2OXQC

Structure of the ubch5 :chip u-box complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
72
structure length
72
Chain Sequence
b'EIPDYLCGKISFELMAEPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQDQLIPNLAMKEVIDAFIQEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2D 1
publication title Interactions between the quality control ubiquitin ligase CHIP and ubiquitin conjugating enzymes.
pubmed doi rcsb
source organism Danio rerio
molecule tags Ligase
total genus 21
structure length 72
sequence length 72
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2oxqC00
1WEMA 2HYED 2E6SA 1FP0A 4C9ZA 5I3LA 2EGPA 4R7EA 1FBVA 3ZTGA 2VPBA 3SOXA 5TRBA 4UP5A 2LXHC 2JMDA 1WIMA 2EODA 3L11A 2YYRA 5JG6A 3ZPVE 2I50A 2AN6A 3O36A 2YSMA 4FO9A 2YU4A 2YURA 2ECTA 4N3WA 2QJ0A 3T7LA 4LADB 2KFTA 5H1TA 3SOUA 1JM7A 2RSDA 2ZETC 2Y1MA 4ZUXU 5FEYA 2LGLA 2Y43A 4GNFA 3KNVA 1WEPA 1WILA 3U5NA 1WESA 3GV4A 5DKAA 4V3KC 1X4JA 2LQ6A 1WEQA 2K16A 3ASLA 1MM2A 3ZNIA 4LJNA 2C2LA 2M85A 1E4UA 4PPEA 2KWOA 3EB6A 3HCSA 2CKLB 5TABA 4AYCA 4YADA 2YSJA 1DVPA 4YBSA 3O7AA 2L80A 4X3GA 1WEUA 2LGVA 2YT5A 2VJEA 2KIZA 4S3OC 5H9MA 1N87A 3VK6A 5C13A 5AIUA 2F6JA 5FB1A 4LK9A 4P5OB 2PNXA 2G45A 2ECJA 4YAXA 3PUQA 5TDWA 3KQIA 5KH9A 4WZ2A 1WENA 2G6QA 2KWNA 2OXQC 4PTBA 3M99A 4UP0A 5TDRA 1X4IA 5B77A 3HCUA 3C6WA 3IHPA 3L1ZB 2BAYA 5FB0A 4R2YA 3HTKC 2VJFB 2L43A 4V3LC 5AITA 4B86C 1VD4A 2MIQA 5B79A 3RPGC 3SOWA 5LKUA 4Q6FA 4WA6A 4XI1A 1WEOA 2MT5A 2VP7A 3SHBA 2MA6A 4UI9B 4WZ3B 5C11A 4LLBA 4LKAA 2XB1A 2VPDA 3DPLR 3O34A 3C5KA 4CA1A 3N9MA 1Z2QA 3HCTA 2EA6A 4I7BA 5B78A 4A49A 4BHWA 2K4DA 5KH3A 2H0DB 1X4UA 3LRQA 3N9LA 2CSZA 2M3HA 1BORA 2RI7A 2KGIA 5EYAF 4CCGX 2FSAA 2KGGA 3ZVYA 4ZQLA 1U6GB 2FUIA 1WEVA 2K1JA 4A4CA 2JMJA 2L0BA 3N9NA 4QF2A 2LV9A 4B7YC 3KV5A 3MHSA 4L58A 4A4BA 2L75A 3GL6A 4YABA 1LDJB 5H1UA 4QF3A 4MSXA 5G04B 3V43A 1IYMA 2K17A 4S3OB 2DX8A 4F52B 1CHCA 3NG2A 3ZPV1 4A0CD 3ZYQA 3PHDA 1Z6UA 4ZDTA 2ECNA 2ECIA 3T6RA 4YC9A 3DQVR 4O64A 5D1LB 2PUYA 3ZVZB 5B75A 2VPGA 2M1RA 4GB0A 1HYIA 4I7DA 4W4UA 2ECGA 1JOCA 5H1VA 4WZ0A 2IDAA 3EB5A 2KR4A 3LQHA 1ZBDB 4NN2A 5LKTA 2Y1NA 3RPGB 3U5PA 3RTRB 2KREA 1F62A 1VFYA 2XEUA 4TKPB 1JM7B 4BBQA 1HYJA 5TBNA 5G05B 2C2VS 2QIZA 3FL2A 2NAAA 4YBMA 3KV6A 3LQJA 2F42A 1RMDA 5B76A 1WE9A 2CSYA 2MA5A 2YQMA 3PURA 1XWHA 2VJFA 3O37A 3LQIA 1V87A 2LGGA 3M62A 3U5OA 3L1XA 1T1HA 2LN0A 3O35A 2JRJA 4MVTA 3QZVA 2VNFA 2F6NA 2M6MA 2KWJA 5LCWB 2LXPC 4AYCB 4I7CA 4AP4A 2KU3A 1WEEA 4FJCA 4YBTA 5LKXA 2KYUA 4FK5A 4AUQB 4R8PK 2CT2A 2VJEB 2E6RA 2HDPA 2JMIA 4GNEA 4IC3A 1MM3A 2H0DA 2YHOA 5FERA 1VYXA 2LRIC 5B8DA 2YREA 1WFKA 2LGKA 3MHHA 3I2DA 5D1MB 4AVXA 1Z60A 5D1KB 2MNZA 1G25A 3M63A 4GNDA 2VPEA 2MD7B 2LDRA 3N9QA 3N9OA 1WEWA 4YATA 2ECWA 2L5UA 5LKZA 3O70A 2ECVA 2MNYA 2CKLA 3U5MA 5J3XA 4L7XA 2YW8A 1WGMA 4N4FA 3O33A 4IC2A 4GNGA 5DINA 2G43A 3N9PA 2QICA 4FIPA 2MD8C 2UZGA 2YQLA 2KWKA 2MUMA 2YUCA 2FUUA 5G0FA 5KH7A 2D8SA 2YHNA 1K2FA 2KE1A 1LDKC
chains in the Genus database with same CATH superfamily
1WEMA 2HYED 3Q1DA 2E6SA 1FP0A 3LJUX 4C9ZA 5I3LA 2EGPA 4QQ4A 4R7EA 2OWAA 1FBVA 3ZTGA 2VPBA 3SOXA 5TRBA 4UP5A 2LXHC 2JMDA 1WIMA 2EODA 3L11A 2YYRA 5JG6A 3ZPVE 2I50A 2AN6A 2XOCA 3O36A 2KKYA 2YSMA 4FO9A 2YU4A 2IQJA 2JUNA 2YURA 2ECTA 4N3WA 2QJ0A 3T7LA 4LADB 2KFTA 5H1TA 3SOUA 1JM7A 5SVIB 2RSDA 2ZETC 2Y1MA 4ZUXU 5FEYA 2LGLA 2Y43A 5K3QA 4GNFA 2YVRA 3KNVA 1WEPA 1WILA 3U5NA 3LDYA 1WESA 3GV4A 5DKAA 4V3KC 1X4JA 2LQ6A 1WEQA 2K16A 3ASLA 1MM2A 3ZNIA 4LJNA 2C2LA 2M85A 1E4UA 4PPEA 2KWOA 4Z0RA 3EB6A 3HCSA 3KDEC 2CKLB 5TABA 4AYCA 4YADA 2D8UA 2YSJA 1DVPA 3FEHA 4YBSA 3O7AA 2L80A 4X3GA 1WEUA 2LGVA 2YT5A 2CRWA 2VJEA 2KIZA 4S3OC 5H9MA 1N87A 3VK6A 5C13A 5AIUA 2F6JA 2DSMA 5FB1A 4LK9A 4P5OB 2PNXA 2G45A 2ECJA 4YAXA 3PUQA 5TDWA 3KQIA 5KH9A 4WZ2A 1WENA 2G6QA 2KWNA 3LVQE 3LVRE 2OXQC 3O47A 4PTBA 3M99A 3FANA 4UP0A 4F1PA 2EGMA 5TDRA 1X4IA 5B77A 3HCUA 2XP0A 3C6WA 3IHPA 3L1ZB 2BAYA 5FB0A 4R2YA 3SUBA 3HTKC 2VJFB 2L43A 4V3LC 5AITA 4B86C 1VD4A 2MIQA 5B79A 3RPGC 3SOWA 5LKUA 4Q6FA 4Z0OA 4WA6A 4XI1A 1WEOA 4O62A 2MT5A 2RR4A 2VP7A 3SHBA 2CONA 2MA6A 4UI9B 1MBMA 4WZ3B 5C11A 4LLBA 4LKAA 2XB1A 2VPDA 3DPLR 3O34A 3C5KA 4CA1A 3N9MA 1Z2QA 3HCTA 2EA6A 4I7BA 3T9KA 5B78A 4A49A 4BHWA 2K4DA 5KH3A 2H0DB 2E61A 1X4UA 3LRQA 3N9LA 2CSZA 2M3HA 1BORA 2RI7A 2KGIA 5EYAF 4CCGX 4H9DA 2FSAA 2KGGA 3ZVYA 4ZQLA 1U6GB 2FUIA 1WEVA 2K1JA 4A4CA 2JMJA 2L0BA 3N9NA 4QF2A 2LV9A 4B7YC 3KV5A 2FFWA 3MHSA 4L58A 4A4BA 2L75A 5SVIA 3GL6A 4YABA 1LDJB 2FD4A 5H1UA 4QF3A 3DWDA 2CRRA 3E2DA 4MSXA 5G04B 3V43A 1IYMA 2LAUA 2K17A 5SVYA 4S3OB 2DX8A 4F52B 3FAOA 1CHCA 3NG2A 3ZPV1 4A0CD 3ZYQA 3PHDA 1Z6UA 4ZDTA 2ECNA 2ECIA 3T6RA 4YC9A 3DQVR 4O64A 5D1LB 2XOZA 2PUYA 3M7KA 3ZVZB 5B75A 2VPGA 2KKXA 2M1RA 4GB0A 1HYIA 4OGEA 4I7DA 4W4UA 2ECGA 1JOCA 5H1VA 2MKEA 2EXUA 4WZ0A 2IDAA 3EB5A 2KR4A 3LQHA 1ZBDB 4NN2A 5LKTA 2Y1NA 3RPGB 3U5PA 3RTRB 2KREA 1F62A 1VFYA 2XEUA 4TKPB 1JM7B 4BBQA 1HYJA 5SVXA 3FM8C 5TBNA 5G05B 2C2VS 2QIZA 2L7PA 3FL2A 2NAAA 4YBMA 3PLWA 3KV6A 3LQJA 2F42A 3DDTA 1RMDA 5B76A 1WE9A 2CSYA 2MA5A 2YQMA 3PURA 1XWHA 2VJFA 3O37A 2P57A 3LQIA 1V87A 2LGGA 3M62A 3U5OA 3L1XA 1T1HA 3JUEA 2LN0A 3O35A 2JRJA 4MVTA 3QZVA 2VNFA 2F6NA 2M13A 2KWJA 2M6MA 2LXPC 4OGCA 5LCWB 4AYCB 4I7CA 4AP4A 2B0OE 2KU3A 1WEEA 4FJCA 1DCQA 4YBTA 5LKXA 2KYUA 4FK5A 4AUQB 4R8PK 2CT2A 2VJEB 2E6RA 2HDPA 3H7HA 2JMIA 4GNEA 4IC3A 1MM3A 2H0DA 2CSVA 2YHOA 5FERA 3MDBC 1VYXA 2LRIC 5B8DA 2YREA 1WFKA 2LGKA 3MHHA 3I2DA 5D1MB 4AVXA 1Z60A 5D1KB 2MNZA 1G25A 3M63A 4GNDA 2VPEA 2DJAA 2MD7B 2LDRA 3N9QA 3N9OA 1WEWA 4YATA 2ECWA 2L5UA 5LKZA 3O70A 2XOYA 2ECVA 2MNYA 2CKLA 3U5MA 5J3XA 4L7XA 2YW8A 1WGMA 4N4FA 3O33A 4IC2A 2JM3A 4GNGA 5DINA 2G43A 3N9PA 2QICA 4FIPA 2MD8C 2UZGA 2YQLA 2KWKA 2MUMA 2YUCA 2FUUA 5G0FA 5KH7A 2D8SA 2YHNA 1K2FA 2KE1A 1LDKC 3FJUB
chains in the Genus database with same CATH topology
1WEMA 2HYED 2E6SA 1FP0A 4C9ZA 5I3LA 2EGPA 4R7EA 1FBVA 3ZTGA 2VPBA 3SOXA 5TRBA 4UP5A 2LXHC 2JMDA 1WIMA 2EODA 3L11A 2YYRA 5JG6A 3ZPVE 2I50A 2AN6A 3O36A 2YSMA 4FO9A 2YU4A 2YURA 2ECTA 4N3WA 2QJ0A 3T7LA 4LADB 2KFTA 5H1TA 3SOUA 1JM7A 2RSDA 2ZETC 2Y1MA 4ZUXU 5FEYA 2LGLA 2Y43A 4GNFA 3KNVA 1WEPA 1WILA 3U5NA 1WESA 3GV4A 5DKAA 4V3KC 1X4JA 2LQ6A 1WEQA 2K16A 3ASLA 1MM2A 3ZNIA 4LJNA 2C2LA 2M85A 1E4UA 4PPEA 2KWOA 3EB6A 3HCSA 2CKLB 5TABA 4AYCA 4YADA 2YSJA 1DVPA 4YBSA 3O7AA 2L80A 4X3GA 1WEUA 2LGVA 2YT5A 2VJEA 2KIZA 4S3OC 5H9MA 1N87A 3VK6A 5C13A 5AIUA 2F6JA 5FB1A 4LK9A 4P5OB 2PNXA 2G45A 2ECJA 4YAXA 3PUQA 5TDWA 3KQIA 5KH9A 4WZ2A 1WENA 2G6QA 2KWNA 2OXQC 4PTBA 3M99A 4UP0A 5TDRA 1X4IA 5B77A 3HCUA 3C6WA 3IHPA 3L1ZB 2BAYA 5FB0A 4R2YA 3HTKC 2VJFB 2L43A 4V3LC 5AITA 4B86C 1VD4A 2MIQA 5B79A 3RPGC 3SOWA 5LKUA 4Q6FA 4WA6A 4XI1A 1WEOA 2MT5A 2VP7A 3SHBA 2MA6A 4UI9B 4WZ3B 5C11A 4LLBA 4LKAA 2XB1A 2VPDA 3DPLR 3O34A 3C5KA 4CA1A 3N9MA 1Z2QA 3HCTA 2EA6A 4I7BA 5B78A 4A49A 4BHWA 2K4DA 5KH3A 2H0DB 1X4UA 3LRQA 3N9LA 2CSZA 2M3HA 1BORA 2RI7A 2KGIA 5EYAF 4CCGX 2FSAA 2KGGA 3ZVYA 4ZQLA 1U6GB 2FUIA 1WEVA 2K1JA 4A4CA 2JMJA 2L0BA 3N9NA 4QF2A 2LV9A 4B7YC 3KV5A 3MHSA 4L58A 4A4BA 2L75A 3GL6A 4YABA 1LDJB 5H1UA 4QF3A 4MSXA 5G04B 3V43A 1IYMA 2K17A 4S3OB 2DX8A 4F52B 1CHCA 3NG2A 3ZPV1 4A0CD 3ZYQA 3PHDA 1Z6UA 4ZDTA 2ECNA 2ECIA 3T6RA 4YC9A 3DQVR 4O64A 5D1LB 2PUYA 3ZVZB 5B75A 2VPGA 2M1RA 4GB0A 1HYIA 4I7DA 4W4UA 2ECGA 1JOCA 5H1VA 4WZ0A 2IDAA 3EB5A 2KR4A 3LQHA 1ZBDB 4NN2A 5LKTA 2Y1NA 3RPGB 3U5PA 3RTRB 2KREA 1F62A 1VFYA 2XEUA 4TKPB 1JM7B 4BBQA 1HYJA 5TBNA 5G05B 2C2VS 2QIZA 3FL2A 2NAAA 4YBMA 3KV6A 3LQJA 2F42A 1RMDA 5B76A 1WE9A 2CSYA 2MA5A 2YQMA 3PURA 1XWHA 2VJFA 3O37A 3LQIA 1V87A 2LGGA 3M62A 3U5OA 3L1XA 1T1HA 2LN0A 3O35A 2JRJA 4MVTA 3QZVA 2VNFA 2F6NA 2M6MA 2KWJA 5LCWB 2LXPC 4AYCB 4I7CA 4AP4A 2KU3A 1WEEA 4FJCA 4YBTA 5LKXA 2KYUA 4FK5A 4AUQB 4R8PK 2CT2A 2VJEB 2E6RA 2HDPA 2JMIA 4GNEA 4IC3A 1MM3A 2H0DA 2YHOA 5FERA 1VYXA 2LRIC 5B8DA 2YREA 1WFKA 2LGKA 3MHHA 3I2DA 5D1MB 4AVXA 1Z60A 5D1KB 2MNZA 1G25A 3M63A 4GNDA 2VPEA 2MD7B 2LDRA 3N9QA 3N9OA 1WEWA 4YATA 2ECWA 2L5UA 5LKZA 3O70A 2ECVA 2MNYA 2CKLA 3U5MA 5J3XA 4L7XA 2YW8A 1WGMA 4N4FA 3O33A 4IC2A 4GNGA 5DINA 2G43A 3N9PA 2QICA 4FIPA 2MD8C 2UZGA 2YQLA 2KWKA 2MUMA 2YUCA 2FUUA 5G0FA 5KH7A 2D8SA 2YHNA 1K2FA 2KE1A 1LDKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEM A;  2HYE D;  2E6S A;  1FP0 A;  4C9Z A;  5I3L A;  2EGP A;  4R7E A;  1FBV A;  3ZTG A;  2VPB A;  3SOX A;  5TRB A;  4UP5 A;  2LXH C;  2JMD A;  1WIM A;  2EOD A;  3L11 A;  2YYR A;  5JG6 A;  3ZPV E;  2I50 A;  2AN6 A;  3O36 A;  2YSM A;  4FO9 A;  2YU4 A;  2YUR A;  2ECT A;  4N3W A;  2QJ0 A;  3T7L A;  4LAD B;  2KFT A;  5H1T A;  3SOU A;  1JM7 A;  2RSD A;  2ZET C;  2Y1M A;  4ZUX U;  5FEY A;  2LGL A;  2Y43 A;  4GNF A;  3KNV A;  1WEP A;  1WIL A;  3U5N A;  1WES A;  3GV4 A;  5DKA A;  4V3K C;  1X4J A;  2LQ6 A;  1WEQ A;  2K16 A;  3ASL A;  1MM2 A;  3ZNI A;  4LJN A;  2C2L A;  2M85 A;  1E4U A;  4PPE A;  2KWO A;  3EB6 A;  3HCS A;  2CKL B;  5TAB A;  4AYC A;  4YAD A;  2YSJ A;  1DVP A;  4YBS A;  3O7A A;  2L80 A;  4X3G A;  1WEU A;  2LGV A;  2YT5 A;  2VJE A;  2KIZ A;  4S3O C;  5H9M A;  1N87 A;  3VK6 A;  5C13 A;  5AIU A;  2F6J A;  5FB1 A;  4LK9 A;  4P5O B;  2PNX A;  2G45 A;  2ECJ A;  4YAX A;  3PUQ A;  5TDW A;  3KQI A;  5KH9 A;  4WZ2 A;  1WEN A;  2G6Q A;  2KWN A;  2OXQ C;  4PTB A;  3M99 A;  4UP0 A;  5TDR A;  1X4I A;  5B77 A;  3HCU A;  3C6W A;  3IHP A;  3L1Z B;  2BAY A;  5FB0 A;  4R2Y A;  3HTK C;  2VJF B;  2L43 A;  4V3L C;  5AIT A;  4B86 C;  1VD4 A;  2MIQ A;  5B79 A;  3RPG C;  3SOW A;  5LKU A;  4Q6F A;  4WA6 A;  4XI1 A;  1WEO A;  2MT5 A;  2VP7 A;  3SHB A;  2MA6 A;  4UI9 B;  4WZ3 B;  5C11 A;  4LLB A;  4LKA A;  2XB1 A;  2VPD A;  3DPL R;  3O34 A;  3C5K A;  4CA1 A;  3N9M A;  1Z2Q A;  3HCT A;  2EA6 A;  4I7B A;  5B78 A;  4A49 A;  4BHW A;  2K4D A;  5KH3 A;  2H0D B;  1X4U A;  3LRQ A;  3N9L A;  2CSZ A;  2M3H A;  1BOR A;  2RI7 A;  2KGI A;  5EYA F;  4CCG X;  2FSA A;  2KGG A;  3ZVY A;  4ZQL A;  1U6G B;  2FUI A;  1WEV A;  2K1J A;  4A4C A;  2JMJ A;  2L0B A;  3N9N A;  4QF2 A;  2LV9 A;  4B7Y C;  3KV5 A;  3MHS A;  4L58 A;  4A4B A;  2L75 A;  3GL6 A;  4YAB A;  1LDJ B;  5H1U A;  4QF3 A;  4MSX A;  5G04 B;  3V43 A;  1IYM A;  2K17 A;  4S3O B;  2DX8 A;  4F52 B;  1CHC A;  3NG2 A;  3ZPV 1;  4A0C D;  3ZYQ A;  3PHD A;  1Z6U A;  4ZDT A;  2ECN A;  2ECI A;  3T6R A;  4YC9 A;  3DQV R;  4O64 A;  5D1L B;  2PUY A;  3ZVZ B;  5B75 A;  2VPG A;  2M1R A;  4GB0 A;  1HYI A;  4I7D A;  4W4U A;  2ECG A;  1JOC A;  5H1V A;  4WZ0 A;  2IDA A;  3EB5 A;  2KR4 A;  3LQH A;  1ZBD B;  4NN2 A;  5LKT A;  2Y1N A;  3RPG B;  3U5P A;  3RTR B;  2KRE A;  1F62 A;  1VFY A;  2XEU A;  4TKP B;  1JM7 B;  4BBQ A;  1HYJ A;  5TBN A;  5G05 B;  2C2V S;  2QIZ A;  3FL2 A;  2NAA A;  4YBM A;  3KV6 A;  3LQJ A;  2F42 A;  1RMD A;  5B76 A;  1WE9 A;  2CSY A;  2MA5 A;  2YQM A;  3PUR A;  1XWH A;  2VJF A;  3O37 A;  3LQI A;  1V87 A;  2LGG A;  3M62 A;  3U5O A;  3L1X A;  1T1H A;  2LN0 A;  3O35 A;  2JRJ A;  4MVT A;  3QZV A;  2VNF A;  2F6N A;  2M6M A;  2KWJ A;  5LCW B;  2LXP C;  4AYC B;  4I7C A;  4AP4 A;  2KU3 A;  1WEE A;  4FJC A;  4YBT A;  5LKX A;  2KYU A;  4FK5 A;  4AUQ B;  4R8P K;  2CT2 A;  2VJE B;  2E6R A;  2HDP A;  2JMI A;  4GNE A;  4IC3 A;  1MM3 A;  2H0D A;  2YHO A;  5FER A;  1VYX A;  2LRI C;  5B8D A;  2YRE A;  1WFK A;  2LGK A;  3MHH A;  3I2D A;  5D1M B;  4AVX A;  1Z60 A;  5D1K B;  2MNZ A;  1G25 A;  3M63 A;  4GND A;  2VPE A;  2MD7 B;  2LDR A;  3N9Q A;  3N9O A;  1WEW A;  4YAT A;  2ECW A;  2L5U A;  5LKZ A;  3O70 A;  2ECV A;  2MNY A;  2CKL A;  3U5M A;  5J3X A;  4L7X A;  2YW8 A;  1WGM A;  4N4F A;  3O33 A;  4IC2 A;  4GNG A;  5DIN A;  2G43 A;  3N9P A;  2QIC A;  4FIP A;  2MD8 C;  2UZG A;  2YQL A;  2KWK A;  2MUM A;  2YUC A;  2FUU A;  5G0F A;  5KH7 A;  2D8S A;  2YHN A;  1K2F A;  2KE1 A;  1LDK C; 
#chains in the Genus database with same CATH topology
 1WEM A;  2HYE D;  3Q1D A;  2E6S A;  1FP0 A;  3LJU X;  4C9Z A;  5I3L A;  2EGP A;  4QQ4 A;  4R7E A;  2OWA A;  1FBV A;  3ZTG A;  2VPB A;  3SOX A;  5TRB A;  4UP5 A;  2LXH C;  2JMD A;  1WIM A;  2EOD A;  3L11 A;  2YYR A;  5JG6 A;  3ZPV E;  2I50 A;  2AN6 A;  2XOC A;  3O36 A;  2KKY A;  2YSM A;  4FO9 A;  2YU4 A;  2IQJ A;  2JUN A;  2YUR A;  2ECT A;  4N3W A;  2QJ0 A;  3T7L A;  4LAD B;  2KFT A;  5H1T A;  3SOU A;  1JM7 A;  5SVI B;  2RSD A;  2ZET C;  2Y1M A;  4ZUX U;  5FEY A;  2LGL A;  2Y43 A;  5K3Q A;  4GNF A;  2YVR A;  3KNV A;  1WEP A;  1WIL A;  3U5N A;  3LDY A;  1WES A;  3GV4 A;  5DKA A;  4V3K C;  1X4J A;  2LQ6 A;  1WEQ A;  2K16 A;  3ASL A;  1MM2 A;  3ZNI A;  4LJN A;  2C2L A;  2M85 A;  1E4U A;  4PPE A;  2KWO A;  4Z0R A;  3EB6 A;  3HCS A;  3KDE C;  2CKL B;  5TAB A;  4AYC A;  4YAD A;  2D8U A;  2YSJ A;  1DVP A;  3FEH A;  4YBS A;  3O7A A;  2L80 A;  4X3G A;  1WEU A;  2LGV A;  2YT5 A;  2CRW A;  2VJE A;  2KIZ A;  4S3O C;  5H9M A;  1N87 A;  3VK6 A;  5C13 A;  5AIU A;  2F6J A;  2DSM A;  5FB1 A;  4LK9 A;  4P5O B;  2PNX A;  2G45 A;  2ECJ A;  4YAX A;  3PUQ A;  5TDW A;  3KQI A;  5KH9 A;  4WZ2 A;  1WEN A;  2G6Q A;  2KWN A;  3LVQ E;  3LVR E;  2OXQ C;  3O47 A;  4PTB A;  3M99 A;  3FAN A;  4UP0 A;  4F1P A;  2EGM A;  5TDR A;  1X4I A;  5B77 A;  3HCU A;  2XP0 A;  3C6W A;  3IHP A;  3L1Z B;  2BAY A;  5FB0 A;  4R2Y A;  3SUB A;  3HTK C;  2VJF B;  2L43 A;  4V3L C;  5AIT A;  4B86 C;  1VD4 A;  2MIQ A;  5B79 A;  3RPG C;  3SOW A;  5LKU A;  4Q6F A;  4Z0O A;  4WA6 A;  4XI1 A;  1WEO A;  4O62 A;  2MT5 A;  2RR4 A;  2VP7 A;  3SHB A;  2CON A;  2MA6 A;  4UI9 B;  1MBM A;  4WZ3 B;  5C11 A;  4LLB A;  4LKA A;  2XB1 A;  2VPD A;  3DPL R;  3O34 A;  3C5K A;  4CA1 A;  3N9M A;  1Z2Q A;  3HCT A;  2EA6 A;  4I7B A;  3T9K A;  5B78 A;  4A49 A;  4BHW A;  2K4D A;  5KH3 A;  2H0D B;  2E61 A;  1X4U A;  3LRQ A;  3N9L A;  2CSZ A;  2M3H A;  1BOR A;  2RI7 A;  2KGI A;  5EYA F;  4CCG X;  4H9D A;  2FSA A;  2KGG A;  3ZVY A;  4ZQL A;  1U6G B;  2FUI A;  1WEV A;  2K1J A;  4A4C A;  2JMJ A;  2L0B A;  3N9N A;  4QF2 A;  2LV9 A;  4B7Y C;  3KV5 A;  2FFW A;  3MHS A;  4L58 A;  4A4B A;  2L75 A;  5SVI A;  3GL6 A;  4YAB A;  1LDJ B;  2FD4 A;  5H1U A;  4QF3 A;  3DWD A;  2CRR A;  3E2D A;  4MSX A;  5G04 B;  3V43 A;  1IYM A;  2LAU A;  2K17 A;  5SVY A;  4S3O B;  2DX8 A;  4F52 B;  3FAO A;  1CHC A;  3NG2 A;  3ZPV 1;  4A0C D;  3ZYQ A;  3PHD A;  1Z6U A;  4ZDT A;  2ECN A;  2ECI A;  3T6R A;  4YC9 A;  3DQV R;  4O64 A;  5D1L B;  2XOZ A;  2PUY A;  3M7K A;  3ZVZ B;  5B75 A;  2VPG A;  2KKX A;  2M1R A;  4GB0 A;  1HYI A;  4OGE A;  4I7D A;  4W4U A;  2ECG A;  1JOC A;  5H1V A;  2MKE A;  2EXU A;  4WZ0 A;  2IDA A;  3EB5 A;  2KR4 A;  3LQH A;  1ZBD B;  4NN2 A;  5LKT A;  2Y1N A;  3RPG B;  3U5P A;  3RTR B;  2KRE A;  1F62 A;  1VFY A;  2XEU A;  4TKP B;  1JM7 B;  4BBQ A;  1HYJ A;  5SVX A;  3FM8 C;  5TBN A;  5G05 B;  2C2V S;  2QIZ A;  2L7P A;  3FL2 A;  2NAA A;  4YBM A;  3PLW A;  3KV6 A;  3LQJ A;  2F42 A;  3DDT A;  1RMD A;  5B76 A;  1WE9 A;  2CSY A;  2MA5 A;  2YQM A;  3PUR A;  1XWH A;  2VJF A;  3O37 A;  2P57 A;  3LQI A;  1V87 A;  2LGG A;  3M62 A;  3U5O A;  3L1X A;  1T1H A;  3JUE A;  2LN0 A;  3O35 A;  2JRJ A;  4MVT A;  3QZV A;  2VNF A;  2F6N A;  2M13 A;  2KWJ A;  2M6M A;  2LXP C;  4OGC A;  5LCW B;  4AYC B;  4I7C A;  4AP4 A;  2B0O E;  2KU3 A;  1WEE A;  4FJC A;  1DCQ A;  4YBT A;  5LKX A;  2KYU A;  4FK5 A;  4AUQ B;  4R8P K;  2CT2 A;  2VJE B;  2E6R A;  2HDP A;  3H7H A;  2JMI A;  4GNE A;  4IC3 A;  1MM3 A;  2H0D A;  2CSV A;  2YHO A;  5FER A;  3MDB C;  1VYX A;  2LRI C;  5B8D A;  2YRE A;  1WFK A;  2LGK A;  3MHH A;  3I2D A;  5D1M B;  4AVX A;  1Z60 A;  5D1K B;  2MNZ A;  1G25 A;  3M63 A;  4GND A;  2VPE A;  2DJA A;  2MD7 B;  2LDR A;  3N9Q A;  3N9O A;  1WEW A;  4YAT A;  2ECW A;  2L5U A;  5LKZ A;  3O70 A;  2XOY A;  2ECV A;  2MNY A;  2CKL A;  3U5M A;  5J3X A;  4L7X A;  2YW8 A;  1WGM A;  4N4F A;  3O33 A;  4IC2 A;  2JM3 A;  4GNG A;  5DIN A;  2G43 A;  3N9P A;  2QIC A;  4FIP A;  2MD8 C;  2UZG A;  2YQL A;  2KWK A;  2MUM A;  2YUC A;  2FUU A;  5G0F A;  5KH7 A;  2D8S A;  2YHN A;  1K2F A;  2KE1 A;  1LDK C;  3FJU B; 
#chains in the Genus database with same CATH homology
 1WEM A;  2HYE D;  2E6S A;  1FP0 A;  4C9Z A;  5I3L A;  2EGP A;  4R7E A;  1FBV A;  3ZTG A;  2VPB A;  3SOX A;  5TRB A;  4UP5 A;  2LXH C;  2JMD A;  1WIM A;  2EOD A;  3L11 A;  2YYR A;  5JG6 A;  3ZPV E;  2I50 A;  2AN6 A;  3O36 A;  2YSM A;  4FO9 A;  2YU4 A;  2YUR A;  2ECT A;  4N3W A;  2QJ0 A;  3T7L A;  4LAD B;  2KFT A;  5H1T A;  3SOU A;  1JM7 A;  2RSD A;  2ZET C;  2Y1M A;  4ZUX U;  5FEY A;  2LGL A;  2Y43 A;  4GNF A;  3KNV A;  1WEP A;  1WIL A;  3U5N A;  1WES A;  3GV4 A;  5DKA A;  4V3K C;  1X4J A;  2LQ6 A;  1WEQ A;  2K16 A;  3ASL A;  1MM2 A;  3ZNI A;  4LJN A;  2C2L A;  2M85 A;  1E4U A;  4PPE A;  2KWO A;  3EB6 A;  3HCS A;  2CKL B;  5TAB A;  4AYC A;  4YAD A;  2YSJ A;  1DVP A;  4YBS A;  3O7A A;  2L80 A;  4X3G A;  1WEU A;  2LGV A;  2YT5 A;  2VJE A;  2KIZ A;  4S3O C;  5H9M A;  1N87 A;  3VK6 A;  5C13 A;  5AIU A;  2F6J A;  5FB1 A;  4LK9 A;  4P5O B;  2PNX A;  2G45 A;  2ECJ A;  4YAX A;  3PUQ A;  5TDW A;  3KQI A;  5KH9 A;  4WZ2 A;  1WEN A;  2G6Q A;  2KWN A;  2OXQ C;  4PTB A;  3M99 A;  4UP0 A;  5TDR A;  1X4I A;  5B77 A;  3HCU A;  3C6W A;  3IHP A;  3L1Z B;  2BAY A;  5FB0 A;  4R2Y A;  3HTK C;  2VJF B;  2L43 A;  4V3L C;  5AIT A;  4B86 C;  1VD4 A;  2MIQ A;  5B79 A;  3RPG C;  3SOW A;  5LKU A;  4Q6F A;  4WA6 A;  4XI1 A;  1WEO A;  2MT5 A;  2VP7 A;  3SHB A;  2MA6 A;  4UI9 B;  4WZ3 B;  5C11 A;  4LLB A;  4LKA A;  2XB1 A;  2VPD A;  3DPL R;  3O34 A;  3C5K A;  4CA1 A;  3N9M A;  1Z2Q A;  3HCT A;  2EA6 A;  4I7B A;  5B78 A;  4A49 A;  4BHW A;  2K4D A;  5KH3 A;  2H0D B;  1X4U A;  3LRQ A;  3N9L A;  2CSZ A;  2M3H A;  1BOR A;  2RI7 A;  2KGI A;  5EYA F;  4CCG X;  2FSA A;  2KGG A;  3ZVY A;  4ZQL A;  1U6G B;  2FUI A;  1WEV A;  2K1J A;  4A4C A;  2JMJ A;  2L0B A;  3N9N A;  4QF2 A;  2LV9 A;  4B7Y C;  3KV5 A;  3MHS A;  4L58 A;  4A4B A;  2L75 A;  3GL6 A;  4YAB A;  1LDJ B;  5H1U A;  4QF3 A;  4MSX A;  5G04 B;  3V43 A;  1IYM A;  2K17 A;  4S3O B;  2DX8 A;  4F52 B;  1CHC A;  3NG2 A;  3ZPV 1;  4A0C D;  3ZYQ A;  3PHD A;  1Z6U A;  4ZDT A;  2ECN A;  2ECI A;  3T6R A;  4YC9 A;  3DQV R;  4O64 A;  5D1L B;  2PUY A;  3ZVZ B;  5B75 A;  2VPG A;  2M1R A;  4GB0 A;  1HYI A;  4I7D A;  4W4U A;  2ECG A;  1JOC A;  5H1V A;  4WZ0 A;  2IDA A;  3EB5 A;  2KR4 A;  3LQH A;  1ZBD B;  4NN2 A;  5LKT A;  2Y1N A;  3RPG B;  3U5P A;  3RTR B;  2KRE A;  1F62 A;  1VFY A;  2XEU A;  4TKP B;  1JM7 B;  4BBQ A;  1HYJ A;  5TBN A;  5G05 B;  2C2V S;  2QIZ A;  3FL2 A;  2NAA A;  4YBM A;  3KV6 A;  3LQJ A;  2F42 A;  1RMD A;  5B76 A;  1WE9 A;  2CSY A;  2MA5 A;  2YQM A;  3PUR A;  1XWH A;  2VJF A;  3O37 A;  3LQI A;  1V87 A;  2LGG A;  3M62 A;  3U5O A;  3L1X A;  1T1H A;  2LN0 A;  3O35 A;  2JRJ A;  4MVT A;  3QZV A;  2VNF A;  2F6N A;  2M6M A;  2KWJ A;  5LCW B;  2LXP C;  4AYC B;  4I7C A;  4AP4 A;  2KU3 A;  1WEE A;  4FJC A;  4YBT A;  5LKX A;  2KYU A;  4FK5 A;  4AUQ B;  4R8P K;  2CT2 A;  2VJE B;  2E6R A;  2HDP A;  2JMI A;  4GNE A;  4IC3 A;  1MM3 A;  2H0D A;  2YHO A;  5FER A;  1VYX A;  2LRI C;  5B8D A;  2YRE A;  1WFK A;  2LGK A;  3MHH A;  3I2D A;  5D1M B;  4AVX A;  1Z60 A;  5D1K B;  2MNZ A;  1G25 A;  3M63 A;  4GND A;  2VPE A;  2MD7 B;  2LDR A;  3N9Q A;  3N9O A;  1WEW A;  4YAT A;  2ECW A;  2L5U A;  5LKZ A;  3O70 A;  2ECV A;  2MNY A;  2CKL A;  3U5M A;  5J3X A;  4L7X A;  2YW8 A;  1WGM A;  4N4F A;  3O33 A;  4IC2 A;  4GNG A;  5DIN A;  2G43 A;  3N9P A;  2QIC A;  4FIP A;  2MD8 C;  2UZG A;  2YQL A;  2KWK A;  2MUM A;  2YUC A;  2FUU A;  5G0F A;  5KH7 A;  2D8S A;  2YHN A;  1K2F A;  2KE1 A;  1LDK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...