5FEYA

Trim32 ring
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
78
Chain Sequence
SHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASGVRCPFCSKITRITQLTDNLTVLKIIDTAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase TRIM32
publication title Functional role of TRIM E3 ligase oligomerization and regulation of catalytic activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 16
structure length 78
sequence length 84
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13445 zf-RING_UBOX RING-type zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5feyA00
2QJ0A 1WEUA 3C6WA 3ZNIA 2K1JA 4XI1A 3U5MA 2CSYA 4W4UA 3SHBA 4MSXA 2MD8C 4QF2A 1V87A 5KH3A 3PHDA 3O34A 2M1RA 2RSDA 3N9OA 3LQHA 3QZVA 4X3GA 2KWKA 4LK9A 5DKAA 2KYUA 2Y1NA 4TKPB 2F6JA 3EB5A 3GL6A 3SOUA 2MA6A 5D1KB 5EYAF 4ZDTA 2VNFA 2MNYA 1IYMA 3KQIA 4R2YA 3KV5A 1XWHA 4GNEA 4F52B 2VJFB 1WEMA 3ASLA 2VPDA 1VYXA 3KV6A 1DVPA 2I50A 4YBSA 2YHOA 3ZVZB 4CA1A 2LN0A 5G04B 2L5UA 2MNZA 2H0DA 2VP7A 2LGLA 1G25A 3DPLR 1LDJB 3N9NA 4L58A 1X4IA 3V43A 4UI9B 2M85A 3EB6A 2YSJA 3RTRB 1K2FA 2PUYA 2LRIC 4I7BA 2K4DA 4S3OB 4YADA 3PURA 4S3OC 1WIMA 3HCUA 2CKLB 3M63A 2BAYA 5AITA 3N9MA 4GB0A 2K16A 4R8PK 4LKAA 3L11A 5JG6A 4B86C 5H9MA 3KNVA 2YW8A 1WENA 1FBVA 2RI7A 5B77A 3I2DA 2AN6A 3O33A 4A0CD 4FJCA 4YBMA 3DQVR 3O37A 2ECIA 1RMDA 4LJNA 2VJEA 3GV4A 2VJFA 3LRQA 4AP4A 1VFYA 5D1MB 3HCSA 4AYCB 1MM3A 4N3WA 4FK5A 5C11A 1MM2A 3MHHA 1N87A 2E6SA 2FUIA 3L1XA 5TBNA 1WEQA 5KH9A 5LKTA 2K17A 4V3LC 2VPEA 4R7EA 3U5OA 3ZPVE 2KFTA 4I7DA 5I3LA 4GNGA 4UP0A 2YQMA 2KREA 1WE9A 3N9QA 2CT2A 4BBQA 2OXQC 3NG2A 2CKLA 2CSZA 2XB1A 2LGGA 5TRBA 1Z60A 2G6QA 5TDWA 2EGPA 2ECGA 2L43A 2VPGA 3FL2A 4FO9A 2ECNA 3RPGB 2QICA 4YC9A 1X4JA 4IC2A 3RPGC 4C9ZA 3O7AA 1CHCA 5FEYA 2LGVA 1JM7A 1F62A 2ECWA 5C13A 3M99A 2Y43A 2DX8A 2EA6A 4PPEA 3ZVYA 2FUUA 2KGGA 5H1VA 3N9LA 4LLBA 4ZUXU 5B79A 4IC3A 5J3XA 2KWOA 2MA5A 3T6RA 3LQIA 3SOXA 5B76A 4WZ0A 5LKUA 1WILA 4AYCA 2IDAA 2KE1A 2D8SA 2KGIA 2LXPC 3N9PA 4YBTA 1WFKA 5B75A 3IHPA 4CCGX 2E6RA 4WZ3B 4AUQB 2XEUA 3M62A 2KIZA 4WZ2A 4I7CA 2JMJA 3LQJA 3U5NA 3ZPV1 4YABA 1WEWA 1VD4A 4BHWA 5B8DA 1Z2QA 2YU4A 4GNDA 5TABA 2HDPA 3L1ZB 5LKXA 3HCTA 5G05B 4A4CA 4FIPA 2UZGA 2VPBA 2ECTA 1Z6UA 2PNXA 3HTKC 4YATA 2LDRA 2ECVA 2C2VS 5H1UA 4A4BA 2L75A 3MHSA 5H1TA 2MT5A 5LKZA 1X4UA 1WEOA 3O35A 2YUCA 1ZBDB 2L80A 3O36A 2QIZA 4L7XA 4A49A 1WEVA 2LV9A 2ECJA 4WA6A 1T1HA 2YURA 2ZETC 2YT5A 5AIUA 2HYED 3SOWA 4YAXA 4PTBA 5G0FA 2L0BA 2KWNA 2KWJA 1BORA 3O70A 2EODA 2VJEB 4N4FA 1JOCA 4UP5A 4QF3A 2JMIA 2G43A 2M6MA 5FB0A 1HYIA 1WEEA 2JMDA 4P5OB 1LDKC 4GNFA 3ZYQA 2F42A 2KR4A 3U5PA 4Q6FA 4LADB 5FB1A 2JRJA 2KU3A 4V3KC 5B78A 2G45A 5KH7A 3VK6A 2MD7B 2Y1MA 4NN2A 2YSMA 1WGMA 3C5KA 2LXHC 1FP0A 2LQ6A 2LGKA 5D1LB 3PUQA 1WEPA 4MVTA 2YREA 4O64A 2M3HA 5DINA 5TDRA 2YHNA 2FSAA 3ZTGA 2MUMA 5LCWB 4AVXA 1WESA 4B7YC 1HYJA 1E4UA 2YQLA 2NAAA 5FERA 2F6NA 1JM7B 2MIQA 2C2LA 2H0DB 3T7LA 1U6GB 2YYRA 4ZQLA
chains in the Genus database with same CATH superfamily
2QJ0A 1WEUA 3C6WA 3ZNIA 2K1JA 4XI1A 3U5MA 3LVQE 2CSYA 4W4UA 3SHBA 2E61A 4MSXA 2MD8C 4QF2A 1V87A 5KH3A 4Z0RA 2XP0A 3PHDA 3PLWA 3O34A 2M1RA 2RSDA 3N9OA 4Z0OA 3LQHA 3QZVA 4F1PA 4X3GA 2KWKA 4LK9A 2LAUA 5DKAA 3KDEC 5SVIB 2KYUA 3DDTA 2Y1NA 4TKPB 2F6JA 2XOZA 3EB5A 3GL6A 3SOUA 2MA6A 5D1KB 5EYAF 4ZDTA 2VNFA 2MNYA 1IYMA 3KQIA 4R2YA 3KV5A 1XWHA 4GNEA 2IQJA 5SVYA 4F52B 3O47A 2VJFB 1WEMA 3ASLA 2VPDA 1VYXA 3KV6A 1DVPA 2I50A 4YBSA 3LVRE 2YHOA 4OGCA 3ZVZB 4CA1A 2LN0A 5G04B 2XOCA 3FAOA 2L5UA 2MNZA 2H0DA 2VP7A 2LGLA 1G25A 3DPLR 3T9KA 1LDJB 3N9NA 4L58A 1X4IA 3V43A 4UI9B 2M85A 3EB6A 2YSJA 3RTRB 1K2FA 2PUYA 2LRIC 4I7BA 2K4DA 4S3OB 4YADA 3PURA 2CSVA 4S3OC 1WIMA 3HCUA 2DJAA 2CKLB 3M63A 3MDBC 2BAYA 5AITA 3N9MA 4GB0A 2CONA 2K16A 4R8PK 5SVIA 4LKAA 3L11A 5JG6A 4B86C 3LDYA 5H9MA 3KNVA 2YW8A 1WENA 1FBVA 2OWAA 2L7PA 2RI7A 5B77A 3I2DA 2AN6A 3O33A 4A0CD 4FJCA 4YBMA 3DQVR 3O37A 2ECIA 1RMDA 4LJNA 2VJEA 3GV4A 2XOYA 2VJFA 2DSMA 5SVXA 3LRQA 4AP4A 3SUBA 1VFYA 5D1MB 3HCSA 4AYCB 1MM3A 4N3WA 4FK5A 5C11A 1MM2A 3MHHA 1N87A 4OGEA 2E6SA 2FUIA 3L1XA 5TBNA 1WEQA 5KH9A 2EGMA 5LKTA 2K17A 4V3LC 2VPEA 4R7EA 3U5OA 3ZPVE 2KFTA 4I7DA 5I3LA 4GNGA 4UP0A 2YQMA 2KREA 1WE9A 3N9QA 2CT2A 4BBQA 2CRRA 2OXQC 3NG2A 2CKLA 2D8UA 2CSZA 2XB1A 2LGGA 5TRBA 3FANA 1Z60A 2G6QA 5K3QA 5TDWA 2EGPA 2ECGA 2L43A 2VPGA 3FL2A 4FO9A 2ECNA 3RPGB 2QICA 4YC9A 1X4JA 4IC2A 3RPGC 2YVRA 4C9ZA 3O7AA 1CHCA 5FEYA 2LGVA 2CRWA 1JM7A 1F62A 2ECWA 5C13A 3M99A 2Y43A 2DX8A 2EA6A 4PPEA 3ZVYA 2EXUA 2FUUA 2KGGA 5H1VA 3N9LA 4LLBA 4ZUXU 5B79A 4IC3A 3H7HA 5J3XA 2KWOA 3E2DA 2MA5A 3T6RA 3LQIA 3SOXA 3FEHA 3Q1DA 5B76A 4WZ0A 5LKUA 1WILA 4AYCA 4QQ4A 2IDAA 2KE1A 2D8SA 2KGIA 2LXPC 3N9PA 4YBTA 1WFKA 5B75A 3IHPA 4CCGX 2E6RA 4WZ3B 4AUQB 2XEUA 3M62A 2KIZA 4WZ2A 3FJUB 4I7CA 2JMJA 3LQJA 3U5NA 2KKXA 3ZPV1 4YABA 1WEWA 1VD4A 4BHWA 5B8DA 1Z2QA 2YU4A 4GNDA 5TABA 2HDPA 2B0OE 3L1ZB 5LKXA 3HCTA 5G05B 3DWDA 4A4CA 4FIPA 2JM3A 2UZGA 2VPBA 2ECTA 1Z6UA 2PNXA 3HTKC 4YATA 2LDRA 2ECVA 2C2VS 5H1UA 4A4BA 2FFWA 2L75A 3MHSA 4O62A 5H1TA 2MT5A 5LKZA 1X4UA 1WEOA 3O35A 2YUCA 1ZBDB 2L80A 3O36A 2QIZA 4L7XA 4A49A 1WEVA 2LV9A 2ECJA 4WA6A 1T1HA 2YURA 2ZETC 2YT5A 5AIUA 2HYED 3SOWA 4YAXA 4PTBA 5G0FA 2MKEA 2L0BA 2KWNA 3FM8C 2KWJA 1BORA 3O70A 2EODA 2VJEB 4N4FA 1JOCA 4UP5A 4QF3A 2JMIA 2G43A 2JUNA 2M6MA 5FB0A 1HYIA 1WEEA 2JMDA 2M13A 4P5OB 2FD4A 1LDKC 4GNFA 3ZYQA 2F42A 2KR4A 1MBMA 4Q6FA 3U5PA 4LADB 1DCQA 5FB1A 2KKYA 2JRJA 2KU3A 3LJUX 4V3KC 5B78A 2G45A 5KH7A 3JUEA 3VK6A 2MD7B 2P57A 2Y1MA 4NN2A 2RR4A 2YSMA 1WGMA 3C5KA 2LXHC 1FP0A 2LQ6A 2LGKA 5D1LB 3PUQA 1WEPA 4MVTA 2YREA 4O64A 2M3HA 5DINA 5TDRA 2YHNA 2FSAA 3M7KA 3ZTGA 2MUMA 5LCWB 4AVXA 1WESA 4B7YC 1HYJA 1E4UA 2YQLA 2NAAA 5FERA 2F6NA 1JM7B 2MIQA 2C2LA 2H0DB 3T7LA 1U6GB 2YYRA 4H9DA 4ZQLA
chains in the Genus database with same CATH topology
2QJ0A 1WEUA 3C6WA 3ZNIA 2K1JA 4XI1A 3U5MA 2CSYA 4W4UA 3SHBA 4MSXA 2MD8C 4QF2A 1V87A 5KH3A 3PHDA 3O34A 2M1RA 2RSDA 3N9OA 3LQHA 3QZVA 4X3GA 2KWKA 4LK9A 5DKAA 2KYUA 2Y1NA 4TKPB 2F6JA 3EB5A 3GL6A 3SOUA 2MA6A 5D1KB 5EYAF 4ZDTA 2VNFA 2MNYA 1IYMA 3KQIA 4R2YA 3KV5A 1XWHA 4GNEA 4F52B 2VJFB 1WEMA 3ASLA 2VPDA 1VYXA 3KV6A 1DVPA 2I50A 4YBSA 2YHOA 3ZVZB 4CA1A 2LN0A 5G04B 2L5UA 2MNZA 2H0DA 2VP7A 2LGLA 1G25A 3DPLR 1LDJB 3N9NA 4L58A 1X4IA 3V43A 4UI9B 2M85A 3EB6A 2YSJA 3RTRB 1K2FA 2PUYA 2LRIC 4I7BA 2K4DA 4S3OB 4YADA 3PURA 4S3OC 1WIMA 3HCUA 2CKLB 3M63A 2BAYA 5AITA 3N9MA 4GB0A 2K16A 4R8PK 4LKAA 3L11A 5JG6A 4B86C 5H9MA 3KNVA 2YW8A 1WENA 1FBVA 2RI7A 5B77A 3I2DA 2AN6A 3O33A 4A0CD 4FJCA 4YBMA 3DQVR 3O37A 2ECIA 1RMDA 4LJNA 2VJEA 3GV4A 2VJFA 3LRQA 4AP4A 1VFYA 5D1MB 3HCSA 4AYCB 1MM3A 4N3WA 4FK5A 5C11A 1MM2A 3MHHA 1N87A 2E6SA 2FUIA 3L1XA 5TBNA 1WEQA 5KH9A 5LKTA 2K17A 4V3LC 2VPEA 4R7EA 3U5OA 3ZPVE 2KFTA 4I7DA 5I3LA 4GNGA 4UP0A 2YQMA 2KREA 1WE9A 3N9QA 2CT2A 4BBQA 2OXQC 3NG2A 2CKLA 2CSZA 2XB1A 2LGGA 5TRBA 1Z60A 2G6QA 5TDWA 2EGPA 2ECGA 2L43A 2VPGA 3FL2A 4FO9A 2ECNA 3RPGB 2QICA 4YC9A 1X4JA 4IC2A 3RPGC 4C9ZA 3O7AA 1CHCA 5FEYA 2LGVA 1JM7A 1F62A 2ECWA 5C13A 3M99A 2Y43A 2DX8A 2EA6A 4PPEA 3ZVYA 2FUUA 2KGGA 5H1VA 3N9LA 4LLBA 4ZUXU 5B79A 4IC3A 5J3XA 2KWOA 2MA5A 3T6RA 3LQIA 3SOXA 5B76A 4WZ0A 5LKUA 1WILA 4AYCA 2IDAA 2KE1A 2D8SA 2KGIA 2LXPC 3N9PA 4YBTA 1WFKA 5B75A 3IHPA 4CCGX 2E6RA 4WZ3B 4AUQB 2XEUA 3M62A 2KIZA 4WZ2A 4I7CA 2JMJA 3LQJA 3U5NA 3ZPV1 4YABA 1WEWA 1VD4A 4BHWA 5B8DA 1Z2QA 2YU4A 4GNDA 5TABA 2HDPA 3L1ZB 5LKXA 3HCTA 5G05B 4A4CA 4FIPA 2UZGA 2VPBA 2ECTA 1Z6UA 2PNXA 3HTKC 4YATA 2LDRA 2ECVA 2C2VS 5H1UA 4A4BA 2L75A 3MHSA 5H1TA 2MT5A 5LKZA 1X4UA 1WEOA 3O35A 2YUCA 1ZBDB 2L80A 3O36A 2QIZA 4L7XA 4A49A 1WEVA 2LV9A 2ECJA 4WA6A 1T1HA 2YURA 2ZETC 2YT5A 5AIUA 2HYED 3SOWA 4YAXA 4PTBA 5G0FA 2L0BA 2KWNA 2KWJA 1BORA 3O70A 2EODA 2VJEB 4N4FA 1JOCA 4UP5A 4QF3A 2JMIA 2G43A 2M6MA 5FB0A 1HYIA 1WEEA 2JMDA 4P5OB 1LDKC 4GNFA 3ZYQA 2F42A 2KR4A 3U5PA 4Q6FA 4LADB 5FB1A 2JRJA 2KU3A 4V3KC 5B78A 2G45A 5KH7A 3VK6A 2MD7B 2Y1MA 4NN2A 2YSMA 1WGMA 3C5KA 2LXHC 1FP0A 2LQ6A 2LGKA 5D1LB 3PUQA 1WEPA 4MVTA 2YREA 4O64A 2M3HA 5DINA 5TDRA 2YHNA 2FSAA 3ZTGA 2MUMA 5LCWB 4AVXA 1WESA 4B7YC 1HYJA 1E4UA 2YQLA 2NAAA 5FERA 2F6NA 1JM7B 2MIQA 2C2LA 2H0DB 3T7LA 1U6GB 2YYRA 4ZQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJ0 A;  1WEU A;  3C6W A;  3ZNI A;  2K1J A;  4XI1 A;  3U5M A;  2CSY A;  4W4U A;  3SHB A;  4MSX A;  2MD8 C;  4QF2 A;  1V87 A;  5KH3 A;  3PHD A;  3O34 A;  2M1R A;  2RSD A;  3N9O A;  3LQH A;  3QZV A;  4X3G A;  2KWK A;  4LK9 A;  5DKA A;  2KYU A;  2Y1N A;  4TKP B;  2F6J A;  3EB5 A;  3GL6 A;  3SOU A;  2MA6 A;  5D1K B;  5EYA F;  4ZDT A;  2VNF A;  2MNY A;  1IYM A;  3KQI A;  4R2Y A;  3KV5 A;  1XWH A;  4GNE A;  4F52 B;  2VJF B;  1WEM A;  3ASL A;  2VPD A;  1VYX A;  3KV6 A;  1DVP A;  2I50 A;  4YBS A;  2YHO A;  3ZVZ B;  4CA1 A;  2LN0 A;  5G04 B;  2L5U A;  2MNZ A;  2H0D A;  2VP7 A;  2LGL A;  1G25 A;  3DPL R;  1LDJ B;  3N9N A;  4L58 A;  1X4I A;  3V43 A;  4UI9 B;  2M85 A;  3EB6 A;  2YSJ A;  3RTR B;  1K2F A;  2PUY A;  2LRI C;  4I7B A;  2K4D A;  4S3O B;  4YAD A;  3PUR A;  4S3O C;  1WIM A;  3HCU A;  2CKL B;  3M63 A;  2BAY A;  5AIT A;  3N9M A;  4GB0 A;  2K16 A;  4R8P K;  4LKA A;  3L11 A;  5JG6 A;  4B86 C;  5H9M A;  3KNV A;  2YW8 A;  1WEN A;  1FBV A;  2RI7 A;  5B77 A;  3I2D A;  2AN6 A;  3O33 A;  4A0C D;  4FJC A;  4YBM A;  3DQV R;  3O37 A;  2ECI A;  1RMD A;  4LJN A;  2VJE A;  3GV4 A;  2VJF A;  3LRQ A;  4AP4 A;  1VFY A;  5D1M B;  3HCS A;  4AYC B;  1MM3 A;  4N3W A;  4FK5 A;  5C11 A;  1MM2 A;  3MHH A;  1N87 A;  2E6S A;  2FUI A;  3L1X A;  5TBN A;  1WEQ A;  5KH9 A;  5LKT A;  2K17 A;  4V3L C;  2VPE A;  4R7E A;  3U5O A;  3ZPV E;  2KFT A;  4I7D A;  5I3L A;  4GNG A;  4UP0 A;  2YQM A;  2KRE A;  1WE9 A;  3N9Q A;  2CT2 A;  4BBQ A;  2OXQ C;  3NG2 A;  2CKL A;  2CSZ A;  2XB1 A;  2LGG A;  5TRB A;  1Z60 A;  2G6Q A;  5TDW A;  2EGP A;  2ECG A;  2L43 A;  2VPG A;  3FL2 A;  4FO9 A;  2ECN A;  3RPG B;  2QIC A;  4YC9 A;  1X4J A;  4IC2 A;  3RPG C;  4C9Z A;  3O7A A;  1CHC A;  5FEY A;  2LGV A;  1JM7 A;  1F62 A;  2ECW A;  5C13 A;  3M99 A;  2Y43 A;  2DX8 A;  2EA6 A;  4PPE A;  3ZVY A;  2FUU A;  2KGG A;  5H1V A;  3N9L A;  4LLB A;  4ZUX U;  5B79 A;  4IC3 A;  5J3X A;  2KWO A;  2MA5 A;  3T6R A;  3LQI A;  3SOX A;  5B76 A;  4WZ0 A;  5LKU A;  1WIL A;  4AYC A;  2IDA A;  2KE1 A;  2D8S A;  2KGI A;  2LXP C;  3N9P A;  4YBT A;  1WFK A;  5B75 A;  3IHP A;  4CCG X;  2E6R A;  4WZ3 B;  4AUQ B;  2XEU A;  3M62 A;  2KIZ A;  4WZ2 A;  4I7C A;  2JMJ A;  3LQJ A;  3U5N A;  3ZPV 1;  4YAB A;  1WEW A;  1VD4 A;  4BHW A;  5B8D A;  1Z2Q A;  2YU4 A;  4GND A;  5TAB A;  2HDP A;  3L1Z B;  5LKX A;  3HCT A;  5G05 B;  4A4C A;  4FIP A;  2UZG A;  2VPB A;  2ECT A;  1Z6U A;  2PNX A;  3HTK C;  4YAT A;  2LDR A;  2ECV A;  2C2V S;  5H1U A;  4A4B A;  2L75 A;  3MHS A;  5H1T A;  2MT5 A;  5LKZ A;  1X4U A;  1WEO A;  3O35 A;  2YUC A;  1ZBD B;  2L80 A;  3O36 A;  2QIZ A;  4L7X A;  4A49 A;  1WEV A;  2LV9 A;  2ECJ A;  4WA6 A;  1T1H A;  2YUR A;  2ZET C;  2YT5 A;  5AIU A;  2HYE D;  3SOW A;  4YAX A;  4PTB A;  5G0F A;  2L0B A;  2KWN A;  2KWJ A;  1BOR A;  3O70 A;  2EOD A;  2VJE B;  4N4F A;  1JOC A;  4UP5 A;  4QF3 A;  2JMI A;  2G43 A;  2M6M A;  5FB0 A;  1HYI A;  1WEE A;  2JMD A;  4P5O B;  1LDK C;  4GNF A;  3ZYQ A;  2F42 A;  2KR4 A;  3U5P A;  4Q6F A;  4LAD B;  5FB1 A;  2JRJ A;  2KU3 A;  4V3K C;  5B78 A;  2G45 A;  5KH7 A;  3VK6 A;  2MD7 B;  2Y1M A;  4NN2 A;  2YSM A;  1WGM A;  3C5K A;  2LXH C;  1FP0 A;  2LQ6 A;  2LGK A;  5D1L B;  3PUQ A;  1WEP A;  4MVT A;  2YRE A;  4O64 A;  2M3H A;  5DIN A;  5TDR A;  2YHN A;  2FSA A;  3ZTG A;  2MUM A;  5LCW B;  4AVX A;  1WES A;  4B7Y C;  1HYJ A;  1E4U A;  2YQL A;  2NAA A;  5FER A;  2F6N A;  1JM7 B;  2MIQ A;  2C2L A;  2H0D B;  3T7L A;  1U6G B;  2YYR A;  4ZQL A; 
#chains in the Genus database with same CATH topology
 2QJ0 A;  1WEU A;  3C6W A;  3ZNI A;  2K1J A;  4XI1 A;  3U5M A;  3LVQ E;  2CSY A;  4W4U A;  3SHB A;  2E61 A;  4MSX A;  2MD8 C;  4QF2 A;  1V87 A;  5KH3 A;  4Z0R A;  2XP0 A;  3PHD A;  3PLW A;  3O34 A;  2M1R A;  2RSD A;  3N9O A;  4Z0O A;  3LQH A;  3QZV A;  4F1P A;  4X3G A;  2KWK A;  4LK9 A;  2LAU A;  5DKA A;  3KDE C;  5SVI B;  2KYU A;  3DDT A;  2Y1N A;  4TKP B;  2F6J A;  2XOZ A;  3EB5 A;  3GL6 A;  3SOU A;  2MA6 A;  5D1K B;  5EYA F;  4ZDT A;  2VNF A;  2MNY A;  1IYM A;  3KQI A;  4R2Y A;  3KV5 A;  1XWH A;  4GNE A;  2IQJ A;  5SVY A;  4F52 B;  3O47 A;  2VJF B;  1WEM A;  3ASL A;  2VPD A;  1VYX A;  3KV6 A;  1DVP A;  2I50 A;  4YBS A;  3LVR E;  2YHO A;  4OGC A;  3ZVZ B;  4CA1 A;  2LN0 A;  5G04 B;  2XOC A;  3FAO A;  2L5U A;  2MNZ A;  2H0D A;  2VP7 A;  2LGL A;  1G25 A;  3DPL R;  3T9K A;  1LDJ B;  3N9N A;  4L58 A;  1X4I A;  3V43 A;  4UI9 B;  2M85 A;  3EB6 A;  2YSJ A;  3RTR B;  1K2F A;  2PUY A;  2LRI C;  4I7B A;  2K4D A;  4S3O B;  4YAD A;  3PUR A;  2CSV A;  4S3O C;  1WIM A;  3HCU A;  2DJA A;  2CKL B;  3M63 A;  3MDB C;  2BAY A;  5AIT A;  3N9M A;  4GB0 A;  2CON A;  2K16 A;  4R8P K;  5SVI A;  4LKA A;  3L11 A;  5JG6 A;  4B86 C;  3LDY A;  5H9M A;  3KNV A;  2YW8 A;  1WEN A;  1FBV A;  2OWA A;  2L7P A;  2RI7 A;  5B77 A;  3I2D A;  2AN6 A;  3O33 A;  4A0C D;  4FJC A;  4YBM A;  3DQV R;  3O37 A;  2ECI A;  1RMD A;  4LJN A;  2VJE A;  3GV4 A;  2XOY A;  2VJF A;  2DSM A;  5SVX A;  3LRQ A;  4AP4 A;  3SUB A;  1VFY A;  5D1M B;  3HCS A;  4AYC B;  1MM3 A;  4N3W A;  4FK5 A;  5C11 A;  1MM2 A;  3MHH A;  1N87 A;  4OGE A;  2E6S A;  2FUI A;  3L1X A;  5TBN A;  1WEQ A;  5KH9 A;  2EGM A;  5LKT A;  2K17 A;  4V3L C;  2VPE A;  4R7E A;  3U5O A;  3ZPV E;  2KFT A;  4I7D A;  5I3L A;  4GNG A;  4UP0 A;  2YQM A;  2KRE A;  1WE9 A;  3N9Q A;  2CT2 A;  4BBQ A;  2CRR A;  2OXQ C;  3NG2 A;  2CKL A;  2D8U A;  2CSZ A;  2XB1 A;  2LGG A;  5TRB A;  3FAN A;  1Z60 A;  2G6Q A;  5K3Q A;  5TDW A;  2EGP A;  2ECG A;  2L43 A;  2VPG A;  3FL2 A;  4FO9 A;  2ECN A;  3RPG B;  2QIC A;  4YC9 A;  1X4J A;  4IC2 A;  3RPG C;  2YVR A;  4C9Z A;  3O7A A;  1CHC A;  5FEY A;  2LGV A;  2CRW A;  1JM7 A;  1F62 A;  2ECW A;  5C13 A;  3M99 A;  2Y43 A;  2DX8 A;  2EA6 A;  4PPE A;  3ZVY A;  2EXU A;  2FUU A;  2KGG A;  5H1V A;  3N9L A;  4LLB A;  4ZUX U;  5B79 A;  4IC3 A;  3H7H A;  5J3X A;  2KWO A;  3E2D A;  2MA5 A;  3T6R A;  3LQI A;  3SOX A;  3FEH A;  3Q1D A;  5B76 A;  4WZ0 A;  5LKU A;  1WIL A;  4AYC A;  4QQ4 A;  2IDA A;  2KE1 A;  2D8S A;  2KGI A;  2LXP C;  3N9P A;  4YBT A;  1WFK A;  5B75 A;  3IHP A;  4CCG X;  2E6R A;  4WZ3 B;  4AUQ B;  2XEU A;  3M62 A;  2KIZ A;  4WZ2 A;  3FJU B;  4I7C A;  2JMJ A;  3LQJ A;  3U5N A;  2KKX A;  3ZPV 1;  4YAB A;  1WEW A;  1VD4 A;  4BHW A;  5B8D A;  1Z2Q A;  2YU4 A;  4GND A;  5TAB A;  2HDP A;  2B0O E;  3L1Z B;  5LKX A;  3HCT A;  5G05 B;  3DWD A;  4A4C A;  4FIP A;  2JM3 A;  2UZG A;  2VPB A;  2ECT A;  1Z6U A;  2PNX A;  3HTK C;  4YAT A;  2LDR A;  2ECV A;  2C2V S;  5H1U A;  4A4B A;  2FFW A;  2L75 A;  3MHS A;  4O62 A;  5H1T A;  2MT5 A;  5LKZ A;  1X4U A;  1WEO A;  3O35 A;  2YUC A;  1ZBD B;  2L80 A;  3O36 A;  2QIZ A;  4L7X A;  4A49 A;  1WEV A;  2LV9 A;  2ECJ A;  4WA6 A;  1T1H A;  2YUR A;  2ZET C;  2YT5 A;  5AIU A;  2HYE D;  3SOW A;  4YAX A;  4PTB A;  5G0F A;  2MKE A;  2L0B A;  2KWN A;  3FM8 C;  2KWJ A;  1BOR A;  3O70 A;  2EOD A;  2VJE B;  4N4F A;  1JOC A;  4UP5 A;  4QF3 A;  2JMI A;  2G43 A;  2JUN A;  2M6M A;  5FB0 A;  1HYI A;  1WEE A;  2JMD A;  2M13 A;  4P5O B;  2FD4 A;  1LDK C;  4GNF A;  3ZYQ A;  2F42 A;  2KR4 A;  1MBM A;  4Q6F A;  3U5P A;  4LAD B;  1DCQ A;  5FB1 A;  2KKY A;  2JRJ A;  2KU3 A;  3LJU X;  4V3K C;  5B78 A;  2G45 A;  5KH7 A;  3JUE A;  3VK6 A;  2MD7 B;  2P57 A;  2Y1M A;  4NN2 A;  2RR4 A;  2YSM A;  1WGM A;  3C5K A;  2LXH C;  1FP0 A;  2LQ6 A;  2LGK A;  5D1L B;  3PUQ A;  1WEP A;  4MVT A;  2YRE A;  4O64 A;  2M3H A;  5DIN A;  5TDR A;  2YHN A;  2FSA A;  3M7K A;  3ZTG A;  2MUM A;  5LCW B;  4AVX A;  1WES A;  4B7Y C;  1HYJ A;  1E4U A;  2YQL A;  2NAA A;  5FER A;  2F6N A;  1JM7 B;  2MIQ A;  2C2L A;  2H0D B;  3T7L A;  1U6G B;  2YYR A;  4H9D A;  4ZQL A; 
#chains in the Genus database with same CATH homology
 2QJ0 A;  1WEU A;  3C6W A;  3ZNI A;  2K1J A;  4XI1 A;  3U5M A;  2CSY A;  4W4U A;  3SHB A;  4MSX A;  2MD8 C;  4QF2 A;  1V87 A;  5KH3 A;  3PHD A;  3O34 A;  2M1R A;  2RSD A;  3N9O A;  3LQH A;  3QZV A;  4X3G A;  2KWK A;  4LK9 A;  5DKA A;  2KYU A;  2Y1N A;  4TKP B;  2F6J A;  3EB5 A;  3GL6 A;  3SOU A;  2MA6 A;  5D1K B;  5EYA F;  4ZDT A;  2VNF A;  2MNY A;  1IYM A;  3KQI A;  4R2Y A;  3KV5 A;  1XWH A;  4GNE A;  4F52 B;  2VJF B;  1WEM A;  3ASL A;  2VPD A;  1VYX A;  3KV6 A;  1DVP A;  2I50 A;  4YBS A;  2YHO A;  3ZVZ B;  4CA1 A;  2LN0 A;  5G04 B;  2L5U A;  2MNZ A;  2H0D A;  2VP7 A;  2LGL A;  1G25 A;  3DPL R;  1LDJ B;  3N9N A;  4L58 A;  1X4I A;  3V43 A;  4UI9 B;  2M85 A;  3EB6 A;  2YSJ A;  3RTR B;  1K2F A;  2PUY A;  2LRI C;  4I7B A;  2K4D A;  4S3O B;  4YAD A;  3PUR A;  4S3O C;  1WIM A;  3HCU A;  2CKL B;  3M63 A;  2BAY A;  5AIT A;  3N9M A;  4GB0 A;  2K16 A;  4R8P K;  4LKA A;  3L11 A;  5JG6 A;  4B86 C;  5H9M A;  3KNV A;  2YW8 A;  1WEN A;  1FBV A;  2RI7 A;  5B77 A;  3I2D A;  2AN6 A;  3O33 A;  4A0C D;  4FJC A;  4YBM A;  3DQV R;  3O37 A;  2ECI A;  1RMD A;  4LJN A;  2VJE A;  3GV4 A;  2VJF A;  3LRQ A;  4AP4 A;  1VFY A;  5D1M B;  3HCS A;  4AYC B;  1MM3 A;  4N3W A;  4FK5 A;  5C11 A;  1MM2 A;  3MHH A;  1N87 A;  2E6S A;  2FUI A;  3L1X A;  5TBN A;  1WEQ A;  5KH9 A;  5LKT A;  2K17 A;  4V3L C;  2VPE A;  4R7E A;  3U5O A;  3ZPV E;  2KFT A;  4I7D A;  5I3L A;  4GNG A;  4UP0 A;  2YQM A;  2KRE A;  1WE9 A;  3N9Q A;  2CT2 A;  4BBQ A;  2OXQ C;  3NG2 A;  2CKL A;  2CSZ A;  2XB1 A;  2LGG A;  5TRB A;  1Z60 A;  2G6Q A;  5TDW A;  2EGP A;  2ECG A;  2L43 A;  2VPG A;  3FL2 A;  4FO9 A;  2ECN A;  3RPG B;  2QIC A;  4YC9 A;  1X4J A;  4IC2 A;  3RPG C;  4C9Z A;  3O7A A;  1CHC A;  5FEY A;  2LGV A;  1JM7 A;  1F62 A;  2ECW A;  5C13 A;  3M99 A;  2Y43 A;  2DX8 A;  2EA6 A;  4PPE A;  3ZVY A;  2FUU A;  2KGG A;  5H1V A;  3N9L A;  4LLB A;  4ZUX U;  5B79 A;  4IC3 A;  5J3X A;  2KWO A;  2MA5 A;  3T6R A;  3LQI A;  3SOX A;  5B76 A;  4WZ0 A;  5LKU A;  1WIL A;  4AYC A;  2IDA A;  2KE1 A;  2D8S A;  2KGI A;  2LXP C;  3N9P A;  4YBT A;  1WFK A;  5B75 A;  3IHP A;  4CCG X;  2E6R A;  4WZ3 B;  4AUQ B;  2XEU A;  3M62 A;  2KIZ A;  4WZ2 A;  4I7C A;  2JMJ A;  3LQJ A;  3U5N A;  3ZPV 1;  4YAB A;  1WEW A;  1VD4 A;  4BHW A;  5B8D A;  1Z2Q A;  2YU4 A;  4GND A;  5TAB A;  2HDP A;  3L1Z B;  5LKX A;  3HCT A;  5G05 B;  4A4C A;  4FIP A;  2UZG A;  2VPB A;  2ECT A;  1Z6U A;  2PNX A;  3HTK C;  4YAT A;  2LDR A;  2ECV A;  2C2V S;  5H1U A;  4A4B A;  2L75 A;  3MHS A;  5H1T A;  2MT5 A;  5LKZ A;  1X4U A;  1WEO A;  3O35 A;  2YUC A;  1ZBD B;  2L80 A;  3O36 A;  2QIZ A;  4L7X A;  4A49 A;  1WEV A;  2LV9 A;  2ECJ A;  4WA6 A;  1T1H A;  2YUR A;  2ZET C;  2YT5 A;  5AIU A;  2HYE D;  3SOW A;  4YAX A;  4PTB A;  5G0F A;  2L0B A;  2KWN A;  2KWJ A;  1BOR A;  3O70 A;  2EOD A;  2VJE B;  4N4F A;  1JOC A;  4UP5 A;  4QF3 A;  2JMI A;  2G43 A;  2M6M A;  5FB0 A;  1HYI A;  1WEE A;  2JMD A;  4P5O B;  1LDK C;  4GNF A;  3ZYQ A;  2F42 A;  2KR4 A;  3U5P A;  4Q6F A;  4LAD B;  5FB1 A;  2JRJ A;  2KU3 A;  4V3K C;  5B78 A;  2G45 A;  5KH7 A;  3VK6 A;  2MD7 B;  2Y1M A;  4NN2 A;  2YSM A;  1WGM A;  3C5K A;  2LXH C;  1FP0 A;  2LQ6 A;  2LGK A;  5D1L B;  3PUQ A;  1WEP A;  4MVT A;  2YRE A;  4O64 A;  2M3H A;  5DIN A;  5TDR A;  2YHN A;  2FSA A;  3ZTG A;  2MUM A;  5LCW B;  4AVX A;  1WES A;  4B7Y C;  1HYJ A;  1E4U A;  2YQL A;  2NAA A;  5FER A;  2F6N A;  1JM7 B;  2MIQ A;  2C2L A;  2H0D B;  3T7L A;  1U6G B;  2YYR A;  4ZQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...