  2XP0 A;  4L7X A;  3N9O A;  3DPL R;  4NN2 A;  3ZPV 1;  4UP0 A;  3FM8 C;  5AIT A;  4AP4 A;  2JRJ A;  2MKE A;  3LQJ A;  4OGC A;  3HCU A;  2ECV A;  3MHS A;  4LKA A;  4UI9 B;  2E6R A;  3Q1D A;  3U5N A;  4N3W A;  4PTB A;  3MDB C;  3U5P A;  4GND A;  3PHD A;  2VJF A;  2NAA A;  3KDE C;  2XEU A;  1VD4 A;  2YSJ A;  2ZET C;  4A0C D;  2LQ6 A;  2FSA A;  2CT2 A;  2L0B A;  3GV4 A;  4B7Y C;  3EB5 A;  2P57 A;  4I7C A;  4ZDT A;  5TBN A;  3RTR B;  2C2V S;  2LXH C;  5C11 A;  3ZPV E;  2JMI A;  4L58 A;  3SOX A;  4R2Y A;  2MD8 C;  2JMJ A;  3GL6 A;  1DVP A;  2Y43 A;  2EOD A;  4X3G A;  3O7A A;  1WEV A;  3HCS A;  4F52 B;  1BOR A;  4FK5 A;  3DDT A;  5LKT A;  4YAD A;  4YAB A;  2M6M A;  2MNY A;  2LN0 A;  3QZV A;  2FUI A;  2EGM A;  2KR4 A;  4GNG A;  4GNE A;  2ECW A;  2LV9 A;  2YUC A;  3E2D A;  4AUQ B;  2K1J A;  5DKA A;  2CSZ A;  1ZBD B;  2F6N A;  3T7L A;  4FO9 A;  4LAD B;  4QF3 A;  3O47 A;  1MM3 A;  2IDA A;  1X4U A;  2QIZ A;  5G05 B;  1FP0 A;  3N9M A;  1DCQ A;  1E4U A;  2PNX A;  3C6W A;  5JG6 A;  3PUQ A;  4MVT A;  1WEQ A;  5TRB A;  3N9Q A;  5SVI B;  5H1V A;  2K4D A;  4I7D A;  1RMD A;  1LDJ B;  2F6J A;  1XWH A;  4XI1 A;  2YT5 A;  2EGP A;  2CRW A;  2MT5 A;  5D1K B;  5FB0 A;  4Z0R A;  3EB6 A;  2EXU A;  2CKL B;  3H7H A;  2I50 A;  2HDP A;  2DX8 A;  2YSM A;  3LRQ A;  5AIU A;  2M85 A;  5SVY A;  1IYM A;  5DIN A;  3SOW A;  4IC2 A;  4GB0 A;  2YRE A;  2DSM A;  2CRR A;  3HCT A;  2ECI A;  5G0F A;  1WEE A;  4I7B A;  2YQM A;  4QF2 A;  2D8S A;  2L75 A;  2LRI C;  2C2L A;  5B78 A;  4YAT A;  3LJU X;  3O33 A;  3M99 A;  1HYI A;  3PLW A;  2YU4 A;  2E61 A;  3T9K A;  4A4B A;  2YW8 A;  2G6Q A;  2FD4 A;  4S3O C;  2YUR A;  2YVR A;  2CSV A;  4FJC A;  2KWN A;  2KGI A;  4IC3 A;  2M13 A;  4YC9 A;  1JM7 B;  2VPE A;  4F1P A;  2D8U A;  4UP5 A;  2L5U A;  3L1Z B;  2H0D B;  1WEU A;  2FUU A;  2LGK A;  1CHC A;  3IHP A;  3KQI A;  4YBS A;  1WGM A;  2CSY A;  2OWA A;  2MIQ A;  2KE1 A;  1WEN A;  5D1M B;  4AYC B;  1WES A;  2RSD A;  3DWD A;  4A4C A;  4GNF A;  3RPG B;  5LKX A;  1WIL A;  2KWK A;  1WEP A;  4TKP B;  4O64 A;  1X4J A;  4B86 C;  5B75 A;  3DQV R;  2K16 A;  3T6R A;  3RPG C;  4YBT A;  4CA1 A;  4WA6 A;  4BHW A;  2BAY A;  3FAO A;  4ZUX U;  5KH7 A;  2K17 A;  4Q6F A;  3U5O A;  3JUE A;  3FAN A;  3O37 A;  2CON A;  2KKX A;  2KYU A;  4YBM A;  3LDY A;  3FL2 A;  3U5M A;  2RR4 A;  2YHN A;  3LVR E;  3KNV A;  2MNZ A;  4C9Z A;  2E6S A;  3N9P A;  2QIC A;  1JOC A;  2UZG A;  2JUN A;  1VYX A;  4PPE A;  4WZ2 A;  5H9M A;  2PUY A;  1T1H A;  1MM2 A;  2JMD A;  3ZVZ B;  2VJE B;  2VPG A;  3O34 A;  2L43 A;  3LVQ E;  5SVI A;  4AVX A;  3N9L A;  5B77 A;  1U6G B;  5TAB A;  5FER A;  3C5K A;  3L11 A;  2F42 A;  4W4U A;  3ZYQ A;  3PUR A;  2KWJ A;  2LXP C;  2OXQ C;  3SHB A;  4LLB A;  2KRE A;  1V87 A;  2CKL A;  4LK9 A;  4P5O B;  4FIP A;  1N87 A;  2XOY A;  4S3O B;  2YYR A;  3NG2 A;  1Z6U A;  4LJN A;  2AN6 A;  2LGV A;  2FFW A;  5I3L A;  1FBV A;  2L7P A;  3O70 A;  2Y1N A;  3M7K A;  2Y1M A;  2KGG A;  3VK6 A;  3FJU B;  2KWO A;  5LKU A;  5K3Q A;  2YHO A;  1Z2Q A;  5D1L B;  2VJF B;  5LCW B;  4R7E A;  3I2D A;  5C13 A;  2KIZ A;  3O36 A;  4R8P K;  2XOC A;  3SUB A;  1JM7 A;  1WFK A;  3ASL A;  2G43 A;  2DJA A;  1WE9 A;  2LAU A;  3M63 A;  3LQI A;  2VPB A;  2LGL A;  5TDR A;  2H0D A;  3ZTG A;  2L80 A;  3LQH A;  1WIM A;  2VPD A;  1K2F A;  2IQJ A;  2XB1 A;  2MD7 B;  4V3K C;  5SVX A;  3V43 A;  4AYC A;  4H9D A;  2LDR A;  2MA6 A;  2JM3 A;  4O62 A;  5H1U A;  4OGE A;  2ECN A;  3HTK C;  4WZ3 B;  3MHH A;  2KU3 A;  3L1X A;  1Z60 A;  3O35 A;  5B79 A;  2M3H A;  5KH9 A;  2LGG A;  1G25 A;  3M62 A;  1X4I A;  1F62 A;  1VFY A;  1HYJ A;  5EYA F;  2KKY A;  2VP7 A;  2HYE D;  5B8D A;  5FB1 A;  2G45 A;  2ECJ A;  5TDW A;  3ZNI A;  2EA6 A;  1WEW A; 
#chains in the Genus database with same CATH homology
 2ECG A;  4CCG X;  2QJ0 A;  4MSX A;  4N4F A;  5LKZ A;  3SOU A;  4WZ0 A;  5FEY A;  2VNF A;  3N9N A;  1WEM A;  2ECT A;  2M1R A;  5H1T A;  5B76 A;  2MUM A;  4V3L C;  4ZQL A;  5G04 B;  5KH3 A;  2VJE A;  3ZVY A;  3KV5 A;  4BBQ A;  1LDK C;  4YAX A;  4A49 A;  1WEO A;  3KV6 A;  2RI7 A;  5J3X A;  2MA5 A;  2KFT A;  2YQL A;  4L7X A;  3N9O A;  3DPL R;  4NN2 A;  3ZPV 1;  4UP0 A;  5AIT A;  4AP4 A;  2JRJ A;  3LQJ A;  3HCU A;  2ECV A;  3MHS A;  4LKA A;  4UI9 B;  2E6R A;  3U5N A;  4N3W A;  4PTB A;  3U5P A;  4GND A;  3PHD A;  2VJF A;  2NAA A;  2XEU A;  1VD4 A;  2YSJ A;  2ZET C;  4A0C D;  2LQ6 A;  2FSA A;  2CT2 A;  2L0B A;  3GV4 A;  4B7Y C;  3EB5 A;  4I7C A;  4ZDT A;  5TBN A;  3RTR B;  2C2V S;  2LXH C;  5C11 A;  3ZPV E;  2JMI A;  4L58 A;  3SOX A;  4R2Y A;  2MD8 C;  2JMJ A;  3GL6 A;  1DVP A;  2Y43 A;  2EOD A;  4X3G A;  3O7A A;  1WEV A;  3HCS A;  4F52 B;  1BOR A;  4FK5 A;  5LKT A;  4YAD A;  4YAB A;  2M6M A;  2MNY A;  2LN0 A;  3QZV A;  2FUI A;  2KR4 A;  4GNG A;  4GNE A;  2ECW A;  2LV9 A;  2YUC A;  4AUQ B;  2K1J A;  5DKA A;  2CSZ A;  1ZBD B;  2F6N A;  3T7L A;  4FO9 A;  4LAD B;  4QF3 A;  1MM3 A;  2IDA A;  1X4U A;  2QIZ A;  5G05 B;  1FP0 A;  3N9M A;  1E4U A;  2PNX A;  3C6W A;  5JG6 A;  3PUQ A;  4MVT A;  1WEQ A;  5TRB A;  3N9Q A;  5H1V A;  2K4D A;  4I7D A;  1RMD A;  1LDJ B;  2F6J A;  1XWH A;  4XI1 A;  2YT5 A;  2EGP A;  2MT5 A;  5D1K B;  5FB0 A;  3EB6 A;  2CKL B;  2I50 A;  2HDP A;  2DX8 A;  2YSM A;  3LRQ A;  5AIU A;  2M85 A;  1IYM A;  5DIN A;  3SOW A;  4IC2 A;  4GB0 A;  2YRE A;  3HCT A;  2ECI A;  5G0F A;  1WEE A;  4I7B A;  2YQM A;  4QF2 A;  2D8S A;  2L75 A;  2LRI C;  2C2L A;  5B78 A;  4YAT A;  3O33 A;  3M99 A;  1HYI A;  2YU4 A;  4A4B A;  2YW8 A;  2G6Q A;  4S3O C;  2YUR A;  4FJC A;  2KWN A;  2KGI A;  4IC3 A;  4YC9 A;  1JM7 B;  2VPE A;  4UP5 A;  2L5U A;  3L1Z B;  2H0D B;  1WEU A;  2FUU A;  2LGK A;  1CHC A;  3IHP A;  3KQI A;  4YBS A;  1WGM A;  2CSY A;  2MIQ A;  2KE1 A;  1WEN A;  5D1M B;  4AYC B;  1WES A;  2RSD A;  4A4C A;  4GNF A;  3RPG B;  5LKX A;  1WIL A;  2KWK A;  1WEP A;  4TKP B;  4O64 A;  1X4J A;  4B86 C;  5B75 A;  3DQV R;  2K16 A;  3T6R A;  3RPG C;  4YBT A;  4CA1 A;  4WA6 A;  4BHW A;  2BAY A;  4ZUX U;  5KH7 A;  2K17 A;  4Q6F A;  3U5O A;  3O37 A;  2KYU A;  4YBM A;  3FL2 A;  3U5M A;  2YHN A;  3KNV A;  2MNZ A;  4C9Z A;  2E6S A;  3N9P A;  2QIC A;  1JOC A;  2UZG A;  1VYX A;  4PPE A;  4WZ2 A;  5H9M A;  2PUY A;  1T1H A;  1MM2 A;  2JMD A;  3ZVZ B;  2VJE B;  2VPG A;  3O34 A;  2L43 A;  4AVX A;  3N9L A;  5B77 A;  1U6G B;  5TAB A;  5FER A;  3C5K A;  3L11 A;  2F42 A;  4W4U A;  3ZYQ A;  3PUR A;  2KWJ A;  2LXP C;  2OXQ C;  3SHB A;  4LLB A;  2KRE A;  1V87 A;  2CKL A;  4LK9 A;  4P5O B;  4FIP A;  1N87 A;  4S3O B;  2YYR A;  3NG2 A;  1Z6U A;  4LJN A;  2AN6 A;  2LGV A;  5I3L A;  1FBV A;  3O70 A;  2Y1N A;  2Y1M A;  2KGG A;  3VK6 A;  2KWO A;  5LKU A;  2YHO A;  1Z2Q A;  5D1L B;  2VJF B;  5LCW B;  4R7E A;  3I2D A;  5C13 A;  2KIZ A;  3O36 A;  4R8P K;  1JM7 A;  1WFK A;  3ASL A;  2G43 A;  1WE9 A;  3M63 A;  3LQI A;  2VPB A;  2LGL A;  5TDR A;  2H0D A;  3ZTG A;  2L80 A;  3LQH A;  1WIM A;  2VPD A;  1K2F A;  2XB1 A;  3V43 A;  2MD7 B;  4V3K C;  4AYC A;  2LDR A;  2MA6 A;  5H1U A;  2ECN A;  3HTK C;  4WZ3 B;  3MHH A;  2KU3 A;  3L1X A;  1Z60 A;  3O35 A;  5B79 A;  2M3H A;  5KH9 A;  2LGG A;  1G25 A;  3M62 A;  1X4I A;  1F62 A;  1VFY A;  1HYJ A;  5EYA F;  2VP7 A;  2HYE D;  5B8D A;  5FB1 A;  2G45 A;  2ECJ A;  5TDW A;  3ZNI A;  2EA6 A;  1WEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...