2OXQC

Structure of the ubch5 :chip u-box complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
72
structure length
72
Chain Sequence
EIPDYLCGKISFELMAEPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQDQLIPNLAMKEVIDAFIQEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2D 1
publication title Interactions between the quality control ubiquitin ligase CHIP and ubiquitin conjugating enzymes.
pubmed doi rcsb
source organism Danio rerio
molecule tags Ligase
total genus 21
structure length 72
sequence length 72
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2oxqC00
3ASLA 1WENA 3PUQA 3T6RA 4A0CD 1RMDA 3O35A 4LADB 5C11A 2E6SA 1VYXA 4S3OB 5TDRA 4AP4A 4I7BA 3DPLR 2L75A 3VK6A 2FSAA 2EGPA 5H1TA 2CSYA 2QICA 2KGIA 4FO9A 2Y43A 2MIQA 2G45A 5KH9A 2VJFB 2MNZA 4I7DA 2H0DA 3SOXA 2VP7A 1MM2A 3SHBA 5LKUA 2JMDA 1WEPA 5JG6A 3N9NA 4NN2A 1JM7B 4LK9A 1WEQA 2HYED 2LRIC 4W4UA 3ZNIA 3ZVZB 5B8DA 2KIZA 3M62A 1VD4A 2VJEA 4L7XA 1XWHA 5G05B 2LQ6A 3FL2A 2ECVA 2VPBA 4ZUXU 3SOUA 4WZ2A 5EYAF 2K1JA 3HCTA 4YC9A 3HCSA 4IC2A 1E4UA 4YBSA 4UI9B 2JRJA 2CKLA 2YREA 3KV5A 1U6GB 4GNEA 5FB1A 5H1UA 5I3LA 2F42A 4MSXA 4LJNA 1HYJA 1X4JA 2VNFA 2K4DA 4FIPA 4V3LC 4B7YC 3I2DA 3KQIA 4C9ZA 3ZPVE 3ZPV1 4A4BA 2ECJA 3GL6A 2YUCA 4AUQB 3RTRB 3O37A 4X3GA 5FB0A 1WGMA 1WEWA 3ZTGA 4GB0A 1WEOA 1G25A 5TDWA 2YQLA 2K16A 5J3XA 2RI7A 3RPGB 4XI1A 4AYCB 2UZGA 1WEEA 2ECWA 2KWJA 4AVXA 3M63A 4ZDTA 4BHWA 1ZBDB 2MA6A 4B86C 5KH3A 2YSMA 4V3KC 2HDPA 2VJFA 3EB5A 3L1ZB 2YW8A 2MD8C 2KGGA 2MA5A 4YATA 3KV6A 4GNFA 2KR4A 2AN6A 1WILA 2KE1A 2M85A 4YADA 3M99A 1JM7A 1LDJB 2IDAA 4QF3A 4L58A 4P5OB 2I50A 2PNXA 4UP5A 5H9MA 5TABA 5KH7A 1X4UA 1WEVA 3QZVA 2LGGA 5B75A 2MD7B 2M3HA 3GV4A 2YQMA 2LV9A 2YSJA 4PTBA 2QJ0A 1WESA 3ZVYA 2M1RA 4N4FA 4GNDA 2YT5A 1T1HA 2XEUA 3PHDA 2L43A 5DKAA 2G6QA 2KWKA 3MHHA 3LQJA 3LQHA 3SOWA 2KREA 1VFYA 2L0BA 2LXHC 5LKXA 2PUYA 2YURA 5B76A 4YBMA 2E6RA 2OXQC 3O36A 1F62A 2MUMA 4WZ3B 2QIZA 2FUIA 2LN0A 5FEYA 5DINA 2C2LA 2KYUA 2LGVA 4IC3A 3U5PA 5D1MB 3HTKC 3ZYQA 4YAXA 5LCWB 2LXPC 1HYIA 2LGLA 5H1VA 2G43A 3MHSA 3LQIA 1IYMA 1Z6UA 1V87A 3N9PA 4WZ0A 4N3WA 5AITA 4MVTA 4S3OC 2KWNA 2KFTA 2NAAA 1BORA 3O34A 1WEMA 4AYCA 3IHPA 4YABA 5B78A 4CCGX 2ECGA 5LKTA 2YHNA 2M6MA 4I7CA 4UP0A 5G0FA 4TKPB 2VPEA 5D1KB 5G04B 1MM3A 5D1LB 1CHCA 2YYRA 3L1XA 4BBQA 2C2VS 3PURA 2EA6A 5B77A 2H0DB 4ZQLA 4FJCA 1FBVA 2YHOA 3C5KA 2F6NA 2MT5A 4R8PK 4A4CA 2DX8A 5TBNA 3U5NA 2ECIA 2LGKA 1N87A 3O70A 2EODA 1K2FA 2VJEB 3O33A 4F52B 1WFKA 2YU4A 3KNVA 2JMIA 5FERA 2CT2A 1FP0A 1WIMA 3T7LA 4PPEA 2XB1A 3DQVR 2VPGA 1WEUA 2Y1MA 2D8SA 3C6WA 4FK5A 3HCUA 2CKLB 2F6JA 5LKZA 1Z60A 1WE9A 1DVPA 5B79A 2L80A 3NG2A 4A49A 2RSDA 2KWOA 5AIUA 3N9LA 2LDRA 4WA6A 2JMJA 3V43A 3EB6A 5TRBA 4YBTA 1X4IA 4LKAA 2Y1NA 2ZETC 2FUUA 5C13A 2ECTA 4R2YA 3LRQA 3L11A 4CA1A 2VPDA 4O64A 3O7AA 3U5OA 3N9OA 2K17A 3RPGC 3N9MA 2L5UA 4GNGA 4LLBA 4Q6FA 2KU3A 2ECNA 1LDKC 4QF2A 4R7EA 3U5MA 2CSZA 2MNYA 3N9QA 2BAYA 1Z2QA 1JOCA
chains in the Genus database with same CATH superfamily
3ASLA 2FD4A 1WENA 3PUQA 3T6RA 3FAOA 4A0CD 1RMDA 3O35A 4LADB 2FFWA 5C11A 2E6SA 1VYXA 4S3OB 5TDRA 4AP4A 2D8UA 4I7BA 3DPLR 2L75A 3VK6A 2FSAA 2EGPA 5H1TA 2CSYA 2QICA 2KGIA 4FO9A 2Y43A 2MIQA 2G45A 5KH9A 2VJFB 2MNZA 4I7DA 2DSMA 3E2DA 2H0DA 3SOXA 2VP7A 1MM2A 3SHBA 5LKUA 2JMDA 1WEPA 5JG6A 3N9NA 4NN2A 1JM7B 4LK9A 1WEQA 2HYED 2LRIC 4W4UA 3ZNIA 3ZVZB 3M7KA 5B8DA 2KIZA 2DJAA 3M62A 1VD4A 2VJEA 4L7XA 1XWHA 5G05B 2LQ6A 3FL2A 2ECVA 3T9KA 2VPBA 4ZUXU 3SOUA 3MDBC 2XOCA 4WZ2A 5EYAF 2K1JA 3HCTA 4YC9A 3HCSA 2MKEA 4IC2A 2CRWA 1E4UA 4YBSA 4UI9B 2CONA 2JRJA 2CKLA 2YREA 3KV5A 3LVRE 1U6GB 4GNEA 5FB1A 5H1UA 5I3LA 2F42A 2JM3A 4MSXA 4LJNA 1HYJA 1X4JA 2VNFA 2K4DA 4H9DA 4FIPA 4V3LC 4B7YC 3I2DA 3KQIA 2RR4A 4C9ZA 3ZPVE 3ZPV1 4A4BA 3JUEA 2ECJA 3GL6A 2YUCA 4AUQB 3RTRB 3O37A 4X3GA 5FB0A 1WGMA 1WEWA 4QQ4A 3ZTGA 4GB0A 1WEOA 3PLWA 1G25A 3Q1DA 5TDWA 2JUNA 2YQLA 1DCQA 2K16A 2IQJA 5J3XA 2RI7A 2M13A 3FM8C 4OGEA 2KKXA 3RPGB 4XI1A 4AYCB 2UZGA 1WEEA 2ECWA 2KWJA 4AVXA 3M63A 3FANA 4ZDTA 4BHWA 1ZBDB 2MA6A 4B86C 5KH3A 2YSMA 4V3KC 2HDPA 2VJFA 3EB5A 3L1ZB 2YW8A 2L7PA 2MD8C 2KGGA 2MA5A 4YATA 3KV6A 4GNFA 2KR4A 2AN6A 1WILA 2KE1A 2M85A 4YADA 3M99A 1JM7A 1LDJB 2IDAA 4QF3A 2EXUA 4L58A 2E61A 4P5OB 3LDYA 2I50A 2PNXA 4UP5A 5H9MA 5TABA 5KH7A 1X4UA 2CRRA 3DDTA 1WEVA 3QZVA 2LGGA 5SVYA 5B75A 2MD7B 2M3HA 3GV4A 3FEHA 2YQMA 2LV9A 2YSJA 4PTBA 2QJ0A 1WESA 3ZVYA 5SVIB 2M1RA 4N4FA 4GNDA 2YT5A 1T1HA 2XEUA 3PHDA 3FJUB 2L43A 5DKAA 2G6QA 3SUBA 2KWKA 3MHHA 4Z0RA 3LQJA 3LQHA 3SOWA 2KREA 1VFYA 2L0BA 3DWDA 4F1PA 2LXHC 5LKXA 2PUYA 2YURA 5B76A 4YBMA 2E6RA 2OXQC 3O36A 1F62A 2MUMA 4WZ3B 3H7HA 2QIZA 2FUIA 2LN0A 3O47A 5FEYA 2KKYA 5DINA 2C2LA 2KYUA 2LGVA 4IC3A 3U5PA 5D1MB 3HTKC 3ZYQA 4YAXA 5LCWB 2LXPC 1HYIA 2LGLA 5H1VA 2G43A 3MHSA 3LQIA 1IYMA 1Z6UA 1V87A 3N9PA 4WZ0A 4N3WA 2LAUA 5AITA 4MVTA 4S3OC 2KWNA 2KFTA 5K3QA 2NAAA 1BORA 3O34A 2XOYA 1WEMA 4AYCA 3IHPA 3LVQE 4YABA 5B78A 4CCGX 2XOZA 2ECGA 5LKTA 2YHNA 2M6MA 3LJUX 4I7CA 2CSVA 4UP0A 5G0FA 4TKPB 4OGCA 2VPEA 5D1KB 5G04B 1MM3A 2B0OE 5D1LB 1CHCA 2YYRA 3L1XA 4BBQA 2C2VS 3PURA 2EA6A 5B77A 2H0DB 4ZQLA 4FJCA 1FBVA 2YHOA 3C5KA 2F6NA 2YVRA 2MT5A 4R8PK 4A4CA 2DX8A 5TBNA 3U5NA 2ECIA 2LGKA 1N87A 3O70A 2EODA 1K2FA 2VJEB 3O33A 4F52B 1WFKA 2YU4A 3KNVA 2JMIA 5FERA 2CT2A 1FP0A 1MBMA 1WIMA 4O62A 5SVIA 2P57A 3T7LA 4PPEA 2XB1A 3DQVR 2VPGA 1WEUA 2Y1MA 2D8SA 3C6WA 4FK5A 3HCUA 2CKLB 2F6JA 5LKZA 1Z60A 1WE9A 3KDEC 1DVPA 5B79A 2L80A 3NG2A 4A49A 2RSDA 2KWOA 2EGMA 5AIUA 3N9LA 2LDRA 4WA6A 2JMJA 5SVXA 3V43A 3EB6A 5TRBA 4YBTA 1X4IA 4LKAA 2Y1NA 2ZETC 2FUUA 5C13A 2ECTA 2XP0A 4R2YA 3LRQA 3L11A 2OWAA 4CA1A 2VPDA 4O64A 3O7AA 3U5OA 3N9OA 2K17A 3RPGC 3N9MA 2L5UA 4GNGA 4LLBA 4Q6FA 4Z0OA 2KU3A 2ECNA 1LDKC 4QF2A 4R7EA 3U5MA 2CSZA 2MNYA 3N9QA 2BAYA 1Z2QA 1JOCA
chains in the Genus database with same CATH topology
3ASLA 1WENA 3PUQA 3T6RA 4A0CD 1RMDA 3O35A 4LADB 5C11A 2E6SA 1VYXA 4S3OB 5TDRA 4AP4A 4I7BA 3DPLR 2L75A 3VK6A 2FSAA 2EGPA 5H1TA 2CSYA 2QICA 2KGIA 4FO9A 2Y43A 2MIQA 2G45A 5KH9A 2VJFB 2MNZA 4I7DA 2H0DA 3SOXA 2VP7A 1MM2A 3SHBA 5LKUA 2JMDA 1WEPA 5JG6A 3N9NA 4NN2A 1JM7B 4LK9A 1WEQA 2HYED 2LRIC 4W4UA 3ZNIA 3ZVZB 5B8DA 2KIZA 3M62A 1VD4A 2VJEA 4L7XA 1XWHA 5G05B 2LQ6A 3FL2A 2ECVA 2VPBA 4ZUXU 3SOUA 4WZ2A 5EYAF 2K1JA 3HCTA 4YC9A 3HCSA 4IC2A 1E4UA 4YBSA 4UI9B 2JRJA 2CKLA 2YREA 3KV5A 1U6GB 4GNEA 5FB1A 5H1UA 5I3LA 2F42A 4MSXA 4LJNA 1HYJA 1X4JA 2VNFA 2K4DA 4FIPA 4V3LC 4B7YC 3I2DA 3KQIA 4C9ZA 3ZPVE 3ZPV1 4A4BA 2ECJA 3GL6A 2YUCA 4AUQB 3RTRB 3O37A 4X3GA 5FB0A 1WGMA 1WEWA 3ZTGA 4GB0A 1WEOA 1G25A 5TDWA 2YQLA 2K16A 5J3XA 2RI7A 3RPGB 4XI1A 4AYCB 2UZGA 1WEEA 2ECWA 2KWJA 4AVXA 3M63A 4ZDTA 4BHWA 1ZBDB 2MA6A 4B86C 5KH3A 2YSMA 4V3KC 2HDPA 2VJFA 3EB5A 3L1ZB 2YW8A 2MD8C 2KGGA 2MA5A 4YATA 3KV6A 4GNFA 2KR4A 2AN6A 1WILA 2KE1A 2M85A 4YADA 3M99A 1JM7A 1LDJB 2IDAA 4QF3A 4L58A 4P5OB 2I50A 2PNXA 4UP5A 5H9MA 5TABA 5KH7A 1X4UA 1WEVA 3QZVA 2LGGA 5B75A 2MD7B 2M3HA 3GV4A 2YQMA 2LV9A 2YSJA 4PTBA 2QJ0A 1WESA 3ZVYA 2M1RA 4N4FA 4GNDA 2YT5A 1T1HA 2XEUA 3PHDA 2L43A 5DKAA 2G6QA 2KWKA 3MHHA 3LQJA 3LQHA 3SOWA 2KREA 1VFYA 2L0BA 2LXHC 5LKXA 2PUYA 2YURA 5B76A 4YBMA 2E6RA 2OXQC 3O36A 1F62A 2MUMA 4WZ3B 2QIZA 2FUIA 2LN0A 5FEYA 5DINA 2C2LA 2KYUA 2LGVA 4IC3A 3U5PA 5D1MB 3HTKC 3ZYQA 4YAXA 5LCWB 2LXPC 1HYIA 2LGLA 5H1VA 2G43A 3MHSA 3LQIA 1IYMA 1Z6UA 1V87A 3N9PA 4WZ0A 4N3WA 5AITA 4MVTA 4S3OC 2KWNA 2KFTA 2NAAA 1BORA 3O34A 1WEMA 4AYCA 3IHPA 4YABA 5B78A 4CCGX 2ECGA 5LKTA 2YHNA 2M6MA 4I7CA 4UP0A 5G0FA 4TKPB 2VPEA 5D1KB 5G04B 1MM3A 5D1LB 1CHCA 2YYRA 3L1XA 4BBQA 2C2VS 3PURA 2EA6A 5B77A 2H0DB 4ZQLA 4FJCA 1FBVA 2YHOA 3C5KA 2F6NA 2MT5A 4R8PK 4A4CA 2DX8A 5TBNA 3U5NA 2ECIA 2LGKA 1N87A 3O70A 2EODA 1K2FA 2VJEB 3O33A 4F52B 1WFKA 2YU4A 3KNVA 2JMIA 5FERA 2CT2A 1FP0A 1WIMA 3T7LA 4PPEA 2XB1A 3DQVR 2VPGA 1WEUA 2Y1MA 2D8SA 3C6WA 4FK5A 3HCUA 2CKLB 2F6JA 5LKZA 1Z60A 1WE9A 1DVPA 5B79A 2L80A 3NG2A 4A49A 2RSDA 2KWOA 5AIUA 3N9LA 2LDRA 4WA6A 2JMJA 3V43A 3EB6A 5TRBA 4YBTA 1X4IA 4LKAA 2Y1NA 2ZETC 2FUUA 5C13A 2ECTA 4R2YA 3LRQA 3L11A 4CA1A 2VPDA 4O64A 3O7AA 3U5OA 3N9OA 2K17A 3RPGC 3N9MA 2L5UA 4GNGA 4LLBA 4Q6FA 2KU3A 2ECNA 1LDKC 4QF2A 4R7EA 3U5MA 2CSZA 2MNYA 3N9QA 2BAYA 1Z2QA 1JOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASL A;  1WEN A;  3PUQ A;  3T6R A;  4A0C D;  1RMD A;  3O35 A;  4LAD B;  5C11 A;  2E6S A;  1VYX A;  4S3O B;  5TDR A;  4AP4 A;  4I7B A;  3DPL R;  2L75 A;  3VK6 A;  2FSA A;  2EGP A;  5H1T A;  2CSY A;  2QIC A;  2KGI A;  4FO9 A;  2Y43 A;  2MIQ A;  2G45 A;  5KH9 A;  2VJF B;  2MNZ A;  4I7D A;  2H0D A;  3SOX A;  2VP7 A;  1MM2 A;  3SHB A;  5LKU A;  2JMD A;  1WEP A;  5JG6 A;  3N9N A;  4NN2 A;  1JM7 B;  4LK9 A;  1WEQ A;  2HYE D;  2LRI C;  4W4U A;  3ZNI A;  3ZVZ B;  5B8D A;  2KIZ A;  3M62 A;  1VD4 A;  2VJE A;  4L7X A;  1XWH A;  5G05 B;  2LQ6 A;  3FL2 A;  2ECV A;  2VPB A;  4ZUX U;  3SOU A;  4WZ2 A;  5EYA F;  2K1J A;  3HCT A;  4YC9 A;  3HCS A;  4IC2 A;  1E4U A;  4YBS A;  4UI9 B;  2JRJ A;  2CKL A;  2YRE A;  3KV5 A;  1U6G B;  4GNE A;  5FB1 A;  5H1U A;  5I3L A;  2F42 A;  4MSX A;  4LJN A;  1HYJ A;  1X4J A;  2VNF A;  2K4D A;  4FIP A;  4V3L C;  4B7Y C;  3I2D A;  3KQI A;  4C9Z A;  3ZPV E;  3ZPV 1;  4A4B A;  2ECJ A;  3GL6 A;  2YUC A;  4AUQ B;  3RTR B;  3O37 A;  4X3G A;  5FB0 A;  1WGM A;  1WEW A;  3ZTG A;  4GB0 A;  1WEO A;  1G25 A;  5TDW A;  2YQL A;  2K16 A;  5J3X A;  2RI7 A;  3RPG B;  4XI1 A;  4AYC B;  2UZG A;  1WEE A;  2ECW A;  2KWJ A;  4AVX A;  3M63 A;  4ZDT A;  4BHW A;  1ZBD B;  2MA6 A;  4B86 C;  5KH3 A;  2YSM A;  4V3K C;  2HDP A;  2VJF A;  3EB5 A;  3L1Z B;  2YW8 A;  2MD8 C;  2KGG A;  2MA5 A;  4YAT A;  3KV6 A;  4GNF A;  2KR4 A;  2AN6 A;  1WIL A;  2KE1 A;  2M85 A;  4YAD A;  3M99 A;  1JM7 A;  1LDJ B;  2IDA A;  4QF3 A;  4L58 A;  4P5O B;  2I50 A;  2PNX A;  4UP5 A;  5H9M A;  5TAB A;  5KH7 A;  1X4U A;  1WEV A;  3QZV A;  2LGG A;  5B75 A;  2MD7 B;  2M3H A;  3GV4 A;  2YQM A;  2LV9 A;  2YSJ A;  4PTB A;  2QJ0 A;  1WES A;  3ZVY A;  2M1R A;  4N4F A;  4GND A;  2YT5 A;  1T1H A;  2XEU A;  3PHD A;  2L43 A;  5DKA A;  2G6Q A;  2KWK A;  3MHH A;  3LQJ A;  3LQH A;  3SOW A;  2KRE A;  1VFY A;  2L0B A;  2LXH C;  5LKX A;  2PUY A;  2YUR A;  5B76 A;  4YBM A;  2E6R A;  2OXQ C;  3O36 A;  1F62 A;  2MUM A;  4WZ3 B;  2QIZ A;  2FUI A;  2LN0 A;  5FEY A;  5DIN A;  2C2L A;  2KYU A;  2LGV A;  4IC3 A;  3U5P A;  5D1M B;  3HTK C;  3ZYQ A;  4YAX A;  5LCW B;  2LXP C;  1HYI A;  2LGL A;  5H1V A;  2G43 A;  3MHS A;  3LQI A;  1IYM A;  1Z6U A;  1V87 A;  3N9P A;  4WZ0 A;  4N3W A;  5AIT A;  4MVT A;  4S3O C;  2KWN A;  2KFT A;  2NAA A;  1BOR A;  3O34 A;  1WEM A;  4AYC A;  3IHP A;  4YAB A;  5B78 A;  4CCG X;  2ECG A;  5LKT A;  2YHN A;  2M6M A;  4I7C A;  4UP0 A;  5G0F A;  4TKP B;  2VPE A;  5D1K B;  5G04 B;  1MM3 A;  5D1L B;  1CHC A;  2YYR A;  3L1X A;  4BBQ A;  2C2V S;  3PUR A;  2EA6 A;  5B77 A;  2H0D B;  4ZQL A;  4FJC A;  1FBV A;  2YHO A;  3C5K A;  2F6N A;  2MT5 A;  4R8P K;  4A4C A;  2DX8 A;  5TBN A;  3U5N A;  2ECI A;  2LGK A;  1N87 A;  3O70 A;  2EOD A;  1K2F A;  2VJE B;  3O33 A;  4F52 B;  1WFK A;  2YU4 A;  3KNV A;  2JMI A;  5FER A;  2CT2 A;  1FP0 A;  1WIM A;  3T7L A;  4PPE A;  2XB1 A;  3DQV R;  2VPG A;  1WEU A;  2Y1M A;  2D8S A;  3C6W A;  4FK5 A;  3HCU A;  2CKL B;  2F6J A;  5LKZ A;  1Z60 A;  1WE9 A;  1DVP A;  5B79 A;  2L80 A;  3NG2 A;  4A49 A;  2RSD A;  2KWO A;  5AIU A;  3N9L A;  2LDR A;  4WA6 A;  2JMJ A;  3V43 A;  3EB6 A;  5TRB A;  4YBT A;  1X4I A;  4LKA A;  2Y1N A;  2ZET C;  2FUU A;  5C13 A;  2ECT A;  4R2Y A;  3LRQ A;  3L11 A;  4CA1 A;  2VPD A;  4O64 A;  3O7A A;  3U5O A;  3N9O A;  2K17 A;  3RPG C;  3N9M A;  2L5U A;  4GNG A;  4LLB A;  4Q6F A;  2KU3 A;  2ECN A;  1LDK C;  4QF2 A;  4R7E A;  3U5M A;  2CSZ A;  2MNY A;  3N9Q A;  2BAY A;  1Z2Q A;  1JOC A; 
#chains in the Genus database with same CATH topology
 3ASL A;  2FD4 A;  1WEN A;  3PUQ A;  3T6R A;  3FAO A;  4A0C D;  1RMD A;  3O35 A;  4LAD B;  2FFW A;  5C11 A;  2E6S A;  1VYX A;  4S3O B;  5TDR A;  4AP4 A;  2D8U A;  4I7B A;  3DPL R;  2L75 A;  3VK6 A;  2FSA A;  2EGP A;  5H1T A;  2CSY A;  2QIC A;  2KGI A;  4FO9 A;  2Y43 A;  2MIQ A;  2G45 A;  5KH9 A;  2VJF B;  2MNZ A;  4I7D A;  2DSM A;  3E2D A;  2H0D A;  3SOX A;  2VP7 A;  1MM2 A;  3SHB A;  5LKU A;  2JMD A;  1WEP A;  5JG6 A;  3N9N A;  4NN2 A;  1JM7 B;  4LK9 A;  1WEQ A;  2HYE D;  2LRI C;  4W4U A;  3ZNI A;  3ZVZ B;  3M7K A;  5B8D A;  2KIZ A;  2DJA A;  3M62 A;  1VD4 A;  2VJE A;  4L7X A;  1XWH A;  5G05 B;  2LQ6 A;  3FL2 A;  2ECV A;  3T9K A;  2VPB A;  4ZUX U;  3SOU A;  3MDB C;  2XOC A;  4WZ2 A;  5EYA F;  2K1J A;  3HCT A;  4YC9 A;  3HCS A;  2MKE A;  4IC2 A;  2CRW A;  1E4U A;  4YBS A;  4UI9 B;  2CON A;  2JRJ A;  2CKL A;  2YRE A;  3KV5 A;  3LVR E;  1U6G B;  4GNE A;  5FB1 A;  5H1U A;  5I3L A;  2F42 A;  2JM3 A;  4MSX A;  4LJN A;  1HYJ A;  1X4J A;  2VNF A;  2K4D A;  4H9D A;  4FIP A;  4V3L C;  4B7Y C;  3I2D A;  3KQI A;  2RR4 A;  4C9Z A;  3ZPV E;  3ZPV 1;  4A4B A;  3JUE A;  2ECJ A;  3GL6 A;  2YUC A;  4AUQ B;  3RTR B;  3O37 A;  4X3G A;  5FB0 A;  1WGM A;  1WEW A;  4QQ4 A;  3ZTG A;  4GB0 A;  1WEO A;  3PLW A;  1G25 A;  3Q1D A;  5TDW A;  2JUN A;  2YQL A;  1DCQ A;  2K16 A;  2IQJ A;  5J3X A;  2RI7 A;  2M13 A;  3FM8 C;  4OGE A;  2KKX A;  3RPG B;  4XI1 A;  4AYC B;  2UZG A;  1WEE A;  2ECW A;  2KWJ A;  4AVX A;  3M63 A;  3FAN A;  4ZDT A;  4BHW A;  1ZBD B;  2MA6 A;  4B86 C;  5KH3 A;  2YSM A;  4V3K C;  2HDP A;  2VJF A;  3EB5 A;  3L1Z B;  2YW8 A;  2L7P A;  2MD8 C;  2KGG A;  2MA5 A;  4YAT A;  3KV6 A;  4GNF A;  2KR4 A;  2AN6 A;  1WIL A;  2KE1 A;  2M85 A;  4YAD A;  3M99 A;  1JM7 A;  1LDJ B;  2IDA A;  4QF3 A;  2EXU A;  4L58 A;  2E61 A;  4P5O B;  3LDY A;  2I50 A;  2PNX A;  4UP5 A;  5H9M A;  5TAB A;  5KH7 A;  1X4U A;  2CRR A;  3DDT A;  1WEV A;  3QZV A;  2LGG A;  5SVY A;  5B75 A;  2MD7 B;  2M3H A;  3GV4 A;  3FEH A;  2YQM A;  2LV9 A;  2YSJ A;  4PTB A;  2QJ0 A;  1WES A;  3ZVY A;  5SVI B;  2M1R A;  4N4F A;  4GND A;  2YT5 A;  1T1H A;  2XEU A;  3PHD A;  3FJU B;  2L43 A;  5DKA A;  2G6Q A;  3SUB A;  2KWK A;  3MHH A;  4Z0R A;  3LQJ A;  3LQH A;  3SOW A;  2KRE A;  1VFY A;  2L0B A;  3DWD A;  4F1P A;  2LXH C;  5LKX A;  2PUY A;  2YUR A;  5B76 A;  4YBM A;  2E6R A;  2OXQ C;  3O36 A;  1F62 A;  2MUM A;  4WZ3 B;  3H7H A;  2QIZ A;  2FUI A;  2LN0 A;  3O47 A;  5FEY A;  2KKY A;  5DIN A;  2C2L A;  2KYU A;  2LGV A;  4IC3 A;  3U5P A;  5D1M B;  3HTK C;  3ZYQ A;  4YAX A;  5LCW B;  2LXP C;  1HYI A;  2LGL A;  5H1V A;  2G43 A;  3MHS A;  3LQI A;  1IYM A;  1Z6U A;  1V87 A;  3N9P A;  4WZ0 A;  4N3W A;  2LAU A;  5AIT A;  4MVT A;  4S3O C;  2KWN A;  2KFT A;  5K3Q A;  2NAA A;  1BOR A;  3O34 A;  2XOY A;  1WEM A;  4AYC A;  3IHP A;  3LVQ E;  4YAB A;  5B78 A;  4CCG X;  2XOZ A;  2ECG A;  5LKT A;  2YHN A;  2M6M A;  3LJU X;  4I7C A;  2CSV A;  4UP0 A;  5G0F A;  4TKP B;  4OGC A;  2VPE A;  5D1K B;  5G04 B;  1MM3 A;  2B0O E;  5D1L B;  1CHC A;  2YYR A;  3L1X A;  4BBQ A;  2C2V S;  3PUR A;  2EA6 A;  5B77 A;  2H0D B;  4ZQL A;  4FJC A;  1FBV A;  2YHO A;  3C5K A;  2F6N A;  2YVR A;  2MT5 A;  4R8P K;  4A4C A;  2DX8 A;  5TBN A;  3U5N A;  2ECI A;  2LGK A;  1N87 A;  3O70 A;  2EOD A;  1K2F A;  2VJE B;  3O33 A;  4F52 B;  1WFK A;  2YU4 A;  3KNV A;  2JMI A;  5FER A;  2CT2 A;  1FP0 A;  1MBM A;  1WIM A;  4O62 A;  5SVI A;  2P57 A;  3T7L A;  4PPE A;  2XB1 A;  3DQV R;  2VPG A;  1WEU A;  2Y1M A;  2D8S A;  3C6W A;  4FK5 A;  3HCU A;  2CKL B;  2F6J A;  5LKZ A;  1Z60 A;  1WE9 A;  3KDE C;  1DVP A;  5B79 A;  2L80 A;  3NG2 A;  4A49 A;  2RSD A;  2KWO A;  2EGM A;  5AIU A;  3N9L A;  2LDR A;  4WA6 A;  2JMJ A;  5SVX A;  3V43 A;  3EB6 A;  5TRB A;  4YBT A;  1X4I A;  4LKA A;  2Y1N A;  2ZET C;  2FUU A;  5C13 A;  2ECT A;  2XP0 A;  4R2Y A;  3LRQ A;  3L11 A;  2OWA A;  4CA1 A;  2VPD A;  4O64 A;  3O7A A;  3U5O A;  3N9O A;  2K17 A;  3RPG C;  3N9M A;  2L5U A;  4GNG A;  4LLB A;  4Q6F A;  4Z0O A;  2KU3 A;  2ECN A;  1LDK C;  4QF2 A;  4R7E A;  3U5M A;  2CSZ A;  2MNY A;  3N9Q A;  2BAY A;  1Z2Q A;  1JOC A; 
#chains in the Genus database with same CATH homology
 3ASL A;  1WEN A;  3PUQ A;  3T6R A;  4A0C D;  1RMD A;  3O35 A;  4LAD B;  5C11 A;  2E6S A;  1VYX A;  4S3O B;  5TDR A;  4AP4 A;  4I7B A;  3DPL R;  2L75 A;  3VK6 A;  2FSA A;  2EGP A;  5H1T A;  2CSY A;  2QIC A;  2KGI A;  4FO9 A;  2Y43 A;  2MIQ A;  2G45 A;  5KH9 A;  2VJF B;  2MNZ A;  4I7D A;  2H0D A;  3SOX A;  2VP7 A;  1MM2 A;  3SHB A;  5LKU A;  2JMD A;  1WEP A;  5JG6 A;  3N9N A;  4NN2 A;  1JM7 B;  4LK9 A;  1WEQ A;  2HYE D;  2LRI C;  4W4U A;  3ZNI A;  3ZVZ B;  5B8D A;  2KIZ A;  3M62 A;  1VD4 A;  2VJE A;  4L7X A;  1XWH A;  5G05 B;  2LQ6 A;  3FL2 A;  2ECV A;  2VPB A;  4ZUX U;  3SOU A;  4WZ2 A;  5EYA F;  2K1J A;  3HCT A;  4YC9 A;  3HCS A;  4IC2 A;  1E4U A;  4YBS A;  4UI9 B;  2JRJ A;  2CKL A;  2YRE A;  3KV5 A;  1U6G B;  4GNE A;  5FB1 A;  5H1U A;  5I3L A;  2F42 A;  4MSX A;  4LJN A;  1HYJ A;  1X4J A;  2VNF A;  2K4D A;  4FIP A;  4V3L C;  4B7Y C;  3I2D A;  3KQI A;  4C9Z A;  3ZPV E;  3ZPV 1;  4A4B A;  2ECJ A;  3GL6 A;  2YUC A;  4AUQ B;  3RTR B;  3O37 A;  4X3G A;  5FB0 A;  1WGM A;  1WEW A;  3ZTG A;  4GB0 A;  1WEO A;  1G25 A;  5TDW A;  2YQL A;  2K16 A;  5J3X A;  2RI7 A;  3RPG B;  4XI1 A;  4AYC B;  2UZG A;  1WEE A;  2ECW A;  2KWJ A;  4AVX A;  3M63 A;  4ZDT A;  4BHW A;  1ZBD B;  2MA6 A;  4B86 C;  5KH3 A;  2YSM A;  4V3K C;  2HDP A;  2VJF A;  3EB5 A;  3L1Z B;  2YW8 A;  2MD8 C;  2KGG A;  2MA5 A;  4YAT A;  3KV6 A;  4GNF A;  2KR4 A;  2AN6 A;  1WIL A;  2KE1 A;  2M85 A;  4YAD A;  3M99 A;  1JM7 A;  1LDJ B;  2IDA A;  4QF3 A;  4L58 A;  4P5O B;  2I50 A;  2PNX A;  4UP5 A;  5H9M A;  5TAB A;  5KH7 A;  1X4U A;  1WEV A;  3QZV A;  2LGG A;  5B75 A;  2MD7 B;  2M3H A;  3GV4 A;  2YQM A;  2LV9 A;  2YSJ A;  4PTB A;  2QJ0 A;  1WES A;  3ZVY A;  2M1R A;  4N4F A;  4GND A;  2YT5 A;  1T1H A;  2XEU A;  3PHD A;  2L43 A;  5DKA A;  2G6Q A;  2KWK A;  3MHH A;  3LQJ A;  3LQH A;  3SOW A;  2KRE A;  1VFY A;  2L0B A;  2LXH C;  5LKX A;  2PUY A;  2YUR A;  5B76 A;  4YBM A;  2E6R A;  2OXQ C;  3O36 A;  1F62 A;  2MUM A;  4WZ3 B;  2QIZ A;  2FUI A;  2LN0 A;  5FEY A;  5DIN A;  2C2L A;  2KYU A;  2LGV A;  4IC3 A;  3U5P A;  5D1M B;  3HTK C;  3ZYQ A;  4YAX A;  5LCW B;  2LXP C;  1HYI A;  2LGL A;  5H1V A;  2G43 A;  3MHS A;  3LQI A;  1IYM A;  1Z6U A;  1V87 A;  3N9P A;  4WZ0 A;  4N3W A;  5AIT A;  4MVT A;  4S3O C;  2KWN A;  2KFT A;  2NAA A;  1BOR A;  3O34 A;  1WEM A;  4AYC A;  3IHP A;  4YAB A;  5B78 A;  4CCG X;  2ECG A;  5LKT A;  2YHN A;  2M6M A;  4I7C A;  4UP0 A;  5G0F A;  4TKP B;  2VPE A;  5D1K B;  5G04 B;  1MM3 A;  5D1L B;  1CHC A;  2YYR A;  3L1X A;  4BBQ A;  2C2V S;  3PUR A;  2EA6 A;  5B77 A;  2H0D B;  4ZQL A;  4FJC A;  1FBV A;  2YHO A;  3C5K A;  2F6N A;  2MT5 A;  4R8P K;  4A4C A;  2DX8 A;  5TBN A;  3U5N A;  2ECI A;  2LGK A;  1N87 A;  3O70 A;  2EOD A;  1K2F A;  2VJE B;  3O33 A;  4F52 B;  1WFK A;  2YU4 A;  3KNV A;  2JMI A;  5FER A;  2CT2 A;  1FP0 A;  1WIM A;  3T7L A;  4PPE A;  2XB1 A;  3DQV R;  2VPG A;  1WEU A;  2Y1M A;  2D8S A;  3C6W A;  4FK5 A;  3HCU A;  2CKL B;  2F6J A;  5LKZ A;  1Z60 A;  1WE9 A;  1DVP A;  5B79 A;  2L80 A;  3NG2 A;  4A49 A;  2RSD A;  2KWO A;  5AIU A;  3N9L A;  2LDR A;  4WA6 A;  2JMJ A;  3V43 A;  3EB6 A;  5TRB A;  4YBT A;  1X4I A;  4LKA A;  2Y1N A;  2ZET C;  2FUU A;  5C13 A;  2ECT A;  4R2Y A;  3LRQ A;  3L11 A;  4CA1 A;  2VPD A;  4O64 A;  3O7A A;  3U5O A;  3N9O A;  2K17 A;  3RPG C;  3N9M A;  2L5U A;  4GNG A;  4LLB A;  4Q6F A;  2KU3 A;  2ECN A;  1LDK C;  4QF2 A;  4R7E A;  3U5M A;  2CSZ A;  2MNY A;  3N9Q A;  2BAY A;  1Z2Q A;  1JOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...