4O62A

Cw-type zinc finger of zcwpw2 in complex with the amino terminus of histone h3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
ENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger CW-type PWWP domain protein 2
publication title Family-wide Characterization of Histone Binding Abilities of Human CW Domain-containing Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal/dna binding protein
total genus 10
structure length 56
sequence length 56
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 4o62A00
2RR4A 5SVIB 5SVYA 2L7PA 4Z0OA 4Z0RA 4QQ4A 4O62A 2E61A 5SVXA 5SVIA
chains in the Genus database with same CATH superfamily
3N9QA 2XP0A 4AYCA 3ZPV1 3IHPA 3SOXA 2YREA 2KE1A 4B86C 2EXUA 1WEPA 2M1RA 2YHOA 4IC3A 4TKPB 1WFKA 2KKYA 2L7PA 5C11A 2LGGA 2PNXA 4L58A 5FB0A 2CSZA 1WEVA 3LQIA 2KU3A 4MSXA 3PUQA 2CONA 1HYIA 1DVPA 5FERA 3U5PA 2YVRA 3DQVR 2KWJA 3VK6A 2KFTA 2L75A 3L1ZB 4BHWA 3KQIA 3GL6A 3ZNIA 1LDKC 2IQJA 2JUNA 2XOCA 2VPEA 3ZYQA 3U5OA 4QF2A 4R8PK 1WEEA 5B76A 4YC9A 2YT5A 1E4UA 3ASLA 4N4FA 4I7CA 1WEQA 2EA6A 2H0DB 2ZETC 4YAXA 4UP5A 2VPGA 1T1HA 2P57A 4V3KC 3V43A 5H9MA 3LVRE 2EODA 2JMIA 2EGMA 2YSMA 4H9DA 3Q1DA 4NN2A 1HYJA 3FEHA 2PUYA 2KGGA 2L43A 3MDBC 3HCTA 2G43A 2LQ6A 5SVXA 5TABA 4QQ4A 1FBVA 4FJCA 3LJUX 2CT2A 3ZVYA 2ECGA 2CRWA 4GNDA 3O36A 2Y1MA 3DDTA 5TBNA 1JM7B 5TDWA 2Y43A 3KV5A 1RMDA 3O34A 5LKUA 2C2VS 2M13A 1WEUA 3DWDA 4YBTA 3KNVA 2B0OE 5D1KB 1Z2QA 4YADA 4F1PA 2LDRA 2LRIC 2H0DA 5TDRA 3SOUA 2OXQC 1IYMA 3HCSA 4I7BA 2KR4A 2HDPA 2MUMA 4AUQB 1MBMA 3LVQE 4L7XA 4A0CD 4UP0A 1V87A 2DSMA 3RPGC 2E6RA 4IC2A 4GNEA 5DKAA 2MKEA 2YHNA 3KDEC 2XOYA 2MT5A 1JM7A 2RSDA 3M63A 2FUUA 2LN0A 1G25A 2LGKA 3N9PA 3FM8C 1VFYA 4LADB 4QF3A 2HYED 2K17A 1WIMA 3JUEA 2QIZA 5LKTA 1X4UA 5C13A 4LLBA 2EGPA 3PLWA 2YQLA 4FIPA 4O64A 2F6JA 2RI7A 1WEWA 1U6GB 3FL2A 2YUCA 3C5KA 4BBQA 3N9MA 2CSVA 3PHDA 4WZ0A 2VPDA 2MD7B 3T9KA 2K4DA 2NAAA 2AN6A 2YW8A 1WE9A 4N3WA 2L5UA 1X4JA 2CRRA 4A49A 1VYXA 4XI1A 2XOZA 2FD4A 3O33A 3O37A 4I7DA 4CCGX 1N87A 4ZUXU 1LDJB 3H7HA 5AITA 5B77A 4Z0OA 1MM3A 2YSJA 4P5OB 4Q6FA 4GB0A 2DX8A 2LXPC 4S3OB 1Z6UA 2VP7A 4WZ3B 1WENA 2CSYA 1K2FA 3ZPVE 2M6MA 5G04B 2ECJA 3O70A 2LXHC 3MHHA 3PURA 2YURA 4AP4A 1X4IA 4LJNA 2D8UA 3GV4A 4S3OC 5H1TA 2KIZA 5J3XA 3LQJA 2JM3A 5D1LB 4FK5A 5KH9A 3U5NA 2KREA 2YU4A 4PTBA 1CHCA 4V3LC 2UZGA 3SOWA 2OWAA 2E61A 5D1MB 4WZ2A 2MA6A 3T7LA 5B79A 4Z0RA 3T6RA 2JRJA 2MD8C 4UI9B 4LK9A 4YATA 5K3QA 5B78A 1VD4A 2LV9A 2YQMA 5AIUA 2K1JA 3O7AA 2QICA 3M99A 2FFWA 2KKXA 2DJAA 5LKZA 4YBSA 1ZBDB 3HCUA 4X3GA 2I50A 2ECTA 2MNYA 4GNFA 4R2YA 3LRQA 4B7YC 2KYUA 5SVIB 1JOCA 3RTRB 2MNZA 5H1VA 4O62A 1FP0A 2JMJA 5DINA 4A4BA 5H1UA 4PPEA 2G45A 2KWNA 2KWOA 3M62A 2YYRA 1MM2A 4ZDTA 2VJFB 2F42A 3FAOA 2CKLB 2MA5A 2LGVA 3N9OA 3N9LA 2XB1A 2LGLA 5G05B 3L11A 3FANA 5TRBA 3NG2A 3HTKC 3SHBA 2ECWA 1F62A 2G6QA 5JG6A 5LKXA 2L0BA 3MHSA 2Y1NA 3L1XA 2F6NA 2MIQA 2VNFA 3E2DA 1BORA 2K16A 3M7KA 1WESA 2ECNA 1DCQA 3QZVA 5I3LA 2QJ0A 3LQHA 5SVIA 2JMDA 2M3HA 5FEYA 1WGMA 2VJEB 4OGEA 4A4CA 2KWKA 2VJFA 2ECVA 4R7EA 5SVYA 2CKLA 1WEOA 5FB1A 3ZVZB 4AYCB 1WEMA 4OGCA 5EYAF 3EB5A 3SUBA 5KH3A 3I2DA 4C9ZA 3O47A 2M85A 2XEUA 5LCWB 4W4UA 3EB6A 2KGIA 2ECIA 4CA1A 4YABA 2LAUA 3C6WA 1XWHA 2RR4A 2C2LA 2E6SA 2BAYA 1WILA 4MVTA 3RPGB 2FSAA 2D8SA 4ZQLA 4FO9A 3ZTGA 3FJUB 2IDAA 3U5MA 4GNGA 3DPLR 3LDYA 2VPBA 4AVXA 5B75A 3O35A 2FUIA 4LKAA 5G0FA 4WA6A 1Z60A 2VJEA 5KH7A 3KV6A 4YBMA 4F52B 5B8DA 3N9NA 2L80A
chains in the Genus database with same CATH topology
3H7HA 5SVYA 3T9KA 2XP0A 4Z0OA 4QQ4A 4OGCA 3E2DA 2YREA 3FJUB 2OWAA 2E61A 3LJUX 3PLWA 3SUBA 3M7KA 2MKEA 2EXUA 2CRWA 2IQJA 1DCQA 3KDEC 2KKYA 2L7PA 2JUNA 3LDYA 2XOYA 3DDTA 2D8UA 4Z0RA 2P57A 3O47A 2JM3A 2XOCA 2CRRA 5K3QA 5SVIA 3LVRE 5SVIB 2CSVA 3LVQE 3FM8C 4O62A 2LAUA 2EGMA 2XOZA 4H9DA 4OGEA 2M13A 2RR4A 2FD4A 3Q1DA 3FEHA 3DWDA 2CONA 2FFWA 2B0OE 3JUEA 3MDBC 2KKXA 2DJAA 2YVRA 5SVXA 4F1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RR4 A;  5SVI B;  5SVY A;  2L7P A;  4Z0O A;  4Z0R A;  4QQ4 A;  4O62 A;  2E61 A;  5SVX A;  5SVI A; 
#chains in the Genus database with same CATH topology
 3N9Q A;  2XP0 A;  4AYC A;  3ZPV 1;  3IHP A;  3SOX A;  2YRE A;  2KE1 A;  4B86 C;  2EXU A;  1WEP A;  2M1R A;  2YHO A;  4IC3 A;  4TKP B;  1WFK A;  2KKY A;  2L7P A;  5C11 A;  2LGG A;  2PNX A;  4L58 A;  5FB0 A;  2CSZ A;  1WEV A;  3LQI A;  2KU3 A;  4MSX A;  3PUQ A;  2CON A;  1HYI A;  1DVP A;  5FER A;  3U5P A;  2YVR A;  3DQV R;  2KWJ A;  3VK6 A;  2KFT A;  2L75 A;  3L1Z B;  4BHW A;  3KQI A;  3GL6 A;  3ZNI A;  1LDK C;  2IQJ A;  2JUN A;  2XOC A;  2VPE A;  3ZYQ A;  3U5O A;  4QF2 A;  4R8P K;  1WEE A;  5B76 A;  4YC9 A;  2YT5 A;  1E4U A;  3ASL A;  4N4F A;  4I7C A;  1WEQ A;  2EA6 A;  2H0D B;  2ZET C;  4YAX A;  4UP5 A;  2VPG A;  1T1H A;  2P57 A;  4V3K C;  3V43 A;  5H9M A;  3LVR E;  2EOD A;  2JMI A;  2EGM A;  2YSM A;  4H9D A;  3Q1D A;  4NN2 A;  1HYJ A;  3FEH A;  2PUY A;  2KGG A;  2L43 A;  3MDB C;  3HCT A;  2G43 A;  2LQ6 A;  5SVX A;  5TAB A;  4QQ4 A;  1FBV A;  4FJC A;  3LJU X;  2CT2 A;  3ZVY A;  2ECG A;  2CRW A;  4GND A;  3O36 A;  2Y1M A;  3DDT A;  5TBN A;  1JM7 B;  5TDW A;  2Y43 A;  3KV5 A;  1RMD A;  3O34 A;  5LKU A;  2C2V S;  2M13 A;  1WEU A;  3DWD A;  4YBT A;  3KNV A;  2B0O E;  5D1K B;  1Z2Q A;  4YAD A;  4F1P A;  2LDR A;  2LRI C;  2H0D A;  5TDR A;  3SOU A;  2OXQ C;  1IYM A;  3HCS A;  4I7B A;  2KR4 A;  2HDP A;  2MUM A;  4AUQ B;  1MBM A;  3LVQ E;  4L7X A;  4A0C D;  4UP0 A;  1V87 A;  2DSM A;  3RPG C;  2E6R A;  4IC2 A;  4GNE A;  5DKA A;  2MKE A;  2YHN A;  3KDE C;  2XOY A;  2MT5 A;  1JM7 A;  2RSD A;  3M63 A;  2FUU A;  2LN0 A;  1G25 A;  2LGK A;  3N9P A;  3FM8 C;  1VFY A;  4LAD B;  4QF3 A;  2HYE D;  2K17 A;  1WIM A;  3JUE A;  2QIZ A;  5LKT A;  1X4U A;  5C13 A;  4LLB A;  2EGP A;  3PLW A;  2YQL A;  4FIP A;  4O64 A;  2F6J A;  2RI7 A;  1WEW A;  1U6G B;  3FL2 A;  2YUC A;  3C5K A;  4BBQ A;  3N9M A;  2CSV A;  3PHD A;  4WZ0 A;  2VPD A;  2MD7 B;  3T9K A;  2K4D A;  2NAA A;  2AN6 A;  2YW8 A;  1WE9 A;  4N3W A;  2L5U A;  1X4J A;  2CRR A;  4A49 A;  1VYX A;  4XI1 A;  2XOZ A;  2FD4 A;  3O33 A;  3O37 A;  4I7D A;  4CCG X;  1N87 A;  4ZUX U;  1LDJ B;  3H7H A;  5AIT A;  5B77 A;  4Z0O A;  1MM3 A;  2YSJ A;  4P5O B;  4Q6F A;  4GB0 A;  2DX8 A;  2LXP C;  4S3O B;  1Z6U A;  2VP7 A;  4WZ3 B;  1WEN A;  2CSY A;  1K2F A;  3ZPV E;  2M6M A;  5G04 B;  2ECJ A;  3O70 A;  2LXH C;  3MHH A;  3PUR A;  2YUR A;  4AP4 A;  1X4I A;  4LJN A;  2D8U A;  3GV4 A;  4S3O C;  5H1T A;  2KIZ A;  5J3X A;  3LQJ A;  2JM3 A;  5D1L B;  4FK5 A;  5KH9 A;  3U5N A;  2KRE A;  2YU4 A;  4PTB A;  1CHC A;  4V3L C;  2UZG A;  3SOW A;  2OWA A;  2E61 A;  5D1M B;  4WZ2 A;  2MA6 A;  3T7L A;  5B79 A;  4Z0R A;  3T6R A;  2JRJ A;  2MD8 C;  4UI9 B;  4LK9 A;  4YAT A;  5K3Q A;  5B78 A;  1VD4 A;  2LV9 A;  2YQM A;  5AIU A;  2K1J A;  3O7A A;  2QIC A;  3M99 A;  2FFW A;  2KKX A;  2DJA A;  5LKZ A;  4YBS A;  1ZBD B;  3HCU A;  4X3G A;  2I50 A;  2ECT A;  2MNY A;  4GNF A;  4R2Y A;  3LRQ A;  4B7Y C;  2KYU A;  5SVI B;  1JOC A;  3RTR B;  2MNZ A;  5H1V A;  4O62 A;  1FP0 A;  2JMJ A;  5DIN A;  4A4B A;  5H1U A;  4PPE A;  2G45 A;  2KWN A;  2KWO A;  3M62 A;  2YYR A;  1MM2 A;  4ZDT A;  2VJF B;  2F42 A;  3FAO A;  2CKL B;  2MA5 A;  2LGV A;  3N9O A;  3N9L A;  2XB1 A;  2LGL A;  5G05 B;  3L11 A;  3FAN A;  5TRB A;  3NG2 A;  3HTK C;  3SHB A;  2ECW A;  1F62 A;  2G6Q A;  5JG6 A;  5LKX A;  2L0B A;  3MHS A;  2Y1N A;  3L1X A;  2F6N A;  2MIQ A;  2VNF A;  3E2D A;  1BOR A;  2K16 A;  3M7K A;  1WES A;  2ECN A;  1DCQ A;  3QZV A;  5I3L A;  2QJ0 A;  3LQH A;  5SVI A;  2JMD A;  2M3H A;  5FEY A;  1WGM A;  2VJE B;  4OGE A;  4A4C A;  2KWK A;  2VJF A;  2ECV A;  4R7E A;  5SVY A;  2CKL A;  1WEO A;  5FB1 A;  3ZVZ B;  4AYC B;  1WEM A;  4OGC A;  5EYA F;  3EB5 A;  3SUB A;  5KH3 A;  3I2D A;  4C9Z A;  3O47 A;  2M85 A;  2XEU A;  5LCW B;  4W4U A;  3EB6 A;  2KGI A;  2ECI A;  4CA1 A;  4YAB A;  2LAU A;  3C6W A;  1XWH A;  2RR4 A;  2C2L A;  2E6S A;  2BAY A;  1WIL A;  4MVT A;  3RPG B;  2FSA A;  2D8S A;  4ZQL A;  4FO9 A;  3ZTG A;  3FJU B;  2IDA A;  3U5M A;  4GNG A;  3DPL R;  3LDY A;  2VPB A;  4AVX A;  5B75 A;  3O35 A;  2FUI A;  4LKA A;  5G0F A;  4WA6 A;  1Z60 A;  2VJE A;  5KH7 A;  3KV6 A;  4YBM A;  4F52 B;  5B8D A;  3N9N A;  2L80 A; 
#chains in the Genus database with same CATH homology
 3H7H A;  5SVY A;  3T9K A;  2XP0 A;  4Z0O A;  4QQ4 A;  4OGC A;  3E2D A;  2YRE A;  3FJU B;  2OWA A;  2E61 A;  3LJU X;  3PLW A;  3SUB A;  3M7K A;  2MKE A;  2EXU A;  2CRW A;  2IQJ A;  1DCQ A;  3KDE C;  2KKY A;  2L7P A;  2JUN A;  3LDY A;  2XOY A;  3DDT A;  2D8U A;  4Z0R A;  2P57 A;  3O47 A;  2JM3 A;  2XOC A;  2CRR A;  5K3Q A;  5SVI A;  3LVR E;  5SVI B;  2CSV A;  3LVQ E;  3FM8 C;  4O62 A;  2LAU A;  2EGM A;  2XOZ A;  4H9D A;  4OGE A;  2M13 A;  2RR4 A;  2FD4 A;  3Q1D A;  3FEH A;  3DWD A;  2CON A;  2FFW A;  2B0O E;  3JUE A;  3MDB C;  2KKX A;  2DJA A;  2YVR A;  5SVX A;  4F1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...