5FEYA

Trim32 ring
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
78
Chain Sequence
SHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASGVRCPFCSKITRITQLTDNLTVLKIIDTAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional role of TRIM E3 ligase oligomerization and regulation of catalytic activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase TRIM32
total genus 16
structure length 78
sequence length 84
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13445 zf-RING_UBOX RING-type zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5feyA00
5EYAF 1WEVA 2KGIA 2XB1A 1HYJA 4YBMA 4FJCA 4L7XA 3M63A 3O70A 2VP7A 2CKLA 3HCUA 2LV9A 5G05B 2MNYA 2HYED 1G25A 2PUYA 3T6RA 2KWJA 5B8DA 5LKZA 2VJFA 3ASLA 2MT5A 2E6SA 5H9MA 2RI7A 3O33A 3RPGC 1CHCA 4IC2A 2YSJA 3N9PA 2VJFB 1FBVA 4FIPA 5KH7A 3L1ZB 2JMDA 2KFTA 5LKXA 2JRJA 2VPEA 2KWNA 3L11A 5TDWA 5FEYA 2K17A 3KV5A 4I7DA 4ZDTA 4YBTA 2K4DA 3EB5A 2F6NA 3LQIA 3C6WA 3SHBA 4V3KC 4QF2A 4UP0A 4PTBA 2LGKA 2DX8A 4B7YC 5C11A 4IC3A 1BORA 1WEUA 1WEPA 4YABA 3HCTA 3IHPA 3EB6A 2VNFA 4N4FA 3DPLR 1WGMA 4WZ3B 4O64A 5B75A 2XEUA 2E6RA 1WFKA 2KR4A 4AUQB 5FB0A 3SOXA 3NG2A 4YATA 2ECVA 5H1TA 4AYCB 2LRIC 2ECIA 2HDPA 4AP4A 4LLBA 3ZVYA 5TABA 2ECGA 1Z2QA 1WENA 3N9QA 4N3WA 2BAYA 4YAXA 1Z6UA 2M6MA 5FERA 3ZYQA 4YADA 3T7LA 2UZGA 3O7AA 5I3LA 3GL6A 3N9MA 1MM2A 3V43A 2FUUA 2ECNA 4GNEA 5B76A 3RTRB 4GB0A 2YU4A 5H1UA 4R2YA 4NN2A 2ECJA 1VD4A 3O34A 2YYRA 2C2VS 5LKTA 2QIZA 2NAAA 2YSMA 3O35A 2YW8A 2CSZA 3ZTGA 3SOUA 1WEOA 2LXHC 4YC9A 3KQIA 2G43A 2ZETC 3I2DA 4MVTA 3U5OA 2KU3A 1E4UA 2Y43A 3PHDA 3M62A 5B78A 4A4CA 5B79A 3ZPV1 1WEEA 4WZ0A 4S3OB 3ZPVE 2EODA 2M3HA 1U6GB 4R7EA 4QF3A 1VYXA 2M85A 4CA1A 1N87A 4V3LC 5D1LB 1X4IA 5G0FA 2MA5A 1WIMA 5AITA 4BBQA 2ECWA 1WESA 2YUCA 1ZBDB 4BHWA 5TDRA 2RSDA 3N9NA 2YREA 4ZUXU 4LADB 5DKAA 3MHHA 1X4JA 3L1XA 2VJEB 1DVPA 2L80A 4FO9A 2F6JA 4PPEA 4P5OB 1WEMA 2L5UA 2L43A 2CKLB 4FK5A 1JM7B 2KREA 3ZNIA 5G04B 4A4BA 1LDJB 2MUMA 2KWKA 4ZQLA 1IYMA 3LQJA 3O36A 3KV6A 4L58A 2H0DA 3HTKC 2KE1A 4X3GA 4AVXA 1V87A 4S3OC 1T1HA 2Y1NA 3N9LA 4AYCA 1LDKC 2MNZA 2PNXA 5LCWB 2KWOA 2KIZA 3U5PA 2LGGA 5H1VA 4MSXA 2VJEA 1HYIA 4A0CD 1MM3A 4C9ZA 1WEWA 5C13A 3U5MA 2LGLA 2K1JA 4UI9B 3U5NA 1RMDA 4Q6FA 2MIQA 2YURA 5KH9A 2JMIA 4UP5A 1JOCA 3LQHA 1WE9A 1FP0A 2LXPC 3HCSA 5LKUA 2L0BA 5D1MB 2Y1MA 2ECTA 4W4UA 2YQMA 2IDAA 2L75A 4XI1A 2JMJA 2M1RA 2OXQC 1JM7A 3VK6A 2QJ0A 4GNDA 5B77A 2G45A 2LQ6A 5D1KB 2D8SA 2C2LA 4GNFA 4R8PK 2MA6A 2CT2A 1F62A 2KYUA 1WILA 5KH3A 2CSYA 1Z60A 3SOWA 2MD7B 2VPGA 4CCGX 4F52B 4B86C 2AN6A 2LDRA 2G6QA 2F42A 1XWHA 1VFYA 4WA6A 2LGVA 2QICA 4LJNA 2EGPA 3PURA 2YHOA 2K16A 4I7CA 3O37A 2FSAA 1X4UA 4A49A 3PUQA 2EA6A 4LKAA 2H0DB 3MHSA 5TRBA 2MD8C 3DQVR 5TBNA 2I50A 2YT5A 3GV4A 4WZ2A 3N9OA 2FUIA 3FL2A 2VPBA 4YBSA 3LRQA 5AIUA 3KNVA 3M99A 1K2FA 3ZVZB 3QZVA 4TKPB 2YHNA 4I7BA 5JG6A 2LN0A 4GNGA 2KGGA 5J3XA 1WEQA 3RPGB 3C5KA 2VPDA 4LK9A 2YQLA 5FB1A 5DINA
chains in the Genus database with same CATH superfamily
5EYAF 1WEVA 2KGIA 2XB1A 1HYJA 2KKXA 5SVIB 4YBMA 5SVYA 4FJCA 4L7XA 3M63A 3LDYA 3O70A 2VP7A 2CKLA 3HCUA 2LV9A 5G05B 2MNYA 2HYED 1G25A 3O47A 2PUYA 3T6RA 2KWJA 5B8DA 2CSVA 2XP0A 5LKZA 2VJFA 3ASLA 2MT5A 2E6SA 5H9MA 2RI7A 3O33A 3RPGC 1CHCA 4IC2A 2YSJA 3N9PA 2VJFB 1FBVA 4FIPA 5KH7A 3L1ZB 2JMDA 2IQJA 2D8UA 3KDEC 4H9DA 2KFTA 5LKXA 2JRJA 2VPEA 2KWNA 3L11A 5TDWA 5FEYA 2K17A 3KV5A 4I7DA 4ZDTA 2JUNA 4YBTA 2K4DA 3EB5A 4OGCA 2F6NA 3LQIA 3C6WA 3SHBA 2JM3A 4V3KC 4QF2A 4UP0A 4PTBA 5SVXA 2LGKA 2DX8A 4B7YC 5C11A 4IC3A 3FANA 1BORA 1WEUA 1WEPA 4YABA 2KKYA 3HCTA 3IHPA 3EB6A 2VNFA 4N4FA 3DPLR 1WGMA 4WZ3B 4Z0RA 4O64A 5B75A 2XEUA 2E6RA 1WFKA 2KR4A 4AUQB 5FB0A 3SOXA 2OWAA 3NG2A 4YATA 2ECVA 5H1TA 3T9KA 4AYCB 2LRIC 2ECIA 2HDPA 2FFWA 4AP4A 4LLBA 3ZVYA 5TABA 2ECGA 1Z2QA 1WENA 3N9QA 4N3WA 2BAYA 4YAXA 1Z6UA 2M6MA 5FERA 3ZYQA 4YADA 3T7LA 2UZGA 3O7AA 5I3LA 3GL6A 3N9MA 1MM2A 3V43A 3SUBA 2FUUA 2ECNA 2DSMA 2LAUA 4GNEA 5B76A 3RTRB 4GB0A 2YU4A 5H1UA 4R2YA 4NN2A 2P57A 2ECJA 2M13A 1VD4A 3O34A 2YYRA 2C2VS 5LKTA 2QIZA 2NAAA 2YSMA 3O35A 2YW8A 2CSZA 2L7PA 3ZTGA 3SOUA 1WEOA 2LXHC 4YC9A 3KQIA 3LJUX 2G43A 2ZETC 3E2DA 3I2DA 2XOZA 4MVTA 5SVIA 3U5OA 2KU3A 1E4UA 2Y43A 3PHDA 3M62A 5B78A 4A4CA 4Z0OA 5B79A 3ZPV1 1WEEA 4WZ0A 2CONA 3FAOA 4S3OB 2EODA 3ZPVE 2M3HA 1U6GB 4R7EA 4QF3A 3DWDA 1VYXA 2M85A 4CA1A 1N87A 2CRRA 4V3LC 1X4IA 5D1LB 5G0FA 2MA5A 1WIMA 5AITA 4BBQA 1MBMA 2ECWA 1WESA 2CRWA 2YUCA 1ZBDB 4BHWA 5TDRA 2RSDA 3N9NA 2B0OE 4O62A 2YREA 4ZUXU 4LADB 2YVRA 5DKAA 3MHHA 1X4JA 3L1XA 2VJEB 1DVPA 2L80A 4FO9A 2F6JA 4PPEA 4P5OB 1WEMA 2L5UA 3FM8C 2L43A 2CKLB 4FK5A 1JM7B 2KREA 2EXUA 3ZNIA 5G04B 4A4BA 1LDJB 2MUMA 2KWKA 4ZQLA 1IYMA 2XOCA 3LQJA 3O36A 3LVRE 3KV6A 4L58A 3PLWA 2H0DA 3FJUB 3HTKC 2KE1A 4X3GA 3JUEA 4AVXA 1V87A 2FD4A 4S3OC 1T1HA 2Y1NA 3MDBC 4QQ4A 3N9LA 4AYCA 1LDKC 2MNZA 2PNXA 5LCWB 2KWOA 2KIZA 3M7KA 3U5PA 2LGGA 5H1VA 4MSXA 2VJEA 1HYIA 4A0CD 1MM3A 4C9ZA 1WEWA 5C13A 3U5MA 2LGLA 2K1JA 4UI9B 3U5NA 1RMDA 4Q6FA 2MIQA 2YURA 5KH9A 2E61A 2JMIA 4UP5A 1JOCA 3LQHA 1WE9A 2EGMA 1FP0A 3FEHA 2LXPC 3HCSA 5LKUA 2L0BA 5D1MB 2Y1MA 2ECTA 4W4UA 2YQMA 5K3QA 2IDAA 2L75A 4XI1A 2JMJA 2M1RA 2OXQC 1JM7A 3VK6A 2QJ0A 4GNDA 5B77A 2G45A 2LQ6A 5D1KB 2D8SA 3H7HA 2C2LA 4GNFA 4R8PK 2MA6A 2CT2A 3Q1DA 1F62A 2KYUA 1WILA 5KH3A 2CSYA 1Z60A 3SOWA 2MD7B 2VPGA 4CCGX 4F52B 4OGEA 4B86C 2AN6A 2LDRA 2G6QA 2F42A 1XWHA 1VFYA 4WA6A 4LJNA 2LGVA 2QICA 2EGPA 3PURA 2YHOA 2K16A 4I7CA 3O37A 2FSAA 1X4UA 4A49A 2DJAA 3PUQA 2EA6A 4LKAA 2H0DB 3MHSA 5TRBA 2MD8C 3DQVR 5TBNA 2MKEA 2I50A 2YT5A 3GV4A 4WZ2A 1DCQA 3LVQE 3N9OA 2FUIA 3FL2A 2VPBA 4YBSA 3LRQA 5AIUA 3KNVA 3M99A 1K2FA 3ZVZB 3QZVA 4TKPB 3DDTA 2RR4A 2YHNA 4I7BA 5JG6A 2LN0A 4GNGA 2KGGA 5J3XA 1WEQA 3RPGB 3C5KA 2VPDA 4LK9A 2YQLA 4F1PA 2XOYA 5FB1A 5DINA
chains in the Genus database with same CATH topology
5EYAF 1WEVA 2KGIA 2XB1A 1HYJA 4YBMA 4FJCA 4L7XA 3M63A 3O70A 2VP7A 2CKLA 3HCUA 2LV9A 5G05B 2MNYA 2HYED 1G25A 2PUYA 3T6RA 2KWJA 5B8DA 5LKZA 2VJFA 3ASLA 2MT5A 2E6SA 5H9MA 2RI7A 3O33A 3RPGC 1CHCA 4IC2A 2YSJA 3N9PA 2VJFB 1FBVA 4FIPA 5KH7A 3L1ZB 2JMDA 2KFTA 5LKXA 2JRJA 2VPEA 2KWNA 3L11A 5TDWA 5FEYA 2K17A 3KV5A 4I7DA 4ZDTA 4YBTA 2K4DA 3EB5A 2F6NA 3LQIA 3C6WA 3SHBA 4V3KC 4QF2A 4UP0A 4PTBA 2LGKA 2DX8A 4B7YC 5C11A 4IC3A 1BORA 1WEUA 1WEPA 4YABA 3HCTA 3IHPA 3EB6A 2VNFA 4N4FA 3DPLR 1WGMA 4WZ3B 4O64A 5B75A 2XEUA 2E6RA 1WFKA 2KR4A 4AUQB 5FB0A 3SOXA 3NG2A 4YATA 2ECVA 5H1TA 4AYCB 2LRIC 2ECIA 2HDPA 4AP4A 4LLBA 3ZVYA 5TABA 2ECGA 1Z2QA 1WENA 3N9QA 4N3WA 2BAYA 4YAXA 1Z6UA 2M6MA 5FERA 3ZYQA 4YADA 3T7LA 2UZGA 3O7AA 5I3LA 3GL6A 3N9MA 1MM2A 3V43A 2FUUA 2ECNA 4GNEA 5B76A 3RTRB 4GB0A 2YU4A 5H1UA 4R2YA 4NN2A 2ECJA 1VD4A 3O34A 2YYRA 2C2VS 5LKTA 2QIZA 2NAAA 2YSMA 3O35A 2YW8A 2CSZA 3ZTGA 3SOUA 1WEOA 2LXHC 4YC9A 3KQIA 2G43A 2ZETC 3I2DA 4MVTA 3U5OA 2KU3A 1E4UA 2Y43A 3PHDA 3M62A 5B78A 4A4CA 5B79A 3ZPV1 1WEEA 4WZ0A 4S3OB 3ZPVE 2EODA 2M3HA 1U6GB 4R7EA 4QF3A 1VYXA 2M85A 4CA1A 1N87A 4V3LC 5D1LB 1X4IA 5G0FA 2MA5A 1WIMA 5AITA 4BBQA 2ECWA 1WESA 2YUCA 1ZBDB 4BHWA 5TDRA 2RSDA 3N9NA 2YREA 4ZUXU 4LADB 5DKAA 3MHHA 1X4JA 3L1XA 2VJEB 1DVPA 2L80A 4FO9A 2F6JA 4PPEA 4P5OB 1WEMA 2L5UA 2L43A 2CKLB 4FK5A 1JM7B 2KREA 3ZNIA 5G04B 4A4BA 1LDJB 2MUMA 2KWKA 4ZQLA 1IYMA 3LQJA 3O36A 3KV6A 4L58A 2H0DA 3HTKC 2KE1A 4X3GA 4AVXA 1V87A 4S3OC 1T1HA 2Y1NA 3N9LA 4AYCA 1LDKC 2MNZA 2PNXA 5LCWB 2KWOA 2KIZA 3U5PA 2LGGA 5H1VA 4MSXA 2VJEA 1HYIA 4A0CD 1MM3A 4C9ZA 1WEWA 5C13A 3U5MA 2LGLA 2K1JA 4UI9B 3U5NA 1RMDA 4Q6FA 2MIQA 2YURA 5KH9A 2JMIA 4UP5A 1JOCA 3LQHA 1WE9A 1FP0A 2LXPC 3HCSA 5LKUA 2L0BA 5D1MB 2Y1MA 2ECTA 4W4UA 2YQMA 2IDAA 2L75A 4XI1A 2JMJA 2M1RA 2OXQC 1JM7A 3VK6A 2QJ0A 4GNDA 5B77A 2G45A 2LQ6A 5D1KB 2D8SA 2C2LA 4GNFA 4R8PK 2MA6A 2CT2A 1F62A 2KYUA 1WILA 5KH3A 2CSYA 1Z60A 3SOWA 2MD7B 2VPGA 4CCGX 4F52B 4B86C 2AN6A 2LDRA 2G6QA 2F42A 1XWHA 1VFYA 4WA6A 2LGVA 2QICA 4LJNA 2EGPA 3PURA 2YHOA 2K16A 4I7CA 3O37A 2FSAA 1X4UA 4A49A 3PUQA 2EA6A 4LKAA 2H0DB 3MHSA 5TRBA 2MD8C 3DQVR 5TBNA 2I50A 2YT5A 3GV4A 4WZ2A 3N9OA 2FUIA 3FL2A 2VPBA 4YBSA 3LRQA 5AIUA 3KNVA 3M99A 1K2FA 3ZVZB 3QZVA 4TKPB 2YHNA 4I7BA 5JG6A 2LN0A 4GNGA 2KGGA 5J3XA 1WEQA 3RPGB 3C5KA 2VPDA 4LK9A 2YQLA 5FB1A 5DINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EYA F;  1WEV A;  2KGI A;  2XB1 A;  1HYJ A;  4YBM A;  4FJC A;  4L7X A;  3M63 A;  3O70 A;  2VP7 A;  2CKL A;  3HCU A;  2LV9 A;  5G05 B;  2MNY A;  2HYE D;  1G25 A;  2PUY A;  3T6R A;  2KWJ A;  5B8D A;  5LKZ A;  2VJF A;  3ASL A;  2MT5 A;  2E6S A;  5H9M A;  2RI7 A;  3O33 A;  3RPG C;  1CHC A;  4IC2 A;  2YSJ A;  3N9P A;  2VJF B;  1FBV A;  4FIP A;  5KH7 A;  3L1Z B;  2JMD A;  2KFT A;  5LKX A;  2JRJ A;  2VPE A;  2KWN A;  3L11 A;  5TDW A;  5FEY A;  2K17 A;  3KV5 A;  4I7D A;  4ZDT A;  4YBT A;  2K4D A;  3EB5 A;  2F6N A;  3LQI A;  3C6W A;  3SHB A;  4V3K C;  4QF2 A;  4UP0 A;  4PTB A;  2LGK A;  2DX8 A;  4B7Y C;  5C11 A;  4IC3 A;  1BOR A;  1WEU A;  1WEP A;  4YAB A;  3HCT A;  3IHP A;  3EB6 A;  2VNF A;  4N4F A;  3DPL R;  1WGM A;  4WZ3 B;  4O64 A;  5B75 A;  2XEU A;  2E6R A;  1WFK A;  2KR4 A;  4AUQ B;  5FB0 A;  3SOX A;  3NG2 A;  4YAT A;  2ECV A;  5H1T A;  4AYC B;  2LRI C;  2ECI A;  2HDP A;  4AP4 A;  4LLB A;  3ZVY A;  5TAB A;  2ECG A;  1Z2Q A;  1WEN A;  3N9Q A;  4N3W A;  2BAY A;  4YAX A;  1Z6U A;  2M6M A;  5FER A;  3ZYQ A;  4YAD A;  3T7L A;  2UZG A;  3O7A A;  5I3L A;  3GL6 A;  3N9M A;  1MM2 A;  3V43 A;  2FUU A;  2ECN A;  4GNE A;  5B76 A;  3RTR B;  4GB0 A;  2YU4 A;  5H1U A;  4R2Y A;  4NN2 A;  2ECJ A;  1VD4 A;  3O34 A;  2YYR A;  2C2V S;  5LKT A;  2QIZ A;  2NAA A;  2YSM A;  3O35 A;  2YW8 A;  2CSZ A;  3ZTG A;  3SOU A;  1WEO A;  2LXH C;  4YC9 A;  3KQI A;  2G43 A;  2ZET C;  3I2D A;  4MVT A;  3U5O A;  2KU3 A;  1E4U A;  2Y43 A;  3PHD A;  3M62 A;  5B78 A;  4A4C A;  5B79 A;  3ZPV 1;  1WEE A;  4WZ0 A;  4S3O B;  3ZPV E;  2EOD A;  2M3H A;  1U6G B;  4R7E A;  4QF3 A;  1VYX A;  2M85 A;  4CA1 A;  1N87 A;  4V3L C;  5D1L B;  1X4I A;  5G0F A;  2MA5 A;  1WIM A;  5AIT A;  4BBQ A;  2ECW A;  1WES A;  2YUC A;  1ZBD B;  4BHW A;  5TDR A;  2RSD A;  3N9N A;  2YRE A;  4ZUX U;  4LAD B;  5DKA A;  3MHH A;  1X4J A;  3L1X A;  2VJE B;  1DVP A;  2L80 A;  4FO9 A;  2F6J A;  4PPE A;  4P5O B;  1WEM A;  2L5U A;  2L43 A;  2CKL B;  4FK5 A;  1JM7 B;  2KRE A;  3ZNI A;  5G04 B;  4A4B A;  1LDJ B;  2MUM A;  2KWK A;  4ZQL A;  1IYM A;  3LQJ A;  3O36 A;  3KV6 A;  4L58 A;  2H0D A;  3HTK C;  2KE1 A;  4X3G A;  4AVX A;  1V87 A;  4S3O C;  1T1H A;  2Y1N A;  3N9L A;  4AYC A;  1LDK C;  2MNZ A;  2PNX A;  5LCW B;  2KWO A;  2KIZ A;  3U5P A;  2LGG A;  5H1V A;  4MSX A;  2VJE A;  1HYI A;  4A0C D;  1MM3 A;  4C9Z A;  1WEW A;  5C13 A;  3U5M A;  2LGL A;  2K1J A;  4UI9 B;  3U5N A;  1RMD A;  4Q6F A;  2MIQ A;  2YUR A;  5KH9 A;  2JMI A;  4UP5 A;  1JOC A;  3LQH A;  1WE9 A;  1FP0 A;  2LXP C;  3HCS A;  5LKU A;  2L0B A;  5D1M B;  2Y1M A;  2ECT A;  4W4U A;  2YQM A;  2IDA A;  2L75 A;  4XI1 A;  2JMJ A;  2M1R A;  2OXQ C;  1JM7 A;  3VK6 A;  2QJ0 A;  4GND A;  5B77 A;  2G45 A;  2LQ6 A;  5D1K B;  2D8S A;  2C2L A;  4GNF A;  4R8P K;  2MA6 A;  2CT2 A;  1F62 A;  2KYU A;  1WIL A;  5KH3 A;  2CSY A;  1Z60 A;  3SOW A;  2MD7 B;  2VPG A;  4CCG X;  4F52 B;  4B86 C;  2AN6 A;  2LDR A;  2G6Q A;  2F42 A;  1XWH A;  1VFY A;  4WA6 A;  2LGV A;  2QIC A;  4LJN A;  2EGP A;  3PUR A;  2YHO A;  2K16 A;  4I7C A;  3O37 A;  2FSA A;  1X4U A;  4A49 A;  3PUQ A;  2EA6 A;  4LKA A;  2H0D B;  3MHS A;  5TRB A;  2MD8 C;  3DQV R;  5TBN A;  2I50 A;  2YT5 A;  3GV4 A;  4WZ2 A;  3N9O A;  2FUI A;  3FL2 A;  2VPB A;  4YBS A;  3LRQ A;  5AIU A;  3KNV A;  3M99 A;  1K2F A;  3ZVZ B;  3QZV A;  4TKP B;  2YHN A;  4I7B A;  5JG6 A;  2LN0 A;  4GNG A;  2KGG A;  5J3X A;  1WEQ A;  3RPG B;  3C5K A;  2VPD A;  4LK9 A;  2YQL A;  5FB1 A;  5DIN A; 
#chains in the Genus database with same CATH topology
 5EYA F;  1WEV A;  2KGI A;  2XB1 A;  1HYJ A;  2KKX A;  5SVI B;  4YBM A;  5SVY A;  4FJC A;  4L7X A;  3M63 A;  3LDY A;  3O70 A;  2VP7 A;  2CKL A;  3HCU A;  2LV9 A;  5G05 B;  2MNY A;  2HYE D;  1G25 A;  3O47 A;  2PUY A;  3T6R A;  2KWJ A;  5B8D A;  2CSV A;  2XP0 A;  5LKZ A;  2VJF A;  3ASL A;  2MT5 A;  2E6S A;  5H9M A;  2RI7 A;  3O33 A;  3RPG C;  1CHC A;  4IC2 A;  2YSJ A;  3N9P A;  2VJF B;  1FBV A;  4FIP A;  5KH7 A;  3L1Z B;  2JMD A;  2IQJ A;  2D8U A;  3KDE C;  4H9D A;  2KFT A;  5LKX A;  2JRJ A;  2VPE A;  2KWN A;  3L11 A;  5TDW A;  5FEY A;  2K17 A;  3KV5 A;  4I7D A;  4ZDT A;  2JUN A;  4YBT A;  2K4D A;  3EB5 A;  4OGC A;  2F6N A;  3LQI A;  3C6W A;  3SHB A;  2JM3 A;  4V3K C;  4QF2 A;  4UP0 A;  4PTB A;  5SVX A;  2LGK A;  2DX8 A;  4B7Y C;  5C11 A;  4IC3 A;  3FAN A;  1BOR A;  1WEU A;  1WEP A;  4YAB A;  2KKY A;  3HCT A;  3IHP A;  3EB6 A;  2VNF A;  4N4F A;  3DPL R;  1WGM A;  4WZ3 B;  4Z0R A;  4O64 A;  5B75 A;  2XEU A;  2E6R A;  1WFK A;  2KR4 A;  4AUQ B;  5FB0 A;  3SOX A;  2OWA A;  3NG2 A;  4YAT A;  2ECV A;  5H1T A;  3T9K A;  4AYC B;  2LRI C;  2ECI A;  2HDP A;  2FFW A;  4AP4 A;  4LLB A;  3ZVY A;  5TAB A;  2ECG A;  1Z2Q A;  1WEN A;  3N9Q A;  4N3W A;  2BAY A;  4YAX A;  1Z6U A;  2M6M A;  5FER A;  3ZYQ A;  4YAD A;  3T7L A;  2UZG A;  3O7A A;  5I3L A;  3GL6 A;  3N9M A;  1MM2 A;  3V43 A;  3SUB A;  2FUU A;  2ECN A;  2DSM A;  2LAU A;  4GNE A;  5B76 A;  3RTR B;  4GB0 A;  2YU4 A;  5H1U A;  4R2Y A;  4NN2 A;  2P57 A;  2ECJ A;  2M13 A;  1VD4 A;  3O34 A;  2YYR A;  2C2V S;  5LKT A;  2QIZ A;  2NAA A;  2YSM A;  3O35 A;  2YW8 A;  2CSZ A;  2L7P A;  3ZTG A;  3SOU A;  1WEO A;  2LXH C;  4YC9 A;  3KQI A;  3LJU X;  2G43 A;  2ZET C;  3E2D A;  3I2D A;  2XOZ A;  4MVT A;  5SVI A;  3U5O A;  2KU3 A;  1E4U A;  2Y43 A;  3PHD A;  3M62 A;  5B78 A;  4A4C A;  4Z0O A;  5B79 A;  3ZPV 1;  1WEE A;  4WZ0 A;  2CON A;  3FAO A;  4S3O B;  2EOD A;  3ZPV E;  2M3H A;  1U6G B;  4R7E A;  4QF3 A;  3DWD A;  1VYX A;  2M85 A;  4CA1 A;  1N87 A;  2CRR A;  4V3L C;  1X4I A;  5D1L B;  5G0F A;  2MA5 A;  1WIM A;  5AIT A;  4BBQ A;  1MBM A;  2ECW A;  1WES A;  2CRW A;  2YUC A;  1ZBD B;  4BHW A;  5TDR A;  2RSD A;  3N9N A;  2B0O E;  4O62 A;  2YRE A;  4ZUX U;  4LAD B;  2YVR A;  5DKA A;  3MHH A;  1X4J A;  3L1X A;  2VJE B;  1DVP A;  2L80 A;  4FO9 A;  2F6J A;  4PPE A;  4P5O B;  1WEM A;  2L5U A;  3FM8 C;  2L43 A;  2CKL B;  4FK5 A;  1JM7 B;  2KRE A;  2EXU A;  3ZNI A;  5G04 B;  4A4B A;  1LDJ B;  2MUM A;  2KWK A;  4ZQL A;  1IYM A;  2XOC A;  3LQJ A;  3O36 A;  3LVR E;  3KV6 A;  4L58 A;  3PLW A;  2H0D A;  3FJU B;  3HTK C;  2KE1 A;  4X3G A;  3JUE A;  4AVX A;  1V87 A;  2FD4 A;  4S3O C;  1T1H A;  2Y1N A;  3MDB C;  4QQ4 A;  3N9L A;  4AYC A;  1LDK C;  2MNZ A;  2PNX A;  5LCW B;  2KWO A;  2KIZ A;  3M7K A;  3U5P A;  2LGG A;  5H1V A;  4MSX A;  2VJE A;  1HYI A;  4A0C D;  1MM3 A;  4C9Z A;  1WEW A;  5C13 A;  3U5M A;  2LGL A;  2K1J A;  4UI9 B;  3U5N A;  1RMD A;  4Q6F A;  2MIQ A;  2YUR A;  5KH9 A;  2E61 A;  2JMI A;  4UP5 A;  1JOC A;  3LQH A;  1WE9 A;  2EGM A;  1FP0 A;  3FEH A;  2LXP C;  3HCS A;  5LKU A;  2L0B A;  5D1M B;  2Y1M A;  2ECT A;  4W4U A;  2YQM A;  5K3Q A;  2IDA A;  2L75 A;  4XI1 A;  2JMJ A;  2M1R A;  2OXQ C;  1JM7 A;  3VK6 A;  2QJ0 A;  4GND A;  5B77 A;  2G45 A;  2LQ6 A;  5D1K B;  2D8S A;  3H7H A;  2C2L A;  4GNF A;  4R8P K;  2MA6 A;  2CT2 A;  3Q1D A;  1F62 A;  2KYU A;  1WIL A;  5KH3 A;  2CSY A;  1Z60 A;  3SOW A;  2MD7 B;  2VPG A;  4CCG X;  4F52 B;  4OGE A;  4B86 C;  2AN6 A;  2LDR A;  2G6Q A;  2F42 A;  1XWH A;  1VFY A;  4WA6 A;  4LJN A;  2LGV A;  2QIC A;  2EGP A;  3PUR A;  2YHO A;  2K16 A;  4I7C A;  3O37 A;  2FSA A;  1X4U A;  4A49 A;  2DJA A;  3PUQ A;  2EA6 A;  4LKA A;  2H0D B;  3MHS A;  5TRB A;  2MD8 C;  3DQV R;  5TBN A;  2MKE A;  2I50 A;  2YT5 A;  3GV4 A;  4WZ2 A;  1DCQ A;  3LVQ E;  3N9O A;  2FUI A;  3FL2 A;  2VPB A;  4YBS A;  3LRQ A;  5AIU A;  3KNV A;  3M99 A;  1K2F A;  3ZVZ B;  3QZV A;  4TKP B;  3DDT A;  2RR4 A;  2YHN A;  4I7B A;  5JG6 A;  2LN0 A;  4GNG A;  2KGG A;  5J3X A;  1WEQ A;  3RPG B;  3C5K A;  2VPD A;  4LK9 A;  2YQL A;  4F1P A;  2XOY A;  5FB1 A;  5DIN A; 
#chains in the Genus database with same CATH homology
 5EYA F;  1WEV A;  2KGI A;  2XB1 A;  1HYJ A;  4YBM A;  4FJC A;  4L7X A;  3M63 A;  3O70 A;  2VP7 A;  2CKL A;  3HCU A;  2LV9 A;  5G05 B;  2MNY A;  2HYE D;  1G25 A;  2PUY A;  3T6R A;  2KWJ A;  5B8D A;  5LKZ A;  2VJF A;  3ASL A;  2MT5 A;  2E6S A;  5H9M A;  2RI7 A;  3O33 A;  3RPG C;  1CHC A;  4IC2 A;  2YSJ A;  3N9P A;  2VJF B;  1FBV A;  4FIP A;  5KH7 A;  3L1Z B;  2JMD A;  2KFT A;  5LKX A;  2JRJ A;  2VPE A;  2KWN A;  3L11 A;  5TDW A;  5FEY A;  2K17 A;  3KV5 A;  4I7D A;  4ZDT A;  4YBT A;  2K4D A;  3EB5 A;  2F6N A;  3LQI A;  3C6W A;  3SHB A;  4V3K C;  4QF2 A;  4UP0 A;  4PTB A;  2LGK A;  2DX8 A;  4B7Y C;  5C11 A;  4IC3 A;  1BOR A;  1WEU A;  1WEP A;  4YAB A;  3HCT A;  3IHP A;  3EB6 A;  2VNF A;  4N4F A;  3DPL R;  1WGM A;  4WZ3 B;  4O64 A;  5B75 A;  2XEU A;  2E6R A;  1WFK A;  2KR4 A;  4AUQ B;  5FB0 A;  3SOX A;  3NG2 A;  4YAT A;  2ECV A;  5H1T A;  4AYC B;  2LRI C;  2ECI A;  2HDP A;  4AP4 A;  4LLB A;  3ZVY A;  5TAB A;  2ECG A;  1Z2Q A;  1WEN A;  3N9Q A;  4N3W A;  2BAY A;  4YAX A;  1Z6U A;  2M6M A;  5FER A;  3ZYQ A;  4YAD A;  3T7L A;  2UZG A;  3O7A A;  5I3L A;  3GL6 A;  3N9M A;  1MM2 A;  3V43 A;  2FUU A;  2ECN A;  4GNE A;  5B76 A;  3RTR B;  4GB0 A;  2YU4 A;  5H1U A;  4R2Y A;  4NN2 A;  2ECJ A;  1VD4 A;  3O34 A;  2YYR A;  2C2V S;  5LKT A;  2QIZ A;  2NAA A;  2YSM A;  3O35 A;  2YW8 A;  2CSZ A;  3ZTG A;  3SOU A;  1WEO A;  2LXH C;  4YC9 A;  3KQI A;  2G43 A;  2ZET C;  3I2D A;  4MVT A;  3U5O A;  2KU3 A;  1E4U A;  2Y43 A;  3PHD A;  3M62 A;  5B78 A;  4A4C A;  5B79 A;  3ZPV 1;  1WEE A;  4WZ0 A;  4S3O B;  3ZPV E;  2EOD A;  2M3H A;  1U6G B;  4R7E A;  4QF3 A;  1VYX A;  2M85 A;  4CA1 A;  1N87 A;  4V3L C;  5D1L B;  1X4I A;  5G0F A;  2MA5 A;  1WIM A;  5AIT A;  4BBQ A;  2ECW A;  1WES A;  2YUC A;  1ZBD B;  4BHW A;  5TDR A;  2RSD A;  3N9N A;  2YRE A;  4ZUX U;  4LAD B;  5DKA A;  3MHH A;  1X4J A;  3L1X A;  2VJE B;  1DVP A;  2L80 A;  4FO9 A;  2F6J A;  4PPE A;  4P5O B;  1WEM A;  2L5U A;  2L43 A;  2CKL B;  4FK5 A;  1JM7 B;  2KRE A;  3ZNI A;  5G04 B;  4A4B A;  1LDJ B;  2MUM A;  2KWK A;  4ZQL A;  1IYM A;  3LQJ A;  3O36 A;  3KV6 A;  4L58 A;  2H0D A;  3HTK C;  2KE1 A;  4X3G A;  4AVX A;  1V87 A;  4S3O C;  1T1H A;  2Y1N A;  3N9L A;  4AYC A;  1LDK C;  2MNZ A;  2PNX A;  5LCW B;  2KWO A;  2KIZ A;  3U5P A;  2LGG A;  5H1V A;  4MSX A;  2VJE A;  1HYI A;  4A0C D;  1MM3 A;  4C9Z A;  1WEW A;  5C13 A;  3U5M A;  2LGL A;  2K1J A;  4UI9 B;  3U5N A;  1RMD A;  4Q6F A;  2MIQ A;  2YUR A;  5KH9 A;  2JMI A;  4UP5 A;  1JOC A;  3LQH A;  1WE9 A;  1FP0 A;  2LXP C;  3HCS A;  5LKU A;  2L0B A;  5D1M B;  2Y1M A;  2ECT A;  4W4U A;  2YQM A;  2IDA A;  2L75 A;  4XI1 A;  2JMJ A;  2M1R A;  2OXQ C;  1JM7 A;  3VK6 A;  2QJ0 A;  4GND A;  5B77 A;  2G45 A;  2LQ6 A;  5D1K B;  2D8S A;  2C2L A;  4GNF A;  4R8P K;  2MA6 A;  2CT2 A;  1F62 A;  2KYU A;  1WIL A;  5KH3 A;  2CSY A;  1Z60 A;  3SOW A;  2MD7 B;  2VPG A;  4CCG X;  4F52 B;  4B86 C;  2AN6 A;  2LDR A;  2G6Q A;  2F42 A;  1XWH A;  1VFY A;  4WA6 A;  2LGV A;  2QIC A;  4LJN A;  2EGP A;  3PUR A;  2YHO A;  2K16 A;  4I7C A;  3O37 A;  2FSA A;  1X4U A;  4A49 A;  3PUQ A;  2EA6 A;  4LKA A;  2H0D B;  3MHS A;  5TRB A;  2MD8 C;  3DQV R;  5TBN A;  2I50 A;  2YT5 A;  3GV4 A;  4WZ2 A;  3N9O A;  2FUI A;  3FL2 A;  2VPB A;  4YBS A;  3LRQ A;  5AIU A;  3KNV A;  3M99 A;  1K2F A;  3ZVZ B;  3QZV A;  4TKP B;  2YHN A;  4I7B A;  5JG6 A;  2LN0 A;  4GNG A;  2KGG A;  5J3X A;  1WEQ A;  3RPG B;  3C5K A;  2VPD A;  4LK9 A;  2YQL A;  5FB1 A;  5DIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...