2OXQC

Structure of the ubch5 :chip u-box complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
72
structure length
72
Chain Sequence
b'EIPDYLCGKISFELMAEPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQDQLIPNLAMKEVIDAFIQEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2D 1
molecule tags Ligase
source organism Danio rerio
publication title Interactions between the quality control ubiquitin ligase CHIP and ubiquitin conjugating enzymes.
pubmed doi rcsb
total genus 21
structure length 72
sequence length 72
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2oxqC00
2LN0A 2FSAA 5KH3A 2YSJA 1FBVA 3C5KA 3KV6A 2G45A 3ZNIA 5LKTA 4GB0A 5B75A 2YHOA 1IYMA 2AN6A 2K1JA 4F52B 1JM7B 4YATA 2D8SA 4BBQA 5JG6A 2L5UA 3ZVYA 5LKUA 2G43A 1U6GB 4GNDA 2VJEB 3O7AA 4FO9A 2LDRA 2NAAA 2EODA 4NN2A 2XB1A 1G25A 2K4DA 2OXQC 1BORA 4C9ZA 2CKLA 2MNZA 1LDKC 2L43A 2QICA 1Z2QA 3PHDA 1WEQA 1WE9A 5LKZA 4YBMA 4FK5A 2QIZA 1WILA 3V43A 4LLBA 1F62A 4N4FA 1MM2A 4V3LC 1WEPA 2VJFA 2YHNA 4WZ2A 5C11A 1WIMA 2EGPA 2KR4A 2MA5A 1VD4A 2EA6A 5H1TA 4PPEA 4N3WA 5D1LB 2C2VS 3M99A 1JOCA 1E4UA 5B79A 2M6MA 2LGGA 5G0FA 3ZVZB 3LQJA 3DPLR 3HCSA 2KREA 2LRIC 5I3LA 1X4IA 2M1RA 5B78A 2XEUA 4ZUXU 4I7BA 2HYED 1V87A 1WEWA 4GNFA 1WEMA 2QJ0A 2LGLA 2KU3A 2L75A 2YW8A 4FIPA 1JM7A 4LJNA 5DKAA 4AYCA 2ECGA 4AYCB 2VPGA 5TRBA 4UP0A 3IHPA 2C2LA 3N9LA 4XI1A 3SOXA 5H1UA 3MHSA 1X4JA 2YT5A 4B86C 5TBNA 2LQ6A 4GNGA 5C13A 5B77A 2HDPA 5KH7A 4A4BA 3L11A 2K17A 5B8DA 1FP0A 4YABA 1N87A 1WENA 1Z6UA 2CSZA 4WA6A 3N9OA 3MHHA 3I2DA 4A0CD 1DVPA 3O36A 2RI7A 5FERA 3L1ZB 2LGKA 4WZ0A 2ECNA 4ZDTA 2K16A 2FUIA 2L0BA 2I50A 2E6RA 2ECWA 2Y43A 2VPEA 3ZPV1 2Y1NA 5J3XA 4YC9A 2M85A 4R2YA 3VK6A 4L7XA 4QF2A 4YAXA 3RPGC 2IDAA 4R8PK 2CKLB 3KV5A 1HYIA 1Z60A 2JMJA 3T7LA 1RMDA 1X4UA 4A49A 2KE1A 1WESA 5AITA 3SOUA 4A4CA 2LGVA 3SOWA 3GL6A 3RPGB 3U5MA 3EB6A 1CHCA 2E6SA 3RTRB 3N9QA 4YBTA 2BAYA 2KFTA 3N9MA 5H9MA 2KWNA 3ZYQA 4W4UA 2MA6A 5TABA 4S3OC 3C6WA 1VFYA 1T1HA 4ZQLA 2MNYA 3HCUA 4CCGX 5EYAF 1ZBDB 2KYUA 3DQVR 3M63A 3QZVA 2LXHC 4AP4A 2ECJA 2F6JA 3O34A 4PTBA 1MM3A 2KWKA 2VJFB 4V3KC 5KH9A 2VPDA 4LADB 3SHBA 2UZGA 4IC2A 3ZPVE 1WEVA 1WFKA 4Q6FA 3PURA 5H1VA 4CA1A 2JRJA 4R7EA 4TKPB 5LCWB 3NG2A 2YUCA 2LXPC 3EB5A 5LKXA 4MSXA 4L58A 5B76A 4LK9A 1WEEA 2VPBA 2MUMA 2CSYA 3T6RA 2L80A 4I7CA 5TDRA 3GV4A 3U5PA 3O37A 2KWOA 5G04B 2CT2A 2YSMA 2YQLA 4AVXA 1WEUA 4BHWA 2ZETC 4WZ3B 4LKAA 3N9NA 2ECVA 2MD8C 2H0DB 3KNVA 4O64A 4QF3A 4YBSA 5D1MB 2YREA 2FUUA 3O33A 4YADA 2YURA 4B7YC 3M62A 3U5NA 4P5OB 1WEOA 2MT5A 4MVTA 5TDWA 2ECIA 2F6NA 2DX8A 3U5OA 4IC3A 2PNXA 5FB1A 2JMIA 2MD7B 5DINA 2YYRA 2ECTA 4I7DA 2YU4A 4FJCA 5FEYA 1K2FA 2MIQA 3N9PA 5AIUA 5D1KB 3ASLA 4UP5A 3LQHA 3ZTGA 1VYXA 4X3GA 2VP7A 2JMDA 5FB0A 4S3OB 4AUQB 3FL2A 2KIZA 3HCTA 2PUYA 1HYJA 3PUQA 2LV9A 2F42A 2VJEA 5G05B 2Y1MA 1XWHA 2M3HA 3L1XA 2YQMA 4GNEA 2G6QA 3LQIA 2VNFA 2KGIA 2KWJA 3KQIA 1LDJB 2H0DA 2KGGA 3O35A 3LRQA 2RSDA 3O70A 3HTKC 4UI9B 1WGMA
chains in the Genus database with same CATH superfamily
2LN0A 2EGMA 2FSAA 3FJUB 5KH3A 2YSJA 3T9KA 1FBVA 3C5KA 3KV6A 2G45A 3Q1DA 3ZNIA 5LKTA 4GB0A 5SVIA 5B75A 2YHOA 1IYMA 2AN6A 2D8UA 2K1JA 4F52B 1JM7B 4YATA 2D8SA 3JUEA 4BBQA 3FAOA 5JG6A 2L5UA 3ZVYA 5LKUA 1U6GB 2G43A 4GNDA 2VJEB 3O7AA 4FO9A 2LDRA 2NAAA 2EODA 4NN2A 2XB1A 1G25A 2K4DA 2OXQC 2JUNA 1BORA 4C9ZA 2CKLA 2MNZA 1LDKC 2L43A 2QICA 1Z2QA 3PHDA 1WEQA 2L7PA 1WE9A 5LKZA 4YBMA 4FK5A 2QIZA 1WILA 3V43A 4LLBA 1F62A 2E61A 4N4FA 1MM2A 4V3LC 1WEPA 2VJFA 3LVRE 2YHNA 4WZ2A 5C11A 1WIMA 2EGPA 2KR4A 2MA5A 1VD4A 2EA6A 5H1TA 4PPEA 4N3WA 5D1LB 2C2VS 3SUBA 3M99A 1JOCA 3FM8C 1E4UA 5B79A 2M6MA 2LGGA 5G0FA 3ZVZB 3LQJA 3DPLR 3HCSA 2KREA 2LRIC 5I3LA 1X4IA 2M1RA 5B78A 2XEUA 4ZUXU 4I7BA 2HYED 2OWAA 1V87A 1WEWA 4GNFA 1WEMA 2QJ0A 2LGLA 2KU3A 2L75A 2CRWA 2YW8A 4FIPA 1JM7A 4LJNA 5DKAA 4AYCA 2ECGA 3FANA 4AYCB 2VPGA 2MKEA 5TRBA 4UP0A 3IHPA 2C2LA 3N9LA 4XI1A 3SOXA 5H1UA 3MHSA 1X4JA 2YT5A 4B86C 5TBNA 2LQ6A 3LDYA 4GNGA 5C13A 5B77A 2HDPA 5KH7A 4A4BA 3L11A 2K17A 5B8DA 1FP0A 4YABA 1N87A 2DJAA 1WENA 1Z6UA 2CSZA 4WA6A 3N9OA 3MHHA 3I2DA 5SVXA 4A0CD 1DVPA 3O36A 3O47A 2RI7A 5FERA 3L1ZB 2LGKA 4WZ0A 2ECNA 4ZDTA 2K16A 3LVQE 2FUIA 2L0BA 2I50A 2E6RA 2ECWA 2KKXA 2Y43A 2VPEA 3ZPV1 2Y1NA 2EXUA 5J3XA 4YC9A 4QQ4A 2M85A 4R2YA 3VK6A 4L7XA 4OGEA 4QF2A 4YAXA 2IDAA 3RPGC 4R8PK 2CKLB 2B0OE 3KV5A 1HYIA 1Z60A 3DDTA 2CSVA 2JMJA 2M13A 3T7LA 2YVRA 4F1PA 1RMDA 1X4UA 5SVYA 4A49A 4O62A 2KE1A 3KDEC 1WESA 5AITA 3DWDA 3SOUA 4A4CA 2LGVA 3SOWA 3GL6A 3RPGB 3U5MA 3EB6A 2FD4A 1CHCA 2E6SA 3RTRB 3MDBC 2LAUA 3N9QA 4YBTA 2BAYA 2KFTA 3N9MA 5H9MA 2KWNA 3ZYQA 4W4UA 2MA6A 2FFWA 5TABA 4S3OC 3C6WA 1VFYA 1T1HA 4ZQLA 2MNYA 3HCUA 4CCGX 5EYAF 3PLWA 1ZBDB 2KYUA 3DQVR 3M63A 3QZVA 2LXHC 4AP4A 2ECJA 2F6JA 4PTBA 3O34A 2RR4A 1MM3A 2KWKA 2VJFB 2XOYA 4V3KC 5KH9A 2VPDA 2CONA 4LADB 3SHBA 2UZGA 4IC2A 3ZPVE 1WEVA 1WFKA 4Q6FA 3PURA 5H1VA 4CA1A 3H7HA 2JRJA 4R7EA 3LJUX 4TKPB 5LCWB 3NG2A 2P57A 2YUCA 2LXPC 3EB5A 5LKXA 4MSXA 3E2DA 4L58A 5B76A 4LK9A 1WEEA 2VPBA 4H9DA 2MUMA 2CSYA 3T6RA 2L80A 4I7CA 3GV4A 5TDRA 3U5PA 3O37A 2KWOA 5K3QA 5G04B 2CT2A 2YSMA 2IQJA 4OGCA 3M7KA 2YQLA 4AVXA 1WEUA 4BHWA 2DSMA 2ZETC 4WZ3B 4LKAA 3N9NA 2ECVA 2MD8C 2H0DB 3KNVA 4O64A 4QF3A 4YBSA 5D1MB 2YREA 2FUUA 3O33A 4YADA 2YURA 4B7YC 3M62A 3U5NA 2XOCA 4P5OB 1WEOA 2MT5A 4MVTA 5TDWA 2ECIA 2F6NA 2DX8A 3U5OA 4IC3A 2PNXA 5SVIB 5FB1A 2JMIA 2MD7B 5DINA 2YYRA 2ECTA 4I7DA 2YU4A 4FJCA 4Z0RA 5FEYA 1K2FA 2MIQA 3N9PA 5AIUA 5D1KB 3ASLA 4UP5A 3LQHA 3ZTGA 2KKYA 1VYXA 4X3GA 2VP7A 2CRRA 4Z0OA 2XOZA 2JMDA 5FB0A 4S3OB 4AUQB 3FL2A 2KIZA 3HCTA 2PUYA 1HYJA 3PUQA 1MBMA 2LV9A 3FEHA 2F42A 2VJEA 5G05B 1DCQA 2JM3A 2Y1MA 1XWHA 2M3HA 3L1XA 2YQMA 4GNEA 2G6QA 3LQIA 2VNFA 2KGIA 2KWJA 3KQIA 1LDJB 2H0DA 2KGGA 2XP0A 3O35A 3LRQA 2RSDA 3O70A 3HTKC 4UI9B 1WGMA
chains in the Genus database with same CATH topology
2LN0A 2FSAA 5KH3A 2YSJA 1FBVA 3C5KA 3KV6A 2G45A 3ZNIA 5LKTA 4GB0A 5B75A 2YHOA 1IYMA 2AN6A 2K1JA 4F52B 1JM7B 4YATA 2D8SA 4BBQA 5JG6A 2L5UA 3ZVYA 5LKUA 2G43A 1U6GB 4GNDA 2VJEB 3O7AA 4FO9A 2LDRA 2NAAA 2EODA 4NN2A 2XB1A 1G25A 2K4DA 2OXQC 1BORA 4C9ZA 2CKLA 2MNZA 1LDKC 2L43A 2QICA 1Z2QA 3PHDA 1WEQA 1WE9A 5LKZA 4YBMA 4FK5A 2QIZA 1WILA 3V43A 4LLBA 1F62A 4N4FA 1MM2A 4V3LC 1WEPA 2VJFA 2YHNA 4WZ2A 5C11A 1WIMA 2EGPA 2KR4A 2MA5A 1VD4A 2EA6A 5H1TA 4PPEA 4N3WA 5D1LB 2C2VS 3M99A 1JOCA 1E4UA 5B79A 2M6MA 2LGGA 5G0FA 3ZVZB 3LQJA 3DPLR 3HCSA 2KREA 2LRIC 5I3LA 1X4IA 2M1RA 5B78A 2XEUA 4ZUXU 4I7BA 2HYED 1V87A 1WEWA 4GNFA 1WEMA 2QJ0A 2LGLA 2KU3A 2L75A 2YW8A 4FIPA 1JM7A 4LJNA 5DKAA 4AYCA 2ECGA 4AYCB 2VPGA 5TRBA 4UP0A 3IHPA 2C2LA 3N9LA 4XI1A 3SOXA 5H1UA 3MHSA 1X4JA 2YT5A 4B86C 5TBNA 2LQ6A 4GNGA 5C13A 5B77A 2HDPA 5KH7A 4A4BA 3L11A 2K17A 5B8DA 1FP0A 4YABA 1N87A 1WENA 1Z6UA 2CSZA 4WA6A 3N9OA 3MHHA 3I2DA 4A0CD 1DVPA 3O36A 2RI7A 5FERA 3L1ZB 2LGKA 4WZ0A 2ECNA 4ZDTA 2K16A 2FUIA 2L0BA 2I50A 2E6RA 2ECWA 2Y43A 2VPEA 3ZPV1 2Y1NA 5J3XA 4YC9A 2M85A 4R2YA 3VK6A 4L7XA 4QF2A 4YAXA 3RPGC 2IDAA 4R8PK 2CKLB 3KV5A 1HYIA 1Z60A 2JMJA 3T7LA 1RMDA 1X4UA 4A49A 2KE1A 1WESA 5AITA 3SOUA 4A4CA 2LGVA 3SOWA 3GL6A 3RPGB 3U5MA 3EB6A 1CHCA 2E6SA 3RTRB 3N9QA 4YBTA 2BAYA 2KFTA 3N9MA 5H9MA 2KWNA 3ZYQA 4W4UA 2MA6A 5TABA 4S3OC 3C6WA 1VFYA 1T1HA 4ZQLA 2MNYA 3HCUA 4CCGX 5EYAF 1ZBDB 2KYUA 3DQVR 3M63A 3QZVA 2LXHC 4AP4A 2ECJA 2F6JA 3O34A 4PTBA 1MM3A 2KWKA 2VJFB 4V3KC 5KH9A 2VPDA 4LADB 3SHBA 2UZGA 4IC2A 3ZPVE 1WEVA 1WFKA 4Q6FA 3PURA 5H1VA 4CA1A 2JRJA 4R7EA 4TKPB 5LCWB 3NG2A 2YUCA 2LXPC 3EB5A 5LKXA 4MSXA 4L58A 5B76A 4LK9A 1WEEA 2VPBA 2MUMA 2CSYA 3T6RA 2L80A 4I7CA 5TDRA 3GV4A 3U5PA 3O37A 2KWOA 5G04B 2CT2A 2YSMA 2YQLA 4AVXA 1WEUA 4BHWA 2ZETC 4WZ3B 4LKAA 3N9NA 2ECVA 2MD8C 2H0DB 3KNVA 4O64A 4QF3A 4YBSA 5D1MB 2YREA 2FUUA 3O33A 4YADA 2YURA 4B7YC 3M62A 3U5NA 4P5OB 1WEOA 2MT5A 4MVTA 5TDWA 2ECIA 2F6NA 2DX8A 3U5OA 4IC3A 2PNXA 5FB1A 2JMIA 2MD7B 5DINA 2YYRA 2ECTA 4I7DA 2YU4A 4FJCA 5FEYA 1K2FA 2MIQA 3N9PA 5AIUA 5D1KB 3ASLA 4UP5A 3LQHA 3ZTGA 1VYXA 4X3GA 2VP7A 2JMDA 5FB0A 4S3OB 4AUQB 3FL2A 2KIZA 3HCTA 2PUYA 1HYJA 3PUQA 2LV9A 2F42A 2VJEA 5G05B 2Y1MA 1XWHA 2M3HA 3L1XA 2YQMA 4GNEA 2G6QA 3LQIA 2VNFA 2KGIA 2KWJA 3KQIA 1LDJB 2H0DA 2KGGA 3O35A 3LRQA 2RSDA 3O70A 3HTKC 4UI9B 1WGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LN0 A;  2FSA A;  5KH3 A;  2YSJ A;  1FBV A;  3C5K A;  3KV6 A;  2G45 A;  3ZNI A;  5LKT A;  4GB0 A;  5B75 A;  2YHO A;  1IYM A;  2AN6 A;  2K1J A;  4F52 B;  1JM7 B;  4YAT A;  2D8S A;  4BBQ A;  5JG6 A;  2L5U A;  3ZVY A;  5LKU A;  2G43 A;  1U6G B;  4GND A;  2VJE B;  3O7A A;  4FO9 A;  2LDR A;  2NAA A;  2EOD A;  4NN2 A;  2XB1 A;  1G25 A;  2K4D A;  2OXQ C;  1BOR A;  4C9Z A;  2CKL A;  2MNZ A;  1LDK C;  2L43 A;  2QIC A;  1Z2Q A;  3PHD A;  1WEQ A;  1WE9 A;  5LKZ A;  4YBM A;  4FK5 A;  2QIZ A;  1WIL A;  3V43 A;  4LLB A;  1F62 A;  4N4F A;  1MM2 A;  4V3L C;  1WEP A;  2VJF A;  2YHN A;  4WZ2 A;  5C11 A;  1WIM A;  2EGP A;  2KR4 A;  2MA5 A;  1VD4 A;  2EA6 A;  5H1T A;  4PPE A;  4N3W A;  5D1L B;  2C2V S;  3M99 A;  1JOC A;  1E4U A;  5B79 A;  2M6M A;  2LGG A;  5G0F A;  3ZVZ B;  3LQJ A;  3DPL R;  3HCS A;  2KRE A;  2LRI C;  5I3L A;  1X4I A;  2M1R A;  5B78 A;  2XEU A;  4ZUX U;  4I7B A;  2HYE D;  1V87 A;  1WEW A;  4GNF A;  1WEM A;  2QJ0 A;  2LGL A;  2KU3 A;  2L75 A;  2YW8 A;  4FIP A;  1JM7 A;  4LJN A;  5DKA A;  4AYC A;  2ECG A;  4AYC B;  2VPG A;  5TRB A;  4UP0 A;  3IHP A;  2C2L A;  3N9L A;  4XI1 A;  3SOX A;  5H1U A;  3MHS A;  1X4J A;  2YT5 A;  4B86 C;  5TBN A;  2LQ6 A;  4GNG A;  5C13 A;  5B77 A;  2HDP A;  5KH7 A;  4A4B A;  3L11 A;  2K17 A;  5B8D A;  1FP0 A;  4YAB A;  1N87 A;  1WEN A;  1Z6U A;  2CSZ A;  4WA6 A;  3N9O A;  3MHH A;  3I2D A;  4A0C D;  1DVP A;  3O36 A;  2RI7 A;  5FER A;  3L1Z B;  2LGK A;  4WZ0 A;  2ECN A;  4ZDT A;  2K16 A;  2FUI A;  2L0B A;  2I50 A;  2E6R A;  2ECW A;  2Y43 A;  2VPE A;  3ZPV 1;  2Y1N A;  5J3X A;  4YC9 A;  2M85 A;  4R2Y A;  3VK6 A;  4L7X A;  4QF2 A;  4YAX A;  3RPG C;  2IDA A;  4R8P K;  2CKL B;  3KV5 A;  1HYI A;  1Z60 A;  2JMJ A;  3T7L A;  1RMD A;  1X4U A;  4A49 A;  2KE1 A;  1WES A;  5AIT A;  3SOU A;  4A4C A;  2LGV A;  3SOW A;  3GL6 A;  3RPG B;  3U5M A;  3EB6 A;  1CHC A;  2E6S A;  3RTR B;  3N9Q A;  4YBT A;  2BAY A;  2KFT A;  3N9M A;  5H9M A;  2KWN A;  3ZYQ A;  4W4U A;  2MA6 A;  5TAB A;  4S3O C;  3C6W A;  1VFY A;  1T1H A;  4ZQL A;  2MNY A;  3HCU A;  4CCG X;  5EYA F;  1ZBD B;  2KYU A;  3DQV R;  3M63 A;  3QZV A;  2LXH C;  4AP4 A;  2ECJ A;  2F6J A;  3O34 A;  4PTB A;  1MM3 A;  2KWK A;  2VJF B;  4V3K C;  5KH9 A;  2VPD A;  4LAD B;  3SHB A;  2UZG A;  4IC2 A;  3ZPV E;  1WEV A;  1WFK A;  4Q6F A;  3PUR A;  5H1V A;  4CA1 A;  2JRJ A;  4R7E A;  4TKP B;  5LCW B;  3NG2 A;  2YUC A;  2LXP C;  3EB5 A;  5LKX A;  4MSX A;  4L58 A;  5B76 A;  4LK9 A;  1WEE A;  2VPB A;  2MUM A;  2CSY A;  3T6R A;  2L80 A;  4I7C A;  5TDR A;  3GV4 A;  3U5P A;  3O37 A;  2KWO A;  5G04 B;  2CT2 A;  2YSM A;  2YQL A;  4AVX A;  1WEU A;  4BHW A;  2ZET C;  4WZ3 B;  4LKA A;  3N9N A;  2ECV A;  2MD8 C;  2H0D B;  3KNV A;  4O64 A;  4QF3 A;  4YBS A;  5D1M B;  2YRE A;  2FUU A;  3O33 A;  4YAD A;  2YUR A;  4B7Y C;  3M62 A;  3U5N A;  4P5O B;  1WEO A;  2MT5 A;  4MVT A;  5TDW A;  2ECI A;  2F6N A;  2DX8 A;  3U5O A;  4IC3 A;  2PNX A;  5FB1 A;  2JMI A;  2MD7 B;  5DIN A;  2YYR A;  2ECT A;  4I7D A;  2YU4 A;  4FJC A;  5FEY A;  1K2F A;  2MIQ A;  3N9P A;  5AIU A;  5D1K B;  3ASL A;  4UP5 A;  3LQH A;  3ZTG A;  1VYX A;  4X3G A;  2VP7 A;  2JMD A;  5FB0 A;  4S3O B;  4AUQ B;  3FL2 A;  2KIZ A;  3HCT A;  2PUY A;  1HYJ A;  3PUQ A;  2LV9 A;  2F42 A;  2VJE A;  5G05 B;  2Y1M A;  1XWH A;  2M3H A;  3L1X A;  2YQM A;  4GNE A;  2G6Q A;  3LQI A;  2VNF A;  2KGI A;  2KWJ A;  3KQI A;  1LDJ B;  2H0D A;  2KGG A;  3O35 A;  3LRQ A;  2RSD A;  3O70 A;  3HTK C;  4UI9 B;  1WGM A; 
#chains in the Genus database with same CATH topology
 2LN0 A;  2EGM A;  2FSA A;  3FJU B;  5KH3 A;  2YSJ A;  3T9K A;  1FBV A;  3C5K A;  3KV6 A;  2G45 A;  3Q1D A;  3ZNI A;  5LKT A;  4GB0 A;  5SVI A;  5B75 A;  2YHO A;  1IYM A;  2AN6 A;  2D8U A;  2K1J A;  4F52 B;  1JM7 B;  4YAT A;  2D8S A;  3JUE A;  4BBQ A;  3FAO A;  5JG6 A;  2L5U A;  3ZVY A;  5LKU A;  1U6G B;  2G43 A;  4GND A;  2VJE B;  3O7A A;  4FO9 A;  2LDR A;  2NAA A;  2EOD A;  4NN2 A;  2XB1 A;  1G25 A;  2K4D A;  2OXQ C;  2JUN A;  1BOR A;  4C9Z A;  2CKL A;  2MNZ A;  1LDK C;  2L43 A;  2QIC A;  1Z2Q A;  3PHD A;  1WEQ A;  2L7P A;  1WE9 A;  5LKZ A;  4YBM A;  4FK5 A;  2QIZ A;  1WIL A;  3V43 A;  4LLB A;  1F62 A;  2E61 A;  4N4F A;  1MM2 A;  4V3L C;  1WEP A;  2VJF A;  3LVR E;  2YHN A;  4WZ2 A;  5C11 A;  1WIM A;  2EGP A;  2KR4 A;  2MA5 A;  1VD4 A;  2EA6 A;  5H1T A;  4PPE A;  4N3W A;  5D1L B;  2C2V S;  3SUB A;  3M99 A;  1JOC A;  3FM8 C;  1E4U A;  5B79 A;  2M6M A;  2LGG A;  5G0F A;  3ZVZ B;  3LQJ A;  3DPL R;  3HCS A;  2KRE A;  2LRI C;  5I3L A;  1X4I A;  2M1R A;  5B78 A;  2XEU A;  4ZUX U;  4I7B A;  2HYE D;  2OWA A;  1V87 A;  1WEW A;  4GNF A;  1WEM A;  2QJ0 A;  2LGL A;  2KU3 A;  2L75 A;  2CRW A;  2YW8 A;  4FIP A;  1JM7 A;  4LJN A;  5DKA A;  4AYC A;  2ECG A;  3FAN A;  4AYC B;  2VPG A;  2MKE A;  5TRB A;  4UP0 A;  3IHP A;  2C2L A;  3N9L A;  4XI1 A;  3SOX A;  5H1U A;  3MHS A;  1X4J A;  2YT5 A;  4B86 C;  5TBN A;  2LQ6 A;  3LDY A;  4GNG A;  5C13 A;  5B77 A;  2HDP A;  5KH7 A;  4A4B A;  3L11 A;  2K17 A;  5B8D A;  1FP0 A;  4YAB A;  1N87 A;  2DJA A;  1WEN A;  1Z6U A;  2CSZ A;  4WA6 A;  3N9O A;  3MHH A;  3I2D A;  5SVX A;  4A0C D;  1DVP A;  3O36 A;  3O47 A;  2RI7 A;  5FER A;  3L1Z B;  2LGK A;  4WZ0 A;  2ECN A;  4ZDT A;  2K16 A;  3LVQ E;  2FUI A;  2L0B A;  2I50 A;  2E6R A;  2ECW A;  2KKX A;  2Y43 A;  2VPE A;  3ZPV 1;  2Y1N A;  2EXU A;  5J3X A;  4YC9 A;  4QQ4 A;  2M85 A;  4R2Y A;  3VK6 A;  4L7X A;  4OGE A;  4QF2 A;  4YAX A;  2IDA A;  3RPG C;  4R8P K;  2CKL B;  2B0O E;  3KV5 A;  1HYI A;  1Z60 A;  3DDT A;  2CSV A;  2JMJ A;  2M13 A;  3T7L A;  2YVR A;  4F1P A;  1RMD A;  1X4U A;  5SVY A;  4A49 A;  4O62 A;  2KE1 A;  3KDE C;  1WES A;  5AIT A;  3DWD A;  3SOU A;  4A4C A;  2LGV A;  3SOW A;  3GL6 A;  3RPG B;  3U5M A;  3EB6 A;  2FD4 A;  1CHC A;  2E6S A;  3RTR B;  3MDB C;  2LAU A;  3N9Q A;  4YBT A;  2BAY A;  2KFT A;  3N9M A;  5H9M A;  2KWN A;  3ZYQ A;  4W4U A;  2MA6 A;  2FFW A;  5TAB A;  4S3O C;  3C6W A;  1VFY A;  1T1H A;  4ZQL A;  2MNY A;  3HCU A;  4CCG X;  5EYA F;  3PLW A;  1ZBD B;  2KYU A;  3DQV R;  3M63 A;  3QZV A;  2LXH C;  4AP4 A;  2ECJ A;  2F6J A;  4PTB A;  3O34 A;  2RR4 A;  1MM3 A;  2KWK A;  2VJF B;  2XOY A;  4V3K C;  5KH9 A;  2VPD A;  2CON A;  4LAD B;  3SHB A;  2UZG A;  4IC2 A;  3ZPV E;  1WEV A;  1WFK A;  4Q6F A;  3PUR A;  5H1V A;  4CA1 A;  3H7H A;  2JRJ A;  4R7E A;  3LJU X;  4TKP B;  5LCW B;  3NG2 A;  2P57 A;  2YUC A;  2LXP C;  3EB5 A;  5LKX A;  4MSX A;  3E2D A;  4L58 A;  5B76 A;  4LK9 A;  1WEE A;  2VPB A;  4H9D A;  2MUM A;  2CSY A;  3T6R A;  2L80 A;  4I7C A;  3GV4 A;  5TDR A;  3U5P A;  3O37 A;  2KWO A;  5K3Q A;  5G04 B;  2CT2 A;  2YSM A;  2IQJ A;  4OGC A;  3M7K A;  2YQL A;  4AVX A;  1WEU A;  4BHW A;  2DSM A;  2ZET C;  4WZ3 B;  4LKA A;  3N9N A;  2ECV A;  2MD8 C;  2H0D B;  3KNV A;  4O64 A;  4QF3 A;  4YBS A;  5D1M B;  2YRE A;  2FUU A;  3O33 A;  4YAD A;  2YUR A;  4B7Y C;  3M62 A;  3U5N A;  2XOC A;  4P5O B;  1WEO A;  2MT5 A;  4MVT A;  5TDW A;  2ECI A;  2F6N A;  2DX8 A;  3U5O A;  4IC3 A;  2PNX A;  5SVI B;  5FB1 A;  2JMI A;  2MD7 B;  5DIN A;  2YYR A;  2ECT A;  4I7D A;  2YU4 A;  4FJC A;  4Z0R A;  5FEY A;  1K2F A;  2MIQ A;  3N9P A;  5AIU A;  5D1K B;  3ASL A;  4UP5 A;  3LQH A;  3ZTG A;  2KKY A;  1VYX A;  4X3G A;  2VP7 A;  2CRR A;  4Z0O A;  2XOZ A;  2JMD A;  5FB0 A;  4S3O B;  4AUQ B;  3FL2 A;  2KIZ A;  3HCT A;  2PUY A;  1HYJ A;  3PUQ A;  1MBM A;  2LV9 A;  3FEH A;  2F42 A;  2VJE A;  5G05 B;  1DCQ A;  2JM3 A;  2Y1M A;  1XWH A;  2M3H A;  3L1X A;  2YQM A;  4GNE A;  2G6Q A;  3LQI A;  2VNF A;  2KGI A;  2KWJ A;  3KQI A;  1LDJ B;  2H0D A;  2KGG A;  2XP0 A;  3O35 A;  3LRQ A;  2RSD A;  3O70 A;  3HTK C;  4UI9 B;  1WGM A; 
#chains in the Genus database with same CATH homology
 2LN0 A;  2FSA A;  5KH3 A;  2YSJ A;  1FBV A;  3C5K A;  3KV6 A;  2G45 A;  3ZNI A;  5LKT A;  4GB0 A;  5B75 A;  2YHO A;  1IYM A;  2AN6 A;  2K1J A;  4F52 B;  1JM7 B;  4YAT A;  2D8S A;  4BBQ A;  5JG6 A;  2L5U A;  3ZVY A;  5LKU A;  2G43 A;  1U6G B;  4GND A;  2VJE B;  3O7A A;  4FO9 A;  2LDR A;  2NAA A;  2EOD A;  4NN2 A;  2XB1 A;  1G25 A;  2K4D A;  2OXQ C;  1BOR A;  4C9Z A;  2CKL A;  2MNZ A;  1LDK C;  2L43 A;  2QIC A;  1Z2Q A;  3PHD A;  1WEQ A;  1WE9 A;  5LKZ A;  4YBM A;  4FK5 A;  2QIZ A;  1WIL A;  3V43 A;  4LLB A;  1F62 A;  4N4F A;  1MM2 A;  4V3L C;  1WEP A;  2VJF A;  2YHN A;  4WZ2 A;  5C11 A;  1WIM A;  2EGP A;  2KR4 A;  2MA5 A;  1VD4 A;  2EA6 A;  5H1T A;  4PPE A;  4N3W A;  5D1L B;  2C2V S;  3M99 A;  1JOC A;  1E4U A;  5B79 A;  2M6M A;  2LGG A;  5G0F A;  3ZVZ B;  3LQJ A;  3DPL R;  3HCS A;  2KRE A;  2LRI C;  5I3L A;  1X4I A;  2M1R A;  5B78 A;  2XEU A;  4ZUX U;  4I7B A;  2HYE D;  1V87 A;  1WEW A;  4GNF A;  1WEM A;  2QJ0 A;  2LGL A;  2KU3 A;  2L75 A;  2YW8 A;  4FIP A;  1JM7 A;  4LJN A;  5DKA A;  4AYC A;  2ECG A;  4AYC B;  2VPG A;  5TRB A;  4UP0 A;  3IHP A;  2C2L A;  3N9L A;  4XI1 A;  3SOX A;  5H1U A;  3MHS A;  1X4J A;  2YT5 A;  4B86 C;  5TBN A;  2LQ6 A;  4GNG A;  5C13 A;  5B77 A;  2HDP A;  5KH7 A;  4A4B A;  3L11 A;  2K17 A;  5B8D A;  1FP0 A;  4YAB A;  1N87 A;  1WEN A;  1Z6U A;  2CSZ A;  4WA6 A;  3N9O A;  3MHH A;  3I2D A;  4A0C D;  1DVP A;  3O36 A;  2RI7 A;  5FER A;  3L1Z B;  2LGK A;  4WZ0 A;  2ECN A;  4ZDT A;  2K16 A;  2FUI A;  2L0B A;  2I50 A;  2E6R A;  2ECW A;  2Y43 A;  2VPE A;  3ZPV 1;  2Y1N A;  5J3X A;  4YC9 A;  2M85 A;  4R2Y A;  3VK6 A;  4L7X A;  4QF2 A;  4YAX A;  3RPG C;  2IDA A;  4R8P K;  2CKL B;  3KV5 A;  1HYI A;  1Z60 A;  2JMJ A;  3T7L A;  1RMD A;  1X4U A;  4A49 A;  2KE1 A;  1WES A;  5AIT A;  3SOU A;  4A4C A;  2LGV A;  3SOW A;  3GL6 A;  3RPG B;  3U5M A;  3EB6 A;  1CHC A;  2E6S A;  3RTR B;  3N9Q A;  4YBT A;  2BAY A;  2KFT A;  3N9M A;  5H9M A;  2KWN A;  3ZYQ A;  4W4U A;  2MA6 A;  5TAB A;  4S3O C;  3C6W A;  1VFY A;  1T1H A;  4ZQL A;  2MNY A;  3HCU A;  4CCG X;  5EYA F;  1ZBD B;  2KYU A;  3DQV R;  3M63 A;  3QZV A;  2LXH C;  4AP4 A;  2ECJ A;  2F6J A;  3O34 A;  4PTB A;  1MM3 A;  2KWK A;  2VJF B;  4V3K C;  5KH9 A;  2VPD A;  4LAD B;  3SHB A;  2UZG A;  4IC2 A;  3ZPV E;  1WEV A;  1WFK A;  4Q6F A;  3PUR A;  5H1V A;  4CA1 A;  2JRJ A;  4R7E A;  4TKP B;  5LCW B;  3NG2 A;  2YUC A;  2LXP C;  3EB5 A;  5LKX A;  4MSX A;  4L58 A;  5B76 A;  4LK9 A;  1WEE A;  2VPB A;  2MUM A;  2CSY A;  3T6R A;  2L80 A;  4I7C A;  5TDR A;  3GV4 A;  3U5P A;  3O37 A;  2KWO A;  5G04 B;  2CT2 A;  2YSM A;  2YQL A;  4AVX A;  1WEU A;  4BHW A;  2ZET C;  4WZ3 B;  4LKA A;  3N9N A;  2ECV A;  2MD8 C;  2H0D B;  3KNV A;  4O64 A;  4QF3 A;  4YBS A;  5D1M B;  2YRE A;  2FUU A;  3O33 A;  4YAD A;  2YUR A;  4B7Y C;  3M62 A;  3U5N A;  4P5O B;  1WEO A;  2MT5 A;  4MVT A;  5TDW A;  2ECI A;  2F6N A;  2DX8 A;  3U5O A;  4IC3 A;  2PNX A;  5FB1 A;  2JMI A;  2MD7 B;  5DIN A;  2YYR A;  2ECT A;  4I7D A;  2YU4 A;  4FJC A;  5FEY A;  1K2F A;  2MIQ A;  3N9P A;  5AIU A;  5D1K B;  3ASL A;  4UP5 A;  3LQH A;  3ZTG A;  1VYX A;  4X3G A;  2VP7 A;  2JMD A;  5FB0 A;  4S3O B;  4AUQ B;  3FL2 A;  2KIZ A;  3HCT A;  2PUY A;  1HYJ A;  3PUQ A;  2LV9 A;  2F42 A;  2VJE A;  5G05 B;  2Y1M A;  1XWH A;  2M3H A;  3L1X A;  2YQM A;  4GNE A;  2G6Q A;  3LQI A;  2VNF A;  2KGI A;  2KWJ A;  3KQI A;  1LDJ B;  2H0D A;  2KGG A;  3O35 A;  3LRQ A;  2RSD A;  3O70 A;  3HTK C;  4UI9 B;  1WGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...