2OXQC

Structure of the ubch5 :chip u-box complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
72
structure length
72
Chain Sequence
EIPDYLCGKISFELMAEPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQDQLIPNLAMKEVIDAFIQEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2D 1
publication title Interactions between the quality control ubiquitin ligase CHIP and ubiquitin conjugating enzymes.
pubmed doi rcsb
source organism Danio rerio
total genus 21
structure length 72
sequence length 72
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2oxqC00
3SOWA 5H1UA 3M99A 1WEOA 1X4JA 4FK5A 5EYAF 2G6QA 4A4BA 4AYCA 5TBNA 5B76A 3N9PA 2XEUA 4WZ0A 4A0CD 3L1XA 2KYUA 3U5MA 2M3HA 2FUIA 2ECTA 5TDWA 5DINA 5G04B 2K16A 3ASLA 4Q6FA 5FEYA 2L43A 2F6NA 2YUCA 3DQVR 2JRJA 3V43A 3ZNIA 1V87A 5FERA 3O70A 5H1TA 5KH9A 4CA1A 1DVPA 1Z6UA 4XI1A 5D1MB 2ECNA 3RPGB 1WEEA 2LQ6A 1LDJB 3KNVA 2CKLA 2K4DA 3LRQA 5B78A 1WILA 3SOUA 1JM7A 2YQMA 2L5UA 2ECVA 2CSZA 2F6JA 5I3LA 2VPDA 2Y1MA 2ZETC 5LKUA 2VJFB 4A4CA 2KWOA 4YBMA 3N9LA 2KU3A 1BORA 5H1VA 3LQIA 2MT5A 4R8PK 2VPGA 2DX8A 2M6MA 2JMDA 4ZQLA 5LKZA 2I50A 2QICA 2L0BA 2RSDA 3O37A 1CHCA 2LGGA 2K17A 1JOCA 3ZVYA 4NN2A 4R2YA 2KGIA 3ZTGA 3EB6A 2KFTA 3N9MA 3U5NA 2ECJA 2VJEA 2YW8A 2ECGA 5C11A 1N87A 2HDPA 4IC2A 2PNXA 4BBQA 2G43A 1FBVA 2EODA 3ZPV1 4ZDTA 2LN0A 1FP0A 2OXQC 1WEVA 5H9MA 3U5PA 4TKPB 2JMJA 2KWNA 2YHNA 4CCGX 2E6RA 2LV9A 4X3GA 4N4FA 1MM3A 4FIPA 2NAAA 2YREA 4LLBA 3O35A 3PURA 2EA6A 2KREA 4GNDA 3VK6A 3MHHA 2H0DB 4ZUXU 1E4UA 1X4UA 3O36A 3EB5A 4PTBA 2HYED 2VPEA 3I2DA 2LGKA 2YQLA 1WENA 4BHWA 5KH7A 4B86C 4I7BA 4C9ZA 1F62A 4S3OC 2FUUA 2MA6A 4L7XA 1WFKA 1WEQA 2YSJA 2JMIA 1WEPA 2MNYA 4B7YC 5AIUA 3O34A 3PUQA 4V3LC 1X4IA 2CSYA 5D1LB 2VJFA 5FB0A 2K1JA 3C6WA 1XWHA 3DPLR 1K2FA 5FB1A 3ZVZB 2LGLA 1VD4A 4WA6A 2L75A 4FJCA 5TABA 3HCUA 2YYRA 4YATA 2MD7B 4I7DA 1HYJA 4QF3A 3PHDA 4UP5A 3IHPA 5D1KB 4YBTA 2VNFA 4UP0A 3RPGC 2XB1A 3C5KA 2FSAA 5KH3A 5B8DA 2LRIC 1ZBDB 1LDKC 5TRBA 2MIQA 4P5OB 2KR4A 5LKTA 4F52B 2AN6A 4PPEA 3ZPVE 4MVTA 1U6GB 2PUYA 4AYCB 2UZGA 4W4UA 2LGVA 2YURA 2MA5A 2G45A 1WEUA 1VYXA 5TDRA 2KIZA 2M85A 5LCWB 1VFYA 2H0DA 2M1RA 1Z60A 3RTRB 5B79A 3O7AA 1HYIA 3KQIA 4AUQB 1T1HA 4LK9A 4GNFA 3L1ZB 3L11A 4YC9A 1WE9A 2Y1NA 4YADA 3T7LA 2LXHC 5J3XA 2QJ0A 4LADB 2E6SA 2VP7A 4LKAA 3N9NA 5G0FA 2F42A 2LXPC 3FL2A 3HTKC 4GNGA 2YU4A 1WIMA 3LQHA 3HCSA 5B77A 5G05B 3GV4A 4FO9A 2CKLB 3ZYQA 1WEMA 3KV5A 1RMDA 4A49A 3U5OA 5LKXA 2RI7A 2YHOA 1WGMA 2KWJA 2QIZA 5C13A 4R7EA 1JM7B 3QZVA 4YABA 2C2VS 2VPBA 4YAXA 3O33A 2MNZA 4MSXA 3M63A 5B75A 4N3WA 1WESA 4UI9B 2CT2A 3SOXA 5DKAA 4AVXA 2KWKA 1WEWA 2Y43A 4YBSA 2EGPA 2YT5A 4O64A 2LDRA 2KE1A 2BAYA 1Z2QA 3LQJA 3KV6A 2KGGA 2MD8C 2C2LA 1MM2A 2D8SA 2L80A 3HCTA 3MHSA 4L58A 4WZ2A 1G25A 4IC3A 3NG2A 4V3KC 2IDAA 3M62A 5AITA 3GL6A 2ECWA 2MUMA 4S3OB 5JG6A 4AP4A 3SHBA 4WZ3B 2ECIA 1IYMA 3N9OA 2VJEB 3T6RA 4LJNA 2YSMA 3N9QA 4QF2A 4GB0A 4GNEA 4I7CA
chains in the Genus database with same CATH superfamily
3SOWA 5H1UA 3M99A 3T9KA 2XOYA 1WEOA 1X4JA 4FK5A 5EYAF 2G6QA 4A4BA 4AYCA 5SVYA 5TBNA 5B76A 3N9PA 2XEUA 4WZ0A 2L7PA 4A0CD 3L1XA 2KYUA 3U5MA 2M3HA 2FUIA 2ECTA 5TDWA 5DINA 5G04B 2K16A 3ASLA 4Q6FA 5FEYA 2EGMA 2L43A 2F6NA 2YUCA 3E2DA 3DQVR 2JRJA 3V43A 3ZNIA 1V87A 5FERA 3O70A 5H1TA 5KH9A 4CA1A 1DVPA 1Z6UA 4XI1A 5D1MB 3PLWA 2MKEA 2ECNA 3RPGB 3FM8C 2FD4A 1WEEA 2LQ6A 1LDJB 3DDTA 3KNVA 2CKLA 2E61A 2K4DA 3LRQA 1DCQA 5B78A 1WILA 2IQJA 3SOUA 1JM7A 2YQMA 2L5UA 2ECVA 2CRWA 2CSZA 2F6JA 2OWAA 2KKYA 5I3LA 2VPDA 2Y1MA 2ZETC 2M13A 5LKUA 2VJFB 4A4CA 2KWOA 4YBMA 3N9LA 1MBMA 2KU3A 1BORA 5H1VA 3LQIA 2MT5A 4R8PK 3LDYA 2VPGA 2DX8A 2M6MA 2JMDA 4ZQLA 5LKZA 4Z0OA 2I50A 2QICA 2L0BA 2RSDA 3FJUB 3O37A 1CHCA 2LGGA 2K17A 1JOCA 3ZVYA 4NN2A 4R2YA 2KGIA 3ZTGA 3LVRE 3EB6A 2KFTA 3N9MA 3U5NA 2ECJA 2VJEA 2YW8A 2ECGA 3Q1DA 5C11A 1N87A 2HDPA 4IC2A 2PNXA 4BBQA 2G43A 1FBVA 2EODA 3ZPV1 4ZDTA 5SVIB 2JUNA 2LN0A 1FP0A 2OXQC 1WEVA 5H9MA 3U5PA 2XP0A 4TKPB 2JMJA 2KWNA 2YHNA 4CCGX 2E6RA 2LV9A 4X3GA 4N4FA 1MM3A 4FIPA 2NAAA 2YREA 4LLBA 3O35A 3FANA 3KDEC 3PURA 2EA6A 2KREA 4GNDA 3VK6A 3MHHA 2H0DB 4ZUXU 1E4UA 1X4UA 3O36A 3FAOA 3EB5A 4O62A 4PTBA 2HYED 2VPEA 2CSVA 3I2DA 2LGKA 2YQLA 4F1PA 1WENA 4BHWA 4Z0RA 5KH7A 4B86C 4I7BA 4C9ZA 3H7HA 1F62A 4S3OC 2FUUA 2MA6A 4H9DA 4L7XA 1WFKA 1WEQA 2YSJA 2JMIA 1WEPA 2MNYA 4B7YC 5AIUA 3O34A 3PUQA 4V3LC 1X4IA 2CSYA 5D1LB 2VJFA 2XOZA 5FB0A 2K1JA 3C6WA 1XWHA 3DPLR 1K2FA 5FB1A 3ZVZB 2LGLA 1VD4A 4WA6A 2L75A 4FJCA 2DSMA 2FFWA 5TABA 3LJUX 3HCUA 2YYRA 4YATA 2P57A 2MD7B 4I7DA 1HYJA 2XOCA 4QF3A 3PHDA 4UP5A 3IHPA 5D1KB 4YBTA 2VNFA 2B0OE 4UP0A 3RPGC 2XB1A 3C5KA 2FSAA 5KH3A 5B8DA 2LAUA 4QQ4A 2LRIC 3FEHA 3M7KA 1ZBDB 1LDKC 2CONA 2MIQA 4P5OB 5TRBA 2KR4A 5LKTA 5K3QA 4F52B 2AN6A 4PPEA 3ZPVE 4MVTA 1U6GB 2PUYA 4AYCB 2UZGA 3JUEA 4W4UA 2LGVA 2YURA 2MA5A 2G45A 1WEUA 5SVXA 3SUBA 1VYXA 5TDRA 2KIZA 3MDBC 2M85A 5LCWB 1VFYA 2H0DA 2M1RA 1Z60A 3RTRB 5B79A 3O7AA 1HYIA 3KQIA 4AUQB 1T1HA 2YVRA 4LK9A 4GNFA 3L1ZB 3L11A 4YC9A 1WE9A 2Y1NA 4YADA 3T7LA 2LXHC 5J3XA 2QJ0A 4LADB 2E6SA 2JM3A 2VP7A 4LKAA 3N9NA 5G0FA 2EXUA 2F42A 2LXPC 3FL2A 3HTKC 4GNGA 2YU4A 1WIMA 3LQHA 3HCSA 2D8UA 5B77A 5G05B 3GV4A 4FO9A 2CKLB 3ZYQA 1WEMA 3KV5A 1RMDA 4A49A 3U5OA 5LKXA 2RI7A 2DJAA 2YHOA 1WGMA 2KWJA 2QIZA 5C13A 4R7EA 1JM7B 3QZVA 4YABA 2C2VS 2VPBA 4YAXA 3O33A 2MNZA 4OGCA 4OGEA 4MSXA 3DWDA 3M63A 5B75A 4N3WA 1WESA 4UI9B 3O47A 2CT2A 3SOXA 5DKAA 2KKXA 4AVXA 2CRRA 2KWKA 1WEWA 2Y43A 4YBSA 2EGPA 2YT5A 4O64A 3LVQE 2LDRA 2KE1A 2BAYA 1Z2QA 3LQJA 3KV6A 2KGGA 2C2LA 4L58A 1MM2A 2D8SA 2L80A 3HCTA 3MHSA 4WZ2A 2MD8C 1G25A 4IC3A 3NG2A 4V3KC 2IDAA 3M62A 5AITA 3GL6A 2ECWA 2MUMA 4S3OB 5JG6A 4AP4A 3SHBA 5SVIA 4WZ3B 2ECIA 1IYMA 3N9OA 2VJEB 3T6RA 4LJNA 2YSMA 3N9QA 2RR4A 4QF2A 4GB0A 4GNEA 4I7CA
chains in the Genus database with same CATH topology
3SOWA 5H1UA 3M99A 1WEOA 1X4JA 4FK5A 5EYAF 2G6QA 4A4BA 4AYCA 5TBNA 5B76A 3N9PA 2XEUA 4WZ0A 4A0CD 3L1XA 2KYUA 3U5MA 2M3HA 2FUIA 2ECTA 5TDWA 5DINA 5G04B 2K16A 3ASLA 4Q6FA 5FEYA 2L43A 2F6NA 2YUCA 3DQVR 2JRJA 3V43A 3ZNIA 1V87A 5FERA 3O70A 5H1TA 5KH9A 4CA1A 1DVPA 1Z6UA 4XI1A 5D1MB 2ECNA 3RPGB 1WEEA 2LQ6A 1LDJB 3KNVA 2CKLA 2K4DA 3LRQA 5B78A 1WILA 3SOUA 1JM7A 2YQMA 2L5UA 2ECVA 2CSZA 2F6JA 5I3LA 2VPDA 2Y1MA 2ZETC 5LKUA 2VJFB 4A4CA 2KWOA 4YBMA 3N9LA 2KU3A 1BORA 5H1VA 3LQIA 2MT5A 4R8PK 2VPGA 2DX8A 2M6MA 2JMDA 4ZQLA 5LKZA 2I50A 2QICA 2L0BA 2RSDA 3O37A 1CHCA 2LGGA 2K17A 1JOCA 3ZVYA 4NN2A 4R2YA 2KGIA 3ZTGA 3EB6A 2KFTA 3N9MA 3U5NA 2ECJA 2VJEA 2YW8A 2ECGA 5C11A 1N87A 2HDPA 4IC2A 2PNXA 4BBQA 2G43A 1FBVA 2EODA 3ZPV1 4ZDTA 2LN0A 1FP0A 2OXQC 1WEVA 5H9MA 3U5PA 4TKPB 2JMJA 2KWNA 2YHNA 4CCGX 2E6RA 2LV9A 4X3GA 4N4FA 1MM3A 4FIPA 2NAAA 2YREA 4LLBA 3O35A 3PURA 2EA6A 2KREA 4GNDA 3VK6A 3MHHA 2H0DB 4ZUXU 1E4UA 1X4UA 3O36A 3EB5A 4PTBA 2HYED 2VPEA 3I2DA 2LGKA 2YQLA 1WENA 4BHWA 5KH7A 4B86C 4I7BA 4C9ZA 1F62A 4S3OC 2FUUA 2MA6A 4L7XA 1WFKA 1WEQA 2YSJA 2JMIA 1WEPA 2MNYA 4B7YC 5AIUA 3O34A 3PUQA 4V3LC 1X4IA 2CSYA 5D1LB 2VJFA 5FB0A 2K1JA 3C6WA 1XWHA 3DPLR 1K2FA 5FB1A 3ZVZB 2LGLA 1VD4A 4WA6A 2L75A 4FJCA 5TABA 3HCUA 2YYRA 4YATA 2MD7B 4I7DA 1HYJA 4QF3A 3PHDA 4UP5A 3IHPA 5D1KB 4YBTA 2VNFA 4UP0A 3RPGC 2XB1A 3C5KA 2FSAA 5KH3A 5B8DA 2LRIC 1ZBDB 1LDKC 5TRBA 2MIQA 4P5OB 2KR4A 5LKTA 4F52B 2AN6A 4PPEA 3ZPVE 4MVTA 1U6GB 2PUYA 4AYCB 2UZGA 4W4UA 2LGVA 2YURA 2MA5A 2G45A 1WEUA 1VYXA 5TDRA 2KIZA 2M85A 5LCWB 1VFYA 2H0DA 2M1RA 1Z60A 3RTRB 5B79A 3O7AA 1HYIA 3KQIA 4AUQB 1T1HA 4LK9A 4GNFA 3L1ZB 3L11A 4YC9A 1WE9A 2Y1NA 4YADA 3T7LA 2LXHC 5J3XA 2QJ0A 4LADB 2E6SA 2VP7A 4LKAA 3N9NA 5G0FA 2F42A 2LXPC 3FL2A 3HTKC 4GNGA 2YU4A 1WIMA 3LQHA 3HCSA 5B77A 5G05B 3GV4A 4FO9A 2CKLB 3ZYQA 1WEMA 3KV5A 1RMDA 4A49A 3U5OA 5LKXA 2RI7A 2YHOA 1WGMA 2KWJA 2QIZA 5C13A 4R7EA 1JM7B 3QZVA 4YABA 2C2VS 2VPBA 4YAXA 3O33A 2MNZA 4MSXA 3M63A 5B75A 4N3WA 1WESA 4UI9B 2CT2A 3SOXA 5DKAA 4AVXA 2KWKA 1WEWA 2Y43A 4YBSA 2EGPA 2YT5A 4O64A 2LDRA 2KE1A 2BAYA 1Z2QA 3LQJA 3KV6A 2KGGA 2MD8C 2C2LA 1MM2A 2D8SA 2L80A 3HCTA 3MHSA 4L58A 4WZ2A 1G25A 4IC3A 3NG2A 4V3KC 2IDAA 3M62A 5AITA 3GL6A 2ECWA 2MUMA 4S3OB 5JG6A 4AP4A 3SHBA 4WZ3B 2ECIA 1IYMA 3N9OA 2VJEB 3T6RA 4LJNA 2YSMA 3N9QA 4QF2A 4GB0A 4GNEA 4I7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOW A;  5H1U A;  3M99 A;  1WEO A;  1X4J A;  4FK5 A;  5EYA F;  2G6Q A;  4A4B A;  4AYC A;  5TBN A;  5B76 A;  3N9P A;  2XEU A;  4WZ0 A;  4A0C D;  3L1X A;  2KYU A;  3U5M A;  2M3H A;  2FUI A;  2ECT A;  5TDW A;  5DIN A;  5G04 B;  2K16 A;  3ASL A;  4Q6F A;  5FEY A;  2L43 A;  2F6N A;  2YUC A;  3DQV R;  2JRJ A;  3V43 A;  3ZNI A;  1V87 A;  5FER A;  3O70 A;  5H1T A;  5KH9 A;  4CA1 A;  1DVP A;  1Z6U A;  4XI1 A;  5D1M B;  2ECN A;  3RPG B;  1WEE A;  2LQ6 A;  1LDJ B;  3KNV A;  2CKL A;  2K4D A;  3LRQ A;  5B78 A;  1WIL A;  3SOU A;  1JM7 A;  2YQM A;  2L5U A;  2ECV A;  2CSZ A;  2F6J A;  5I3L A;  2VPD A;  2Y1M A;  2ZET C;  5LKU A;  2VJF B;  4A4C A;  2KWO A;  4YBM A;  3N9L A;  2KU3 A;  1BOR A;  5H1V A;  3LQI A;  2MT5 A;  4R8P K;  2VPG A;  2DX8 A;  2M6M A;  2JMD A;  4ZQL A;  5LKZ A;  2I50 A;  2QIC A;  2L0B A;  2RSD A;  3O37 A;  1CHC A;  2LGG A;  2K17 A;  1JOC A;  3ZVY A;  4NN2 A;  4R2Y A;  2KGI A;  3ZTG A;  3EB6 A;  2KFT A;  3N9M A;  3U5N A;  2ECJ A;  2VJE A;  2YW8 A;  2ECG A;  5C11 A;  1N87 A;  2HDP A;  4IC2 A;  2PNX A;  4BBQ A;  2G43 A;  1FBV A;  2EOD A;  3ZPV 1;  4ZDT A;  2LN0 A;  1FP0 A;  2OXQ C;  1WEV A;  5H9M A;  3U5P A;  4TKP B;  2JMJ A;  2KWN A;  2YHN A;  4CCG X;  2E6R A;  2LV9 A;  4X3G A;  4N4F A;  1MM3 A;  4FIP A;  2NAA A;  2YRE A;  4LLB A;  3O35 A;  3PUR A;  2EA6 A;  2KRE A;  4GND A;  3VK6 A;  3MHH A;  2H0D B;  4ZUX U;  1E4U A;  1X4U A;  3O36 A;  3EB5 A;  4PTB A;  2HYE D;  2VPE A;  3I2D A;  2LGK A;  2YQL A;  1WEN A;  4BHW A;  5KH7 A;  4B86 C;  4I7B A;  4C9Z A;  1F62 A;  4S3O C;  2FUU A;  2MA6 A;  4L7X A;  1WFK A;  1WEQ A;  2YSJ A;  2JMI A;  1WEP A;  2MNY A;  4B7Y C;  5AIU A;  3O34 A;  3PUQ A;  4V3L C;  1X4I A;  2CSY A;  5D1L B;  2VJF A;  5FB0 A;  2K1J A;  3C6W A;  1XWH A;  3DPL R;  1K2F A;  5FB1 A;  3ZVZ B;  2LGL A;  1VD4 A;  4WA6 A;  2L75 A;  4FJC A;  5TAB A;  3HCU A;  2YYR A;  4YAT A;  2MD7 B;  4I7D A;  1HYJ A;  4QF3 A;  3PHD A;  4UP5 A;  3IHP A;  5D1K B;  4YBT A;  2VNF A;  4UP0 A;  3RPG C;  2XB1 A;  3C5K A;  2FSA A;  5KH3 A;  5B8D A;  2LRI C;  1ZBD B;  1LDK C;  5TRB A;  2MIQ A;  4P5O B;  2KR4 A;  5LKT A;  4F52 B;  2AN6 A;  4PPE A;  3ZPV E;  4MVT A;  1U6G B;  2PUY A;  4AYC B;  2UZG A;  4W4U A;  2LGV A;  2YUR A;  2MA5 A;  2G45 A;  1WEU A;  1VYX A;  5TDR A;  2KIZ A;  2M85 A;  5LCW B;  1VFY A;  2H0D A;  2M1R A;  1Z60 A;  3RTR B;  5B79 A;  3O7A A;  1HYI A;  3KQI A;  4AUQ B;  1T1H A;  4LK9 A;  4GNF A;  3L1Z B;  3L11 A;  4YC9 A;  1WE9 A;  2Y1N A;  4YAD A;  3T7L A;  2LXH C;  5J3X A;  2QJ0 A;  4LAD B;  2E6S A;  2VP7 A;  4LKA A;  3N9N A;  5G0F A;  2F42 A;  2LXP C;  3FL2 A;  3HTK C;  4GNG A;  2YU4 A;  1WIM A;  3LQH A;  3HCS A;  5B77 A;  5G05 B;  3GV4 A;  4FO9 A;  2CKL B;  3ZYQ A;  1WEM A;  3KV5 A;  1RMD A;  4A49 A;  3U5O A;  5LKX A;  2RI7 A;  2YHO A;  1WGM A;  2KWJ A;  2QIZ A;  5C13 A;  4R7E A;  1JM7 B;  3QZV A;  4YAB A;  2C2V S;  2VPB A;  4YAX A;  3O33 A;  2MNZ A;  4MSX A;  3M63 A;  5B75 A;  4N3W A;  1WES A;  4UI9 B;  2CT2 A;  3SOX A;  5DKA A;  4AVX A;  2KWK A;  1WEW A;  2Y43 A;  4YBS A;  2EGP A;  2YT5 A;  4O64 A;  2LDR A;  2KE1 A;  2BAY A;  1Z2Q A;  3LQJ A;  3KV6 A;  2KGG A;  2MD8 C;  2C2L A;  1MM2 A;  2D8S A;  2L80 A;  3HCT A;  3MHS A;  4L58 A;  4WZ2 A;  1G25 A;  4IC3 A;  3NG2 A;  4V3K C;  2IDA A;  3M62 A;  5AIT A;  3GL6 A;  2ECW A;  2MUM A;  4S3O B;  5JG6 A;  4AP4 A;  3SHB A;  4WZ3 B;  2ECI A;  1IYM A;  3N9O A;  2VJE B;  3T6R A;  4LJN A;  2YSM A;  3N9Q A;  4QF2 A;  4GB0 A;  4GNE A;  4I7C A; 
#chains in the Genus database with same CATH topology
 3SOW A;  5H1U A;  3M99 A;  3T9K A;  2XOY A;  1WEO A;  1X4J A;  4FK5 A;  5EYA F;  2G6Q A;  4A4B A;  4AYC A;  5SVY A;  5TBN A;  5B76 A;  3N9P A;  2XEU A;  4WZ0 A;  2L7P A;  4A0C D;  3L1X A;  2KYU A;  3U5M A;  2M3H A;  2FUI A;  2ECT A;  5TDW A;  5DIN A;  5G04 B;  2K16 A;  3ASL A;  4Q6F A;  5FEY A;  2EGM A;  2L43 A;  2F6N A;  2YUC A;  3E2D A;  3DQV R;  2JRJ A;  3V43 A;  3ZNI A;  1V87 A;  5FER A;  3O70 A;  5H1T A;  5KH9 A;  4CA1 A;  1DVP A;  1Z6U A;  4XI1 A;  5D1M B;  3PLW A;  2MKE A;  2ECN A;  3RPG B;  3FM8 C;  2FD4 A;  1WEE A;  2LQ6 A;  1LDJ B;  3DDT A;  3KNV A;  2CKL A;  2E61 A;  2K4D A;  3LRQ A;  1DCQ A;  5B78 A;  1WIL A;  2IQJ A;  3SOU A;  1JM7 A;  2YQM A;  2L5U A;  2ECV A;  2CRW A;  2CSZ A;  2F6J A;  2OWA A;  2KKY A;  5I3L A;  2VPD A;  2Y1M A;  2ZET C;  2M13 A;  5LKU A;  2VJF B;  4A4C A;  2KWO A;  4YBM A;  3N9L A;  1MBM A;  2KU3 A;  1BOR A;  5H1V A;  3LQI A;  2MT5 A;  4R8P K;  3LDY A;  2VPG A;  2DX8 A;  2M6M A;  2JMD A;  4ZQL A;  5LKZ A;  4Z0O A;  2I50 A;  2QIC A;  2L0B A;  2RSD A;  3FJU B;  3O37 A;  1CHC A;  2LGG A;  2K17 A;  1JOC A;  3ZVY A;  4NN2 A;  4R2Y A;  2KGI A;  3ZTG A;  3LVR E;  3EB6 A;  2KFT A;  3N9M A;  3U5N A;  2ECJ A;  2VJE A;  2YW8 A;  2ECG A;  3Q1D A;  5C11 A;  1N87 A;  2HDP A;  4IC2 A;  2PNX A;  4BBQ A;  2G43 A;  1FBV A;  2EOD A;  3ZPV 1;  4ZDT A;  5SVI B;  2JUN A;  2LN0 A;  1FP0 A;  2OXQ C;  1WEV A;  5H9M A;  3U5P A;  2XP0 A;  4TKP B;  2JMJ A;  2KWN A;  2YHN A;  4CCG X;  2E6R A;  2LV9 A;  4X3G A;  4N4F A;  1MM3 A;  4FIP A;  2NAA A;  2YRE A;  4LLB A;  3O35 A;  3FAN A;  3KDE C;  3PUR A;  2EA6 A;  2KRE A;  4GND A;  3VK6 A;  3MHH A;  2H0D B;  4ZUX U;  1E4U A;  1X4U A;  3O36 A;  3FAO A;  3EB5 A;  4O62 A;  4PTB A;  2HYE D;  2VPE A;  2CSV A;  3I2D A;  2LGK A;  2YQL A;  4F1P A;  1WEN A;  4BHW A;  4Z0R A;  5KH7 A;  4B86 C;  4I7B A;  4C9Z A;  3H7H A;  1F62 A;  4S3O C;  2FUU A;  2MA6 A;  4H9D A;  4L7X A;  1WFK A;  1WEQ A;  2YSJ A;  2JMI A;  1WEP A;  2MNY A;  4B7Y C;  5AIU A;  3O34 A;  3PUQ A;  4V3L C;  1X4I A;  2CSY A;  5D1L B;  2VJF A;  2XOZ A;  5FB0 A;  2K1J A;  3C6W A;  1XWH A;  3DPL R;  1K2F A;  5FB1 A;  3ZVZ B;  2LGL A;  1VD4 A;  4WA6 A;  2L75 A;  4FJC A;  2DSM A;  2FFW A;  5TAB A;  3LJU X;  3HCU A;  2YYR A;  4YAT A;  2P57 A;  2MD7 B;  4I7D A;  1HYJ A;  2XOC A;  4QF3 A;  3PHD A;  4UP5 A;  3IHP A;  5D1K B;  4YBT A;  2VNF A;  2B0O E;  4UP0 A;  3RPG C;  2XB1 A;  3C5K A;  2FSA A;  5KH3 A;  5B8D A;  2LAU A;  4QQ4 A;  2LRI C;  3FEH A;  3M7K A;  1ZBD B;  1LDK C;  2CON A;  2MIQ A;  4P5O B;  5TRB A;  2KR4 A;  5LKT A;  5K3Q A;  4F52 B;  2AN6 A;  4PPE A;  3ZPV E;  4MVT A;  1U6G B;  2PUY A;  4AYC B;  2UZG A;  3JUE A;  4W4U A;  2LGV A;  2YUR A;  2MA5 A;  2G45 A;  1WEU A;  5SVX A;  3SUB A;  1VYX A;  5TDR A;  2KIZ A;  3MDB C;  2M85 A;  5LCW B;  1VFY A;  2H0D A;  2M1R A;  1Z60 A;  3RTR B;  5B79 A;  3O7A A;  1HYI A;  3KQI A;  4AUQ B;  1T1H A;  2YVR A;  4LK9 A;  4GNF A;  3L1Z B;  3L11 A;  4YC9 A;  1WE9 A;  2Y1N A;  4YAD A;  3T7L A;  2LXH C;  5J3X A;  2QJ0 A;  4LAD B;  2E6S A;  2JM3 A;  2VP7 A;  4LKA A;  3N9N A;  5G0F A;  2EXU A;  2F42 A;  2LXP C;  3FL2 A;  3HTK C;  4GNG A;  2YU4 A;  1WIM A;  3LQH A;  3HCS A;  2D8U A;  5B77 A;  5G05 B;  3GV4 A;  4FO9 A;  2CKL B;  3ZYQ A;  1WEM A;  3KV5 A;  1RMD A;  4A49 A;  3U5O A;  5LKX A;  2RI7 A;  2DJA A;  2YHO A;  1WGM A;  2KWJ A;  2QIZ A;  5C13 A;  4R7E A;  1JM7 B;  3QZV A;  4YAB A;  2C2V S;  2VPB A;  4YAX A;  3O33 A;  2MNZ A;  4OGC A;  4OGE A;  4MSX A;  3DWD A;  3M63 A;  5B75 A;  4N3W A;  1WES A;  4UI9 B;  3O47 A;  2CT2 A;  3SOX A;  5DKA A;  2KKX A;  4AVX A;  2CRR A;  2KWK A;  1WEW A;  2Y43 A;  4YBS A;  2EGP A;  2YT5 A;  4O64 A;  3LVQ E;  2LDR A;  2KE1 A;  2BAY A;  1Z2Q A;  3LQJ A;  3KV6 A;  2KGG A;  2C2L A;  4L58 A;  1MM2 A;  2D8S A;  2L80 A;  3HCT A;  3MHS A;  4WZ2 A;  2MD8 C;  1G25 A;  4IC3 A;  3NG2 A;  4V3K C;  2IDA A;  3M62 A;  5AIT A;  3GL6 A;  2ECW A;  2MUM A;  4S3O B;  5JG6 A;  4AP4 A;  3SHB A;  5SVI A;  4WZ3 B;  2ECI A;  1IYM A;  3N9O A;  2VJE B;  3T6R A;  4LJN A;  2YSM A;  3N9Q A;  2RR4 A;  4QF2 A;  4GB0 A;  4GNE A;  4I7C A; 
#chains in the Genus database with same CATH homology
 3SOW A;  5H1U A;  3M99 A;  1WEO A;  1X4J A;  4FK5 A;  5EYA F;  2G6Q A;  4A4B A;  4AYC A;  5TBN A;  5B76 A;  3N9P A;  2XEU A;  4WZ0 A;  4A0C D;  3L1X A;  2KYU A;  3U5M A;  2M3H A;  2FUI A;  2ECT A;  5TDW A;  5DIN A;  5G04 B;  2K16 A;  3ASL A;  4Q6F A;  5FEY A;  2L43 A;  2F6N A;  2YUC A;  3DQV R;  2JRJ A;  3V43 A;  3ZNI A;  1V87 A;  5FER A;  3O70 A;  5H1T A;  5KH9 A;  4CA1 A;  1DVP A;  1Z6U A;  4XI1 A;  5D1M B;  2ECN A;  3RPG B;  1WEE A;  2LQ6 A;  1LDJ B;  3KNV A;  2CKL A;  2K4D A;  3LRQ A;  5B78 A;  1WIL A;  3SOU A;  1JM7 A;  2YQM A;  2L5U A;  2ECV A;  2CSZ A;  2F6J A;  5I3L A;  2VPD A;  2Y1M A;  2ZET C;  5LKU A;  2VJF B;  4A4C A;  2KWO A;  4YBM A;  3N9L A;  2KU3 A;  1BOR A;  5H1V A;  3LQI A;  2MT5 A;  4R8P K;  2VPG A;  2DX8 A;  2M6M A;  2JMD A;  4ZQL A;  5LKZ A;  2I50 A;  2QIC A;  2L0B A;  2RSD A;  3O37 A;  1CHC A;  2LGG A;  2K17 A;  1JOC A;  3ZVY A;  4NN2 A;  4R2Y A;  2KGI A;  3ZTG A;  3EB6 A;  2KFT A;  3N9M A;  3U5N A;  2ECJ A;  2VJE A;  2YW8 A;  2ECG A;  5C11 A;  1N87 A;  2HDP A;  4IC2 A;  2PNX A;  4BBQ A;  2G43 A;  1FBV A;  2EOD A;  3ZPV 1;  4ZDT A;  2LN0 A;  1FP0 A;  2OXQ C;  1WEV A;  5H9M A;  3U5P A;  4TKP B;  2JMJ A;  2KWN A;  2YHN A;  4CCG X;  2E6R A;  2LV9 A;  4X3G A;  4N4F A;  1MM3 A;  4FIP A;  2NAA A;  2YRE A;  4LLB A;  3O35 A;  3PUR A;  2EA6 A;  2KRE A;  4GND A;  3VK6 A;  3MHH A;  2H0D B;  4ZUX U;  1E4U A;  1X4U A;  3O36 A;  3EB5 A;  4PTB A;  2HYE D;  2VPE A;  3I2D A;  2LGK A;  2YQL A;  1WEN A;  4BHW A;  5KH7 A;  4B86 C;  4I7B A;  4C9Z A;  1F62 A;  4S3O C;  2FUU A;  2MA6 A;  4L7X A;  1WFK A;  1WEQ A;  2YSJ A;  2JMI A;  1WEP A;  2MNY A;  4B7Y C;  5AIU A;  3O34 A;  3PUQ A;  4V3L C;  1X4I A;  2CSY A;  5D1L B;  2VJF A;  5FB0 A;  2K1J A;  3C6W A;  1XWH A;  3DPL R;  1K2F A;  5FB1 A;  3ZVZ B;  2LGL A;  1VD4 A;  4WA6 A;  2L75 A;  4FJC A;  5TAB A;  3HCU A;  2YYR A;  4YAT A;  2MD7 B;  4I7D A;  1HYJ A;  4QF3 A;  3PHD A;  4UP5 A;  3IHP A;  5D1K B;  4YBT A;  2VNF A;  4UP0 A;  3RPG C;  2XB1 A;  3C5K A;  2FSA A;  5KH3 A;  5B8D A;  2LRI C;  1ZBD B;  1LDK C;  5TRB A;  2MIQ A;  4P5O B;  2KR4 A;  5LKT A;  4F52 B;  2AN6 A;  4PPE A;  3ZPV E;  4MVT A;  1U6G B;  2PUY A;  4AYC B;  2UZG A;  4W4U A;  2LGV A;  2YUR A;  2MA5 A;  2G45 A;  1WEU A;  1VYX A;  5TDR A;  2KIZ A;  2M85 A;  5LCW B;  1VFY A;  2H0D A;  2M1R A;  1Z60 A;  3RTR B;  5B79 A;  3O7A A;  1HYI A;  3KQI A;  4AUQ B;  1T1H A;  4LK9 A;  4GNF A;  3L1Z B;  3L11 A;  4YC9 A;  1WE9 A;  2Y1N A;  4YAD A;  3T7L A;  2LXH C;  5J3X A;  2QJ0 A;  4LAD B;  2E6S A;  2VP7 A;  4LKA A;  3N9N A;  5G0F A;  2F42 A;  2LXP C;  3FL2 A;  3HTK C;  4GNG A;  2YU4 A;  1WIM A;  3LQH A;  3HCS A;  5B77 A;  5G05 B;  3GV4 A;  4FO9 A;  2CKL B;  3ZYQ A;  1WEM A;  3KV5 A;  1RMD A;  4A49 A;  3U5O A;  5LKX A;  2RI7 A;  2YHO A;  1WGM A;  2KWJ A;  2QIZ A;  5C13 A;  4R7E A;  1JM7 B;  3QZV A;  4YAB A;  2C2V S;  2VPB A;  4YAX A;  3O33 A;  2MNZ A;  4MSX A;  3M63 A;  5B75 A;  4N3W A;  1WES A;  4UI9 B;  2CT2 A;  3SOX A;  5DKA A;  4AVX A;  2KWK A;  1WEW A;  2Y43 A;  4YBS A;  2EGP A;  2YT5 A;  4O64 A;  2LDR A;  2KE1 A;  2BAY A;  1Z2Q A;  3LQJ A;  3KV6 A;  2KGG A;  2MD8 C;  2C2L A;  1MM2 A;  2D8S A;  2L80 A;  3HCT A;  3MHS A;  4L58 A;  4WZ2 A;  1G25 A;  4IC3 A;  3NG2 A;  4V3K C;  2IDA A;  3M62 A;  5AIT A;  3GL6 A;  2ECW A;  2MUM A;  4S3O B;  5JG6 A;  4AP4 A;  3SHB A;  4WZ3 B;  2ECI A;  1IYM A;  3N9O A;  2VJE B;  3T6R A;  4LJN A;  2YSM A;  3N9Q A;  4QF2 A;  4GB0 A;  4GNE A;  4I7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...