5FEYA

Trim32 ring
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
78
Chain Sequence
SHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASGVRCPFCSKITRITQLTDNLTVLKIIDTAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase TRIM32
publication title Functional role of TRIM E3 ligase oligomerization and regulation of catalytic activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 78
sequence length 84
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13445 zf-RING_UBOX RING-type zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5feyA00
4LK9A 1FP0A 3ZPV1 1WEOA 4V3KC 5KH3A 2F42A 2H0DA 2KWJA 3O37A 2XEUA 5TRBA 2EGPA 2EODA 1V87A 2CT2A 2FUIA 5C13A 1X4IA 2Y1MA 3IHPA 1JM7A 4A4BA 3O35A 3KNVA 3N9PA 2KWKA 3U5MA 4XI1A 4UP0A 5G05B 2ECGA 2MT5A 2KYUA 4C9ZA 4I7CA 3PUQA 2AN6A 1WEEA 2YQMA 2YUCA 2LV9A 2YSMA 4ZDTA 2C2VS 3KV5A 2YSJA 2KIZA 5C11A 1WE9A 3SOUA 5AIUA 2YW8A 3PHDA 5LKUA 2MUMA 3QZVA 4GNFA 5FB0A 3NG2A 3ZVYA 5B79A 1VYXA 2QJ0A 5B75A 5AITA 2EA6A 2K16A 1JM7B 2LGKA 4GNGA 3M99A 4LJNA 2L0BA 5TDRA 5H1UA 2VNFA 2VPGA 2K4DA 4ZQLA 3MHHA 1N87A 1Z2QA 2LGGA 2LRIC 5H9MA 2MA5A 2KU3A 2OXQC 1VFYA 3T7LA 1G25A 2NAAA 2K1JA 2ECIA 1MM3A 3KV6A 4FIPA 4LKAA 5LKTA 4LLBA 4YC9A 1IYMA 1DVPA 5EYAF 2FSAA 3HTKC 2G45A 3L1ZB 3EB6A 2I50A 2CKLB 3HCSA 2ECJA 2YHNA 5LKXA 2YQLA 4PPEA 2C2LA 2VPBA 4I7BA 5DKAA 5KH9A 2F6NA 2MNYA 2M1RA 3HCTA 2MD7B 1WFKA 4UP5A 2E6RA 2KFTA 4B7YC 3RPGB 3V43A 1WILA 3N9OA 2D8SA 2YU4A 4YABA 1F62A 2ECTA 3ZYQA 1WESA 4LADB 2MNZA 2QICA 3M63A 3U5NA 3PURA 3SHBA 3U5PA 3M62A 1X4JA 2L43A 2ZETC 4S3OB 4QF3A 5KH7A 4O64A 5D1LB 5B76A 4YADA 2L75A 2JMJA 2M85A 2DX8A 5H1VA 4PTBA 1T1HA 2ECWA 3N9LA 3ZTGA 2K17A 1WENA 4YATA 4IC3A 5LCWB 3O34A 3HCUA 4FK5A 2CSYA 3ZVZB 4IC2A 5TBNA 2CKLA 3LRQA 4WA6A 5TDWA 5JG6A 2VPDA 5LKZA 4I7DA 2LDRA 4FO9A 1FBVA 4N4FA 1WEPA 4BHWA 2VJEA 3RPGC 2L5UA 1LDJB 2ECVA 3O7AA 4MSXA 2CSZA 3VK6A 3ZPVE 4X3GA 1WEQA 4R7EA 4B86C 3N9MA 2MA6A 2MIQA 4W4UA 1XWHA 2JMDA 2JMIA 2ECNA 3O70A 1VD4A 1K2FA 4F52B 2LGLA 4YBMA 4WZ3B 3U5OA 4R2YA 1HYIA 4GNEA 4YBSA 5D1KB 4Q6FA 3EB5A 5I3LA 1LDKC 5H1TA 2XB1A 1WEMA 2Y43A 3MHSA 3LQHA 2YYRA 3RTRB 2G43A 2PNXA 4YAXA 4L58A 2M6MA 2LXHC 2BAYA 2VJEB 3O36A 1CHCA 1JOCA 1ZBDB 2HDPA 4AUQB 5G0FA 4MVTA 3LQJA 4UI9B 2YHOA 2VJFB 1E4UA 1WGMA 4R8PK 3DQVR 4FJCA 3LQIA 2QIZA 1Z60A 4QF2A 5J3XA 2KGGA 5TABA 3C5KA 4AYCB 5DINA 2YT5A 3O33A 2YREA 2JRJA 5FB1A 2KREA 4GB0A 4TKPB 4AVXA 4A4CA 3C6WA 1BORA 1Z6UA 2LXPC 2KGIA 5D1MB 2LGVA 3GL6A 1U6GB 1MM2A 2MD8C 1WEVA 3I2DA 2KE1A 2FUUA 2KR4A 3GV4A 1WIMA 4P5OB 4WZ2A 2H0DB 4GNDA 3T6RA 1X4UA 3ZNIA 2L80A 3N9NA 4L7XA 2E6SA 3L1XA 4WZ0A 2Y1NA 2LN0A 2YURA 4AP4A 3FL2A 4NN2A 2PUYA 2IDAA 2VJFA 1HYJA 5B8DA 4N3WA 2HYED 4A49A 2VPEA 4V3LC 4S3OC 4BBQA 2LQ6A 5G04B 2VP7A 2G6QA 4AYCA 1RMDA 3SOXA 1WEUA 5FEYA 2KWOA 3N9QA 4CA1A 2RSDA 3KQIA 3ASLA 2F6JA 2UZGA 2KWNA 4A0CD 3SOWA 3DPLR 2RI7A 5B78A 4CCGX 2M3HA 4ZUXU 3L11A 1WEWA 5FERA 5B77A 4YBTA
chains in the Genus database with same CATH superfamily
4LK9A 3PLWA 1FP0A 3ZPV1 1WEOA 3FM8C 4V3KC 5KH3A 2F42A 2H0DA 2KWJA 3O37A 2XEUA 5TRBA 2EGPA 2EODA 1V87A 2DJAA 2CT2A 2FUIA 5C13A 1X4IA 2Y1MA 3IHPA 1JM7A 4A4BA 3O35A 3KNVA 4Z0OA 3N9PA 2KWKA 3U5MA 4XI1A 4UP0A 5G05B 4OGEA 2ECGA 2MT5A 2KYUA 4C9ZA 4I7CA 2XOYA 2CSVA 3PUQA 2AN6A 1WEEA 3DDTA 2YQMA 3H7HA 5B77A 2YUCA 2LV9A 2YSMA 4ZDTA 2C2VS 3JUEA 2XOCA 2LAUA 3KV5A 2YSJA 2KIZA 5C11A 3E2DA 3DWDA 1WE9A 3SOUA 4F1PA 5AIUA 2YW8A 3PHDA 5LKUA 2MUMA 3QZVA 4GNFA 5FB0A 3NG2A 3ZVYA 5B79A 1VYXA 2QJ0A 5B75A 3FAOA 1MBMA 5AITA 2EA6A 2K16A 1JM7B 2LGKA 4GNGA 3M99A 4LJNA 2L0BA 5TDRA 5SVIA 5H1UA 2L7PA 2VNFA 2VPGA 2K4DA 4ZQLA 3MHHA 1N87A 1Z2QA 2LGGA 2LRIC 2EGMA 5H9MA 2MA5A 2KU3A 2OXQC 1VFYA 3T7LA 2DSMA 1G25A 3FEHA 2NAAA 2K1JA 2ECIA 1MM3A 3KV6A 4FIPA 4LKAA 5LKTA 4LLBA 4YC9A 1IYMA 1DVPA 2D8UA 5EYAF 2FSAA 3HTKC 2G45A 3L1ZB 3EB6A 2I50A 2CKLB 3HCSA 2ECJA 2YHNA 5LKXA 2YQLA 4PPEA 2C2LA 2VPBA 4I7BA 5DKAA 5KH9A 2F6NA 2MKEA 5SVIB 2MNYA 2M1RA 3HCTA 2MD7B 1WFKA 2IQJA 4UP5A 3LJUX 2E6RA 2KFTA 4B7YC 3RPGB 3V43A 1WILA 3N9OA 2D8SA 2YU4A 4YABA 5SVYA 1F62A 2ECTA 3ZYQA 1WESA 4LADB 2MNZA 2QICA 3M63A 3FANA 3PURA 3U5NA 3SHBA 3U5PA 3M62A 1X4JA 2L43A 2ZETC 4S3OB 4QF3A 5KH7A 4O64A 2EXUA 5D1LB 1DCQA 5B76A 4YADA 2JUNA 2L75A 2JMJA 2M85A 2DX8A 5H1VA 4PTBA 2CONA 1T1HA 2ECWA 3N9LA 3ZTGA 2K17A 1WENA 4YATA 4IC3A 5LCWB 3O34A 3HCUA 4FK5A 2CSYA 3ZVZB 4IC2A 5TBNA 2CKLA 2XOZA 3LRQA 4WA6A 5TDWA 5JG6A 2VPDA 2KKYA 5LKZA 4I7DA 2LDRA 4QQ4A 4FO9A 1FBVA 4N4FA 1WEPA 4BHWA 2M13A 2VJEA 2L5UA 1LDJB 2ECVA 3O7AA 4MSXA 2CSZA 4Z0RA 3RPGC 3VK6A 3ZPVE 4X3GA 1WEQA 4R7EA 4B86C 3N9MA 2MA6A 3LVQE 2MIQA 4W4UA 3LVRE 1XWHA 2JMDA 2JMIA 2CRWA 3M7KA 2ECNA 2CRRA 3O70A 1VD4A 1K2FA 4F52B 2LGLA 4YBMA 4WZ3B 3U5OA 4R2YA 1HYIA 4GNEA 2JM3A 3SUBA 4YBSA 5D1KB 4Q6FA 3EB5A 5I3LA 1LDKC 5H1TA 4O62A 2XB1A 1WEMA 2Y43A 3MHSA 3LQHA 2YYRA 3RTRB 5SVXA 2G43A 2PNXA 4YAXA 2FD4A 4L58A 2M6MA 2LXHC 2E61A 2BAYA 2VJEB 3O36A 1CHCA 1JOCA 1ZBDB 2HDPA 2KKXA 2P57A 5G0FA 4AUQB 4MVTA 3LQJA 4UI9B 3Q1DA 2YHOA 2VJFB 1E4UA 1WGMA 4R8PK 3DQVR 4FJCA 3FJUB 3LQIA 2OWAA 2QIZA 1Z60A 4QF2A 5J3XA 2KGGA 5TABA 3C5KA 4AYCB 5DINA 2YT5A 3MDBC 3O33A 2YREA 2JRJA 5FB1A 2KREA 4GB0A 4TKPB 4AVXA 4A4CA 3C6WA 1BORA 1Z6UA 2LXPC 2KGIA 2YVRA 5D1MB 2LGVA 3GL6A 1U6GB 1MM2A 2MD8C 1WEVA 2B0OE 3I2DA 2KE1A 2FUUA 2KR4A 3GV4A 1WIMA 4P5OB 4WZ2A 2H0DB 4GNDA 3T6RA 3KDEC 1X4UA 3ZNIA 2L80A 3N9NA 4L7XA 2E6SA 3L1XA 4WZ0A 3LDYA 2Y1NA 2LN0A 2YURA 4AP4A 3FL2A 4NN2A 2PUYA 2IDAA 2VJFA 1HYJA 5B8DA 4H9DA 4N3WA 2HYED 4A49A 5K3QA 2VPEA 4V3LC 4S3OC 4BBQA 2LQ6A 5G04B 2VP7A 3O47A 2G6QA 4AYCA 1RMDA 3SOXA 1WEUA 5FEYA 3T9KA 2KWOA 3N9QA 4CA1A 2RSDA 3KQIA 3ASLA 2F6JA 2UZGA 2KWNA 4A0CD 2FFWA 4OGCA 3SOWA 3DPLR 2RI7A 5B78A 2XP0A 4CCGX 2M3HA 4ZUXU 3L11A 1WEWA 5FERA 2RR4A 4YBTA
chains in the Genus database with same CATH topology
4LK9A 1FP0A 3ZPV1 1WEOA 4V3KC 5KH3A 2F42A 2H0DA 2KWJA 3O37A 2XEUA 5TRBA 2EGPA 2EODA 1V87A 2CT2A 2FUIA 5C13A 1X4IA 2Y1MA 3IHPA 1JM7A 4A4BA 3O35A 3KNVA 3N9PA 2KWKA 3U5MA 4XI1A 4UP0A 5G05B 2ECGA 2MT5A 2KYUA 4C9ZA 4I7CA 3PUQA 2AN6A 1WEEA 2YQMA 2YUCA 2LV9A 2YSMA 4ZDTA 2C2VS 3KV5A 2YSJA 2KIZA 5C11A 1WE9A 3SOUA 5AIUA 2YW8A 3PHDA 5LKUA 2MUMA 3QZVA 4GNFA 5FB0A 3NG2A 3ZVYA 5B79A 1VYXA 2QJ0A 5B75A 5AITA 2EA6A 2K16A 1JM7B 2LGKA 4GNGA 3M99A 4LJNA 2L0BA 5TDRA 5H1UA 2VNFA 2VPGA 2K4DA 4ZQLA 3MHHA 1N87A 1Z2QA 2LGGA 2LRIC 5H9MA 2MA5A 2KU3A 2OXQC 1VFYA 3T7LA 1G25A 2NAAA 2K1JA 2ECIA 1MM3A 3KV6A 4FIPA 4LKAA 5LKTA 4LLBA 4YC9A 1IYMA 1DVPA 5EYAF 2FSAA 3HTKC 2G45A 3L1ZB 3EB6A 2I50A 2CKLB 3HCSA 2ECJA 2YHNA 5LKXA 2YQLA 4PPEA 2C2LA 2VPBA 4I7BA 5DKAA 5KH9A 2F6NA 2MNYA 2M1RA 3HCTA 2MD7B 1WFKA 4UP5A 2E6RA 2KFTA 4B7YC 3RPGB 3V43A 1WILA 3N9OA 2D8SA 2YU4A 4YABA 1F62A 2ECTA 3ZYQA 1WESA 4LADB 2MNZA 2QICA 3M63A 3U5NA 3PURA 3SHBA 3U5PA 3M62A 1X4JA 2L43A 2ZETC 4S3OB 4QF3A 5KH7A 4O64A 5D1LB 5B76A 4YADA 2L75A 2JMJA 2M85A 2DX8A 5H1VA 4PTBA 1T1HA 2ECWA 3N9LA 3ZTGA 2K17A 1WENA 4YATA 4IC3A 5LCWB 3O34A 3HCUA 4FK5A 2CSYA 3ZVZB 4IC2A 5TBNA 2CKLA 3LRQA 4WA6A 5TDWA 5JG6A 2VPDA 5LKZA 4I7DA 2LDRA 4FO9A 1FBVA 4N4FA 1WEPA 4BHWA 2VJEA 3RPGC 2L5UA 1LDJB 2ECVA 3O7AA 4MSXA 2CSZA 3VK6A 3ZPVE 4X3GA 1WEQA 4R7EA 4B86C 3N9MA 2MA6A 2MIQA 4W4UA 1XWHA 2JMDA 2JMIA 2ECNA 3O70A 1VD4A 1K2FA 4F52B 2LGLA 4YBMA 4WZ3B 3U5OA 4R2YA 1HYIA 4GNEA 4YBSA 5D1KB 4Q6FA 3EB5A 5I3LA 1LDKC 5H1TA 2XB1A 1WEMA 2Y43A 3MHSA 3LQHA 2YYRA 3RTRB 2G43A 2PNXA 4YAXA 4L58A 2M6MA 2LXHC 2BAYA 2VJEB 3O36A 1CHCA 1JOCA 1ZBDB 2HDPA 4AUQB 5G0FA 4MVTA 3LQJA 4UI9B 2YHOA 2VJFB 1E4UA 1WGMA 4R8PK 3DQVR 4FJCA 3LQIA 2QIZA 1Z60A 4QF2A 5J3XA 2KGGA 5TABA 3C5KA 4AYCB 5DINA 2YT5A 3O33A 2YREA 2JRJA 5FB1A 2KREA 4GB0A 4TKPB 4AVXA 4A4CA 3C6WA 1BORA 1Z6UA 2LXPC 2KGIA 5D1MB 2LGVA 3GL6A 1U6GB 1MM2A 2MD8C 1WEVA 3I2DA 2KE1A 2FUUA 2KR4A 3GV4A 1WIMA 4P5OB 4WZ2A 2H0DB 4GNDA 3T6RA 1X4UA 3ZNIA 2L80A 3N9NA 4L7XA 2E6SA 3L1XA 4WZ0A 2Y1NA 2LN0A 2YURA 4AP4A 3FL2A 4NN2A 2PUYA 2IDAA 2VJFA 1HYJA 5B8DA 4N3WA 2HYED 4A49A 2VPEA 4V3LC 4S3OC 4BBQA 2LQ6A 5G04B 2VP7A 2G6QA 4AYCA 1RMDA 3SOXA 1WEUA 5FEYA 2KWOA 3N9QA 4CA1A 2RSDA 3KQIA 3ASLA 2F6JA 2UZGA 2KWNA 4A0CD 3SOWA 3DPLR 2RI7A 5B78A 4CCGX 2M3HA 4ZUXU 3L11A 1WEWA 5FERA 5B77A 4YBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK9 A;  1FP0 A;  3ZPV 1;  1WEO A;  4V3K C;  5KH3 A;  2F42 A;  2H0D A;  2KWJ A;  3O37 A;  2XEU A;  5TRB A;  2EGP A;  2EOD A;  1V87 A;  2CT2 A;  2FUI A;  5C13 A;  1X4I A;  2Y1M A;  3IHP A;  1JM7 A;  4A4B A;  3O35 A;  3KNV A;  3N9P A;  2KWK A;  3U5M A;  4XI1 A;  4UP0 A;  5G05 B;  2ECG A;  2MT5 A;  2KYU A;  4C9Z A;  4I7C A;  3PUQ A;  2AN6 A;  1WEE A;  2YQM A;  2YUC A;  2LV9 A;  2YSM A;  4ZDT A;  2C2V S;  3KV5 A;  2YSJ A;  2KIZ A;  5C11 A;  1WE9 A;  3SOU A;  5AIU A;  2YW8 A;  3PHD A;  5LKU A;  2MUM A;  3QZV A;  4GNF A;  5FB0 A;  3NG2 A;  3ZVY A;  5B79 A;  1VYX A;  2QJ0 A;  5B75 A;  5AIT A;  2EA6 A;  2K16 A;  1JM7 B;  2LGK A;  4GNG A;  3M99 A;  4LJN A;  2L0B A;  5TDR A;  5H1U A;  2VNF A;  2VPG A;  2K4D A;  4ZQL A;  3MHH A;  1N87 A;  1Z2Q A;  2LGG A;  2LRI C;  5H9M A;  2MA5 A;  2KU3 A;  2OXQ C;  1VFY A;  3T7L A;  1G25 A;  2NAA A;  2K1J A;  2ECI A;  1MM3 A;  3KV6 A;  4FIP A;  4LKA A;  5LKT A;  4LLB A;  4YC9 A;  1IYM A;  1DVP A;  5EYA F;  2FSA A;  3HTK C;  2G45 A;  3L1Z B;  3EB6 A;  2I50 A;  2CKL B;  3HCS A;  2ECJ A;  2YHN A;  5LKX A;  2YQL A;  4PPE A;  2C2L A;  2VPB A;  4I7B A;  5DKA A;  5KH9 A;  2F6N A;  2MNY A;  2M1R A;  3HCT A;  2MD7 B;  1WFK A;  4UP5 A;  2E6R A;  2KFT A;  4B7Y C;  3RPG B;  3V43 A;  1WIL A;  3N9O A;  2D8S A;  2YU4 A;  4YAB A;  1F62 A;  2ECT A;  3ZYQ A;  1WES A;  4LAD B;  2MNZ A;  2QIC A;  3M63 A;  3U5N A;  3PUR A;  3SHB A;  3U5P A;  3M62 A;  1X4J A;  2L43 A;  2ZET C;  4S3O B;  4QF3 A;  5KH7 A;  4O64 A;  5D1L B;  5B76 A;  4YAD A;  2L75 A;  2JMJ A;  2M85 A;  2DX8 A;  5H1V A;  4PTB A;  1T1H A;  2ECW A;  3N9L A;  3ZTG A;  2K17 A;  1WEN A;  4YAT A;  4IC3 A;  5LCW B;  3O34 A;  3HCU A;  4FK5 A;  2CSY A;  3ZVZ B;  4IC2 A;  5TBN A;  2CKL A;  3LRQ A;  4WA6 A;  5TDW A;  5JG6 A;  2VPD A;  5LKZ A;  4I7D A;  2LDR A;  4FO9 A;  1FBV A;  4N4F A;  1WEP A;  4BHW A;  2VJE A;  3RPG C;  2L5U A;  1LDJ B;  2ECV A;  3O7A A;  4MSX A;  2CSZ A;  3VK6 A;  3ZPV E;  4X3G A;  1WEQ A;  4R7E A;  4B86 C;  3N9M A;  2MA6 A;  2MIQ A;  4W4U A;  1XWH A;  2JMD A;  2JMI A;  2ECN A;  3O70 A;  1VD4 A;  1K2F A;  4F52 B;  2LGL A;  4YBM A;  4WZ3 B;  3U5O A;  4R2Y A;  1HYI A;  4GNE A;  4YBS A;  5D1K B;  4Q6F A;  3EB5 A;  5I3L A;  1LDK C;  5H1T A;  2XB1 A;  1WEM A;  2Y43 A;  3MHS A;  3LQH A;  2YYR A;  3RTR B;  2G43 A;  2PNX A;  4YAX A;  4L58 A;  2M6M A;  2LXH C;  2BAY A;  2VJE B;  3O36 A;  1CHC A;  1JOC A;  1ZBD B;  2HDP A;  4AUQ B;  5G0F A;  4MVT A;  3LQJ A;  4UI9 B;  2YHO A;  2VJF B;  1E4U A;  1WGM A;  4R8P K;  3DQV R;  4FJC A;  3LQI A;  2QIZ A;  1Z60 A;  4QF2 A;  5J3X A;  2KGG A;  5TAB A;  3C5K A;  4AYC B;  5DIN A;  2YT5 A;  3O33 A;  2YRE A;  2JRJ A;  5FB1 A;  2KRE A;  4GB0 A;  4TKP B;  4AVX A;  4A4C A;  3C6W A;  1BOR A;  1Z6U A;  2LXP C;  2KGI A;  5D1M B;  2LGV A;  3GL6 A;  1U6G B;  1MM2 A;  2MD8 C;  1WEV A;  3I2D A;  2KE1 A;  2FUU A;  2KR4 A;  3GV4 A;  1WIM A;  4P5O B;  4WZ2 A;  2H0D B;  4GND A;  3T6R A;  1X4U A;  3ZNI A;  2L80 A;  3N9N A;  4L7X A;  2E6S A;  3L1X A;  4WZ0 A;  2Y1N A;  2LN0 A;  2YUR A;  4AP4 A;  3FL2 A;  4NN2 A;  2PUY A;  2IDA A;  2VJF A;  1HYJ A;  5B8D A;  4N3W A;  2HYE D;  4A49 A;  2VPE A;  4V3L C;  4S3O C;  4BBQ A;  2LQ6 A;  5G04 B;  2VP7 A;  2G6Q A;  4AYC A;  1RMD A;  3SOX A;  1WEU A;  5FEY A;  2KWO A;  3N9Q A;  4CA1 A;  2RSD A;  3KQI A;  3ASL A;  2F6J A;  2UZG A;  2KWN A;  4A0C D;  3SOW A;  3DPL R;  2RI7 A;  5B78 A;  4CCG X;  2M3H A;  4ZUX U;  3L11 A;  1WEW A;  5FER A;  5B77 A;  4YBT A; 
#chains in the Genus database with same CATH topology
 4LK9 A;  3PLW A;  1FP0 A;  3ZPV 1;  1WEO A;  3FM8 C;  4V3K C;  5KH3 A;  2F42 A;  2H0D A;  2KWJ A;  3O37 A;  2XEU A;  5TRB A;  2EGP A;  2EOD A;  1V87 A;  2DJA A;  2CT2 A;  2FUI A;  5C13 A;  1X4I A;  2Y1M A;  3IHP A;  1JM7 A;  4A4B A;  3O35 A;  3KNV A;  4Z0O A;  3N9P A;  2KWK A;  3U5M A;  4XI1 A;  4UP0 A;  5G05 B;  4OGE A;  2ECG A;  2MT5 A;  2KYU A;  4C9Z A;  4I7C A;  2XOY A;  2CSV A;  3PUQ A;  2AN6 A;  1WEE A;  3DDT A;  2YQM A;  3H7H A;  5B77 A;  2YUC A;  2LV9 A;  2YSM A;  4ZDT A;  2C2V S;  3JUE A;  2XOC A;  2LAU A;  3KV5 A;  2YSJ A;  2KIZ A;  5C11 A;  3E2D A;  3DWD A;  1WE9 A;  3SOU A;  4F1P A;  5AIU A;  2YW8 A;  3PHD A;  5LKU A;  2MUM A;  3QZV A;  4GNF A;  5FB0 A;  3NG2 A;  3ZVY A;  5B79 A;  1VYX A;  2QJ0 A;  5B75 A;  3FAO A;  1MBM A;  5AIT A;  2EA6 A;  2K16 A;  1JM7 B;  2LGK A;  4GNG A;  3M99 A;  4LJN A;  2L0B A;  5TDR A;  5SVI A;  5H1U A;  2L7P A;  2VNF A;  2VPG A;  2K4D A;  4ZQL A;  3MHH A;  1N87 A;  1Z2Q A;  2LGG A;  2LRI C;  2EGM A;  5H9M A;  2MA5 A;  2KU3 A;  2OXQ C;  1VFY A;  3T7L A;  2DSM A;  1G25 A;  3FEH A;  2NAA A;  2K1J A;  2ECI A;  1MM3 A;  3KV6 A;  4FIP A;  4LKA A;  5LKT A;  4LLB A;  4YC9 A;  1IYM A;  1DVP A;  2D8U A;  5EYA F;  2FSA A;  3HTK C;  2G45 A;  3L1Z B;  3EB6 A;  2I50 A;  2CKL B;  3HCS A;  2ECJ A;  2YHN A;  5LKX A;  2YQL A;  4PPE A;  2C2L A;  2VPB A;  4I7B A;  5DKA A;  5KH9 A;  2F6N A;  2MKE A;  5SVI B;  2MNY A;  2M1R A;  3HCT A;  2MD7 B;  1WFK A;  2IQJ A;  4UP5 A;  3LJU X;  2E6R A;  2KFT A;  4B7Y C;  3RPG B;  3V43 A;  1WIL A;  3N9O A;  2D8S A;  2YU4 A;  4YAB A;  5SVY A;  1F62 A;  2ECT A;  3ZYQ A;  1WES A;  4LAD B;  2MNZ A;  2QIC A;  3M63 A;  3FAN A;  3PUR A;  3U5N A;  3SHB A;  3U5P A;  3M62 A;  1X4J A;  2L43 A;  2ZET C;  4S3O B;  4QF3 A;  5KH7 A;  4O64 A;  2EXU A;  5D1L B;  1DCQ A;  5B76 A;  4YAD A;  2JUN A;  2L75 A;  2JMJ A;  2M85 A;  2DX8 A;  5H1V A;  4PTB A;  2CON A;  1T1H A;  2ECW A;  3N9L A;  3ZTG A;  2K17 A;  1WEN A;  4YAT A;  4IC3 A;  5LCW B;  3O34 A;  3HCU A;  4FK5 A;  2CSY A;  3ZVZ B;  4IC2 A;  5TBN A;  2CKL A;  2XOZ A;  3LRQ A;  4WA6 A;  5TDW A;  5JG6 A;  2VPD A;  2KKY A;  5LKZ A;  4I7D A;  2LDR A;  4QQ4 A;  4FO9 A;  1FBV A;  4N4F A;  1WEP A;  4BHW A;  2M13 A;  2VJE A;  2L5U A;  1LDJ B;  2ECV A;  3O7A A;  4MSX A;  2CSZ A;  4Z0R A;  3RPG C;  3VK6 A;  3ZPV E;  4X3G A;  1WEQ A;  4R7E A;  4B86 C;  3N9M A;  2MA6 A;  3LVQ E;  2MIQ A;  4W4U A;  3LVR E;  1XWH A;  2JMD A;  2JMI A;  2CRW A;  3M7K A;  2ECN A;  2CRR A;  3O70 A;  1VD4 A;  1K2F A;  4F52 B;  2LGL A;  4YBM A;  4WZ3 B;  3U5O A;  4R2Y A;  1HYI A;  4GNE A;  2JM3 A;  3SUB A;  4YBS A;  5D1K B;  4Q6F A;  3EB5 A;  5I3L A;  1LDK C;  5H1T A;  4O62 A;  2XB1 A;  1WEM A;  2Y43 A;  3MHS A;  3LQH A;  2YYR A;  3RTR B;  5SVX A;  2G43 A;  2PNX A;  4YAX A;  2FD4 A;  4L58 A;  2M6M A;  2LXH C;  2E61 A;  2BAY A;  2VJE B;  3O36 A;  1CHC A;  1JOC A;  1ZBD B;  2HDP A;  2KKX A;  2P57 A;  5G0F A;  4AUQ B;  4MVT A;  3LQJ A;  4UI9 B;  3Q1D A;  2YHO A;  2VJF B;  1E4U A;  1WGM A;  4R8P K;  3DQV R;  4FJC A;  3FJU B;  3LQI A;  2OWA A;  2QIZ A;  1Z60 A;  4QF2 A;  5J3X A;  2KGG A;  5TAB A;  3C5K A;  4AYC B;  5DIN A;  2YT5 A;  3MDB C;  3O33 A;  2YRE A;  2JRJ A;  5FB1 A;  2KRE A;  4GB0 A;  4TKP B;  4AVX A;  4A4C A;  3C6W A;  1BOR A;  1Z6U A;  2LXP C;  2KGI A;  2YVR A;  5D1M B;  2LGV A;  3GL6 A;  1U6G B;  1MM2 A;  2MD8 C;  1WEV A;  2B0O E;  3I2D A;  2KE1 A;  2FUU A;  2KR4 A;  3GV4 A;  1WIM A;  4P5O B;  4WZ2 A;  2H0D B;  4GND A;  3T6R A;  3KDE C;  1X4U A;  3ZNI A;  2L80 A;  3N9N A;  4L7X A;  2E6S A;  3L1X A;  4WZ0 A;  3LDY A;  2Y1N A;  2LN0 A;  2YUR A;  4AP4 A;  3FL2 A;  4NN2 A;  2PUY A;  2IDA A;  2VJF A;  1HYJ A;  5B8D A;  4H9D A;  4N3W A;  2HYE D;  4A49 A;  5K3Q A;  2VPE A;  4V3L C;  4S3O C;  4BBQ A;  2LQ6 A;  5G04 B;  2VP7 A;  3O47 A;  2G6Q A;  4AYC A;  1RMD A;  3SOX A;  1WEU A;  5FEY A;  3T9K A;  2KWO A;  3N9Q A;  4CA1 A;  2RSD A;  3KQI A;  3ASL A;  2F6J A;  2UZG A;  2KWN A;  4A0C D;  2FFW A;  4OGC A;  3SOW A;  3DPL R;  2RI7 A;  5B78 A;  2XP0 A;  4CCG X;  2M3H A;  4ZUX U;  3L11 A;  1WEW A;  5FER A;  2RR4 A;  4YBT A; 
#chains in the Genus database with same CATH homology
 4LK9 A;  1FP0 A;  3ZPV 1;  1WEO A;  4V3K C;  5KH3 A;  2F42 A;  2H0D A;  2KWJ A;  3O37 A;  2XEU A;  5TRB A;  2EGP A;  2EOD A;  1V87 A;  2CT2 A;  2FUI A;  5C13 A;  1X4I A;  2Y1M A;  3IHP A;  1JM7 A;  4A4B A;  3O35 A;  3KNV A;  3N9P A;  2KWK A;  3U5M A;  4XI1 A;  4UP0 A;  5G05 B;  2ECG A;  2MT5 A;  2KYU A;  4C9Z A;  4I7C A;  3PUQ A;  2AN6 A;  1WEE A;  2YQM A;  2YUC A;  2LV9 A;  2YSM A;  4ZDT A;  2C2V S;  3KV5 A;  2YSJ A;  2KIZ A;  5C11 A;  1WE9 A;  3SOU A;  5AIU A;  2YW8 A;  3PHD A;  5LKU A;  2MUM A;  3QZV A;  4GNF A;  5FB0 A;  3NG2 A;  3ZVY A;  5B79 A;  1VYX A;  2QJ0 A;  5B75 A;  5AIT A;  2EA6 A;  2K16 A;  1JM7 B;  2LGK A;  4GNG A;  3M99 A;  4LJN A;  2L0B A;  5TDR A;  5H1U A;  2VNF A;  2VPG A;  2K4D A;  4ZQL A;  3MHH A;  1N87 A;  1Z2Q A;  2LGG A;  2LRI C;  5H9M A;  2MA5 A;  2KU3 A;  2OXQ C;  1VFY A;  3T7L A;  1G25 A;  2NAA A;  2K1J A;  2ECI A;  1MM3 A;  3KV6 A;  4FIP A;  4LKA A;  5LKT A;  4LLB A;  4YC9 A;  1IYM A;  1DVP A;  5EYA F;  2FSA A;  3HTK C;  2G45 A;  3L1Z B;  3EB6 A;  2I50 A;  2CKL B;  3HCS A;  2ECJ A;  2YHN A;  5LKX A;  2YQL A;  4PPE A;  2C2L A;  2VPB A;  4I7B A;  5DKA A;  5KH9 A;  2F6N A;  2MNY A;  2M1R A;  3HCT A;  2MD7 B;  1WFK A;  4UP5 A;  2E6R A;  2KFT A;  4B7Y C;  3RPG B;  3V43 A;  1WIL A;  3N9O A;  2D8S A;  2YU4 A;  4YAB A;  1F62 A;  2ECT A;  3ZYQ A;  1WES A;  4LAD B;  2MNZ A;  2QIC A;  3M63 A;  3U5N A;  3PUR A;  3SHB A;  3U5P A;  3M62 A;  1X4J A;  2L43 A;  2ZET C;  4S3O B;  4QF3 A;  5KH7 A;  4O64 A;  5D1L B;  5B76 A;  4YAD A;  2L75 A;  2JMJ A;  2M85 A;  2DX8 A;  5H1V A;  4PTB A;  1T1H A;  2ECW A;  3N9L A;  3ZTG A;  2K17 A;  1WEN A;  4YAT A;  4IC3 A;  5LCW B;  3O34 A;  3HCU A;  4FK5 A;  2CSY A;  3ZVZ B;  4IC2 A;  5TBN A;  2CKL A;  3LRQ A;  4WA6 A;  5TDW A;  5JG6 A;  2VPD A;  5LKZ A;  4I7D A;  2LDR A;  4FO9 A;  1FBV A;  4N4F A;  1WEP A;  4BHW A;  2VJE A;  3RPG C;  2L5U A;  1LDJ B;  2ECV A;  3O7A A;  4MSX A;  2CSZ A;  3VK6 A;  3ZPV E;  4X3G A;  1WEQ A;  4R7E A;  4B86 C;  3N9M A;  2MA6 A;  2MIQ A;  4W4U A;  1XWH A;  2JMD A;  2JMI A;  2ECN A;  3O70 A;  1VD4 A;  1K2F A;  4F52 B;  2LGL A;  4YBM A;  4WZ3 B;  3U5O A;  4R2Y A;  1HYI A;  4GNE A;  4YBS A;  5D1K B;  4Q6F A;  3EB5 A;  5I3L A;  1LDK C;  5H1T A;  2XB1 A;  1WEM A;  2Y43 A;  3MHS A;  3LQH A;  2YYR A;  3RTR B;  2G43 A;  2PNX A;  4YAX A;  4L58 A;  2M6M A;  2LXH C;  2BAY A;  2VJE B;  3O36 A;  1CHC A;  1JOC A;  1ZBD B;  2HDP A;  4AUQ B;  5G0F A;  4MVT A;  3LQJ A;  4UI9 B;  2YHO A;  2VJF B;  1E4U A;  1WGM A;  4R8P K;  3DQV R;  4FJC A;  3LQI A;  2QIZ A;  1Z60 A;  4QF2 A;  5J3X A;  2KGG A;  5TAB A;  3C5K A;  4AYC B;  5DIN A;  2YT5 A;  3O33 A;  2YRE A;  2JRJ A;  5FB1 A;  2KRE A;  4GB0 A;  4TKP B;  4AVX A;  4A4C A;  3C6W A;  1BOR A;  1Z6U A;  2LXP C;  2KGI A;  5D1M B;  2LGV A;  3GL6 A;  1U6G B;  1MM2 A;  2MD8 C;  1WEV A;  3I2D A;  2KE1 A;  2FUU A;  2KR4 A;  3GV4 A;  1WIM A;  4P5O B;  4WZ2 A;  2H0D B;  4GND A;  3T6R A;  1X4U A;  3ZNI A;  2L80 A;  3N9N A;  4L7X A;  2E6S A;  3L1X A;  4WZ0 A;  2Y1N A;  2LN0 A;  2YUR A;  4AP4 A;  3FL2 A;  4NN2 A;  2PUY A;  2IDA A;  2VJF A;  1HYJ A;  5B8D A;  4N3W A;  2HYE D;  4A49 A;  2VPE A;  4V3L C;  4S3O C;  4BBQ A;  2LQ6 A;  5G04 B;  2VP7 A;  2G6Q A;  4AYC A;  1RMD A;  3SOX A;  1WEU A;  5FEY A;  2KWO A;  3N9Q A;  4CA1 A;  2RSD A;  3KQI A;  3ASL A;  2F6J A;  2UZG A;  2KWN A;  4A0C D;  3SOW A;  3DPL R;  2RI7 A;  5B78 A;  4CCG X;  2M3H A;  4ZUX U;  3L11 A;  1WEW A;  5FER A;  5B77 A;  4YBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...